BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21601_g4_i1 len=1653 path=[2206:0-319 2526:320-344 15604:345-345
9570:346-673 9898:674-699 988:700-1149 1438:1150-1174
14050:1175-1652]

Length=1653
                                                                      Score     E

emb|CDP01287.1|  unnamed protein product                                387   3e-126   
ref|XP_011074408.1|  PREDICTED: cyclin-D3-3-like                        381   4e-124   
ref|XP_009790545.1|  PREDICTED: cyclin-D3-3-like isoform X2             373   2e-121   
ref|XP_009800525.1|  PREDICTED: cyclin-D3-3-like                        373   2e-121   
ref|XP_009598219.1|  PREDICTED: cyclin-D3-1-like                        372   7e-121   
ref|XP_009790544.1|  PREDICTED: cyclin-D3-3-like isoform X1             369   1e-119   
ref|XP_007017140.1|  D3-type cyclin isoform 1                           367   1e-118   
emb|CAB61222.1|  cyclin D3a                                             366   2e-118   Antirrhinum majus [garden snapdragon]
ref|XP_006342647.1|  PREDICTED: cyclin-D3-3-like isoform X2             359   2e-116   
ref|XP_011017157.1|  PREDICTED: cyclin-D3-1-like                        360   7e-116   
gb|KHG01551.1|  Cyclin-D3-1 -like protein                               359   1e-115   
ref|XP_004252752.1|  PREDICTED: cyclin-D3-3-like                        357   3e-115   
ref|XP_002285001.1|  PREDICTED: cyclin-D3-1                             357   9e-115   Vitis vinifera
emb|CAN79444.1|  hypothetical protein VITISV_042479                     358   2e-114   Vitis vinifera
ref|XP_006342646.1|  PREDICTED: cyclin-D3-3-like isoform X1             354   2e-114   
ref|NP_001275138.1|  D-type cyclin family 3 subgroup 3                  350   1e-112   
ref|NP_001234758.1|  CycD3;3 protein                                    349   4e-112   
emb|CAN88857.1|  D3-type cyclin                                         348   6e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002302430.1|  cyclin D3.1 family protein                         349   1e-111   Populus trichocarpa [western balsam poplar]
dbj|BAE80324.1|  cyclin D3-1                                            348   2e-111   Camellia sinensis [black tea]
gb|KHG12124.1|  Cyclin-D3-1 -like protein                               348   3e-111   
ref|XP_011069720.1|  PREDICTED: cyclin-D3-3-like isoform X2             345   4e-110   
ref|XP_006434702.1|  hypothetical protein CICLE_v10001416mg             345   6e-110   
ref|XP_010061716.1|  PREDICTED: cyclin-D3-1                             345   1e-109   
ref|XP_006473270.1|  PREDICTED: cyclin-D3-1-like                        344   2e-109   
gb|AAO13248.1|AF181993_1  cyclin D                                      343   2e-109   Populus tremula x Populus tremuloides
ref|XP_011029308.1|  PREDICTED: cyclin-D3-3-like                        343   3e-109   
ref|XP_007017142.1|  D3-type cyclin isoform 3                           340   6e-109   
gb|AAQ19973.1|  cyclin D3-1                                             341   1e-108   Euphorbia esula [wolf's milk]
ref|XP_011069719.1|  PREDICTED: cyclin-D3-3-like isoform X1             339   7e-108   
ref|XP_003603091.1|  Cyclin D3-1                                        338   1e-107   
gb|KDP41686.1|  hypothetical protein JCGZ_16093                         339   1e-107   
emb|CAN88856.1|  D3-type cyclin                                         338   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006374876.1|  cyclin D3.1 family protein                         337   5e-107   
gb|AEV41135.1|  D3-type cyclin                                          336   2e-106   
ref|XP_009613153.1|  PREDICTED: cyclin-D3-3-like isoform X2             333   8e-106   
ref|XP_009354156.1|  PREDICTED: cyclin-D3-1-like                        333   3e-105   
ref|XP_009613152.1|  PREDICTED: cyclin-D3-3-like isoform X1             332   3e-105   
gb|ABK95220.1|  unknown                                                 332   6e-105   Populus trichocarpa [western balsam poplar]
ref|NP_001280982.1|  cyclin-D3-1-like                                   329   6e-104   
ref|XP_002510161.1|  cyclin d, putative                                 329   1e-103   Ricinus communis
ref|XP_010101662.1|  hypothetical protein L484_006781                   328   1e-103   
gb|AAN87006.1|  cyclin D                                                325   2e-103   Populus alba [abele]
ref|XP_007227331.1|  hypothetical protein PRUPE_ppa015949mg             328   2e-103   
ref|XP_008220274.1|  PREDICTED: cyclin-D3-1-like                        327   4e-103   
ref|XP_008360986.1|  PREDICTED: cyclin-D3-1-like                        327   5e-103   
gb|KHG03748.1|  CYCD3-2: Cyclin-D3-2                                    325   6e-103   
gb|EYU36321.1|  hypothetical protein MIMGU_mgv1a008989mg                324   5e-102   
ref|XP_009360072.1|  PREDICTED: cyclin-D3-1-like                        322   7e-101   
ref|XP_010244252.1|  PREDICTED: cyclin-D3-2                             320   2e-100   
ref|XP_009606822.1|  PREDICTED: cyclin-D3-1-like                        319   4e-100   
ref|XP_010688588.1|  PREDICTED: cyclin-D3-3-like                        319   6e-100   
ref|XP_002285320.1|  PREDICTED: cyclin-D3-3                             319   1e-99    Vitis vinifera
ref|XP_010270923.1|  PREDICTED: cyclin-D3-1-like                        318   1e-99    
gb|AAM77273.1|AF519810_1  cyclin D3.1 protein                           317   1e-99    Lagenaria siceraria [bottle gourd]
emb|CBI40278.3|  unnamed protein product                                314   4e-98    
ref|XP_010323910.1|  PREDICTED: cycD3;2 protein isoform X1              313   5e-98    
ref|NP_001234753.1|  CycD3;2 protein                                    313   7e-98    
ref|XP_009769846.1|  PREDICTED: cyclin-D3-2-like                        311   4e-97    
ref|XP_004291068.1|  PREDICTED: cyclin-D3-2-like                        310   1e-96    
dbj|BAE93058.1|  cyclin                                                 309   3e-96    Nicotiana tabacum [American tobacco]
ref|XP_004142877.1|  PREDICTED: cyclin-D3-2-like                        308   4e-96    
ref|XP_007160883.1|  hypothetical protein PHAVU_001G024900g             307   8e-96    
ref|XP_007136711.1|  hypothetical protein PHAVU_009G067600g             308   9e-96    
ref|XP_008444594.1|  PREDICTED: cyclin-D3-3-like                        307   1e-95    
ref|NP_001275275.1|  D-type cyclin family 3 subgroup 2                  307   1e-95    
gb|ACU23762.1|  unknown                                                 305   2e-94    Glycine max [soybeans]
gb|KHN22485.1|  Cyclin-D3-1                                             305   2e-94    
ref|XP_010059892.1|  PREDICTED: cyclin-D3-3-like                        302   8e-94    
gb|EYU44438.1|  hypothetical protein MIMGU_mgv1a008834mg                301   4e-93    
ref|XP_002283380.1|  PREDICTED: cyclin-D3-3                             301   6e-93    Vitis vinifera
ref|XP_008238839.1|  PREDICTED: cyclin-D3-2                             300   1e-92    
emb|CAN59802.1|  hypothetical protein VITISV_038874                     300   2e-92    Vitis vinifera
dbj|BAA76478.1|  NtcycD3-1                                              299   2e-92    Nicotiana tabacum [American tobacco]
ref|XP_009622041.1|  PREDICTED: cyclin-D3-1-like                        299   2e-92    
ref|XP_011097241.1|  PREDICTED: cyclin-D3-3-like                        298   3e-92    
ref|XP_007205384.1|  hypothetical protein PRUPE_ppa007350mg             298   7e-92    
gb|KHN12816.1|  Cyclin-D3-1                                             296   4e-91    
gb|KHN45176.1|  Cyclin-D3-2                                             296   4e-91    
ref|XP_006487023.1|  PREDICTED: cyclin-D3-1-like                        296   5e-91    
ref|XP_006422956.1|  hypothetical protein CICLE_v10028675mg             296   5e-91    
emb|CDP21104.1|  unnamed protein product                                296   5e-91    
ref|XP_008391501.1|  PREDICTED: cyclin-D3-2-like                        295   6e-91    
ref|XP_003523970.1|  PREDICTED: cyclin-D3-1-like                        295   7e-91    
ref|XP_003525909.1|  PREDICTED: cyclin-D3-1-like                        295   1e-90    
emb|CAB61223.1|  cyclin D3b                                             294   1e-90    Antirrhinum majus [garden snapdragon]
gb|AAQ19972.1|  cyclin D3-2                                             294   1e-90    Euphorbia esula [wolf's milk]
ref|NP_001241910.1|  uncharacterized protein LOC100804102               295   2e-90    
ref|XP_011099096.1|  PREDICTED: cyclin-D3-3-like                        294   3e-90    
ref|XP_009367569.1|  PREDICTED: cyclin-D3-2                             293   3e-90    
ref|XP_009372441.1|  PREDICTED: cyclin-D3-2-like                        293   3e-90    
gb|AAS48460.1|  cyclin D3-2                                             292   9e-90    Euphorbia esula [wolf's milk]
ref|XP_009788121.1|  PREDICTED: cyclin-D3-1-like                        291   2e-89    
ref|XP_007047384.1|  D3-type cyclin isoform 2                           291   4e-89    
ref|XP_010540382.1|  PREDICTED: cyclin-D3-3-like                        290   5e-89    
dbj|BAE80325.1|  cyclin D3-2                                            290   6e-89    Camellia sinensis [black tea]
ref|XP_011008776.1|  PREDICTED: cyclin-D3-3-like                        290   8e-89    
gb|AFK45806.1|  unknown                                                 290   9e-89    
dbj|BAH15074.1|  cyclin D3                                              290   9e-89    Ipomoea batatas [batate]
ref|XP_008452603.1|  PREDICTED: cyclin-D3-3-like                        288   1e-88    
ref|XP_008361403.1|  PREDICTED: cyclin-D3-2-like                        289   2e-88    
ref|XP_011005820.1|  PREDICTED: cyclin-D3-3-like                        289   2e-88    
gb|ABK93388.1|  unknown                                                 288   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002306487.2|  cyclin D3-2 family protein                         288   4e-88    Populus trichocarpa [western balsam poplar]
emb|CAN88861.1|  D3-type cyclin                                         288   4e-88    Populus trichocarpa [western balsam poplar]
ref|XP_004168271.1|  PREDICTED: cyclin-D3-2-like                        287   5e-88    
ref|XP_004141274.1|  PREDICTED: cyclin-D3-2-like                        287   5e-88    
emb|CAN88860.1|  D3-type cyclin                                         287   9e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002518702.1|  cyclin d, putative                                 288   9e-88    Ricinus communis
ref|XP_007047383.1|  Cyclin d3,3 isoform 1                              290   1e-87    
gb|KDP47128.1|  hypothetical protein JCGZ_22124                         287   1e-87    
ref|XP_007143039.1|  hypothetical protein PHAVU_007G038400g             288   1e-87    
ref|XP_002310704.2|  cyclin D3-2 family protein                         286   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_007017141.1|  D3-type cyclin isoform 2                           285   3e-87    
gb|KHG22908.1|  Cyclin-D3-1 -like protein                               286   4e-87    
gb|AAO72990.1|  cyclin D                                                285   5e-87    Populus alba [abele]
dbj|BAE06272.1|  cyclin D                                               284   2e-86    Scutellaria baicalensis [Baikal skullcap]
gb|KDP31992.1|  hypothetical protein JCGZ_12453                         283   2e-86    
ref|XP_010095313.1|  hypothetical protein L484_009281                   284   3e-86    
ref|XP_006425980.1|  hypothetical protein CICLE_v10025890mg             282   1e-85    
ref|XP_007042498.1|  Cyclin-D3-1                                        282   1e-85    
ref|XP_006466552.1|  PREDICTED: cyclin-D3-2-like                        281   1e-85    
ref|XP_008236568.1|  PREDICTED: cyclin-D3-1                             281   3e-85    
ref|XP_007199910.1|  hypothetical protein PRUPE_ppa006773mg             281   3e-85    
ref|XP_011001003.1|  PREDICTED: cyclin-D3-1-like                        280   4e-85    
ref|XP_002524919.1|  cyclin d, putative                                 277   4e-85    Ricinus communis
emb|CAN88858.1|  D3-type cyclin                                         279   8e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008373097.1|  PREDICTED: cyclin-D3-1                             279   2e-84    
ref|XP_002298743.1|  hypothetical protein POPTR_0001s30920g             279   2e-84    Populus trichocarpa [western balsam poplar]
gb|AAV41032.1|  cyclin D-like protein                                   278   2e-84    Nicotiana tabacum [American tobacco]
ref|NP_001237151.1|  cyclin d3                                          279   3e-84    
emb|CBI33773.3|  unnamed protein product                                276   3e-84    
ref|XP_004496963.1|  PREDICTED: cyclin-D3-1-like                        278   5e-84    
ref|XP_011088217.1|  PREDICTED: cyclin-D3-1                             277   6e-84    
emb|CAB40540.1|  cyclin D3                                              278   6e-84    Medicago sativa [alfalfa]
gb|KDO79077.1|  hypothetical protein CISIN_1g017406mg                   277   6e-84    
ref|XP_004501551.1|  PREDICTED: cyclin-D3-2-like                        276   9e-84    
ref|XP_002313139.1|  cyclin D3 family protein                           275   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_009335011.1|  PREDICTED: cyclin-D3-1                             276   3e-83    
ref|XP_009795658.1|  PREDICTED: cyclin-D3-2-like                        275   6e-83    
gb|KHN06756.1|  Cyclin-D3-1                                             275   1e-82    
gb|KHN42377.1|  Cyclin-D3-1                                             275   1e-82    
ref|XP_004287998.1|  PREDICTED: cyclin-D3-2-like                        274   1e-82    
ref|XP_003536622.1|  PREDICTED: cyclin-D3-1-like isoform 1              275   1e-82    
ref|XP_004509104.1|  PREDICTED: cyclin-D3-3-like                        274   1e-82    
gb|AAQ54560.1|  cyclin D3                                               268   2e-82    Malus domestica [apple tree]
emb|CAA61334.1|  cyclin                                                 274   2e-82    Medicago sativa [alfalfa]
ref|XP_010550351.1|  PREDICTED: cyclin-D3-2-like                        273   3e-82    
ref|XP_009620630.1|  PREDICTED: cyclin-D3-2-like                        272   4e-82    
emb|CDP02536.1|  unnamed protein product                                271   1e-81    
ref|XP_004304033.1|  PREDICTED: cyclin-D3-1-like                        270   3e-81    
dbj|BAA33153.1|  cyclin D                                               269   1e-80    Pisum sativum [garden pea]
gb|KEH44125.1|  carboxy-terminal domain cyclin                          268   3e-80    
ref|XP_006379186.1|  hypothetical protein POPTR_0009s10060g             265   3e-80    
ref|NP_001233794.1|  cyclin D3.1                                        266   5e-80    
ref|XP_010558895.1|  PREDICTED: cyclin-D3-2-like                        266   8e-80    
ref|XP_010691714.1|  PREDICTED: cyclin-D3-1-like                        268   9e-80    
ref|XP_003550037.1|  PREDICTED: cyclin-D3-2-like                        266   9e-80    
gb|ACU23438.1|  unknown                                                 266   1e-79    Glycine max [soybeans]
ref|XP_007155890.1|  hypothetical protein PHAVU_003G240500g             266   2e-79    
ref|XP_006425979.1|  hypothetical protein CICLE_v10025890mg             262   3e-79    
ref|NP_190576.1|  cyclin-D3-3                                           264   6e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CDX76265.1|  BnaA08g11350D                                          263   2e-78    
ref|XP_011000145.1|  PREDICTED: cyclin-D3-1-like                        263   2e-78    
ref|XP_010547997.1|  PREDICTED: cyclin-D3-1-like                        263   2e-78    
ref|XP_010107865.1|  hypothetical protein L484_027452                   263   2e-78    
gb|AAL47480.1|  cyclin D3                                               262   3e-78    Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009108745.1|  PREDICTED: cyclin-D3-1-like                        262   4e-78    
gb|KEH31486.1|  carboxy-terminal domain cyclin                          261   6e-78    
gb|KHG22216.1|  Cyclin-D3-2 -like protein                               259   1e-77    
ref|NP_001275355.1|  D-type cyclin family 3 subgroup 1                  260   2e-77    
ref|XP_003524659.1|  PREDICTED: cyclin-D3-2-like                        260   3e-77    
ref|NP_195142.1|  cyclin-D3-1                                           259   6e-77    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH15073.1|  cyclin D3                                              258   7e-77    Ipomoea batatas [batate]
emb|CDY57741.1|  BnaC03g77070D                                          258   1e-76    
ref|XP_009116335.1|  PREDICTED: cyclin-D3-1                             258   1e-76    
emb|CAA58287.1|  cyclin delta-3                                         258   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028178.1|  PREDICTED: cyclin-D3-3-like                        258   3e-76    
ref|XP_008440318.1|  PREDICTED: cyclin-D3-3                             254   1e-75    
ref|XP_006291328.1|  hypothetical protein CARUB_v10017462mg             255   2e-75    
gb|AID60128.1|  cyclin D-type protein                                   255   3e-75    
ref|XP_004142001.1|  PREDICTED: cyclin-D3-2-like                        254   3e-75    
ref|XP_010530750.1|  PREDICTED: cyclin-D3-1                             254   5e-75    
gb|EPS71859.1|  hypothetical protein M569_02902                         251   7e-75    
emb|CDY01425.1|  BnaA07g11980D                                          253   9e-75    
gb|KHG04117.1|  Cyclin-D3-2 -like protein                               252   2e-74    
ref|XP_010426550.1|  PREDICTED: cyclin-D3-3-like isoform X1             253   2e-74    
ref|XP_006404065.1|  hypothetical protein EUTSA_v10010471mg             252   2e-74    
gb|EYU37644.1|  hypothetical protein MIMGU_mgv1a008148mg                252   3e-74    
ref|XP_002866711.1|  CYCD3_2                                            251   5e-74    
ref|XP_009103438.1|  PREDICTED: cyclin-D3-2                             250   7e-74    
ref|XP_006393923.1|  hypothetical protein EUTSA_v10004441mg             251   7e-74    
ref|XP_006412266.1|  hypothetical protein EUTSA_v10025486mg             251   7e-74    
ref|XP_002877727.1|  CYCD3_3                                            250   1e-73    
emb|CDY12825.1|  BnaC07g16080D                                          250   1e-73    
ref|XP_010556430.1|  PREDICTED: cyclin-D3-1-like                        250   1e-73    
gb|KFK28418.1|  hypothetical protein AALP_AA8G512200                    249   2e-73    
ref|XP_009138263.1|  PREDICTED: cyclin-D3-1-like                        249   2e-73    
emb|CDY69708.1|  BnaCnng64910D                                          249   3e-73    
ref|XP_010437660.1|  PREDICTED: cyclin-D3-1-like                        248   8e-73    
ref|XP_010503676.1|  PREDICTED: cyclin-D3-3-like                        248   2e-72    
ref|XP_010447126.1|  PREDICTED: cyclin-D3-1-like                        247   2e-72    
ref|NP_001289918.1|  cyclin-D3-1                                        247   3e-72    
ref|XP_009101665.1|  PREDICTED: cyclin-D3-3-like                        246   3e-72    
emb|CDY49278.1|  BnaA03g50910D                                          246   6e-72    
gb|KFK30046.1|  hypothetical protein AALP_AA7G210000                    245   8e-72    
ref|XP_010515372.1|  PREDICTED: cyclin-D3-3                             246   8e-72    
emb|CDY30607.1|  BnaAnng03820D                                          244   1e-71    
ref|XP_004140711.1|  PREDICTED: cyclin-D3-1-like                        245   1e-71    
ref|XP_008456160.1|  PREDICTED: cyclin-D3-1-like                        244   3e-71    
ref|XP_006280663.1|  hypothetical protein CARUB_v10026622mg             244   4e-71    
ref|XP_011092549.1|  PREDICTED: cyclin-D3-1-like isoform X2             243   5e-71    
gb|KHG07268.1|  Cyclin-D3-2 -like protein                               242   7e-71    
gb|ABV23488.1|  cyclin D3-1                                             243   7e-71    Cucumis sativus [cucumbers]
dbj|BAM10425.1|  cyclin                                                 237   8e-71    
ref|NP_201527.1|  cyclin-D3-2                                           242   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526969.1|  PREDICTED: cyclin-D3-1-like                        243   1e-70    
ref|XP_006283905.1|  hypothetical protein CARUB_v10005023mg             242   2e-70    
ref|XP_011092548.1|  PREDICTED: cyclin-D3-1-like isoform X1             241   3e-70    
ref|XP_010444674.1|  PREDICTED: cyclin-D3-2-like                        241   4e-70    
emb|CDX68573.1|  BnaC01g26510D                                          240   5e-70    
gb|ABR18175.1|  unknown                                                 240   6e-70    Picea sitchensis
emb|CDX72453.1|  BnaC07g44750D                                          240   7e-70    
ref|XP_009115688.1|  PREDICTED: cyclin-D3-3-like                        239   1e-69    
emb|CDY17742.1|  BnaC08g21500D                                          238   2e-69    
ref|XP_010464289.1|  PREDICTED: cyclin-D3-2-like                        238   8e-69    
ref|XP_002869170.1|  CYCD3_1                                            237   1e-68    
dbj|BAM10426.1|  cyclin                                                 229   4e-68    
gb|EPS70339.1|  hypothetical protein M569_04420                         229   2e-67    
gb|KCW54856.1|  hypothetical protein EUGRSUZ_I00802                     232   8e-67    
emb|CAA09769.1|  cyclin D3                                              231   9e-67    Oxybasis rubra [pigweed]
ref|XP_010426551.1|  PREDICTED: cyclin-D3-3-like isoform X2             229   1e-65    
dbj|BAM10429.1|  cyclin                                                 223   3e-65    
ref|XP_004159904.1|  PREDICTED: cyclin-D3-1-like                        228   3e-65    
emb|CDY23022.1|  BnaC07g31650D                                          226   4e-65    
gb|AAM77274.1|AF519811_1  cyclin D3.2 protein                           228   5e-65    Lagenaria siceraria [bottle gourd]
ref|XP_004136965.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D3-1-...    227   1e-64    
ref|XP_009136535.1|  PREDICTED: cyclin-D3-3-like                        224   2e-64    
ref|XP_003538806.1|  PREDICTED: cyclin-D3-3-like isoform X1             224   4e-64    
gb|AAK54466.1|  cyclin D3                                               223   6e-64    Helianthus annuus
emb|CDY02095.1|  BnaA03g40720D                                          223   9e-64    
ref|XP_003516610.1|  PREDICTED: cyclin-D3-2-like                        221   4e-63    
gb|ACY82354.1|  transcription factor cyclin D3a                         218   1e-62    Oreocharis dinghushanensis
gb|KFK34267.1|  hypothetical protein AALP_AA5G122800                    221   1e-62    
gb|KHN36259.1|  Cyclin-D3-2                                             219   2e-62    
gb|EYU34556.1|  hypothetical protein MIMGU_mgv1a009276mg                219   2e-62    
ref|XP_010246564.1|  PREDICTED: cyclin-D3-3-like                        216   3e-61    
dbj|BAM10427.1|  cyclin                                                 211   3e-60    
gb|EPS68559.1|  hypothetical protein M569_06207                         209   2e-59    
ref|XP_008454979.1|  PREDICTED: cyclin-D3-3                             213   2e-59    
gb|EPS68434.1|  hypothetical protein M569_06335                         205   1e-58    
gb|EPS69521.1|  cyclin d3                                               206   2e-58    
gb|AEX07599.1|  cyclin A3-2                                             204   8e-58    
ref|XP_007156763.1|  hypothetical protein PHAVU_002G015500g             205   5e-57    
ref|XP_010065976.1|  PREDICTED: cyclin-D3-1-like                        207   5e-57    
gb|AFK38963.1|  unknown                                                 203   4e-56    
ref|XP_006590646.1|  PREDICTED: cyclin-D3-3-like isoform X2             201   2e-55    
gb|KCW63724.1|  hypothetical protein EUGRSUZ_G01371                     203   2e-55    
ref|XP_006367192.1|  PREDICTED: cyclin-D3-1-like                        196   7e-55    
gb|ACY82356.1|  transcription factor cyclin D3c                         197   1e-54    Oreocharis dinghushanensis
emb|CAN60924.1|  hypothetical protein VITISV_019341                     196   1e-54    Vitis vinifera
gb|EPS67948.1|  hypothetical protein M569_06825                         191   4e-53    
gb|KHG03749.1|  CYCD3-1: Cyclin-D3-1                                    182   3e-50    
ref|XP_009390983.1|  PREDICTED: cyclin-D3-2-like                        182   8e-49    
ref|XP_010646275.1|  PREDICTED: cyclin-D3-1-like                        174   6e-48    
emb|CAB40541.1|  cyclin D3                                              177   8e-48    Medicago sativa [alfalfa]
ref|XP_009398673.1|  PREDICTED: cyclin-D3-2-like                        181   2e-47    
ref|XP_010107833.1|  hypothetical protein L484_027417                   173   1e-46    
emb|CBI25754.3|  unnamed protein product                                176   8e-46    
ref|XP_009396408.1|  PREDICTED: cyclin-D3-2-like                        175   2e-45    
ref|XP_003603092.1|  Cyclin D3-1                                        168   2e-45    
ref|XP_010109458.1|  hypothetical protein L484_003174                   168   3e-45    
ref|XP_006856973.1|  hypothetical protein AMTR_s00190p00017930          172   6e-45    
ref|XP_010943276.1|  PREDICTED: cyclin-D3-2-like                        173   1e-44    
ref|XP_008799685.1|  PREDICTED: cyclin-D3-2-like                        172   4e-44    
ref|XP_009392156.1|  PREDICTED: cyclin-D3-2-like                        169   3e-43    
dbj|BAP05445.1|  cyclinD3                                               162   4e-43    
ref|XP_010059706.1|  PREDICTED: cyclin-D3-3-like                        165   6e-43    
gb|KCW75457.1|  hypothetical protein EUGRSUZ_E04223                     165   1e-42    
ref|XP_010436267.1|  PREDICTED: cyclin-D3-1-like                        160   2e-42    
ref|XP_010939736.1|  PREDICTED: cyclin-D3-1-like                        165   3e-42    
ref|XP_001756858.1|  predicted protein                                  165   4e-42    
ref|XP_010266361.1|  PREDICTED: cyclin-D3-1-like                        164   7e-42    
ref|NP_001105048.1|  LOC541915                                          164   1e-41    
ref|XP_006841234.1|  hypothetical protein AMTR_s00135p00066200          164   1e-41    
gb|AFW64381.1|  D-type cyclin                                           164   1e-41    
ref|XP_009408010.1|  PREDICTED: cyclin-D3-2-like                        164   1e-41    
gb|KFK41441.1|  hypothetical protein AALP_AA2G130900                    163   1e-41    
gb|KFK41442.1|  hypothetical protein AALP_AA2G130900                    162   1e-41    
ref|XP_009631276.1|  PREDICTED: cyclin-D2-1-like                        162   3e-41    
gb|ACF87787.1|  unknown                                                 160   4e-41    
ref|XP_001783314.1|  predicted protein                                  162   5e-41    
emb|CAD32542.1|  cyclin D protein                                       162   6e-41    
ref|XP_003519458.1|  PREDICTED: cyclin-D1-1-like                        161   7e-41    
ref|XP_008782336.1|  PREDICTED: cyclin-D3-1-like                        161   8e-41    
ref|XP_008646296.1|  PREDICTED: cyclin-D3-1-like                        159   8e-41    
ref|XP_008795181.1|  PREDICTED: cyclin-D4-1-like                        161   9e-41    
ref|XP_002972205.1|  hypothetical protein SELMODRAFT_412774             161   9e-41    
ref|XP_002977517.1|  hypothetical protein SELMODRAFT_417325             161   9e-41    
ref|XP_004953991.1|  PREDICTED: cyclin-D3-1-like                        161   9e-41    
ref|XP_010679540.1|  PREDICTED: cyclin-D3-3-like                        157   1e-40    
ref|NP_001105834.1|  LOC732735                                          160   1e-40    
ref|XP_002530701.1|  cyclin d, putative                                 161   2e-40    
ref|XP_009127780.1|  PREDICTED: cyclin-D1-1-like                        160   2e-40    
ref|XP_009801107.1|  PREDICTED: cyclin-D2-1-like                        160   2e-40    
ref|XP_006390912.1|  hypothetical protein EUTSA_v10018896mg             159   2e-40    
ref|XP_006472509.1|  PREDICTED: cyclin-D2-1-like                        160   2e-40    
ref|XP_010926356.1|  PREDICTED: cyclin-D4-1-like isoform X1             160   3e-40    
ref|XP_004238706.1|  PREDICTED: cyclin-D1-1                             159   3e-40    
ref|XP_008813810.1|  PREDICTED: cyclin-D3-2-like                        160   3e-40    
gb|ABB36798.1|  D-type cyclin                                           157   3e-40    
ref|XP_006433861.1|  hypothetical protein CICLE_v10001581mg             160   3e-40    
gb|KDO81113.1|  hypothetical protein CISIN_1g045125mg                   159   3e-40    
ref|XP_009380230.1|  PREDICTED: cyclin-D4-1-like                        159   3e-40    
emb|CDY59943.1|  BnaAnng16340D                                          159   4e-40    
ref|XP_009403082.1|  PREDICTED: cyclin-D4-1-like                        159   4e-40    
ref|XP_008802301.1|  PREDICTED: cyclin-D4-1-like                        159   5e-40    
ref|XP_002525288.1|  cyclin d, putative                                 157   6e-40    
ref|XP_006647938.1|  PREDICTED: cyclin-D3-1-like                        158   9e-40    
ref|XP_003518252.1|  PREDICTED: cyclin-D4-1                             158   1e-39    
gb|AGH32903.1|  cyclin D4                                               156   1e-39    
ref|XP_008235419.1|  PREDICTED: cyclin-D2-1                             157   2e-39    
ref|XP_002887287.1|  cyclin delta-1                                     157   2e-39    
ref|XP_002454584.1|  hypothetical protein SORBIDRAFT_04g033870          157   2e-39    
ref|XP_010512100.1|  PREDICTED: cyclin-D1-1-like isoform X2             158   2e-39    
ref|XP_009409296.1|  PREDICTED: cyclin-D4-1-like                        157   3e-39    
ref|XP_009417607.1|  PREDICTED: cyclin-D4-1-like                        157   3e-39    
ref|XP_009380893.1|  PREDICTED: cyclin-D4-1-like                        156   3e-39    
ref|XP_010512099.1|  PREDICTED: cyclin-D1-1-like isoform X1             158   3e-39    
gb|AEK20778.1|  cyclin dependent kinase regulator                       156   3e-39    
ref|XP_010272942.1|  PREDICTED: cyclin-D3-1-like                        157   4e-39    
ref|XP_008440562.1|  PREDICTED: cyclin-D4-1-like isoform X1             157   4e-39    
ref|XP_010942651.1|  PREDICTED: cyclin-D3-1-like                        156   4e-39    
ref|XP_010419132.1|  PREDICTED: cyclin-D1-1                             155   4e-39    
gb|AAR87269.1|  putative cyclin                                         156   4e-39    
emb|CAA71244.1|  cyclin-D like protein                                  157   4e-39    
ref|XP_004143552.1|  PREDICTED: cyclin-D2-1-like                        156   7e-39    
ref|XP_010530194.1|  PREDICTED: cyclin-D4-1-like                        155   7e-39    
emb|CAA58285.1|  cyclin delta-1                                         155   7e-39    
ref|XP_006596367.1|  PREDICTED: cyclin-D4-1-like isoform X2             155   8e-39    
ref|XP_004237975.1|  PREDICTED: cyclin-D2-1-like                        155   8e-39    
ref|XP_009410124.1|  PREDICTED: cyclin-D3-1-like                        155   8e-39    
ref|NP_177178.1|  cyclin-D1-1                                           155   8e-39    
ref|XP_010236088.1|  PREDICTED: cyclin-D3-1-like                        155   9e-39    
emb|CDY67142.1|  BnaAnng23660D                                          155   1e-38    
ref|XP_009391337.1|  PREDICTED: cyclin-D3-1-like isoform X1             155   1e-38    
ref|XP_003544823.1|  PREDICTED: cyclin-D4-1-like isoform X1             155   1e-38    
ref|XP_007141249.1|  hypothetical protein PHAVU_008G180000g             155   2e-38    
emb|CDY11608.1|  BnaC06g31310D                                          154   2e-38    
ref|XP_007205537.1|  hypothetical protein PRUPE_ppa008565mg             154   2e-38    
ref|XP_006355943.1|  PREDICTED: cyclin-D1-1-like                        154   2e-38    
ref|XP_008811014.1|  PREDICTED: cyclin-D4-1-like isoform X1             154   2e-38    
ref|XP_010061509.1|  PREDICTED: cyclin-D4-2-like                        154   2e-38    
ref|XP_003522757.1|  PREDICTED: cyclin-D4-2-like                        154   3e-38    
ref|XP_006302511.1|  hypothetical protein CARUB_v10020608mg             154   3e-38    
ref|XP_006302510.1|  hypothetical protein CARUB_v10020608mg             153   3e-38    
ref|XP_009106467.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D1-1        156   3e-38    
gb|KHN08249.1|  Cyclin-D3-1                                             154   4e-38    
ref|XP_010254697.1|  PREDICTED: cyclin-D1-1                             152   5e-38    
gb|EEC83751.1|  hypothetical protein OsI_29617                          152   5e-38    
gb|AAV28533.2|  D-type cyclin                                           153   5e-38    
ref|XP_009390267.1|  PREDICTED: cyclin-D4-1-like                        153   6e-38    
gb|EYU22467.1|  hypothetical protein MIMGU_mgv1a019051mg                151   7e-38    
ref|XP_006660716.1|  PREDICTED: cyclin-D4-1-like                        153   9e-38    
ref|NP_001062054.1|  Os08g0479300                                       153   1e-37    
ref|XP_009394048.1|  PREDICTED: cyclin-D3-1-like                        152   2e-37    
ref|XP_010675548.1|  PREDICTED: cyclin-D4-1                             152   2e-37    
ref|XP_006338089.1|  PREDICTED: cyclin-D2-1-like                        152   2e-37    
ref|XP_009627754.1|  PREDICTED: cyclin-D1-1                             151   2e-37    
ref|XP_002982531.1|  hypothetical protein SELMODRAFT_421971             151   2e-37    
ref|XP_010551453.1|  PREDICTED: cyclin-D1-1                             151   2e-37    
gb|KFK32810.1|  hypothetical protein AALP_AA6G290800                    151   2e-37    
gb|EMS59418.1|  Cyclin-D3-1                                             149   2e-37    
ref|XP_002981056.1|  hypothetical protein SELMODRAFT_420671             151   2e-37    
ref|XP_010521055.1|  PREDICTED: cyclin-D4-1-like                        151   2e-37    
ref|XP_009773645.1|  PREDICTED: cyclin-D1-1                             151   3e-37    
ref|XP_006650160.1|  PREDICTED: putative cyclin-D2-3-like               151   3e-37    
ref|XP_007157500.1|  hypothetical protein PHAVU_002G074800g             153   3e-37    
ref|XP_010238138.1|  PREDICTED: cyclin-D2-1-like isoform X2             150   3e-37    
ref|XP_007156481.1|  hypothetical protein PHAVU_003G289500g             150   3e-37    
ref|XP_010058001.1|  PREDICTED: cyclin-D3-3-like                        149   4e-37    
ref|XP_006659503.1|  PREDICTED: cyclin-D4-2-like                        151   5e-37    
ref|XP_009401229.1|  PREDICTED: cyclin-D4-1-like                        150   5e-37    
ref|XP_006386422.1|  cyclin d2 family protein                           150   5e-37    
ref|XP_002306546.1|  hypothetical protein POPTR_0005s17720g             150   6e-37    
gb|KDP21306.1|  hypothetical protein JCGZ_21777                         150   6e-37    
ref|XP_010928373.1|  PREDICTED: cyclin-D3-2                             150   8e-37    
ref|XP_010272026.1|  PREDICTED: cyclin-D1-1-like isoform X3             149   9e-37    
gb|KDP32089.1|  hypothetical protein JCGZ_12550                         152   9e-37    
ref|XP_004288506.1|  PREDICTED: cyclin-D2-1-like                        150   1e-36    
emb|CDP00205.1|  unnamed protein product                                149   1e-36    
ref|XP_010273048.1|  PREDICTED: cyclin-D2-1-like                        149   1e-36    
ref|XP_002514014.1|  cyclin d, putative                                 149   1e-36    
ref|XP_010272024.1|  PREDICTED: cyclin-D1-1-like isoform X1             149   1e-36    
ref|XP_007137638.1|  hypothetical protein PHAVU_009G143200g             149   1e-36    
gb|KHN09012.1|  Cyclin-D3-1                                             149   2e-36    
ref|XP_006383515.1|  hypothetical protein POPTR_0005s17720g             148   2e-36    
ref|XP_011016888.1|  PREDICTED: cyclin-D2-1-like                        148   2e-36    
ref|XP_010520763.1|  PREDICTED: cyclin-D4-1-like isoform X2             148   2e-36    
sp|Q10K98.1|CCD23_ORYSJ  RecName: Full=Putative cyclin-D2-3; AltN...    149   3e-36    
gb|KDP41457.1|  hypothetical protein JCGZ_15864                         148   3e-36    
ref|XP_003576488.1|  PREDICTED: cyclin-D2-1-like isoform X1             147   3e-36    
emb|CAD43141.1|  cyclin D2                                              149   3e-36    
gb|ACU21437.1|  unknown                                                 148   3e-36    
ref|XP_009381630.1|  PREDICTED: cyclin-D2-1-like isoform X1             147   4e-36    
ref|XP_008368595.1|  PREDICTED: cyclin-D4-1-like                        148   4e-36    
ref|XP_007155814.1|  hypothetical protein PHAVU_003G234000g             146   5e-36    
gb|KFK32809.1|  hypothetical protein AALP_AA6G290800                    147   5e-36    
ref|XP_008355412.1|  PREDICTED: cyclin-D4-1-like                        147   6e-36    
gb|AAL47479.1|  cyclin D1                                               146   6e-36    
ref|NP_001063417.1|  Os09g0466100                                       147   6e-36    
gb|EAZ45038.1|  hypothetical protein OsJ_29676                          147   6e-36    
ref|XP_006483788.1|  PREDICTED: cyclin-D1-1-like                        147   7e-36    
gb|KHN45294.1|  Cyclin-D1-1                                             147   7e-36    
ref|XP_006438465.1|  hypothetical protein CICLE_v10032080mg             146   8e-36    
ref|XP_010653055.1|  PREDICTED: cyclin-D1-1 isoform X1                  146   9e-36    
gb|EAZ09418.1|  hypothetical protein OsI_31691                          147   9e-36    
gb|AAQ08041.1|  cyclin D2                                               147   1e-35    
ref|XP_003574644.1|  PREDICTED: cyclin-D4-2-like                        146   1e-35    
ref|XP_009340977.1|  PREDICTED: cyclin-D4-2                             146   1e-35    
ref|XP_006655914.1|  PREDICTED: cyclin-D3-1-like                        145   1e-35    
ref|XP_010681046.1|  PREDICTED: cyclin-D4-1                             147   2e-35    
ref|XP_003517843.2|  PREDICTED: cyclin-D1-1-like                        147   2e-35    
ref|XP_007018180.1|  D2/4-type cyclin                                   146   2e-35    
ref|XP_009348245.1|  PREDICTED: cyclin-D4-1-like                        145   2e-35    
ref|XP_003551241.1|  PREDICTED: cyclin-D2-1-like                        145   2e-35    
gb|EEC75397.1|  hypothetical protein OsI_11885                          148   2e-35    
tpg|DAA40281.1|  TPA: hypothetical protein ZEAMMB73_495366              144   2e-35    
gb|EMT15062.1|  Cyclin-D3-1                                             145   3e-35    
gb|EYU30953.1|  hypothetical protein MIMGU_mgv1a019792mg                145   3e-35    
ref|XP_008440563.1|  PREDICTED: cyclin-D2-1-like isoform X2             144   3e-35    
ref|XP_007044533.1|  Cyclin-D1-1 isoform 1                              145   3e-35    
ref|NP_001237137.1|  cyclin d2                                          145   3e-35    
ref|XP_002268394.1|  PREDICTED: cyclin-D1-1 isoform X2                  144   3e-35    
ref|XP_009791933.1|  PREDICTED: cyclin-D4-1-like                        145   3e-35    
ref|XP_010520762.1|  PREDICTED: cyclin-D4-1-like isoform X1             145   3e-35    
ref|XP_006426294.1|  hypothetical protein CICLE_v10025924mg             145   4e-35    
ref|XP_002314728.1|  cyclin delta-1 family protein                      144   4e-35    
ref|XP_004973707.1|  PREDICTED: cyclin-D4-2-like                        145   4e-35    
gb|ABK94839.1|  unknown                                                 140   5e-35    
emb|CDY38800.1|  BnaA07g28720D                                          144   5e-35    
ref|XP_009392017.1|  PREDICTED: cyclin-D2-1-like                        143   5e-35    
gb|EMT26539.1|  Cyclin-D2-2                                             143   6e-35    
gb|KHN20612.1|  Cyclin-D3-1                                             144   6e-35    
gb|AAV28532.1|  D-type cyclin                                           144   6e-35    
ref|XP_010102044.1|  hypothetical protein L484_002829                   144   7e-35    
sp|Q8H339.2|CCD12_ORYSJ  RecName: Full=Cyclin-D1-2; AltName: Full...    144   8e-35    
ref|XP_010916679.1|  PREDICTED: cyclin-D4-1-like                        144   9e-35    
gb|ADE76356.1|  unknown                                                 144   1e-34    
ref|XP_003607665.1|  Cyclin d2                                          144   1e-34    
ref|XP_009597995.1|  PREDICTED: cyclin-D4-1-like                        144   1e-34    
ref|XP_008670257.1|  PREDICTED: cyclin-D4-1-like isoform X2             144   1e-34    
ref|XP_010274408.1|  PREDICTED: cyclin-D2-1-like                        144   1e-34    
ref|XP_008339993.1|  PREDICTED: cyclin-D1-1                             143   1e-34    
ref|XP_009410280.1|  PREDICTED: cyclin-D2-1-like                        142   1e-34    
gb|KDO82576.1|  hypothetical protein CISIN_1g020177mg                   141   1e-34    
gb|EEE59188.1|  hypothetical protein OsJ_11124                          146   1e-34    
ref|XP_008444892.1|  PREDICTED: cyclin-D4-1-like                        144   1e-34    
ref|XP_010269719.1|  PREDICTED: cyclin-D4-1-like isoform X2             143   1e-34    
ref|XP_009385528.1|  PREDICTED: cyclin-D3-2-like                        144   1e-34    
gb|KDO82574.1|  hypothetical protein CISIN_1g020177mg                   143   1e-34    
ref|XP_009789780.1|  PREDICTED: cyclin-D4-1-like                        143   1e-34    
ref|XP_008245470.1|  PREDICTED: cyclin-D1-1                             143   1e-34    
ref|XP_003635232.1|  PREDICTED: cyclin-D4-1 isoform X1                  142   1e-34    
tpg|DAA61837.1|  TPA: cyclin delta-2                                    143   1e-34    
ref|NP_001149910.1|  cyclin delta-2                                     143   2e-34    
ref|XP_007222540.1|  hypothetical protein PRUPE_ppa008337mg             143   2e-34    
ref|XP_009401443.1|  PREDICTED: cyclin-D4-1-like                        143   2e-34    
ref|XP_004956725.1|  PREDICTED: cyclin-D2-1-like isoform X4             142   2e-34    
ref|XP_003550970.1|  PREDICTED: cyclin-D1-1-like                        142   2e-34    
gb|KHN20362.1|  Cyclin-D1-1                                             142   2e-34    
ref|XP_004957066.1|  PREDICTED: cyclin-D4-1-like                        143   2e-34    
ref|XP_011021642.1|  PREDICTED: cyclin-D1-1-like                        142   2e-34    
tpg|DAA61838.1|  TPA: hypothetical protein ZEAMMB73_857360              141   2e-34    
emb|CAA09852.1|  cyclin D2.1 protein                                    143   2e-34    
dbj|BAJ96456.1|  predicted protein                                      142   2e-34    
ref|XP_010646811.1|  PREDICTED: cyclin-D4-1 isoform X2                  142   2e-34    
ref|XP_009614643.1|  PREDICTED: cyclin-D4-1-like                        143   2e-34    
ref|XP_004501614.1|  PREDICTED: cyclin-D2-1-like                        143   2e-34    
gb|EYU29703.1|  hypothetical protein MIMGU_mgv1a010022mg                142   2e-34    
gb|KHN14522.1|  Cyclin-D4-1                                             143   2e-34    
ref|XP_009404028.1|  PREDICTED: cyclin-D3-1-like                        144   3e-34    
ref|XP_004250518.1|  PREDICTED: cyclin-D4-1-like                        142   3e-34    
ref|XP_009342571.1|  PREDICTED: cyclin-D2-1-like                        142   3e-34    
gb|KHG30136.1|  Cyclin-D4-1                                             142   3e-34    
ref|XP_006573019.1|  PREDICTED: cyclin-D4-1-like                        142   3e-34    
ref|XP_003524697.1|  PREDICTED: cyclin-D1-1-like                        141   3e-34    
ref|XP_002460365.1|  hypothetical protein SORBIDRAFT_02g027020          142   3e-34    
ref|XP_006353186.1|  PREDICTED: cyclin-D4-1-like                        142   4e-34    
gb|AAL83928.1|AF351191_1  D-type cyclin                                 143   4e-34    
gb|KHN23256.1|  Cyclin-D1-1                                             142   4e-34    
emb|CAN88854.1|  D2/4-type cyclin                                       142   5e-34    
ref|XP_010100514.1|  hypothetical protein L484_027829                   141   5e-34    
ref|NP_001141798.2|  hypothetical protein                               141   5e-34    
ref|XP_002267356.1|  PREDICTED: cyclin-D2-1                             142   5e-34    
ref|XP_002462322.1|  hypothetical protein SORBIDRAFT_02g023800          141   5e-34    
ref|XP_010107298.1|  hypothetical protein L484_008550                   142   5e-34    
ref|XP_003578259.1|  PREDICTED: cyclin-D4-1-like                        141   5e-34    
ref|XP_009360468.1|  PREDICTED: cyclin-D1-1-like                        141   5e-34    
ref|XP_003613330.1|  Cyclin-D1-1                                        141   6e-34    



>emb|CDP01287.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   387 bits (995),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 208/322 (65%), Positives = 250/322 (78%), Gaps = 8/322 (2%)
 Frame = +3

Query  192   TSSSRKKMPFQ---EPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesv--v  356
             T+  +KKM  Q   E QK PFL DALYCEEE  HW   D++  C I  +EE   +    +
Sbjct  11    TALLQKKMAHQHQNEKQKFPFLLDALYCEEE--HWEGLDKE-DCFISNEEESRIDGKPPL  67

Query  357   lleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTA  536
             L+EQDL W + EL SL +KEQEN+L+N +++NP LA AR+EAVEW+LKVT+ YSFSA TA
Sbjct  68    LMEQDLFWGEEELCSLFNKEQENDLYNSLKRNPSLAGARTEAVEWMLKVTAFYSFSAPTA  127

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNYLDR  F       +K WM+QLAAVACLSLAAKVEET VPLLLDFQVEES+YVFE
Sbjct  128   VLAVNYLDRFLFSFQSHNEKKLWMTQLAAVACLSLAAKVEETQVPLLLDFQVEESKYVFE  187

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRME+LVLS LEWKMNPVTP SFLD++ RRL LK+H+  EFL+RCE +LL IISDC
Sbjct  188   AKTIQRMEILVLSTLEWKMNPVTPLSFLDFVTRRLGLKNHIYWEFLKRCEFLLLFIISDC  247

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ  1076
             RFM YLPSVMA+ATMLHVI  + P +G E Q+QL+GILGI+K KVEEC +LI EVAS   
Sbjct  248   RFMSYLPSVMATATMLHVIVSVEPCLGVEYQDQLLGILGINKDKVEECYRLISEVASAYH  307

Query  1077  FESAYKRKYGAMPGSPKGVMEV  1142
             F S+ KRK+ ++PGSPKGVM++
Sbjct  308   FHSSNKRKFRSVPGSPKGVMDL  329



>ref|XP_011074408.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum]
Length=363

 Score =   381 bits (978),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 203/318 (64%), Positives = 246/318 (77%), Gaps = 11/318 (3%)
 Frame = +3

Query  213   MPFQEPQKLPFLFDALYCEEEGEHWGQAD---RDPSCSIeeqeeeeeesvvll---eqDL  374
             M      K  F FDALYCEEE  HW   +      +C IE + +   +    L    QDL
Sbjct  1     MASHHQHKPQFFFDALYCEEE--HWDNGEIVHETLNCLIEGEGDSSSDHKPSLEFLGQDL  58

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             LWED ELSSLL+KEQENEL++ +Q++P LA ARSEAVEW+LKVT HYSFSA TA+LAVNY
Sbjct  59    LWEDEELSSLLNKEQENELYDGLQESPSLAMARSEAVEWMLKVTGHYSFSALTAVLAVNY  118

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR F  S +S  +KPWM+QLAAVACLSLAAKVEET VPLLLD QVE S+YVFE+KTIQR
Sbjct  119   LDR-FLHSFQSHREKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVESSKYVFESKTIQR  177

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             ME+L+LS L+W+MNPVT  SFLDYIARRL LKSHLC EFLRRCE +LLS++SD RFM YL
Sbjct  178   MEILILSTLQWRMNPVTALSFLDYIARRLGLKSHLCREFLRRCECLLLSLVSDYRFMSYL  237

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PS +A+ATML+VIS L P +G + Q+QL+GILG++K KVE+C +LI+EVA+ + F S+ K
Sbjct  238   PSALATATMLYVISSLEPCIGVQYQDQLVGILGVNKDKVEDCCRLIQEVATSVDFHSSNK  297

Query  1095  RKYGA--MPGSPKGVMEV  1142
             RK G+  +PGSPKGVM+V
Sbjct  298   RKMGSVVVPGSPKGVMDV  315



>ref|XP_009790545.1| PREDICTED: cyclin-D3-3-like isoform X2 [Nicotiana sylvestris]
Length=337

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 230/301 (76%), Gaps = 10/301 (3%)
 Frame = +3

Query  234   KLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSK  413
             KLPFL D+LYC++E       DR  +C        EE  V      LLWE+ ELSSL+SK
Sbjct  13    KLPFLLDSLYCKDES--LDVLDRG-NC------LTEEVEVNPNSISLLWEEEELSSLMSK  63

Query  414   EQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
             EQEN+++NVV  NP L+ AR+EAV W+L+  S+++FSAQTA+LA+NYLDR  F S +SQ+
Sbjct  64    EQENQMYNVVINNPYLSVARTEAVHWILEAISYHNFSAQTAILAINYLDRFLF-SFQSQS  122

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
             +KPWM+QLAAV CLSLAAKVEET VPLL+D QVEES Y+FE +TIQRMELLVLS L+WKM
Sbjct  123   EKPWMNQLAAVTCLSLAAKVEETQVPLLVDLQVEESRYLFEPRTIQRMELLVLSTLKWKM  182

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NPVTPFSFLDY +RRL   +H+CCE LRRCE VLLS I+DCRFMCYLPS +A+ATMLH I
Sbjct  183   NPVTPFSFLDYFSRRLGFNNHICCELLRRCERVLLSTITDCRFMCYLPSAVAAATMLHAI  242

Query  954   SRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGV  1133
              RL P + EE QEQL+GILGI K  V +C +L++EVAS I F S  ++  GA+PGSP GV
Sbjct  243   DRLEPCIEEEYQEQLLGILGIVKDNVTDCYRLVQEVASNIDFNSNKRKSIGALPGSPVGV  302

Query  1134  M  1136
             M
Sbjct  303   M  303



>ref|XP_009800525.1| PREDICTED: cyclin-D3-3-like [Nicotiana sylvestris]
Length=342

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 233/310 (75%), Gaps = 6/310 (2%)
 Frame = +3

Query  216   PFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             P+QE +KLPFL D LYCEE+       +       EE E    E++     DL+WE+GEL
Sbjct  5     PYQETEKLPFLLDVLYCEEDDLF---TEEVKVEEEEEGESFCSENINPNPHDLIWEEGEL  61

Query  396   SSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             SSL SKE EN + NVV+K P LA AR EAVEW+LKV  +YSFSAQTA LAVNYLDR F  
Sbjct  62    SSLFSKETENVINNVVEKTPSLASARREAVEWILKVIGYYSFSAQTAFLAVNYLDR-FLS  120

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S E Q+ KPW++QL AVACLSLAAKVEET VPLL D QVE+  YVFE+KT+QRMELLVLS
Sbjct  121   SFEFQSHKPWINQLVAVACLSLAAKVEETEVPLLFDLQVEDPRYVFESKTVQRMELLVLS  180

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              LEWKMNPVTPFSFLDYI RRL L + LC EF+RRCE VLL  I+DCRF+ YLPS MASA
Sbjct  181   TLEWKMNPVTPFSFLDYITRRLGLNNCLCWEFVRRCERVLLYTITDCRFIGYLPSAMASA  240

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGA-M  1112
             TMLHVI RL P +GE+ Q+QL+ ILGI K KVE+C +L++EVA+ I F S  KRK+G  +
Sbjct  241   TMLHVIDRLQPCIGEKYQDQLLDILGIVKDKVEDCYRLMQEVATNIDFHSN-KRKFGTNL  299

Query  1113  PGSPKGVMEV  1142
             PGSP GVM+V
Sbjct  300   PGSPTGVMDV  309



>ref|XP_009598219.1| PREDICTED: cyclin-D3-1-like [Nicotiana tomentosiformis]
Length=340

 Score =   372 bits (954),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 218/354 (62%), Positives = 250/354 (71%), Gaps = 24/354 (7%)
 Frame = +3

Query  234   KLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLL  407
             +LPFL DALYCEEEG      + +        E E    E++     DL+WE+GELSSL 
Sbjct  4     QLPFLLDALYCEEEGFFTEEVKVEEGEGEGEGEGESFCSENINPNPYDLIWEEGELSSLF  63

Query  408   SKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLES  587
             SKE EN + NV++K P LA  R EAVEW+LKV  +YSFSAQTA LAVNYLDR F  S   
Sbjct  64    SKETENVINNVLEKTPSLASVRREAVEWILKVIGYYSFSAQTAFLAVNYLDR-FLSSFVF  122

Query  588   QTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEW  767
             QT KPW+ QL AVACLSLAAKVEET VPLLLD QVEES YVFE+KT+QRMELLVLS LEW
Sbjct  123   QTHKPWIYQLVAVACLSLAAKVEETEVPLLLDLQVEESRYVFESKTVQRMELLVLSTLEW  182

Query  768   KMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLH  947
             KMNPVTPFSFLDYI RRL L + LC EFLRRCE VLL  I+DCRF+ YLPS MASATMLH
Sbjct  183   KMNPVTPFSFLDYITRRLGLNNCLCWEFLRRCERVLLYTITDCRFIGYLPSAMASATMLH  242

Query  948   VISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGA-MPGSP  1124
             VI RL P +GE+ Q+QL+ ILGI K KVE+C KL++EVAS I F S  KRK+G  +PGSP
Sbjct  243   VIDRLQPCIGEKYQDQLLDILGIVKDKVEDCYKLMQEVASNIDFHSN-KRKFGTNLPGSP  301

Query  1125  KGVMEVsfsssssslssdsskdswavsanassssstsatssvsssPEPLSKKTR  1286
              GVM+V                     ++  S+ S S  +SVSSSPEPLSKKTR
Sbjct  302   TGVMDV-------------------SFSSDYSNDSWSVATSVSSSPEPLSKKTR  336



>ref|XP_009790544.1| PREDICTED: cyclin-D3-3-like isoform X1 [Nicotiana sylvestris]
Length=338

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 230/302 (76%), Gaps = 11/302 (4%)
 Frame = +3

Query  234   KLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSK  413
             KLPFL D+LYC++E       DR  +C        EE  V      LLWE+ ELSSL+SK
Sbjct  13    KLPFLLDSLYCKDES--LDVLDRG-NC------LTEEVEVNPNSISLLWEEEELSSLMSK  63

Query  414   EQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
             EQEN+++NVV  NP L+ AR+EAV W+L+  S+++FSAQTA+LA+NYLDR  F S +SQ+
Sbjct  64    EQENQMYNVVINNPYLSVARTEAVHWILEAISYHNFSAQTAILAINYLDRFLF-SFQSQS  122

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
             +KPWM+QLAAV CLSLAAKVEET VPLL+D QVEES Y+FE +TIQRMELLVLS L+WKM
Sbjct  123   EKPWMNQLAAVTCLSLAAKVEETQVPLLVDLQVEESRYLFEPRTIQRMELLVLSTLKWKM  182

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIIS-DCRFMCYLPSVMASATMLHV  950
             NPVTPFSFLDY +RRL   +H+CCE LRRCE VLLS I+ DCRFMCYLPS +A+ATMLH 
Sbjct  183   NPVTPFSFLDYFSRRLGFNNHICCELLRRCERVLLSTITADCRFMCYLPSAVAAATMLHA  242

Query  951   ISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKG  1130
             I RL P + EE QEQL+GILGI K  V +C +L++EVAS I F S  ++  GA+PGSP G
Sbjct  243   IDRLEPCIEEEYQEQLLGILGIVKDNVTDCYRLVQEVASNIDFNSNKRKSIGALPGSPVG  302

Query  1131  VM  1136
             VM
Sbjct  303   VM  304



>ref|XP_007017140.1| D3-type cyclin isoform 1 [Theobroma cacao]
 gb|EOY14365.1| D3-type cyclin isoform 1 [Theobroma cacao]
Length=364

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 234/309 (76%), Gaps = 10/309 (3%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEG-------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             Q   F+ DALYC EE        +H+ + + + SC       +     +LLEQDL WED 
Sbjct  6     QNSTFVVDALYCSEENWDEEVGEDHFLEVEEE-SC-YNNGINKSNPFPILLEQDLFWEDD  63

Query  390   ELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLF  569
             ELSSLLSKE++N+L++ +Q N + A AR EAVEW+LKV +HYSFSA TA+LAVNYLDR  
Sbjct  64    ELSSLLSKEEQNQLYDSLQTNGNPAGARREAVEWMLKVNAHYSFSALTAVLAVNYLDRFL  123

Query  570   FLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLV  749
             F +   Q +KPWMSQLAAVACLSLAAKVEET VPLLLD QVEE+ YVFEAK IQRME+LV
Sbjct  124   F-NFRFQNEKPWMSQLAAVACLSLAAKVEETQVPLLLDLQVEENRYVFEAKAIQRMEVLV  182

Query  750   LSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMA  929
             LS L+WKMNPVTP SFLDYI+RRL LK HLC EFLRRC  +LLS+ISD RFMCYLPSVMA
Sbjct  183   LSTLQWKMNPVTPLSFLDYISRRLGLKDHLCWEFLRRCGRILLSVISDSRFMCYLPSVMA  242

Query  930   SATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGA  1109
             +ATMLHV+  + P +  E Q QL+GILGIDK KV++C KLI E+A+R+Q   + KR++ +
Sbjct  243   TATMLHVVDSVEPNLRVEYQNQLLGILGIDKEKVDKCCKLIIELATRVQGNQSNKRRFSS  302

Query  1110  MPGSPKGVM  1136
             +PGSP GVM
Sbjct  303   IPGSPNGVM  311



>emb|CAB61222.1| cyclin D3a [Antirrhinum majus]
Length=343

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 234/310 (75%), Gaps = 23/310 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWED------------GE  392
             FDALYCEEE ++W   +    C IEEQE            DLL  D             E
Sbjct  11    FDALYCEEE-QNWDNGEIINDCFIEEQEPFS---------DLLKHDLLCGVDDDDDDKEE  60

Query  393   LSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             LSSLL KEQE EL+ V++ NP LAKAR EAVEW+ KV  +YSFSA TA+LAVNYLDR F 
Sbjct  61    LSSLLCKEQEYELYRVLEDNPSLAKARDEAVEWMFKVIGYYSFSALTAVLAVNYLDR-FL  119

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              + + Q  KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVFE+KTIQRMELLVL
Sbjct  120   CTFQFQQDKPWMYQLAAVACLSLAAKVEETQVPLLLDLQVEESKYVFESKTIQRMELLVL  179

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+WKMNPVTP SFL+YIARRL LKSHLC EFL RCE +LLS+I+DCRFMC+LPS +A+
Sbjct  180   STLKWKMNPVTPISFLEYIARRLALKSHLCKEFLNRCECLLLSLITDCRFMCHLPSALAT  239

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             ATML+VIS L P +G E Q+QL+ ILGI+K KVEEC KLI+EVA+ + F+S  KRK+G++
Sbjct  240   ATMLYVISSLEPCIGVEYQDQLINILGINKDKVEECCKLIQEVATSVHFQSGNKRKFGSL  299

Query  1113  PGSPKGVMEV  1142
             P SPKGV+++
Sbjct  300   PYSPKGVVDI  309



>ref|XP_006342647.1| PREDICTED: cyclin-D3-3-like isoform X2 [Solanum tuberosum]
Length=322

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 227/301 (75%), Gaps = 17/301 (6%)
 Frame = +3

Query  237   LPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             + F+ D+LYC++E     +  +  S S+  Q             DL+WE  EL SLLSKE
Sbjct  1     MAFVLDSLYCKDETFQVFEV-KPKSVSLLNQ-------------DLIWEKEELESLLSKE  46

Query  417   QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQ  596
             +EN+++NVV  NP L+  R EA+EW+L+   +++FSAQTA+LAVNYLDR  F S++SQ++
Sbjct  47    EENQMYNVVINNPFLSVFRKEAIEWILEGVDYHNFSAQTAILAVNYLDRFLF-SVQSQSE  105

Query  597   K-PWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
             K PWM+QLAAV CLSLAAK+EET VPLLLD QVEES Y FE KTIQRME+LVLS L+WKM
Sbjct  106   KQPWMNQLAAVTCLSLAAKIEETQVPLLLDLQVEESRYFFEPKTIQRMEILVLSTLKWKM  165

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NPVTPFSFLDY +RRL L  H+C E LRRCE VLLS I+DCRFMCYLPS MA+ATMLHVI
Sbjct  166   NPVTPFSFLDYFSRRLGLNDHICFELLRRCEWVLLSTITDCRFMCYLPSAMAAATMLHVI  225

Query  954   SRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGV  1133
              +L P  G+E QEQL+GILGI K  V +C KL++EVAS I F S +KRK+GA+PGSP GV
Sbjct  226   DKLEPCTGQEYQEQLLGILGIVKDNVTDCYKLVQEVASNIDFNS-HKRKFGALPGSPIGV  284

Query  1134  M  1136
             M
Sbjct  285   M  285



>ref|XP_011017157.1| PREDICTED: cyclin-D3-1-like [Populus euphratica]
Length=371

 Score =   360 bits (924),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 232/314 (74%), Gaps = 8/314 (3%)
 Frame = +3

Query  222   QEPQKLP-FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             Q+ Q+ P FL+D LYC EE       E + Q +            +     V ++QDL W
Sbjct  13    QQYQQNPTFLYDGLYCSEENWEKEVREDYFQDEVKGESFYSIDSNKRNTFPVFVQQDLSW  72

Query  381   EDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             E+ ELSSL +KE++N+L+ +++ NP LA+AR EAVEW+LKV  HYSFSA TA+LAVNYLD
Sbjct  73    EEEELSSLFAKEEQNQLYKILETNPSLARARCEAVEWILKVNVHYSFSAVTAILAVNYLD  132

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F LS   +  KPWM+QLAAVACLSLAAKVEET VPLLLDFQVEES+YVFEAKTIQRME
Sbjct  133   R-FLLSFHLEKDKPWMAQLAAVACLSLAAKVEETQVPLLLDFQVEESKYVFEAKTIQRME  191

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             +LVLS L+WKMNP+TP SFLDYI RRL LK +LC EFL+RCE + LS++ D R M Y+PS
Sbjct  192   ILVLSTLKWKMNPITPISFLDYITRRLGLKDYLCLEFLKRCERIALSVVPDSRSMLYVPS  251

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRK  1100
             VMA+A ML++I  + P +  E Q QL+GILGIDK KVE+C KL+ E+A R  F+ + KRK
Sbjct  252   VMATAVMLYIIDGVEPLLAAEYQSQLLGILGIDKDKVEDCSKLVMELAPRDHFKFSSKRK  311

Query  1101  YGAMPGSPKGVMEV  1142
             Y ++PGSP GV++V
Sbjct  312   YSSIPGSPNGVIDV  325



>gb|KHG01551.1| Cyclin-D3-1 -like protein [Gossypium arboreum]
Length=365

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 210/257 (82%), Gaps = 2/257 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED ELSSL +KE+ N+L++ +Q N +LA AR EAVEWVLKV++HYSFSA TALLAV
Sbjct  54    DLFWEDDELSSLFTKEERNQLYDSLQTNGNLAGARREAVEWVLKVSAHYSFSALTALLAV  113

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR  F S   Q++KPWM+QLAAVACLSLAAKVEET VPLLLD QVEE+ YVFEAKTI
Sbjct  114   NYLDRFLF-SFRFQSEKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVEETRYVFEAKTI  172

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRME+LVLS+L+WKMNPVTPFSFLDYI RRL LK HLC EFLRRC  +LLS+ISD RFMC
Sbjct  173   QRMEILVLSSLQWKMNPVTPFSFLDYITRRLGLKDHLCWEFLRRCHRILLSLISDSRFMC  232

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA-SRIQFES  1085
             YLPSVMA++TMLHV+  + P +  E   Q++GILGIDK KV EC +LI E A +R++   
Sbjct  233   YLPSVMATSTMLHVVDSVEPNLRVEYYNQILGILGIDKEKVNECGELIMEWATTRVEGNQ  292

Query  1086  AYKRKYGAMPGSPKGVM  1136
             + KR++ ++PGSP GVM
Sbjct  293   SNKRRFSSIPGSPNGVM  309



>ref|XP_004252752.1| PREDICTED: cyclin-D3-3-like [Solanum lycopersicum]
Length=325

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 227/304 (75%), Gaps = 20/304 (7%)
 Frame = +3

Query  237   LPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             + F+ D+LYC++E     +  +  S ++  Q             DL+WE  EL SLLSKE
Sbjct  1     MAFVIDSLYCKDETFQVFEV-KPKSVTLLNQ-------------DLIWEKEELESLLSKE  46

Query  417   QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT-  593
             +EN+++NVV  NP L+  RSEA+EW+L+   +++FSAQTA+LAVNYLDR  F SL+SQ  
Sbjct  47    EENQMYNVVINNPFLSVFRSEAIEWILEAVDYHNFSAQTAILAVNYLDRFLF-SLQSQNH  105

Query  594   ---QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
                ++PWM+QLAAV CLSLAAK+EET VPLLLD QVEES Y+FE KTIQRME+L+LS L+
Sbjct  106   DDEKQPWMNQLAAVTCLSLAAKIEETQVPLLLDLQVEESRYLFEPKTIQRMEILLLSTLK  165

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKMNPVTPFSFLDY +RRL L  H+C E LRRCE VLLS I+DCRFMCYLPS MA+ATML
Sbjct  166   WKMNPVTPFSFLDYFSRRLGLNDHICFELLRRCEKVLLSTITDCRFMCYLPSAMAAATML  225

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSP  1124
             HVI +L P +G+E QEQL GILG+ K  V +C KL++EVAS + F S  KRK+GA+PGSP
Sbjct  226   HVIDKLEPCIGQEYQEQLFGILGVVKDNVTDCCKLVQEVASNVDFNSN-KRKFGALPGSP  284

Query  1125  KGVM  1136
              GVM
Sbjct  285   MGVM  288



>ref|XP_002285001.1| PREDICTED: cyclin-D3-1 [Vitis vinifera]
 emb|CBI19472.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 227/312 (73%), Gaps = 9/312 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq------DLLWE  383
             Q+P  LPFL D LYCEE   HW +  R+     EE+EE                 DLL E
Sbjct  11    QQPHNLPFLLDTLYCEEN--HWEEEVREEGFLEEEEEESYYSDGSKPNAPPLLEPDLLCE  68

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D EL SL SKE++N+L +  + NP  A ARSEAVEW+L+V +HYSFSA TA+LAVNY DR
Sbjct  69    DEELVSLFSKEEKNDLHSNPESNPLAAGARSEAVEWMLRVNAHYSFSALTAVLAVNYFDR  128

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
               F S + Q +KPWM+QLAAVACLSLAAKVEET VPLLLD QVEE+ YVFEAKTIQRME+
Sbjct  129   FLF-SCDVQGEKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVEETMYVFEAKTIQRMEI  187

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             +VLS L WKMNPVTP SFLDYI RRL LK+HLC EFL+RCE +LLS++SDCRF CYLPSV
Sbjct  188   MVLSTLRWKMNPVTPLSFLDYITRRLGLKNHLCWEFLKRCERLLLSVLSDCRFGCYLPSV  247

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKY  1103
             +A+A MLHVI  + P +  + Q QL+GILGIDK KVE+C +LI ++AS  +     KRK+
Sbjct  248   IATAIMLHVIDSVEPCIRVQYQSQLLGILGIDKDKVEDCSQLILDIASSARCHHHNKRKF  307

Query  1104  GAMPGSPKGVME  1139
              + PGSP GVM+
Sbjct  308   ASTPGSPNGVMD  319



>emb|CAN79444.1| hypothetical protein VITISV_042479 [Vitis vinifera]
Length=419

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 227/312 (73%), Gaps = 9/312 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq------DLLWE  383
             Q+P  LPFL D LYCEE   HW +  R+     EE+EE                 DLL E
Sbjct  11    QQPHNLPFLLDTLYCEES--HWEEEVREEGFLEEEEEESYYGDGSKPNAPPLLEPDLLCE  68

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D EL SL SKE++N+L +  + NP  A ARSEAVEW+L+V +HYSFSA TA+LAVNY DR
Sbjct  69    DEELVSLFSKEEKNDLHSNPESNPLAAGARSEAVEWMLRVNAHYSFSALTAVLAVNYFDR  128

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
               F S + Q +KPWM+QLAAVACLSLAAKVEET VPLLLD QVEE+ YVFEAKTIQRME+
Sbjct  129   FLF-SCDVQGEKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVEETMYVFEAKTIQRMEI  187

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             +VLS L WKMNPVTP SFLDYI RRL LK+HLC EFL+RCE VLLS++SDCRF CYLPSV
Sbjct  188   MVLSTLRWKMNPVTPLSFLDYITRRLGLKNHLCWEFLKRCERVLLSVLSDCRFGCYLPSV  247

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKY  1103
             +A+A MLHVI  + P +  + Q QL+GILGIDK KVE+C +LI ++AS  +     KRK+
Sbjct  248   IATAIMLHVIDSVEPCIRAQYQSQLLGILGIDKDKVEDCSQLILDIASSARCHHHNKRKF  307

Query  1104  GAMPGSPKGVME  1139
              + PGSP GVM+
Sbjct  308   SSTPGSPNGVMD  319



>ref|XP_006342646.1| PREDICTED: cyclin-D3-3-like isoform X1 [Solanum tuberosum]
Length=329

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 230/308 (75%), Gaps = 24/308 (8%)
 Frame = +3

Query  237   LPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             + F+ D+LYC++E     +  +  S S+  Q             DL+WE  EL SLLSKE
Sbjct  1     MAFVLDSLYCKDETFQVFEV-KPKSVSLLNQ-------------DLIWEKEELESLLSKE  46

Query  417   QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQ  596
             +EN+++NVV  NP L+  R EA+EW+L+   +++FSAQTA+LAVNYLDR  F S++SQ++
Sbjct  47    EENQMYNVVINNPFLSVFRKEAIEWILEGVDYHNFSAQTAILAVNYLDRFLF-SVQSQSE  105

Query  597   K-PWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
             K PWM+QLAAV CLSLAAK+EET VPLLLD QVEES Y FE KTIQRME+LVLS L+WKM
Sbjct  106   KQPWMNQLAAVTCLSLAAKIEETQVPLLLDLQVEESRYFFEPKTIQRMEILVLSTLKWKM  165

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NPVTPFSFLDY +RRL L  H+C E LRRCE VLLS I+DCRFMCYLPS MA+ATMLHVI
Sbjct  166   NPVTPFSFLDYFSRRLGLNDHICFELLRRCEWVLLSTITDCRFMCYLPSAMAAATMLHVI  225

Query  954   SRLVPTVGEESQEQLMGILGI----DKVK---VEECQKLIKEVASRIQFESAYKRKYGAM  1112
              +L P  G+E QEQL+GILGI    ++VK   V +C KL++EVAS I F S +KRK+GA+
Sbjct  226   DKLEPCTGQEYQEQLLGILGIVKESNRVKQDNVTDCYKLVQEVASNIDFNS-HKRKFGAL  284

Query  1113  PGSPKGVM  1136
             PGSP GVM
Sbjct  285   PGSPIGVM  292



>ref|NP_001275138.1| D-type cyclin family 3 subgroup 3 [Solanum tuberosum]
 gb|ABY25837.1| D-type cyclin family 3 subgroup 3 [Solanum tuberosum]
Length=332

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 221/309 (72%), Gaps = 19/309 (6%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             QE QK+PFL D+LYCEE+                   E   E+      DLLWE+ EL+S
Sbjct  8     QEEQKIPFLLDSLYCEED----------------ILTEVSVETESFSAHDLLWEEEELTS  51

Query  402   LLSKEQENELF-NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             L SKE E ++  NV++K+     AR E+VEW+LK T++YSFSAQTA LAVNY DR    S
Sbjct  52    LFSKETEYKISCNVLEKDQSFISARRESVEWILKTTAYYSFSAQTAFLAVNYFDRFLLFS  111

Query  579   L-ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
               +S   KPWM QLAAV C SLAAKVEET VPLLLD QVEES +VFE+KTIQRME+LVLS
Sbjct  112   FNQSLKHKPWMIQLAAVTCPSLAAKVEETDVPLLLDLQVEESRFVFESKTIQRMEMLVLS  171

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+WKMNPVTPFSFLD+I RRL LK  L  EFLRRCE VLL  I+D RF+ YLPS MASA
Sbjct  172   TLKWKMNPVTPFSFLDFITRRLGLKYCLSLEFLRRCEKVLLYTITDGRFIGYLPSAMASA  231

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMP  1115
             TMLHV+ RL P +GE+ Q+QL+GILGI K KVEEC +LI+EVA  I F+S  KRK+G +P
Sbjct  232   TMLHVLDRLKPCIGEKYQDQLLGILGIVKDKVEECYRLIQEVACNIDFDSN-KRKFGTLP  290

Query  1116  GSPKGVMEV  1142
             G P GVM+V
Sbjct  291   GXPTGVMDV  299



>ref|NP_001234758.1| CycD3;3 protein [Solanum lycopersicum]
 emb|CAB60838.1| CycD3;3 [Solanum lycopersicum]
Length=336

 Score =   349 bits (895),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 219/308 (71%), Gaps = 18/308 (6%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             E QK+PFL D+LYCEE                    E   E+      DLLWE+ EL+SL
Sbjct  12    EAQKIPFLLDSLYCEENN---------------ILTEVSIETESFSSHDLLWEEEELTSL  56

Query  405   LSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
              SKE E E+ +NV++KN     +R E+VEW+LK T++YSFSAQT  LAVNY DR    S 
Sbjct  57    FSKETEYEISYNVLEKNQSFISSRRESVEWILKTTAYYSFSAQTGFLAVNYFDRFLLFSF  116

Query  582   -ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
              +S   KPWM+QL AV CLSLAAKVEET VPLLLD QVEES ++FE+KTIQRME+L+LS 
Sbjct  117   NQSLNHKPWMNQLVAVTCLSLAAKVEETDVPLLLDLQVEESGFLFESKTIQRMEMLILST  176

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+WKMNPVTPFSFLD+I RRL LK  L  EFLRRCE VLL  I+D RF+ YLPS MASAT
Sbjct  177   LKWKMNPVTPFSFLDFITRRLGLKHCLSLEFLRRCEKVLLYTITDDRFIGYLPSAMASAT  236

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHV+ RL P +GE+ Q+QL+GILGI K KVE C +LI+EVA  I F S  KRK+G +PG
Sbjct  237   MLHVLDRLKPCIGEKYQDQLLGILGIVKEKVEGCYRLIQEVACNIDFGSN-KRKFGTLPG  295

Query  1119  SPKGVMEV  1142
             SP GVM++
Sbjct  296   SPTGVMDM  303



>emb|CAN88857.1| D3-type cyclin [Populus trichocarpa]
Length=341

 Score =   348 bits (894),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 229/313 (73%), Gaps = 7/313 (2%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             Q  Q   FL+D LYC EE       E + Q +            +     V ++QDL WE
Sbjct  1     QYQQNPTFLYDGLYCSEENWEKEVREDYFQDEVKGEYFYSIDSNKRNTFPVFVQQDLSWE  60

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             + ELSSL +KE++N+L+ +++ NP LA+AR EAVEW+LKV  HYSFSA TA+LAVNYLDR
Sbjct  61    EEELSSLFAKEEQNQLYKILEINPSLARARCEAVEWILKVNVHYSFSAVTAVLAVNYLDR  120

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F LS+  +  KPWM+QLAAVACLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+
Sbjct  121   -FLLSVHLEKDKPWMAQLAAVACLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEI  179

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             LVLS L+WKMNP+TP SFLDYI RRL LK +LC EFL+RCE ++LS++     M Y+PSV
Sbjct  180   LVLSTLKWKMNPITPISFLDYIIRRLGLKDYLCLEFLKRCERIVLSVVPGKLSMLYVPSV  239

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKY  1103
             MA+A ML++I  + P++  E Q QL+GILGIDK  VE+C KL+ E+A R  F+ + KRKY
Sbjct  240   MATAVMLYIIDGVEPSLAAEYQSQLLGILGIDKDMVEDCSKLVMELAPRDHFKFSSKRKY  299

Query  1104  GAMPGSPKGVMEV  1142
              ++PGSP GV++V
Sbjct  300   SSIPGSPNGVIDV  312



>ref|XP_002302430.1| cyclin D3.1 family protein [Populus trichocarpa]
 gb|EEE81703.1| cyclin D3.1 family protein [Populus trichocarpa]
Length=371

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 232/314 (74%), Gaps = 8/314 (3%)
 Frame = +3

Query  222   QEPQKLP-FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             Q+ Q+ P FL+D LYC EE       E + Q +            +     V ++QDL W
Sbjct  13    QQYQQNPTFLYDGLYCSEENWEKEVREDYFQDEVKGEYFYSIDSNKRNTFPVFVQQDLSW  72

Query  381   EDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             E+ ELSSL +KE++N+L+ +++ NP LA+AR EAVEW+LKV  HYSFSA TA+LAVNYLD
Sbjct  73    EEEELSSLFAKEEQNQLYKILEINPSLARARCEAVEWILKVNVHYSFSAVTAVLAVNYLD  132

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F LS+  +  KPWM+QLAAVACLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME
Sbjct  133   R-FLLSVHLEKDKPWMAQLAAVACLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRME  191

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             +LVLS L+WKMNP+TP SFLDYI RRL LK +LC EFL+RCE ++LS++     M Y+PS
Sbjct  192   ILVLSTLKWKMNPITPISFLDYIIRRLGLKDYLCLEFLKRCERIVLSVVPGKLSMLYVPS  251

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRK  1100
             VMA+A ML++I  + P++  E Q QL+GILGIDK  VE+C KL+ E+A R  F+ + KRK
Sbjct  252   VMATAVMLYIIDGVEPSLAAEYQSQLLGILGIDKDMVEDCSKLVMELAPRDHFKFSSKRK  311

Query  1101  YGAMPGSPKGVMEV  1142
             Y ++PGSP GV++V
Sbjct  312   YSSIPGSPNGVIDV  325



>dbj|BAE80324.1| cyclin D3-1 [Camellia sinensis]
Length=371

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 223/307 (73%), Gaps = 7/307 (2%)
 Frame = +3

Query  234   KLPFLFDALYCEEE----GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
              LPF+ DALYC+E+    GE     D +             +   LLEQDL WED EL+S
Sbjct  18    NLPFVLDALYCQEQHLEGGETEDYFDSEEEDCHYSDNIVSPKPPQLLEQDLFWEDEELTS  77

Query  402   LLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             LLSKEQEN LF+ ++ +P L  AR  AVEW+LKV +HYSFSA TA+LAVNYLDR  F S 
Sbjct  78    LLSKEQENPLFHSLETDPSLGGARRAAVEWLLKVNAHYSFSALTAVLAVNYLDRFLF-SF  136

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q +KPWM+QLAAVACLSLAAKVEET VPLLLD QVE+S YVFEAKTIQRME+L+LS L
Sbjct  137   HFQREKPWMTQLAAVACLSLAAKVEETEVPLLLDLQVEDSRYVFEAKTIQRMEMLILSTL  196

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKMNPVTP SFLD+I RRL LK+ LCCEFL+RCE +LL IISD RFM YLPSV+++ATM
Sbjct  197   QWKMNPVTPLSFLDHITRRLGLKNRLCCEFLKRCESILLCIISDSRFMLYLPSVLSTATM  256

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGS  1121
             L V S L P +  E Q QL+GIL IDK KVE+C KL+ E  S I    + KRK+ +MPGS
Sbjct  257   LLVFSSLEPCLAVEYQNQLLGILQIDKDKVEDCYKLMLESTSGIH--QSNKRKFRSMPGS  314

Query  1122  PKGVMEV  1142
             P  V +V
Sbjct  315   PNCVTDV  321



>gb|KHG12124.1| Cyclin-D3-1 -like protein [Gossypium arboreum]
Length=364

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 231/309 (75%), Gaps = 11/309 (4%)
 Frame = +3

Query  243   FLFDALYC-------EEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             F+FDALYC       E    ++ + + + SC       +      LL+QDL WE  ELSS
Sbjct  7     FVFDALYCLEENWEEEPREGYFVEVEEEGSC-YNHGINKSNSFPTLLDQDLSWEGDELSS  65

Query  402   LLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             LLSKE++N L++ +Q N +LA AR EAVEW+LKV +HYSFSA TA+LAVNYLDR F L+ 
Sbjct  66    LLSKEEQNLLYDSLQSNGNLAGARREAVEWMLKVNAHYSFSALTAVLAVNYLDR-FLLTF  124

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q++KPWMSQLAA+ACLSLAAKVEET VPLLLD QVEES YVFE KTIQRME+LVLS L
Sbjct  125   PFQSEKPWMSQLAAIACLSLAAKVEETQVPLLLDLQVEESRYVFEPKTIQRMEILVLSTL  184

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKMNPVTP SFLDYIARRL LK HLC EFLRRC+  L+S+ISD RFMCYLPSVMA+ATM
Sbjct  185   QWKMNPVTPLSFLDYIARRLGLKDHLCWEFLRRCDRTLISVISDSRFMCYLPSVMATATM  244

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQFESAYKRKY-GAMP  1115
             LHV+  + P +  E + QL+GILGIDK KV+EC KLI + V + +Q   + KR++  ++P
Sbjct  245   LHVVDCVEPNLRVEYENQLLGILGIDKEKVDECCKLITDLVTTIVQGNLSKKRRFSSSIP  304

Query  1116  GSPKGVMEV  1142
              SP GVM+V
Sbjct  305   RSPNGVMDV  313



>ref|XP_011069720.1| PREDICTED: cyclin-D3-3-like isoform X2 [Sesamum indicum]
Length=358

 Score =   345 bits (884),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 225/315 (71%), Gaps = 19/315 (6%)
 Frame = +3

Query  234   KLPFLFDALYCEEEGEHWGQAD-------------RDPSCSIeeqeeeeeesvvlleqDL  374
              LPFL DAL+CEEE   W   D              +   S        E  + LL Q+ 
Sbjct  6     NLPFLLDALFCEEE--QWDDGDITETTENCLIGVEGEGDNSFLHHSLSPEPFLELLGQEE  63

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
              W D ELSSLLSKEQENEL+  +++ P LA AR EAVEW+LKV  +YSFSA TA+LAVNY
Sbjct  64    FWGDEELSSLLSKEQENELYGGLEETPSLAMARGEAVEWMLKVIGYYSFSALTAVLAVNY  123

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR F  S +S  +KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVFE KTIQR
Sbjct  124   LDR-FLYSFQSHREKPWMIQLAAVACLSLAAKVEETEVPLLLDLQVEESKYVFEPKTIQR  182

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             ME+LVLS LEWKMNPVTP SFLDYIARR+EL+SHLC EFLR+CE ++LS+ISDCRF  + 
Sbjct  183   MEILVLSTLEWKMNPVTPLSFLDYIARRVELQSHLCREFLRKCECLILSLISDCRFTGFQ  242

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PS +A+ATML+VIS L P  G + Q+QL+ ILG DK KV +C  LI+EVA+ + F S+ K
Sbjct  243   PSALATATMLYVISSLEPCTGLDHQDQLVAILGTDKDKVLDCCMLIQEVATTVDFHSSNK  302

Query  1095  RKYG---AMPGSPKG  1130
             RK+G   A   SPKG
Sbjct  303   RKFGSFLAAGSSPKG  317



>ref|XP_006434702.1| hypothetical protein CICLE_v10001416mg [Citrus clementina]
 gb|ESR47942.1| hypothetical protein CICLE_v10001416mg [Citrus clementina]
Length=393

 Score =   345 bits (886),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 232/332 (70%), Gaps = 30/332 (9%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCS--------------------Ieeqeeee  341
             Q+P    FL DALYC EE  +W    R                         I + +   
Sbjct  6     QQPHNSTFLLDALYCSEE--NWEDELRVDCFQVQDGGLIEEEEEEEGESFYFINKTKTIP  63

Query  342   eesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSF  521
                 +L EQDL W+  ELS+LLSKE  N L+N+++ NP L++ARSEAV+W+LKV +HYSF
Sbjct  64    VPVPMLHEQDLSWQHDELSTLLSKEVPNRLYNILKTNPSLSRARSEAVDWMLKVNAHYSF  123

Query  522   SAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             +A TALLAVNYLDR  F S + Q  KPWM+QLAAVACLSLAAKVEET VPLLLD QVE++
Sbjct  124   TALTALLAVNYLDRFLF-SFQLQRDKPWMAQLAAVACLSLAAKVEETQVPLLLDLQVEDT  182

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS  881
             ++VFEAKTIQRME+LVLS L+WKMNPVTP SFLDYIARRL LK +LC EFL+RC+ +LLS
Sbjct  183   KFVFEAKTIQRMEILVLSTLQWKMNPVTPLSFLDYIARRLGLKGYLCWEFLKRCDRILLS  242

Query  882   IISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV  1061
              ISD  FM YLPSVMA+ATMLHV+  + P++G E ++QL+ ILG DK KVE C KLI ++
Sbjct  243   AISDSSFMQYLPSVMANATMLHVVQNIEPSLGVEYEKQLLNILGTDKDKVEHCSKLIMQL  302

Query  1062  ASRI--QFESAYKRKYGAM-----PGSPKGVM  1136
             A ++  Q   + KRK+G++     PGSP GVM
Sbjct  303   AEQVRGQGSQSNKRKFGSITVPVVPGSPNGVM  334



>ref|XP_010061716.1| PREDICTED: cyclin-D3-1 [Eucalyptus grandis]
 gb|KCW68701.1| hypothetical protein EUGRSUZ_F02302 [Eucalyptus grandis]
Length=415

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 230/319 (72%), Gaps = 9/319 (3%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesv-----vlleq  368
             R+  P    Q+   LFDALYC EE  HWG+ D     + +    EE +        LL+Q
Sbjct  41    RQHDPSSSQQEEQVLFDALYCSEE--HWGEEDEGEGLASDGLLSEERDHRLLSPRALLDQ  98

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DLLWED EL+SL SKE+   +   ++ +P LA AR EAVEW+++V +HY+FSA TALLAV
Sbjct  99    DLLWEDEELASLFSKEEPGGMRLNLENDPSLADARREAVEWIMRVHAHYAFSALTALLAV  158

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S   Q  KPWM+QL+AVACLSLAAKVEET VPLL+DFQVE+S  VFEAK I
Sbjct  159   NYWDR-FTCSFALQEDKPWMTQLSAVACLSLAAKVEETQVPLLIDFQVEDSSPVFEAKNI  217

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS+LEWKMNPVTP SFLDY+ RRL L  HLC EFLRRCE VLLS+ISDCRF C
Sbjct  218   QRMELLVLSSLEWKMNPVTPLSFLDYMTRRLGLTGHLCWEFLRRCENVLLSVISDCRFTC  277

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFES  1085
             +LPSV+A++TMLHVI+ L P +  E Q QL+GIL +   K++ C KLI  + A R Q  S
Sbjct  278   FLPSVIAASTMLHVINGLKPRLDVEDQTQLLGILAMGMDKIDACYKLIDDDHALRSQRYS  337

Query  1086  AYKRKYGAMPGSPKGVMEV  1142
               KRK+G++PGSP+GVME+
Sbjct  338   HNKRKFGSVPGSPRGVMEL  356



>ref|XP_006473270.1| PREDICTED: cyclin-D3-1-like [Citrus sinensis]
 gb|KDO84068.1| hypothetical protein CISIN_1g016163mg [Citrus sinensis]
Length=394

 Score =   344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 232/333 (70%), Gaps = 31/333 (9%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCS---------------------Ieeqeee  338
             Q+P    FL DALYC EE  +W    R                          I + +  
Sbjct  6     QQPHNSTFLLDALYCSEE--NWEDELRVDCFQVQDGGLIEEEEEEEEGESFYFINKTKTI  63

Query  339   eeesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYS  518
                  +L EQDL W+D ELS+LLSKE  N L+N+++ NP L++ARSEAV+W+LKV +HYS
Sbjct  64    PVPVPMLHEQDLSWQDDELSTLLSKEVPNRLYNILKTNPSLSRARSEAVDWMLKVNAHYS  123

Query  519   FSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEE  698
             F+A TALLAVNYLDR  F S + Q  KPWM+QLAAVACLSLAAKVEET VPLLLD QVE+
Sbjct  124   FTALTALLAVNYLDRFLF-SFQLQRDKPWMAQLAAVACLSLAAKVEETQVPLLLDLQVED  182

Query  699   SEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLL  878
              ++VFEAKTIQRME+LVLS L+WKMNPVTP SFLDYIARRL LK +LC EFL+RC+ +LL
Sbjct  183   IKFVFEAKTIQRMEILVLSTLQWKMNPVTPLSFLDYIARRLGLKGYLCWEFLKRCDRILL  242

Query  879   SIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE  1058
             S ISD  FM YLPSVMA+ATMLHV+  +  ++G E ++QL+ ILG DK KVE C KLI +
Sbjct  243   SAISDSSFMQYLPSVMANATMLHVVQNIESSLGVEYEKQLLNILGTDKDKVEHCSKLIMQ  302

Query  1059  VASRIQFES--AYKRKYGAM-----PGSPKGVM  1136
             +A ++Q +   + KRK+G++     PGSP GVM
Sbjct  303   LAEQVQGQGSQSIKRKFGSITVPVVPGSPNGVM  335



>gb|AAO13248.1|AF181993_1 cyclin D [Populus tremula x Populus tremuloides]
Length=376

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 230/311 (74%), Gaps = 9/311 (3%)
 Frame = +3

Query  222   QEPQKLP-FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             Q+ Q+ P  L+DALYC EE       E W Q + +          +     +LLEQDL W
Sbjct  13    QDQQQNPTLLYDALYCSEENWVEEVREDWFQDELEGESYCSNNSNKLNTFPILLEQDLSW  72

Query  381   EDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             ED ELSSL +KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLD
Sbjct  73    EDEELSSLFAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLD  132

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R  F S+  Q +KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME
Sbjct  133   RFLF-SVHLQKEKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRME  191

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             +LVLS L+WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PS
Sbjct  192   ILVLSTLKWKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPS  251

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKR  1097
             VMA+ATML+VI  + P++  E Q QL+ ILGIDK KVE+C K + E A R  F+  + KR
Sbjct  252   VMAAATMLYVIDNIEPSLAAEYQSQLLSILGIDKDKVEDCSKFLMEFALRDHFKLLSNKR  311

Query  1098  KYGAMPGSPKG  1130
             K+ ++PGSP G
Sbjct  312   KFCSLPGSPSG  322



>ref|XP_011029308.1| PREDICTED: cyclin-D3-3-like [Populus euphratica]
Length=379

 Score =   343 bits (880),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 231/311 (74%), Gaps = 16/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADR----------DPSCSIeeqeeeeeesvvlleqDLLWEDGE  392
              L+DALYC EE  +W +  R          D  CS     ++     +LLEQDL WED E
Sbjct  24    LLYDALYCSEE--NWVEEVREDCFQDELEGDSYCS--NNIDKLNTFPILLEQDLSWEDEE  79

Query  393   LSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             LSSLL+KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F
Sbjct  80    LSSLLAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF  139

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              S+  Q  KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+Y+FEAKTIQRME+LVL
Sbjct  140   -SVHLQKDKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYLFEAKTIQRMEILVL  198

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+
Sbjct  199   STLKWKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMSYVPSVMAA  258

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGA  1109
             ATML+VI  + P++  E Q QL+ ILGIDK KVE C K + E A R  F+  + KRK+ +
Sbjct  259   ATMLYVIDNIEPSLAAEYQSQLLSILGIDKDKVEVCSKFLMESALRDHFKLLSNKRKFSS  318

Query  1110  MPGSPKGVMEV  1142
             +PGSP GV++V
Sbjct  319   LPGSPSGVIDV  329



>ref|XP_007017142.1| D3-type cyclin isoform 3 [Theobroma cacao]
 gb|EOY14367.1| D3-type cyclin isoform 3 [Theobroma cacao]
Length=326

 Score =   340 bits (873),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 215/302 (71%), Gaps = 34/302 (11%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLS  410
             Q   F+ DALYC EE  +W +                             E GE   L  
Sbjct  6     QNSTFVVDALYCSEE--NWDE-----------------------------EVGEDHFL--  32

Query  411   KEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQ  590
             +E++N+L++ +Q N + A AR EAVEW+LKV +HYSFSA TA+LAVNYLDR  F +   Q
Sbjct  33    EEEQNQLYDSLQTNGNPAGARREAVEWMLKVNAHYSFSALTAVLAVNYLDRFLF-NFRFQ  91

Query  591   TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWK  770
              +KPWMSQLAAVACLSLAAKVEET VPLLLD QVEE+ YVFEAK IQRME+LVLS L+WK
Sbjct  92    NEKPWMSQLAAVACLSLAAKVEETQVPLLLDLQVEENRYVFEAKAIQRMEVLVLSTLQWK  151

Query  771   MNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHV  950
             MNPVTP SFLDYI+RRL LK HLC EFLRRC  +LLS+ISD RFMCYLPSVMA+ATMLHV
Sbjct  152   MNPVTPLSFLDYISRRLGLKDHLCWEFLRRCGRILLSVISDSRFMCYLPSVMATATMLHV  211

Query  951   ISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKG  1130
             +  + P +  E Q QL+GILGIDK KV++C KLI E+A+R+Q   + KR++ ++PGSP G
Sbjct  212   VDSVEPNLRVEYQNQLLGILGIDKEKVDKCCKLIIELATRVQGNQSNKRRFSSIPGSPNG  271

Query  1131  VM  1136
             VM
Sbjct  272   VM  273



>gb|AAQ19973.1| cyclin D3-1 [Euphorbia esula]
Length=350

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 226/308 (73%), Gaps = 17/308 (6%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWG--------QADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELS  398
             FL+DALYC EE    G        Q D+  + S+  Q             DL WE+ EL+
Sbjct  8     FLYDALYCSEEDNWEGEVVDIFHEQEDQGENTSVFPQNSSPV--------DLNWEEDELT  59

Query  399   SLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             S+ SK+++N+L+  ++ NP LAK+R +AV+W++KV +HYSF+A T++LAVN+LDR  F S
Sbjct  60    SVFSKQEQNQLYKKLEINPCLAKSRRDAVDWMMKVNAHYSFTALTSVLAVNFLDRFLF-S  118

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
              + QT+KPWM+QL AVACLSLAAKVEET VPLLLD QV +S+YVFEAKTIQRMELLVLS 
Sbjct  119   FDLQTEKPWMTQLTAVACLSLAAKVEETQVPLLLDLQVVDSKYVFEAKTIQRMELLVLST  178

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+MNPVTP SF+DY+ RRL  K +LC EF+RRCE ++LSIISD RF+ YLPS +ASA 
Sbjct  179   LQWRMNPVTPLSFIDYMTRRLGFKDYLCWEFIRRCELIVLSIISDMRFIPYLPSEIASAI  238

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHVI+ + P++G+E + QL GILGIDK KV  C+++I E+ SR     + KRKYG+ PG
Sbjct  239   MLHVINGIEPSLGDEFETQLFGILGIDKEKVNNCREMIIELGSRYYGNQSNKRKYGSDPG  298

Query  1119  SPKGVMEV  1142
             SP  VM+V
Sbjct  299   SPNCVMDV  306



>ref|XP_011069719.1| PREDICTED: cyclin-D3-3-like isoform X1 [Sesamum indicum]
Length=365

 Score =   339 bits (870),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 226/322 (70%), Gaps = 26/322 (8%)
 Frame = +3

Query  234   KLPFLFDALYCEEEGEHWGQAD-------------RDPSCSIeeqeeeeeesvvlleqDL  374
              LPFL DAL+CEEE   W   D              +   S        E  + LL Q+ 
Sbjct  6     NLPFLLDALFCEEE--QWDDGDITETTENCLIGVEGEGDNSFLHHSLSPEPFLELLGQEE  63

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
              W D ELSSLLSKEQENEL+  +++ P LA AR EAVEW+LKV  +YSFSA TA+LAVNY
Sbjct  64    FWGDEELSSLLSKEQENELYGGLEETPSLAMARGEAVEWMLKVIGYYSFSALTAVLAVNY  123

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR F  S +S  +KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVFE KTIQR
Sbjct  124   LDR-FLYSFQSHREKPWMIQLAAVACLSLAAKVEETEVPLLLDLQVEESKYVFEPKTIQR  182

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             ME+LVLS LEWKMNPVTP SFLDYIARR+EL+SHLC EFLR+CE ++LS+ISDCRF  + 
Sbjct  183   MEILVLSTLEWKMNPVTPLSFLDYIARRVELQSHLCREFLRKCECLILSLISDCRFTGFQ  242

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKV-------KVEECQKLIKEVASRI  1073
             PS +A+ATML+VIS L P  G + Q+QL+ ILG DK+       KV +C  LI+EVA+ +
Sbjct  243   PSALATATMLYVISSLEPCTGLDHQDQLVAILGTDKMGCEMKQDKVLDCCMLIQEVATTV  302

Query  1074  QFESAYKRKYG---AMPGSPKG  1130
              F S+ KRK+G   A   SPKG
Sbjct  303   DFHSSNKRKFGSFLAAGSSPKG  324



>ref|XP_003603091.1| Cyclin D3-1 [Medicago truncatula]
 gb|AES73342.1| carboxy-terminal domain cyclin [Medicago truncatula]
 gb|AFK43823.1| unknown [Medicago truncatula]
Length=348

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 225/304 (74%), Gaps = 7/304 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesv-vlleqDLLWEDGELSSLLSKEQ  419
              L D LYC EE  HW + D     ++         +   LLE D+ WED EL SLL+KEQ
Sbjct  10    LLLDTLYCSEE--HWEEQDELEYDNVSLNNTTINTTTCSLLETDMFWEDEELKSLLNKEQ  67

Query  420   ENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQK  599
             +N L+  +Q NP L  AR E++EW+LKV +HYSFSA T++LAVNYLDR  F S   Q +K
Sbjct  68    QNPLYIFLQTNPVLETARRESIEWILKVNAHYSFSALTSVLAVNYLDRFLF-SFRFQNEK  126

Query  600   PWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNP  779
             PWM+QLAAVACLSLAAK+EET VPLLLD QVEES Y+FEAKTI++ME+L+LS L WKMNP
Sbjct  127   PWMTQLAAVACLSLAAKMEETHVPLLLDLQVEESRYLFEAKTIKKMEILILSTLGWKMNP  186

Query  780   VTPFSFLDYIARRLELKSHLCC-EFLRRCEGVLLSII-SDCRFMCYLPSVMASATMLHVI  953
              TP SF+D+I RRL LK HL C EFL+RCEGVLLS+I SD +FM YLPSV+A+ATM+HV 
Sbjct  187   ATPLSFIDFIIRRLGLKDHLICWEFLKRCEGVLLSVIRSDSKFMSYLPSVLATATMVHVF  246

Query  954   SRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI-QFESAYKRKYGAMPGSPKG  1130
             + + P++G+E Q QL+GILGI+K KV+EC KL+ ++ S   +     KRK+G++P SPKG
Sbjct  247   NSVEPSLGDEYQTQLLGILGINKDKVDECGKLLLKLWSGYEEGNECNKRKFGSIPSSPKG  306

Query  1131  VMEV  1142
             VME+
Sbjct  307   VMEM  310



>gb|KDP41686.1| hypothetical protein JCGZ_16093 [Jatropha curcas]
Length=390

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 238/335 (71%), Gaps = 32/335 (10%)
 Frame = +3

Query  219   FQEPQKLP---FLFDALYCEEEGEHWGQADRDP--------------------SC---SI  320
              QEPQ  P   F+ DALYC EE  +W +  RD                     +C   + 
Sbjct  11    LQEPQYQPSLTFVNDALYCSEE--NWEEEIRDDYFPQVEVEVEEEEEEEEEGGTCFCNNN  68

Query  321   eeqeeeeeesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLK  500
                 ++++ S VLLE+DL WED ELSSLL+K++ N+L++ +Q  P L +AR +AVEW+LK
Sbjct  69    NNNNKKQQCSAVLLERDLYWEDEELSSLLAKQEPNQLYDNLQAKPSLVEARRQAVEWMLK  128

Query  501   VTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLL  680
             V +HYSF+A TA+LAVNYLDR  F S   QT+KPWM+QLAAVACLSLAAKVEET VPLLL
Sbjct  129   VNAHYSFTALTAVLAVNYLDRFLF-SFHLQTEKPWMTQLAAVACLSLAAKVEETEVPLLL  187

Query  681   DFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRR  860
             D QVE+S+YVFEAKTIQRME+LVLS L W+MNPVTP SFLDY+ RRL LK + C EFLRR
Sbjct  188   DLQVEDSKYVFEAKTIQRMEILVLSTLRWRMNPVTPLSFLDYMTRRLGLKEYFCREFLRR  247

Query  861   CEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEEC  1040
             CE ++LSIISD   +CYLPSV+A+ATMLHVI+ + P +  E + QL+ +LGIDK KV+ C
Sbjct  248   CERIVLSIISDSWSICYLPSVIATATMLHVITGVEPCLKAEYESQLLVVLGIDKDKVDNC  307

Query  1041  QKLIKEVASR---IQFESAYKRKYGAMPGSPKGVM  1136
              +LI E+ASR   I    + KRKY ++PGSP GV+
Sbjct  308   SELIMELASRGHGISISQSNKRKYDSIPGSPNGVI  342



>emb|CAN88856.1| D3-type cyclin [Populus trichocarpa]
Length=379

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 223/303 (74%), Gaps = 8/303 (3%)
 Frame = +3

Query  243   FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
              L+DALYC EE       E   Q + +          +     + LEQDL WED ELSSL
Sbjct  24    LLYDALYCSEENWVEEVREDCFQDELEGESYCSNNSNKLNTFPIFLEQDLSWEDEELSSL  83

Query  405   LSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
              +KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F S+ 
Sbjct  84    FAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF-SVH  142

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q +KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+LVLS L+
Sbjct  143   LQKEKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEILVLSTLK  202

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+ATML
Sbjct  203   WKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPSVMAAATML  262

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGAMPGS  1121
             +VI  + P++  E Q QL+ ILGIDK KVE+C K + E A R  F+  + KRK+ ++PGS
Sbjct  263   YVIDNIEPSLAAEYQSQLLSILGIDKDKVEDCSKFLMEFALRYHFKLLSNKRKFCSLPGS  322

Query  1122  PKG  1130
             P G
Sbjct  323   PSG  325



>ref|XP_006374876.1| cyclin D3.1 family protein [Populus trichocarpa]
 gb|ERP52673.1| cyclin D3.1 family protein [Populus trichocarpa]
Length=379

 Score =   337 bits (865),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 223/303 (74%), Gaps = 8/303 (3%)
 Frame = +3

Query  243   FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
              L+DALYC EE       E   Q + +          +     + LEQDL WED ELSSL
Sbjct  24    LLYDALYCSEENWVEEVREDCFQDELEGESYCSNNSNKLNTFPIFLEQDLSWEDEELSSL  83

Query  405   LSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
              +KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F S+ 
Sbjct  84    FAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF-SVH  142

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q +KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+LVLS L+
Sbjct  143   LQKEKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEILVLSTLK  202

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+ATML
Sbjct  203   WKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPSVMAAATML  262

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGAMPGS  1121
             +VI  + P++  E Q QL+ ILGIDK KVE+C K + E A R  F+  + KRK+ ++PGS
Sbjct  263   YVIDNIEPSLAAEYQSQLLSILGIDKDKVEDCSKFLMEFALRDHFKLLSNKRKFCSLPGS  322

Query  1122  PKG  1130
             P G
Sbjct  323   PSG  325



>gb|AEV41135.1| D3-type cyclin [Populus x canadensis]
Length=379

 Score =   336 bits (861),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 223/303 (74%), Gaps = 8/303 (3%)
 Frame = +3

Query  243   FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
              L+DALYC EE       E   Q + +          +     +LLEQDL WED ELSSL
Sbjct  24    LLYDALYCSEENWVEEVREDCFQDELEGESYCSNNSNKLNTFPILLEQDLSWEDEELSSL  83

Query  405   LSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
              +KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F S+ 
Sbjct  84    FAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF-SVH  142

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q +KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+LVLS L+
Sbjct  143   LQKEKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEILVLSTLK  202

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+ATML
Sbjct  203   WKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPSVMAAATML  262

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGAMPGS  1121
             +VI  + P++  E Q QL  ILGIDK KVE+C K + E A R  F+  + KRK+ ++PGS
Sbjct  263   YVIDNIEPSLAAEYQSQLWSILGIDKDKVEDCSKFLMEFALRDHFKLLSNKRKFCSLPGS  322

Query  1122  PKG  1130
             P G
Sbjct  323   PSG  325



>ref|XP_009613153.1| PREDICTED: cyclin-D3-3-like isoform X2 [Nicotiana tomentosiformis]
Length=339

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 233/302 (77%), Gaps = 5/302 (2%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLS  410
             QKLPFL D+LYC+ E         D    + E+ E   +S+ LLEQDLLWE+ ELSSLLS
Sbjct  11    QKLPFLLDSLYCKNES----LDVLDTENCLTEEVEVNPKSISLLEQDLLWEEEELSSLLS  66

Query  411   KEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQ  590
             KEQEN+++N+V  NP L+ A  EAV+W+L+  ++++FSAQTA+LAVNY DR  F S +SQ
Sbjct  67    KEQENQMYNIVINNPYLSVATREAVDWILEAIAYHNFSAQTAILAVNYFDRFLF-SFQSQ  125

Query  591   TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWK  770
             ++KPW++ LAAV+CLSLAAKVEET VPLLLD QVEES Y+FE +TIQRMELLVL+ L+WK
Sbjct  126   SEKPWLNHLAAVSCLSLAAKVEETQVPLLLDLQVEESRYLFEPRTIQRMELLVLTTLKWK  185

Query  771   MNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHV  950
             MNPVTP SFLDY +RRL L +H+  E LRRCE VLLS I D RFMCYLPS MA+ATMLHV
Sbjct  186   MNPVTPLSFLDYFSRRLGLNNHIYYELLRRCERVLLSTIIDFRFMCYLPSTMAAATMLHV  245

Query  951   ISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKG  1130
             I RL P +GEE QEQL+GILGI K KV +C +LI+EVAS I F S  ++  GA+PGSP G
Sbjct  246   IDRLEPCIGEEYQEQLLGILGIVKDKVTDCYRLIQEVASNIDFNSNKRKSIGALPGSPIG  305

Query  1131  VM  1136
             VM
Sbjct  306   VM  307



>ref|XP_009354156.1| PREDICTED: cyclin-D3-1-like [Pyrus x bretschneideri]
Length=376

 Score =   333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 229/318 (72%), Gaps = 15/318 (5%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEE---GEHWGQADRDP-------SCSIeeqeeeeeesvvlleqDL  374
             E Q   FLFDALYC EE    E     D  P       S +         ++ +L+EQDL
Sbjct  14    EEQNPVFLFDALYCSEEHLVDEQVSPVDYFPEEELVEDSFNSNVSSFNPIKAPILVEQDL  73

Query  375   LWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              W++ EL SLLSKE E NEL   +Q +P LA AR EAV+W+L+V SHYSFSA TA+LA +
Sbjct  74    FWDNEELISLLSKESEQNELQKPLQISPSLAGARREAVDWMLRVASHYSFSALTAVLAAD  133

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  SL  Q +KPWM+QLAAVAC+SLAAKVEET VPLLLDFQVE+S+YVFEA+TI+
Sbjct  134   YFDR-FLSSLHLQVEKPWMTQLAAVACISLAAKVEETQVPLLLDFQVEDSKYVFEARTIK  192

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RME++VLS L+WKMNPVTP SF+DYI RRL LK+HLC E L+RCE +LLS+ISD RFM +
Sbjct  193   RMEIVVLSTLQWKMNPVTPISFIDYITRRLGLKNHLCWEVLKRCELILLSLISDSRFMSF  252

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES--  1085
             LPSV+A+A MLHV++ + P +  E Q QL+GILGIDK KV+EC KLI E+ S     S  
Sbjct  253   LPSVVATAIMLHVVNNIEPCLLMEYQNQLLGILGIDKDKVDECSKLISELTSSGGNGSGK  312

Query  1086  -AYKRKYGAMPGSPKGVM  1136
              + KRK+G++P SP GVM
Sbjct  313   QSNKRKFGSVPCSPNGVM  330



>ref|XP_009613152.1| PREDICTED: cyclin-D3-3-like isoform X1 [Nicotiana tomentosiformis]
Length=340

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 235/303 (78%), Gaps = 6/303 (2%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLS  410
             QKLPFL D+LYC+ E         D    + E+ E   +S+ LLEQDLLWE+ ELSSLLS
Sbjct  11    QKLPFLLDSLYCKNES----LDVLDTENCLTEEVEVNPKSISLLEQDLLWEEEELSSLLS  66

Query  411   KEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQ  590
             KEQEN+++N+V  NP L+ A  EAV+W+L+  ++++FSAQTA+LAVNY DR  F S +SQ
Sbjct  67    KEQENQMYNIVINNPYLSVATREAVDWILEAIAYHNFSAQTAILAVNYFDRFLF-SFQSQ  125

Query  591   TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWK  770
             ++KPW++ LAAV+CLSLAAKVEET VPLLLD QVEES Y+FE +TIQRMELLVL+ L+WK
Sbjct  126   SEKPWLNHLAAVSCLSLAAKVEETQVPLLLDLQVEESRYLFEPRTIQRMELLVLTTLKWK  185

Query  771   MNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS-IISDCRFMCYLPSVMASATMLH  947
             MNPVTP SFLDY +RRL L +H+  E LRRCE VLLS II+D RFMCYLPS MA+ATMLH
Sbjct  186   MNPVTPLSFLDYFSRRLGLNNHIYYELLRRCERVLLSTIIADFRFMCYLPSTMAAATMLH  245

Query  948   VISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPK  1127
             VI RL P +GEE QEQL+GILGI K KV +C +LI+EVAS I F S  ++  GA+PGSP 
Sbjct  246   VIDRLEPCIGEEYQEQLLGILGIVKDKVTDCYRLIQEVASNIDFNSNKRKSIGALPGSPI  305

Query  1128  GVM  1136
             GVM
Sbjct  306   GVM  308



>gb|ABK95220.1| unknown [Populus trichocarpa]
Length=379

 Score =   332 bits (851),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 221/303 (73%), Gaps = 8/303 (3%)
 Frame = +3

Query  243   FLFDALYCEEEG------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
              L+DALYC EE       E   Q + +          +     + LEQDL WED ELSSL
Sbjct  24    LLYDALYCSEENWVEEVREDCFQDELEGESYCSNNSNKLNTFPIFLEQDLSWEDEELSSL  83

Query  405   LSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
              +KE++N+L   ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F S+ 
Sbjct  84    FAKEEQNQLCKDLETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF-SVH  142

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q +KPWM+QLAAV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+LVLS L+
Sbjct  143   LQKEKPWMAQLAAVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEILVLSTLK  202

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKMNPVTP SFLDYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+ATML
Sbjct  203   WKMNPVTPISFLDYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPSVMAAATML  262

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGAMPGS  1121
             + I  + P++  E Q QL+  LGIDK KVE+C K + E A R  F+  + KRK+ ++PGS
Sbjct  263   YGIDNIEPSLAAEYQSQLLSSLGIDKDKVEDCSKFLMEFALRDHFKLLSNKRKFCSLPGS  322

Query  1122  PKG  1130
             P G
Sbjct  323   PSG  325



>ref|NP_001280982.1| cyclin-D3-1-like [Malus domestica]
 gb|ADD51364.1| D3-type cyclin [Malus domestica]
Length=376

 Score =   329 bits (844),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 230/318 (72%), Gaps = 15/318 (5%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEE---GEHWGQADRDP-------SCSIeeqeeeeeesvvlleqDL  374
             E Q   FL DALYC E    GE     D  P       S +         ++ +L+EQDL
Sbjct  14    EEQNPVFLLDALYCSEVHLVGEQVSPVDYFPEEELVEDSFNSNVSSFNPIKAPILVEQDL  73

Query  375   LWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              W++ EL SLLSKE E NEL   +Q +P LA AR EAV+W+L+V SHYSFSA TA+LA +
Sbjct  74    FWDNEELISLLSKESEQNELQKPLQISPSLAGARREAVDWMLRVASHYSFSALTAVLAAD  133

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  SL+ Q +KPWM+QLAAVAC+SLAAKVEET VPLLLDFQVE+S+YVFEA+TI+
Sbjct  134   YFDR-FLSSLQLQVEKPWMTQLAAVACISLAAKVEETQVPLLLDFQVEDSKYVFEARTIK  192

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RME+LVLS L+W+MNPVTP SF+DYI RRL LK+HLC E L+RCE +LL++ISD RFM +
Sbjct  193   RMEILVLSTLQWRMNPVTPISFIDYITRRLGLKNHLCWEVLKRCELILLNLISDSRFMYF  252

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES--  1085
             LPSV+A+ATMLHV+  + P +  E Q QL+GILGI+K KV++C KLI E+ S     S  
Sbjct  253   LPSVVATATMLHVVKNMEPCLLIEYQTQLLGILGINKDKVDDCCKLISELTSSGGNGSGK  312

Query  1086  -AYKRKYGAMPGSPKGVM  1136
              + KRK+G++PGSP GVM
Sbjct  313   QSNKRKFGSVPGSPSGVM  330



>ref|XP_002510161.1| cyclin d, putative [Ricinus communis]
 gb|EEF52348.1| cyclin d, putative [Ricinus communis]
Length=378

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 229/318 (72%), Gaps = 13/318 (4%)
 Frame = +3

Query  225   EPQKLP-FLFDALYCEEEG-------EHWGQADR--DPSC--SIeeqeeeeeesvvlleq  368
             E Q  P FL DALYC EE        E + Q  +  +  C  +    ++ +   V++LEQ
Sbjct  15    EYQPTPTFLNDALYCSEENWEDEEVREDYFQEQQLAESFCFNTTSRNKKPDFSPVLVLEQ  74

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED ELS L +KE++N+L+  ++ N  L ++R EAVEW+LKV +HYSF+  TA+LAV
Sbjct  75    DLCWEDEELSCLFTKEEQNQLYKKLETNSSLTESRREAVEWMLKVNAHYSFTPLTAVLAV  134

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR  F S   QT+KPWM+QLAAVACLSLAAKVEET VPLLLD QVE+S+YVFEAKTI
Sbjct  135   NYLDRFLF-SFHIQTEKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVEDSKYVFEAKTI  193

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRME+LVLS L+W+MNPVTP SF DY+ RRL LK+++C EFLRRCE ++LSIISD R M 
Sbjct  194   QRMEILVLSTLQWRMNPVTPLSFFDYVTRRLGLKNYICWEFLRRCELIVLSIISDTRCMR  253

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             YLPSV+A+A MLHVI+ + P +G + + QL+GIL IDK KV +C  L+ E  S      +
Sbjct  254   YLPSVIAAAAMLHVINSIKPCLGAKFESQLLGILAIDKDKVNDCTILVLESLSTEHDRQS  313

Query  1089  YKRKYGAMPGSPKGVMEV  1142
              KRK+ + PGSP GVM+V
Sbjct  314   NKRKFASDPGSPSGVMDV  331



>ref|XP_010101662.1| hypothetical protein L484_006781 [Morus notabilis]
 gb|EXB89228.1| hypothetical protein L484_006781 [Morus notabilis]
Length=366

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 210/263 (80%), Gaps = 9/263 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQE--NEL--FNV-VQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             DL+W+D EL SLLSKE++  N++  +N+ +Q NP LA+AR EA++W+LKV +HYSF+A T
Sbjct  62    DLVWDDEELISLLSKEKKMMNQMCDYNIKLQTNPPLAEARKEAIDWMLKVIAHYSFTALT  121

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             A+LAVNYLDR F LS E Q +KPWM+ LA+VACLSLAAKVEET VPLLLDFQVEES+++F
Sbjct  122   AVLAVNYLDR-FLLSFEFQREKPWMTHLASVACLSLAAKVEETEVPLLLDFQVEESKFMF  180

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTI+RMELLVLS LEWKMNPVTP SFLDYI +RL LK HLC E L+RCE ++L +ISD
Sbjct  181   EAKTIKRMELLVLSTLEWKMNPVTPISFLDYIIKRLGLKDHLCWEILKRCENIILFLISD  240

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI  1073
              RFM +LPS++A+ATMLHV+  + P +  E Q QL+GILGIDK K E+C KLI E+AS  
Sbjct  241   SRFMSFLPSIVATATMLHVVDSIEPCLQVEFQNQLLGILGIDKDKAEDCCKLISELASA-  299

Query  1074  QFESAYKRKYG--AMPGSPKGVM  1136
                 + KRK+G   +PGSP GVM
Sbjct  300   NVGQSKKRKFGVVVVPGSPNGVM  322



>gb|AAN87006.1| cyclin D [Populus alba]
Length=289

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/287 (60%), Positives = 216/287 (75%), Gaps = 2/287 (1%)
 Frame = +3

Query  261   YCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQENELFNV  440
             + EE  E W Q + +          +     +LLEQDL WED ELSSL +KE++N+L   
Sbjct  4     WAEEVREDWFQDELEGESYCSNNSNKLNTFPILLEQDLSWEDEELSSLFAKEEQNQLCKD  63

Query  441   VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLA  620
             ++ NP LA+AR EAVEW+LKV  HYSF+A TA+LAVNYLDR  F S+  Q +KPWM+QLA
Sbjct  64    LETNPSLARARCEAVEWILKVNEHYSFTALTAVLAVNYLDRFLF-SVHLQKEKPWMAQLA  122

Query  621   AVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFL  800
             AV+CLSLAAKVEET VPLLLDFQVE+S+YVFEAKTIQRME+LVLS L+WKMNPVTP SFL
Sbjct  123   AVSCLSLAAKVEETQVPLLLDFQVEDSKYVFEAKTIQRMEILVLSTLKWKMNPVTPISFL  182

Query  801   DYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGE  980
             DYI RRL L+ +LC EFL+RCE ++LSI++D R M Y+PSVMA+ATML+VI  + P++  
Sbjct  183   DYITRRLGLEHYLCLEFLKRCERMVLSILADSRSMPYVPSVMAAATMLYVIDNIKPSLAA  242

Query  981   ESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-SAYKRKYGAMPG  1118
             E Q QL+ ILGIDK KVE+C K + E A R  F+  + KRK+ ++PG
Sbjct  243   EYQSQLLSILGIDKDKVEDCSKFLMEFALREHFKLLSNKRKFCSLPG  289



>ref|XP_007227331.1| hypothetical protein PRUPE_ppa015949mg [Prunus persica]
 gb|EMJ28530.1| hypothetical protein PRUPE_ppa015949mg [Prunus persica]
Length=376

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 232/318 (73%), Gaps = 15/318 (5%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEG--------EHWGQADR---DPSCSIeeqeeeeeesvvlleqD  371
             E Q   FL DALYC EE         E++ + D    D  C       +  +  +LLEQD
Sbjct  14    EEQNPVFLLDALYCSEEHLEEQASVVEYFQEEDEFVGDSCCYSNISSYKPIKVPILLEQD  73

Query  372   LLWEDGELSSLLSKE--QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             L W++ EL SLLSKE  Q  EL   +Q +  ++ AR EAV+W+L+V +H+SFSA TA+LA
Sbjct  74    LFWDNEELISLLSKEAEQNGELQKPLQISSSVSGARKEAVDWMLRVITHFSFSALTAVLA  133

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             V+Y DR FF SL+ Q +KPW +QLAAVACLSLAAKVEET VPLLLDFQVE+S+Y FEA+T
Sbjct  134   VDYFDRFFF-SLQFQIEKPWTTQLAAVACLSLAAKVEETQVPLLLDFQVEDSKYFFEART  192

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             I+RME+LVLS L+WKMNPVTP SF+DYI RRL LK HLC EFL+RCE +LL++ISD RFM
Sbjct  193   IKRMEILVLSTLQWKMNPVTPLSFVDYITRRLGLKHHLCWEFLKRCELILLNLISDSRFM  252

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR-IQFE  1082
              +LPSV+A+ATMLHV++ + P +  E Q QL+GILGIDK KV++C +L+ E++S     +
Sbjct  253   SFLPSVVATATMLHVVNNIEPCLHVEYQNQLLGILGIDKDKVDDCYRLVLELSSSGGHGK  312

Query  1083  SAYKRKYGAMPGSPKGVM  1136
              + KRK+G++PGSP GV+
Sbjct  313   PSNKRKFGSIPGSPNGVI  330



>ref|XP_008220274.1| PREDICTED: cyclin-D3-1-like [Prunus mume]
Length=375

 Score =   327 bits (839),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 232/317 (73%), Gaps = 14/317 (4%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEG--------EHWGQADR--DPSCSIeeqeeeeeesvvlleqDL  374
             E Q   FL DALYC EE         E++ + D     +C       +  +  +LLEQDL
Sbjct  14    EEQNPVFLLDALYCSEEHLEEQASVVEYFQEEDEFVGDNCYSNISSYKPIKVPILLEQDL  73

Query  375   LWEDGELSSLLSKE--QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              W++ EL SLLSKE  Q  EL   +Q +  ++ AR EAV+W+L+V +H+SFSA TA+LAV
Sbjct  74    FWDNEELISLLSKEAEQNGELQKPLQISSSVSGARKEAVDWMLRVITHFSFSALTAVLAV  133

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             +Y DR FF SL+ Q +KPW +QLAAVACLSLAAKVEET VPLLLDFQVE+S+Y FEA+TI
Sbjct  134   DYFDRFFF-SLQFQIEKPWTTQLAAVACLSLAAKVEETQVPLLLDFQVEDSKYFFEARTI  192

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             +RME+LVLS L+WKMNPVTP SF+DYI RRL LK HLC EFL+RCE +LL++ISD RFM 
Sbjct  193   KRMEILVLSTLQWKMNPVTPLSFVDYITRRLGLKHHLCWEFLKRCELILLNLISDSRFMS  252

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR-IQFES  1085
             +LPSV+A+ATMLHV++ + P +  E Q QL+GILGIDK KV++C KL+ E++S     + 
Sbjct  253   FLPSVVATATMLHVVNNIEPCLHVEYQNQLLGILGIDKDKVDDCYKLVLELSSSGGHCKP  312

Query  1086  AYKRKYGAMPGSPKGVM  1136
             + KRK+G++PGSP GV+
Sbjct  313   SNKRKFGSIPGSPNGVI  329



>ref|XP_008360986.1| PREDICTED: cyclin-D3-1-like [Malus domestica]
Length=376

 Score =   327 bits (838),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 228/318 (72%), Gaps = 15/318 (5%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEE---GEHWGQADRDP-------SCSIeeqeeeeeesvvlleqDL  374
             E Q   FL DALYC EE    E     D  P       S        +  ++ + +EQDL
Sbjct  14    EEQNPVFLLDALYCSEEHLVDEQVSAVDYFPEEELVEDSFYSNVSSFKPXKAPIFVEQDL  73

Query  375   LWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              W++ EL SLLSKE E NEL   ++ +P LA AR EAV+W+L+VTSHYSFSA TA+LA +
Sbjct  74    FWDNEELXSLLSKESEQNELQKPLKISPSLAGARREAVDWMLRVTSHYSFSALTAVLAAD  133

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  SL+ Q +KPWM+QLAAVAC+SLAAKVEET VPLL DFQVE+S+YVFE +TI+
Sbjct  134   YFDR-FLSSLQLQVEKPWMTQLAAVACISLAAKVEETQVPLLQDFQVEDSKYVFEDRTIK  192

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RME+LVLS L+WKMNPVTP SF+DYI RRL LK+HLC EFL+RCE +LL++ISD RFM +
Sbjct  193   RMEILVLSTLQWKMNPVTPISFIDYITRRLGLKNHLCWEFLKRCELILLNLISDSRFMXF  252

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS---RIQFE  1082
             LPSV+A+ATMLHV+  + P +  E Q QL+GILGI+K KV++C KLI E+ S   +    
Sbjct  253   LPSVVATATMLHVVXNIEPCLLIEYQTQLLGILGINKDKVDDCCKLISELTSSGGKGNGX  312

Query  1083  SAYKRKYGAMPGSPKGVM  1136
              + KRK+G++P SP GVM
Sbjct  313   QSNKRKFGSVPSSPNGVM  330



>gb|KHG03748.1| CYCD3-2: Cyclin-D3-2 [Gossypium arboreum]
Length=330

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 227/306 (74%), Gaps = 15/306 (5%)
 Frame = +3

Query  240   PFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSK  413
             PF+ D+LYC E+   +H+ +     SC       +     +LLEQD LWED ELSSLLSK
Sbjct  6     PFVIDSLYCSEDTGEDHFVEE----SC-----FNKSNPFPILLEQDFLWEDDELSSLLSK  56

Query  414   EQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
             E++++++N +Q N +LA AR  AV+W+LKVT+H+SFSA TA+LAVNYLDR  F SL  QT
Sbjct  57    EEQSQMYNCLQTNRNLAVARFTAVDWMLKVTAHHSFSALTAVLAVNYLDRFLF-SLPFQT  115

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
              KPWM+QL AVACLSLAAKVEET VPLLLD QVEES+Y FEAKTIQRME+LVLS L+WKM
Sbjct  116   DKPWMTQLGAVACLSLAAKVEETQVPLLLDLQVEESKYYFEAKTIQRMEILVLSTLQWKM  175

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NP+TP SFLDYIARRL LK H+C EFLRRC+ +LLS+ISD RF+CYLPS MA+A ML V+
Sbjct  176   NPITPISFLDYIARRLGLKGHVCWEFLRRCDQILLSVISDSRFLCYLPSAMATAIMLQVM  235

Query  954   S--RLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA-SRIQFESAYKRKYGAMPGSP  1124
                 L P +  + + QL+  LGI+K KV+E  KLI E+  +R +   + KR++  +P SP
Sbjct  236   DSVELEPNLRVQFENQLLDNLGINKDKVDESCKLIIELTKTREEGNQSKKRRFKWIPESP  295

Query  1125  KGVMEV  1142
              GV+++
Sbjct  296   NGVIDL  301



>gb|EYU36321.1| hypothetical protein MIMGU_mgv1a008989mg [Erythranthe guttata]
Length=356

 Score =   324 bits (830),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 223/301 (74%), Gaps = 8/301 (3%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDL---LWEDGELSSLLSK  413
             F  D+LYCEEE  HW   +     +     + + ES    +  L   LWE  ELSSLL K
Sbjct  10    FFSDSLYCEEE--HWDNVELLMHTTANCLTKCQGESSTNSDPSLFVELWEVDELSSLLHK  67

Query  414   EQENELFNV--VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLES  587
             EQ NEL +   +++NP LA+AR EAVEW+LKV  +YSFSA TA+LAVNYLDR F  S  S
Sbjct  68    EQGNELHDAAGLEQNPSLAEARCEAVEWMLKVVGYYSFSALTAVLAVNYLDR-FLHSFRS  126

Query  588   QTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEW  767
               +KPWM  LAAV+CLSLAAKVEET VPLLLD QVE+S YVFE+KTIQRME+L+L+ LEW
Sbjct  127   HREKPWMIHLAAVSCLSLAAKVEETQVPLLLDLQVEDSMYVFESKTIQRMEILILTTLEW  186

Query  768   KMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLH  947
             KMNPVTP  FL++IARRL LK  LC EFLRRC+ +LLS++SDCRFMCYLPS MA+A ML+
Sbjct  187   KMNPVTPLPFLEHIARRLGLKDALCAEFLRRCDCLLLSLLSDCRFMCYLPSAMATAVMLY  246

Query  948   VISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPK  1127
             VI+ L P  G E Q+QL+ ILG +K KVEEC  LI+EVA+ IQF S  KRK+G++PGSPK
Sbjct  247   VINSLEPCYGVEYQDQLLNILGTNKDKVEECCGLIQEVATSIQFYSCNKRKFGSVPGSPK  306

Query  1128  G  1130
             G
Sbjct  307   G  307



>ref|XP_009360072.1| PREDICTED: cyclin-D3-1-like [Pyrus x bretschneideri]
Length=376

 Score =   322 bits (824),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 226/318 (71%), Gaps = 15/318 (5%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEE---GEHWGQADRDP-------SCSIeeqeeeeeesvvlleqDL  374
             E Q   FL D LYC EE          D  P       S        +  ++ + +EQDL
Sbjct  14    EEQNPGFLLDTLYCSEEHLVDAQVSAVDYFPEEELVEDSFYSNVSSFKPIKAPIFVEQDL  73

Query  375   LWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              W++ EL SL SKE E NEL   +Q +P LA AR EAV+W+L+VTSHYSFSA TA+LA +
Sbjct  74    FWDNEELISLSSKESEQNELQKPLQISPSLAGARREAVDWMLRVTSHYSFSALTAVLAAD  133

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  S + Q +KPWM+QLAAVAC+SLAAKVEET VPLL DFQVE+S+YVFEA+TI+
Sbjct  134   YFDR-FLSSRQLQVEKPWMTQLAAVACISLAAKVEETQVPLLQDFQVEDSKYVFEARTIK  192

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RME+LVLS L+WKMNPVTP SF+DYI RRL LK+HLC EFL+RCE +LL++ISD RFM +
Sbjct  193   RMEILVLSTLQWKMNPVTPISFIDYITRRLGLKNHLCWEFLKRCELILLNLISDSRFMSF  252

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS---RIQFE  1082
             LPSV+A+ATMLHV++ + P +  E + QL+GILGI+K KV+ C KLI E+ S   +   +
Sbjct  253   LPSVVATATMLHVVNNIEPCLLIEYRNQLLGILGINKDKVDACCKLISELTSSGGKGNGK  312

Query  1083  SAYKRKYGAMPGSPKGVM  1136
              + KRK+G++P SP GVM
Sbjct  313   QSNKRKFGSVPSSPNGVM  330



>ref|XP_010244252.1| PREDICTED: cyclin-D3-2 [Nelumbo nucifera]
Length=371

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 198/260 (76%), Gaps = 3/260 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DLLWED EL +LL+KEQ+ + L N+   NP LA AR EAVEW+LKV SHYSFS  TA+LA
Sbjct  61    DLLWEDEELLTLLAKEQQTHHLNNLDTANPSLASARREAVEWMLKVNSHYSFSTLTAVLA  120

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNYLDR F  SL  Q  KPWM+QL AVACLSLAAKVEE   PLLLD QVEE++YVFEAKT
Sbjct  121   VNYLDR-FLSSLNIQRDKPWMTQLTAVACLSLAAKVEEIQAPLLLDLQVEETKYVFEAKT  179

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVLS L WKMNPVTP SF+D+I RRL LK+HL  EFLRRCE +LLSII D  F+
Sbjct  180   IQRMELLVLSTLHWKMNPVTPLSFIDHIIRRLGLKNHLHWEFLRRCERLLLSIIGDPGFV  239

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA-SRIQFE  1082
              YLPS++A+ATMLHVIS + P    E Q QLMG+L I K  V+EC +LI+E+  S     
Sbjct  240   RYLPSILATATMLHVISEVEPCNPVEYQNQLMGVLKISKDTVDECLQLIQELTWSCHGLN  299

Query  1083  SAYKRKYGAMPGSPKGVMEV  1142
              + KRKY +MPGSP GV++V
Sbjct  300   YSRKRKYQSMPGSPNGVIDV  319



>ref|XP_009606822.1| PREDICTED: cyclin-D3-1-like [Nicotiana tomentosiformis]
 dbj|BAE93057.1| cyclin [Nicotiana tabacum]
Length=369

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 211/307 (69%), Gaps = 12/307 (4%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlle-------qDLLWEDGELSS  401
             FL DALYCEEE E WG    D +       E    +            QDL WED EL S
Sbjct  15    FLLDALYCEEEEEKWGDLLDDETIITPLSSELTTTTKPNSLLPLLLLEQDLFWEDEELLS  74

Query  402   LLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             L SKE+E    FN  Q +P L  AR +AVEW+LKV  +Y FSA TA+LA+NY DR F  S
Sbjct  75    LFSKEKETHCWFNSFQDDPLLCSARVDAVEWILKVNGYYGFSALTAILAINYFDR-FLTS  133

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             L  Q  KPWM QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELLVLS+
Sbjct  134   LHYQKDKPWMIQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELLVLSS  193

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+MNPVTP SFLD+I RRL LK+++  EFLRRCE +LLSI++DCRF+ Y+PSV+A+A 
Sbjct  194   LKWRMNPVTPLSFLDHIIRRLGLKNNVHWEFLRRCESLLLSIMADCRFVRYMPSVLATAI  253

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHVI ++ P    E Q QL+G+L I K KV  C +LI EV S+     ++KRKY     
Sbjct  254   MLHVIHQVEPCNSVEYQNQLLGVLKISKEKVNNCFELISEVCSK---PISHKRKYENPSS  310

Query  1119  SPKGVME  1139
             SP GV++
Sbjct  311   SPSGVID  317



>ref|XP_010688588.1| PREDICTED: cyclin-D3-3-like [Beta vulgaris subsp. vulgaris]
Length=379

 Score =   319 bits (818),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 200/262 (76%), Gaps = 6/262 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQE---NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             DL WE+ EL +LLSKE++   N +F  +Q NP LAK+RSEA++W+LKV SHYSFS  TA+
Sbjct  70    DLYWENDELPTLLSKEEDFHKNHIFKTLQSNPSLAKSRSEAIDWMLKVHSHYSFSLNTAI  129

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNY DR  F S + Q +K WM+QL +VACLS+AAK+EET VPLLLDFQVE+S+Y+FEA
Sbjct  130   LAVNYFDRFMF-SFQLQREKQWMTQLVSVACLSIAAKLEETHVPLLLDFQVEDSKYIFEA  188

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRME+LVLS L+WKMNPVT FSFLDYI RR+ LK +LC EFLRRCE +LL  I D R
Sbjct  189   KTIQRMEILVLSTLQWKMNPVTSFSFLDYIIRRISLKGYLCWEFLRRCEKILLCTIWDSR  248

Query  900   FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQ  1076
             F+ Y PSVMA+AT+LHV +   P +G+E   Q++ ILGIDK KV+EC +LI E  A  I 
Sbjct  249   FLRYPPSVMATATILHVFNGFEPCIGDEYHNQVLDILGIDKEKVDECCELILESTAGEIA  308

Query  1077  FESAYKRKYGAMPGSPKGVMEV  1142
               S  KRK   +PGSP GV++V
Sbjct  309   LLSN-KRKSVPVPGSPNGVIDV  329



>ref|XP_002285320.1| PREDICTED: cyclin-D3-3 [Vitis vinifera]
Length=386

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 221/337 (66%), Gaps = 31/337 (9%)
 Frame = +3

Query  195   SSSRKKMPFQEPQKLPFLFDALYCEEEG---------------EHWGQADRD---PSCSI  320
             +   ++ P Q P    FL DALYCEEE                E +G  D D   PS ++
Sbjct  4     NQHHQQTPPQPPNSSSFLLDALYCEEERWEEEEEDECLQEEACEKYGNVDNDGIDPSSTL  63

Query  321   eeqeeeeeesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWV  494
                   E+        DL WED EL SL SKE++           D  LA AR +AVEW+
Sbjct  64    LPLLLLEQ--------DLFWEDEELLSLFSKEEQQASLGAGNGEMDGALAVARRQAVEWM  115

Query  495   LKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPL  674
             +KV +HY FSA TA+LA+NYLDR F  SL  Q  KPWM QLAAV CLSLAAKVEET VPL
Sbjct  116   MKVNAHYGFSAVTAILAINYLDR-FLSSLHFQRDKPWMIQLAAVTCLSLAAKVEETQVPL  174

Query  675   LLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFL  854
             LLD QVE+S+YVFEAKTIQRMELLVLS L+WKMNPVTP SF+D+I RRL LK+HL  EFL
Sbjct  175   LLDLQVEDSKYVFEAKTIQRMELLVLSTLQWKMNPVTPLSFIDHIIRRLGLKTHLHWEFL  234

Query  855   RRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVE  1034
             R CE  LLS+++D RF+ YLPSV+A+ATMLHVI+ + P    E Q QL+GIL IDK KV 
Sbjct  235   RLCERFLLSVVADSRFVRYLPSVLATATMLHVINHVEPCNPIEYQNQLLGILKIDKDKVT  294

Query  1035  ECQKLIKEVASRIQF--ESAYKRKYGAMPGSPKGVME  1139
             EC +LI EV++   +   + +KRKY  +PGSP GVM+
Sbjct  295   ECHQLIVEVSNTHFYAQNNPHKRKYTKIPGSPNGVMD  331



>ref|XP_010270923.1| PREDICTED: cyclin-D3-1-like [Nelumbo nucifera]
Length=379

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 219/317 (69%), Gaps = 29/317 (9%)
 Frame = +3

Query  246   LFDALYC---------------EEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             L DALYC               EE+GE+      +PS             + LLEQDL W
Sbjct  22    LLDALYCEENGWEEEEERATADEEKGENSENNTANPSL----------FPLFLLEQDLFW  71

Query  381   EDGELSSLLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             ED EL SL +KEQ+N  F  N+   +P +  AR EAV W+L+V SHY+FSA T +LAVNY
Sbjct  72    EDEELLSLFTKEQQNHHFIRNLDIGDPSVGSARREAVNWILRVNSHYAFSALTGVLAVNY  131

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR FF S   Q  KPWM+QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTIQR
Sbjct  132   LDR-FFYSFHFQRDKPWMTQLAAVACLSLAAKVEETQVPLLLDLQVEDTKYVFEAKTIQR  190

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L+WKMNPVTP SF+D+I RRL LK+HL   FLR CE +LLS+I+D RF+ YL
Sbjct  191   MELLVLSTLQWKMNPVTPLSFIDHIIRRLGLKNHLHWVFLRSCEQLLLSVIADSRFVRYL  250

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ-FESAY  1091
             PSV+A+ATMLHVI  + P    E Q+QLMG+L I K  V++C +LI+E+ S  Q    + 
Sbjct  251   PSVLAAATMLHVIEEVEPCNPIEYQKQLMGVLKISKDMVDDCYELIRELTSGCQGLNHSR  310

Query  1092  KRKYGAMPGSPKGVMEV  1142
             KRKY ++PGSP GV++V
Sbjct  311   KRKYLSVPGSPNGVIDV  327



>gb|AAM77273.1|AF519810_1 cyclin D3.1 protein [Lagenaria siceraria]
Length=352

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 210/308 (68%), Gaps = 15/308 (5%)
 Frame = +3

Query  240   PFLFDALYCEEEGEHWGQADRD--------PSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             P+  D+LYC E+  HW   D +        P  ++  +      +V     DL WE+ EL
Sbjct  4     PYALDSLYCSED--HWENDDEEEERGFHEQPYSNLTTESSSPILAVAEQ--DLFWENDEL  59

Query  396   SSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
              SL S+E+ NELF  +Q +P LA AR  AV W+LKV +HYSFSA TA+LAV+YLDR F  
Sbjct  60    ISLFSREKPNELFKTIQIDPSLAAARRSAVGWMLKVNAHYSFSALTAVLAVDYLDR-FLS  118

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
                 Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QVE+S Y+FEAKTI++MELLVLS
Sbjct  119   CFHFQRDKPWMSQLAAVACISLAAKVEETQVPLLLDLQVEDSRYLFEAKTIKKMELLVLS  178

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+W+MNPVTPFSF+DYI+RRL  K H+C E L +CE  +LS+I +  FM +LPSVMA+A
Sbjct  179   TLQWRMNPVTPFSFVDYISRRLGFKEHICWEILWQCERTILSVILESDFMSFLPSVMATA  238

Query  936   TMLHVISRL-VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             TMLHV   +  PT+  E   QL+ ILGIDK  VEEC KLI   ASR       KRK G++
Sbjct  239   TMLHVFKAMEEPTLSVEYDSQLLNILGIDKGNVEECCKLISN-ASRRNGNQFKKRKIGSI  297

Query  1113  PGSPKGVM  1136
             PGSP GVM
Sbjct  298   PGSPNGVM  305



>emb|CBI40278.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 220/319 (69%), Gaps = 7/319 (2%)
 Frame = +3

Query  195   SSSRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDL  374
             +   ++ P Q P    FL DALYCEEE     + + D     E         ++LLEQDL
Sbjct  4     NQHHQQTPPQPPNSSSFLLDALYCEEERW--EEEEEDECLQEEAYPSSTLLPLLLLEQDL  61

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              WED EL SL SKE++           D  LA AR +AVEW++KV +HY FSA TA+LA+
Sbjct  62    FWEDEELLSLFSKEEQQASLGAGNGEMDGALAVARRQAVEWMMKVNAHYGFSAVTAILAI  121

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR F  SL  Q  KPWM QLAAV CLSLAAKVEET VPLLLD QVE+S+YVFEAKTI
Sbjct  122   NYLDR-FLSSLHFQRDKPWMIQLAAVTCLSLAAKVEETQVPLLLDLQVEDSKYVFEAKTI  180

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS L+WKMNPVTP SF+D+I RRL LK+HL  EFLR CE  LLS+++D RF+ 
Sbjct  181   QRMELLVLSTLQWKMNPVTPLSFIDHIIRRLGLKTHLHWEFLRLCERFLLSVVADSRFVR  240

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF--E  1082
             YLPSV+A+ATMLHVI+ + P    E Q QL+GIL IDK KV EC +LI EV++   +   
Sbjct  241   YLPSVLATATMLHVINHVEPCNPIEYQNQLLGILKIDKDKVTECHQLIVEVSNTHFYAQN  300

Query  1083  SAYKRKYGAMPGSPKGVME  1139
             + +KRKY  +PGSP GVM+
Sbjct  301   NPHKRKYTKIPGSPNGVMD  319



>ref|XP_010323910.1| PREDICTED: cycD3;2 protein isoform X1 [Solanum lycopersicum]
Length=362

 Score =   313 bits (803),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 208/311 (67%), Gaps = 15/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq-----------DLLWEDG  389
             F  D LYCEEE E WG    D    I        E                  DL WED 
Sbjct  10    FFLDVLYCEEEEEKWGDLLEDEEGVIINPLLLSSEGTTKTNSLLLLPLLLLEQDLFWEDE  69

Query  390   ELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL SL  KE+E    F     +P L  AR + VEW+LKV +HY FSA TA+LA+NYLDR 
Sbjct  70    ELLSLFVKEKETRCCFESFGSDPFLCSARVDVVEWILKVNAHYDFSALTAILAINYLDR-  128

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  SL+ Q  KPWM+QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELL
Sbjct  129   FLSSLQFQKDKPWMTQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELL  188

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS+L+W+MNPVTP SFLD+I RRL LK+++  EFLRRCE +LLS++ DCRF+ Y+PSV+
Sbjct  189   VLSSLKWRMNPVTPLSFLDHIIRRLGLKNNVHWEFLRRCESLLLSVMIDCRFVRYMPSVL  248

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+A MLHVI ++ P    + Q QL+G+L I K  V  C +LI EV+S+    +++KRKY 
Sbjct  249   ATAIMLHVIHQIEPCNAIDYQNQLLGVLKISKENVNNCYELISEVSSKPI--TSHKRKYD  306

Query  1107  AMPGSPKGVME  1139
               P SP GV++
Sbjct  307   ENPSSPSGVID  317



>ref|NP_001234753.1| CycD3;2 protein [Solanum lycopersicum]
 emb|CAB60837.1| CycD3;2 [Solanum lycopersicum]
Length=364

 Score =   313 bits (802),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 208/311 (67%), Gaps = 15/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq-----------DLLWEDG  389
             F  D LYCEEE E WG    D    I        E                  DL WED 
Sbjct  10    FFLDVLYCEEEEEKWGDLLEDEEGVIINPLLLSSEGTTKTNSLLLLPLLLLEQDLFWEDE  69

Query  390   ELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL SL  KE+E    F     +P L  AR + VEW+LKV +HY FSA TA+LA+NYLDR 
Sbjct  70    ELLSLFVKEKETRCCFESFGSDPFLCSARVDVVEWILKVNAHYDFSALTAILAINYLDR-  128

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  SL+ Q  KPWM+QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELL
Sbjct  129   FLSSLQFQKDKPWMTQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELL  188

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS+L+W+MNPVTP SFLD+I RRL LK+++  EFLRRCE +LLS++ DCRF+ Y+PSV+
Sbjct  189   VLSSLKWRMNPVTPLSFLDHIIRRLGLKNNVHWEFLRRCESLLLSVMIDCRFVRYMPSVL  248

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+A MLHVI ++ P    + Q QL+G+L I K  V  C +LI EV+S+    +++KRKY 
Sbjct  249   ATAIMLHVIHQIEPCNAIDYQNQLLGVLKISKENVNNCYELISEVSSKPI--TSHKRKYD  306

Query  1107  AMPGSPKGVME  1139
               P SP GV++
Sbjct  307   ENPSSPSGVID  317



>ref|XP_009769846.1| PREDICTED: cyclin-D3-2-like [Nicotiana sylvestris]
 emb|CAA09853.1| cyclin D3.1 protein [Nicotiana tabacum]
Length=373

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 216/311 (69%), Gaps = 16/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSC-----------SIeeqeeeeeesvvlleqDLLWEDG  389
             FL DALYCEEE E WG    D +            +    +      ++LLEQDL WED 
Sbjct  15    FLLDALYCEEEEEKWGDLVDDETIITPLSSEVTTTTTTTTKPNSLLPLLLLEQDLFWEDE  74

Query  390   ELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL SL SKE+E    FN  Q +  L  AR ++VEW+LKV  +Y FSA TA+LA+NY DR 
Sbjct  75    ELLSLFSKEKETHCWFNSFQDDSLLCSARVDSVEWILKVNGYYGFSALTAVLAINYFDR-  133

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  SL  Q  KPWM QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELL
Sbjct  134   FLTSLHYQKDKPWMIQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELL  193

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS+L+W+MNPVTP SFLD+I RRL L++++  EFLRRCE +LLSI++DCRF+ Y+PSV+
Sbjct  194   VLSSLKWRMNPVTPLSFLDHIIRRLGLRNNIHWEFLRRCENLLLSIMADCRFVRYMPSVL  253

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+A MLHVI ++ P    + Q QL+G+L I+K KV  C +LI EV S+     ++KRKY 
Sbjct  254   ATAIMLHVIHQVEPCNSVDYQNQLLGVLKINKEKVNNCFELISEVCSK---PISHKRKYE  310

Query  1107  AMPGSPKGVME  1139
                 SP GV++
Sbjct  311   NPSHSPSGVID  321



>ref|XP_004291068.1| PREDICTED: cyclin-D3-2-like [Fragaria vesca subsp. vesca]
Length=371

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 222/310 (72%), Gaps = 16/310 (5%)
 Frame = +3

Query  240   PFLFDALYCEEEG-----------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWED  386
             PFL DAL+C E+            E    +    + +     + + +S +LLEQDL W+D
Sbjct  7     PFLLDALFCSEQHLDEEEEEVLDYEFVEDSSLYSNTTSTSFMQTQIKSPILLEQDLFWDD  66

Query  387   GELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
              EL+SLL+KE+ N+   +   +  LA+AR EAV+W+L+V +HYSFSA TA+LAV+YLDR 
Sbjct  67    EELASLLAKEKVNQDRKIKNPSESLARARKEAVDWMLRVNTHYSFSALTAVLAVDYLDRC  126

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F    + Q +KPWM+QLAAVACLS+AAKVEET VPLLLD QVE+S+YVFEAK I RME++
Sbjct  127   FS-RFQFQPEKPWMTQLAAVACLSVAAKVEETQVPLLLDLQVEDSKYVFEAKNISRMEIM  185

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS L+W+MNPVTP SFLDY+ RR  LK HLC EFL+RCE +L+++ISD RF+ +LPSV 
Sbjct  186   VLSTLDWRMNPVTPISFLDYMTRRFGLKDHLCWEFLKRCELILVNLISDSRFLSFLPSVA  245

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+ATMLHV++ + P +  E + QL+ ILGIDK  V++C KLI E++S     S  KRK+G
Sbjct  246   ATATMLHVVNNIEPCLQVEYENQLLSILGIDKGAVDDCSKLIMELSSSW---SRNKRKFG  302

Query  1107  -AMPGSPKGV  1133
              ++PGSP GV
Sbjct  303   SSIPGSPNGV  312



>dbj|BAE93058.1| cyclin [Nicotiana tabacum]
Length=373

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 215/311 (69%), Gaps = 16/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSC-----------SIeeqeeeeeesvvlleqDLLWEDG  389
             FL DALYCEEE E WG    D +            +    +      ++LLEQDL WED 
Sbjct  15    FLLDALYCEEEEEKWGDLVDDETIITPLSSEVTTTTTTTTKPNSLLPLLLLEQDLFWEDE  74

Query  390   ELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL SL SKE+E    FN  Q +     AR ++VEW+LKV  +Y FSA TA+LA+NY DR 
Sbjct  75    ELLSLFSKEKETHCWFNSFQDDSLHCSARVDSVEWILKVNGYYGFSALTAVLAINYFDR-  133

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  SL  Q  KPWM QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELL
Sbjct  134   FLTSLHYQKDKPWMIQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELL  193

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS+L+W+MNPVTP SFLD+I RRL L++++  EFLRRCE +LLSI++DCRF+ Y+PSV+
Sbjct  194   VLSSLKWRMNPVTPLSFLDHIIRRLGLRNNIHWEFLRRCENLLLSIMADCRFVRYMPSVL  253

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+A MLHVI ++ P    + Q QL+G+L I+K KV  C +LI EV S+     ++KRKY 
Sbjct  254   ATAIMLHVIHQVEPCNSVDYQNQLLGVLKINKEKVNNCFELISEVCSK---PISHKRKYE  310

Query  1107  AMPGSPKGVME  1139
                 SP GV++
Sbjct  311   NPSHSPSGVID  321



>ref|XP_004142877.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
 ref|XP_004169740.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
 gb|KGN62482.1| Cyclin D3.1 protein [Cucumis sativus]
Length=359

 Score =   308 bits (790),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 191/260 (73%), Gaps = 4/260 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DLLWE  EL SL S+E+ NELF  +Q +P LA AR  AVEW+LKV +HYSFSA TA+LAV
Sbjct  57    DLLWEKDELISLFSREKPNELFKTIQIDPSLAAARRTAVEWMLKVNAHYSFSALTAVLAV  116

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             +YLDR F      Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QVE+S Y+FEAKTI
Sbjct  117   DYLDR-FLSCFHFQRDKPWMSQLAAVACISLAAKVEETQVPLLLDLQVEDSRYLFEAKTI  175

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             ++MELLVLS L+W+MNPVTPFSF+DYI RRL  K H+C E L +CE  +LS+I +  FM 
Sbjct  176   KKMELLVLSTLQWRMNPVTPFSFVDYITRRLGFKDHMCWEILWQCERTILSVILESDFMS  235

Query  909   YLPSVMASATMLHVISRL-VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
             +LPS MA+ATMLHV   +  P    +   QL+ ILGIDK  VEEC KLI   ASR     
Sbjct  236   FLPSAMATATMLHVFKAMEEPHCSVDYHSQLLNILGIDKGNVEECCKLISN-ASRRNGNQ  294

Query  1086  AYKRKYG-AMPGSPKGVMEV  1142
               KRK+G ++PGSP GVM+V
Sbjct  295   FNKRKFGLSIPGSPNGVMDV  314



>ref|XP_007160883.1| hypothetical protein PHAVU_001G024900g [Phaseolus vulgaris]
 gb|ESW32877.1| hypothetical protein PHAVU_001G024900g [Phaseolus vulgaris]
Length=346

 Score =   307 bits (787),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 208/306 (68%), Gaps = 9/306 (3%)
 Frame = +3

Query  243   FLFDALYCEEEGEHW---GQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSK  413
              L D L+C E+  HW    Q + D    I    E     VVL EQDL W+  ELSSLL+K
Sbjct  8     LLLDTLHCLEDHIHWEEEKQREEDDDY-ISTTPEPNFSDVVLFEQDLFWDTHELSSLLAK  66

Query  414   EQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
             E  N     +  NP LA +R EAVEW+LKV  HYSFS  TALLAVNYLDR  F +   Q 
Sbjct  67    ENLNNPSISLLNNPSLASSRGEAVEWILKVNLHYSFSTLTALLAVNYLDRFLF-TFRFQN  125

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
              KPW++QL AVACLSLAAKVEET VPL +D QV  S+++FEAKT++RME+LVLS L WKM
Sbjct  126   DKPWLTQLVAVACLSLAAKVEETHVPLFVDLQVGGSKHLFEAKTVKRMEILVLSTLGWKM  185

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NPVTP SFLDYI R+L LK HL  EFLRRCE VLLS+ +D RFM YLPSV+A+ATM+ V+
Sbjct  186   NPVTPLSFLDYITRKLGLKGHLGLEFLRRCETVLLSVFADSRFMSYLPSVLATATMMRVV  245

Query  954   SRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAY----KRKYGAMPGS  1121
             S + P +GEE Q+Q++GILGIDK KV+EC ++I EV +    E       KRK+  +  S
Sbjct  246   SVVEPGLGEEYQDQVLGILGIDKEKVKECYRVIMEVVTGKNEEGKRGNLKKRKFECIQCS  305

Query  1122  PKGVME  1139
                VME
Sbjct  306   RNDVME  311



>ref|XP_007136711.1| hypothetical protein PHAVU_009G067600g [Phaseolus vulgaris]
 gb|ESW08705.1| hypothetical protein PHAVU_009G067600g [Phaseolus vulgaris]
Length=374

 Score =   308 bits (789),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 209/321 (65%), Gaps = 19/321 (6%)
 Frame = +3

Query  234   KLPFLFDALYCEEEG--EHWGQADRDPS---------------CSIeeqeeeeeesvvll  362
              L  L D LYC EE   EH G+ + D +                             VL 
Sbjct  14    NLKSLLDTLYCSEEHWEEHVGEDELDQTEDDYLSANNTSNNNTTGGSTIINSVHNPHVLS  73

Query  363   eqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             E D+  ++ EL+SLL KEQ N L   +Q NP L  A  E VEW+L+V +HYSFSA TALL
Sbjct  74    ESDMFCDEQELASLLGKEQHNPLSTCLQTNPALECAHREGVEWMLRVNAHYSFSALTALL  133

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             AVNY DR F  +L  Q  KPWM+ LAAVACLSLAAKVEET VPLLLD QVEE  Y+FEAK
Sbjct  134   AVNYFDR-FLSTLHFQDGKPWMTHLAAVACLSLAAKVEETQVPLLLDLQVEEGRYLFEAK  192

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
             TI+RME+LVLS L WKMNP TP SFLDYI RRL LK HLC EFLR+CEG+L+S++ D R 
Sbjct  193   TIKRMEILVLSTLGWKMNPPTPLSFLDYITRRLGLKDHLCWEFLRKCEGLLVSVLGDWRL  252

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS-RIQF  1079
             M YLPS +ASATM+HV+  + P +  E Q QL GILG DK KV EC+K+++  +    Q 
Sbjct  253   MGYLPSELASATMMHVVKSVKPCLEGEYQRQLSGILGFDKEKVNECRKVLELWSGYGKQG  312

Query  1080  ESAYKRKYGAMPGSPKGVMEV  1142
             +   KRK+ ++PGSP GVME+
Sbjct  313   KQCTKRKFVSIPGSPNGVMEM  333



>ref|XP_008444594.1| PREDICTED: cyclin-D3-3-like [Cucumis melo]
 gb|ADN33726.1| cyclin d3.1 [Cucumis melo subsp. melo]
Length=359

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/260 (61%), Positives = 189/260 (73%), Gaps = 4/260 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WE+ EL SL S+E+ NELF  +  +P LA AR  AVEW+LKV +HYSFSA TA+LAV
Sbjct  57    DLFWENDELISLFSREKPNELFKTIHIDPSLAAARRTAVEWMLKVNAHYSFSALTAVLAV  116

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             +Y DR F      Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QVE+S Y+FEAKTI
Sbjct  117   DYFDR-FLSCFHFQRDKPWMSQLAAVACISLAAKVEETHVPLLLDLQVEDSRYLFEAKTI  175

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             ++MELLVLS L+W+MNPVTPFSF+DYI RRL  K H+C E L +CE  +LS+I +  FM 
Sbjct  176   KKMELLVLSTLQWRMNPVTPFSFVDYITRRLGFKDHMCWEILWQCERTILSVILESDFMS  235

Query  909   YLPSVMASATMLHVISRL-VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
             +LPS MA+ATMLHV   +  P    +   QL+ ILGIDK  VEEC KLI   ASR     
Sbjct  236   FLPSAMATATMLHVFKAMEEPHFSVDYDSQLLDILGIDKGNVEECYKLISN-ASRRNGNQ  294

Query  1086  AYKRKYGAM-PGSPKGVMEV  1142
               KRK+G++ PGSP GVM+V
Sbjct  295   FKKRKFGSLIPGSPNGVMDV  314



>ref|NP_001275275.1| D-type cyclin family 3 subgroup 2 [Solanum tuberosum]
 gb|ABY25839.1| D-type cyclin family 3 subgroup 2 [Solanum tuberosum]
Length=361

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 205/311 (66%), Gaps = 15/311 (5%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq-----------DLLWEDG  389
             FL D LYCEEE E WG    D    I        E                  DL WED 
Sbjct  10    FLLDVLYCEEEEEKWGDLLEDEEGVIINPLLLSSEETTKTNSLLLLPLLLLEQDLFWEDE  69

Query  390   ELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL SL  KE+E    F     +P L  AR + VEW+LK  +HY FSA TA+LA+NYLDR 
Sbjct  70    ELLSLFIKEKETHCCFESFGSDPFLCSARVDVVEWILKANAHYDFSALTAILAINYLDR-  128

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  SL+ Q  KPWM+QLAAV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELL
Sbjct  129   FLSSLQFQKDKPWMTQLAAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELL  188

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS+L+W+MNPVTP SFLD+I RRL LK++   EFLRRCE +LL +++ CRF+ Y+PSV+
Sbjct  189   VLSSLKWRMNPVTPLSFLDHIIRRLGLKNNAHWEFLRRCESLLLFVMTGCRFVRYMPSVL  248

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+A MLHVI ++ P    + Q QL+G+L I K  V  C +LI EV+S+     ++KRKY 
Sbjct  249   ATAIMLHVIHQVEPCNAVDYQNQLLGVLKISKENVNNCYELISEVSSKPII--SHKRKYD  306

Query  1107  AMPGSPKGVME  1139
               P SP GV++
Sbjct  307   ENPSSPSGVID  317



>gb|ACU23762.1| unknown [Glycine max]
Length=381

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/295 (57%), Positives = 209/295 (71%), Gaps = 13/295 (4%)
 Frame = +3

Query  210   KMPFQEPQKLPFLFDALYCEEEGEHWG--QADRDP----SCSIeeqeeeeeesvvlleqD  371
             KM  + P+ L    D LYC ++  HW   Q + D     + +       +  SVV LE D
Sbjct  13    KMAHRYPKPL---LDTLYCLKDHIHWEEEQVEDDEYSSSTTTTITNTNTDTSSVVFLEHD  69

Query  372   LLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
             L W+  ELSSLL+KE +N+L N +QKN  LA +R EAVEW+LKV +HYSFS  TA+LAVN
Sbjct  70    LFWDREELSSLLAKEHQNQLSNTLQKNLVLASSRQEAVEWILKVNAHYSFSTLTAVLAVN  129

Query  552   YLDRLFFLSLESQT---QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             YLDR  F S   Q      PW++QLAAVACLSLAAKVEET VPL +D QVEES+Y+FEAK
Sbjct  130   YLDRFLF-SFRFQNDSNNNPWLTQLAAVACLSLAAKVEETHVPLFVDLQVEESKYLFEAK  188

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
              + RME+LVLS L W+MNPVTP SFLDYI R+L LK +LC EFLRRCE VLLS+ +D RF
Sbjct  189   AVNRMEILVLSALGWQMNPVTPLSFLDYITRKLGLKGYLCLEFLRRCETVLLSVFADSRF  248

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             M YLPSV+A+AT++ V++ +   +G E Q+QL+GILGIDK KVEEC KL+ EV S
Sbjct  249   MGYLPSVVATATVMRVVNIVASRLGVEYQDQLLGILGIDKEKVEECYKLMMEVVS  303



>gb|KHN22485.1| Cyclin-D3-1 [Glycine soja]
Length=368

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 204/283 (72%), Gaps = 10/283 (4%)
 Frame = +3

Query  246   LFDALYCEEEGEHWG--QADRDP----SCSIeeqeeeeeesvvlleqDLLWEDGELSSLL  407
             L D LYC ++  HW   Q + D     + +       +  SVV LE DL W+  ELSSLL
Sbjct  9     LLDTLYCLKDHIHWEEEQVEDDEYSSSTTTTITNTNTDTSSVVFLEHDLFWDREELSSLL  68

Query  408   SKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLES  587
             +KE +N+L N +QKN  LA +R EAVEW+LKV +HYSFS  TA+LAVNYLDR  F S   
Sbjct  69    AKEHQNQLSNTLQKNLVLASSRQEAVEWILKVNAHYSFSTLTAVLAVNYLDRFLF-SFRF  127

Query  588   QT---QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             Q      PW++QLAAVACLSLAAKVEET VPL +D QVEES+Y+FEAK + RME+LVLS 
Sbjct  128   QNDSNNNPWLTQLAAVACLSLAAKVEETHVPLFVDLQVEESKYLFEAKAVNRMEILVLSA  187

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L W+MNPVTP SFLDYI R+L LK +LC EFLRRCE VLLS+ +D RFM YLPSV+A+AT
Sbjct  188   LGWQMNPVTPLSFLDYITRKLGLKGYLCLEFLRRCETVLLSVFADSRFMGYLPSVVATAT  247

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             ++ V++ +   +G E Q+QL+GILGIDK KVEEC KL+ EV S
Sbjct  248   VMRVVNIVASRLGVEYQDQLLGILGIDKEKVEECYKLMMEVVS  290



>ref|XP_010059892.1| PREDICTED: cyclin-D3-3-like [Eucalyptus grandis]
 gb|KCW66357.1| hypothetical protein EUGRSUZ_F00180 [Eucalyptus grandis]
Length=356

 Score =   302 bits (774),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 210/299 (70%), Gaps = 7/299 (2%)
 Frame = +3

Query  246   LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQEN  425
             LFD+LYC EE   W     +    ++  +E+++ +  L +QDL WED EL+ L S+E+ N
Sbjct  15    LFDSLYCSEE--PWDAQGPE----LDVDDEDDDPTAFLADQDLSWEDEELARLASREEPN  68

Query  426   ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPW  605
              L   +  +P LA AR E++ W++K  +   FSA TA+LAV+YLDR F      Q + PW
Sbjct  69    PLRRDLAADPCLAGARRESMGWMMKAHARNGFSALTAVLAVDYLDR-FLSGFGPQAENPW  127

Query  606   MSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVT  785
              +QL AVACLSLAAKVEET VP LLD Q EES Y+FEAKTIQ+MELLVLS LEWKMNPVT
Sbjct  128   TTQLTAVACLSLAAKVEETQVPFLLDLQGEESNYLFEAKTIQKMELLVLSTLEWKMNPVT  187

Query  786   PFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLV  965
             P SFLDY ARRL LK HLC EFLRRCE VLL+ +SDCR   YL SVMA+A +LHVI+ L 
Sbjct  188   PISFLDYFARRLGLKGHLCWEFLRRCEEVLLASLSDCRSTSYLASVMATAVVLHVINDLD  247

Query  966   PTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGVMEV  1142
             P +G +  +QL+ ILG+    V+EC KL+ E+AS I+   + KRK+G++PGSP GV++ 
Sbjct  248   PCLGLQCLDQLLPILGMQSDTVDECTKLVSELASAIRGHRSSKRKFGSVPGSPDGVVDA  306



>gb|EYU44438.1| hypothetical protein MIMGU_mgv1a008834mg [Erythranthe guttata]
Length=361

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 213/319 (67%), Gaps = 17/319 (5%)
 Frame = +3

Query  219   FQEPQKLPFLFDALYCEEE---GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             FQ P     +FDAL+CEEE              + S E ++ ++     L + DL WEDG
Sbjct  5     FQNP-----IFDALFCEEERLDDYAAPPPPPAAAASHEIRQTQQSPFTFLFDHDLFWEDG  59

Query  390   ELSSLLSKEQENELFN--------VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             EL++LL+KE+  E  N         +  +  L  AR++ VEW+LKV  +Y F+A TALLA
Sbjct  60    ELAALLAKEEVEEALNRAARSAYDAIGSDGCLKTARNQGVEWMLKVIGYYGFNAITALLA  119

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             V+Y DR F  SL  Q  KPWM QLAAVACLS+AAKVEET VPLLLD QVEES+Y+FEAKT
Sbjct  120   VDYYDR-FVTSLCFQRDKPWMGQLAAVACLSIAAKVEETQVPLLLDLQVEESKYLFEAKT  178

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVLS L+WKMNPVTP SF D+IARR EL ++  CEF RRCE V+LSII+DCR +
Sbjct  179   IQRMELLVLSTLQWKMNPVTPASFFDHIARRFELINNRHCEFSRRCESVILSIITDCRLV  238

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
              YLPSV+A+ATM++VI  L      E Q+QLM +L   K KVE+C KLI +V   +   S
Sbjct  239   AYLPSVIAAATMIYVIRELQTCDALEYQDQLMNVLRASKEKVEDCHKLITDVMDNLSRRS  298

Query  1086  AYKRKYGAMPGSPKGVMEV  1142
               KRK+ ++P SP GV++ 
Sbjct  299   CNKRKHESIPSSPSGVIDA  317



>ref|XP_002283380.1| PREDICTED: cyclin-D3-3 [Vitis vinifera]
Length=372

 Score =   301 bits (770),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 213/319 (67%), Gaps = 24/319 (8%)
 Frame = +3

Query  231   QKLPFLFDALYCEEE-------GE-----HWGQADRDPSCSIeeqeeeeeesvvlleqDL  374
             Q  PF  D LYCEEE       GE        + DR+   S+      E         DL
Sbjct  11    QNAPFFLDGLYCEEERFGDDDDGEVEEASEIEKCDREKKQSLFPLTLLEH--------DL  62

Query  375   LWEDGELSSLLSKE-QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              WED EL SL+SKE Q +  ++ +  +  L  AR++AVEW+LKV +HY FSA TA+LAVN
Sbjct  63    FWEDDELCSLISKEEQAHHCYSGIISDGFLTVARTKAVEWMLKVNAHYGFSALTAVLAVN  122

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  S   Q  KPWMSQLAAV CLSLAAKV+ET VPLLLD QVEE++YVFEAKTIQ
Sbjct  123   YFDR-FLSSSCFQRDKPWMSQLAAVTCLSLAAKVDETDVPLLLDLQVEETKYVFEAKTIQ  181

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RMELLVLS+L+WKMNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D RF+CY
Sbjct  182   RMELLVLSSLQWKMNPVTPISFFDHIIRRLGLKTHLHWEFLERCERLLLSVIADSRFLCY  241

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQFES-  1085
             LPS +A+ATMLH+I+ + P    E Q QL+ +L I K  V++C KLI E + S    ++ 
Sbjct  242   LPSTLATATMLHIITEVEPCNPLEYQNQLLSVLKISKNDVDDCYKLILEFLGSHGHTQNQ  301

Query  1086  AYKRKYGAMPGSPKGVMEV  1142
              +KRK+ ++P SP G+ + 
Sbjct  302   THKRKHLSLPSSPSGIFDA  320



>ref|XP_008238839.1| PREDICTED: cyclin-D3-2 [Prunus mume]
Length=371

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 214/314 (68%), Gaps = 11/314 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEE-----GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWED  386
             QE Q  P  FDAL+CEE      G++ G  +    C +   E++    +VLLE D  WED
Sbjct  8     QELQNSPMAFDALFCEEGLEEDLGDN-GIEEESEGC-VGNMEKQSTFPLVLLENDFFWED  65

Query  387   GELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
              EL+SL+SKE++  + F+    +  L  AR EAVEW+L V +HY FS+ T +LAVNY DR
Sbjct  66    DELASLISKEEQTHVCFSGSISDGPLMAARKEAVEWILSVKAHYGFSSLTTVLAVNYFDR  125

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  SL  Q  KPWMSQLAAVAC+SLAAKVEE  VPLLLD QVE S+YVFEAKTIQRMEL
Sbjct  126   -FIASLRFQRDKPWMSQLAAVACVSLAAKVEEIHVPLLLDLQVESSKYVFEAKTIQRMEL  184

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             LVLS L W+MNPVTP SF D+I RR  LK HL  EFL RCE +LLS+I+D RFMC++PS+
Sbjct  185   LVLSTLGWRMNPVTPNSFFDHIIRRFGLKIHLHWEFLWRCERLLLSVIADSRFMCFMPSI  244

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ--FESAYKR  1097
             +A+ATMLHVI  +      E Q QLM +L + K +V EC KLI E++         ++KR
Sbjct  245   LATATMLHVIDEIEAFNPVEYQSQLMNVLKVSKDRVNECYKLILELSGSYGNIHNQSHKR  304

Query  1098  KYGAMPGSPKGVME  1139
             K+ ++PGSP GV++
Sbjct  305   KHLSVPGSPNGVID  318



>emb|CAN59802.1| hypothetical protein VITISV_038874 [Vitis vinifera]
Length=372

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 208/319 (65%), Gaps = 24/319 (8%)
 Frame = +3

Query  231   QKLPFLFDALYCEEE-------GE-----HWGQADRDPSCSIeeqeeeeeesvvlleqDL  374
             Q  PF  D LYCEEE       GE        + DR+   S+      E         DL
Sbjct  11    QNAPFFLDGLYCEEERFGDDDDGEVEEASEIEKCDREKKQSLFPLTLLEH--------DL  62

Query  375   LWEDGELSSLLSKE-QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
              WED EL SL+SKE Q +  ++ +  +  L  AR++AVEW+LKV +HY FSA TA+LAVN
Sbjct  63    FWEDDELCSLISKEEQAHHCYSGIISDGFLTVARTKAVEWMLKVNAHYGFSALTAVLAVN  122

Query  552   YLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQ  731
             Y DR F  S   Q  KPWMSQLAAV CLSLAAKV+ET VPLLLD QVEE +YVFEAKTIQ
Sbjct  123   YFDR-FLSSSCFQRDKPWMSQLAAVTCLSLAAKVDETDVPLLLDLQVEEXKYVFEAKTIQ  181

Query  732   RMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCY  911
             RMELLVLS+L+WKMNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D RF+CY
Sbjct  182   RMELLVLSSLQWKMNPVTPISFFDHIIRRLGLKTHLHWEFLERCERLLLSVIADSRFLCY  241

Query  912   LPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF--ES  1085
             LPS +A+ATMLH+I+ + P    E Q QL+ +L I K  V++C KLI E           
Sbjct  242   LPSTLATATMLHIITEVEPCNPLEYQNQLLSVLKISKBDVDDCYKLILEFLGXHGHTQNQ  301

Query  1086  AYKRKYGAMPGSPKGVMEV  1142
              +KRK+ ++P SP G+ + 
Sbjct  302   THKRKHLSLPSSPSGIFDA  320



>dbj|BAA76478.1| NtcycD3-1 [Nicotiana tabacum]
Length=368

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 213/308 (69%), Gaps = 10/308 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
              + Q   FL DALYCEEE       D      I E+E      + LLEQDL WED EL S
Sbjct  9     NQDQTQSFLLDALYCEEERWEETIEDE-----ILEKEATLPLPLPLLEQDLFWEDEELLS  63

Query  402   LLSKEQEN-ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             L +KE+E    F  ++ +P L  +R EAV+W+LKV +HY FS  TA+LA+NY DR F  S
Sbjct  64    LFTKEKETISNFETIKTDPLLCLSRKEAVKWILKVNAHYGFSTFTAILAINYFDR-FLSS  122

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             L  Q  KPWM QL AV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELLVLS+
Sbjct  123   LHFQKDKPWMIQLVAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELLVLSS  182

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+MNPVTP SF+D+I RRL LKSH+  EFL++CE +LL +I+DCRF+ Y+PSV+A+AT
Sbjct  183   LKWRMNPVTPLSFVDHIIRRLGLKSHIHWEFLKQCERILLLVIADCRFLSYMPSVLATAT  242

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHVI ++ P    + Q QL+ +L I K KV +C +LI EV+       ++KRKY +   
Sbjct  243   MLHVIHQVEPCNAADYQNQLLEVLNISKEKVNDCYELITEVSYN---SISHKRKYESPIN  299

Query  1119  SPKGVMEV  1142
             SP  V++ 
Sbjct  300   SPSAVIDT  307



>ref|XP_009622041.1| PREDICTED: cyclin-D3-1-like [Nicotiana tomentosiformis]
Length=368

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 213/308 (69%), Gaps = 10/308 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
              + Q   FL DALYCEEE       D      I E+E      + LLEQDL WED EL S
Sbjct  9     NQDQTQSFLLDALYCEEERWEETIEDE-----ILEKEATLPLPLPLLEQDLFWEDEELLS  63

Query  402   LLSKEQEN-ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             L +KE+E    F  ++ +P L  +R EAV+W+LKV +HY FS  TA+LA+NY DR F  S
Sbjct  64    LFTKEKETISNFETIKTDPLLCLSRKEAVKWILKVNAHYGFSTFTAILAINYFDR-FLSS  122

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             L  Q  KPWM QL AV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELLVLS+
Sbjct  123   LHFQKDKPWMIQLVAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELLVLSS  182

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+MNPVTP SF+D+I RRL LKSH+  EFL++CE +LL +I+DCRF+ Y+PSV+A+AT
Sbjct  183   LKWRMNPVTPLSFVDHIIRRLGLKSHIHWEFLKQCERILLLVIADCRFLSYMPSVLATAT  242

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHVI ++ P    + Q QL+ +L I K KV +C +LI EV+       ++KRKY +   
Sbjct  243   MLHVIHQVEPCNAADYQNQLLEVLNISKEKVNDCYELITEVSYN---SISHKRKYESPIN  299

Query  1119  SPKGVMEV  1142
             SP  V++ 
Sbjct  300   SPSAVIDT  307



>ref|XP_011097241.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum]
Length=367

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 208/305 (68%), Gaps = 13/305 (4%)
 Frame = +3

Query  246   LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvl-----leqDLLWEDGELSSLLS  410
             +FDALYCEEE     + D D    +  +E+ +            E DL WED E+ +LLS
Sbjct  16    VFDALYCEEE-----RFDEDLGGGLGLKEDFDGVVREKPFGFLFEHDLFWEDEEIVTLLS  70

Query  411   KE--QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
             KE  Q +  ++ V  +  L   R+E V+W+LKV SHY F+A TA+LAVNY DR F  SL 
Sbjct  71    KEKKQADLSYDDVSSDGCLKMVRNEGVKWMLKVVSHYGFTAMTAVLAVNYYDR-FITSLC  129

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QVEES+YVFEAKTIQRMELLVLS L 
Sbjct  130   FQRDKPWMSQLAAVACLSIAAKVEETQVPLLLDLQVEESKYVFEAKTIQRMELLVLSTLH  189

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             WKM+PVTP SF D+I RR EL ++L  EFLRRCE VLLSII+DCR +CYLPSV+A+ATM 
Sbjct  190   WKMSPVTPISFFDHIVRRFELITNLHWEFLRRCESVLLSIITDCRHVCYLPSVIAAATMK  249

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSP  1124
             +V+  + P    E Q+QLM  L   K  +++C KL+ E+ S    +  +KRK+  +P SP
Sbjct  250   YVVRDIDPCDAVEYQDQLMSALRTSKESIDDCHKLVIEIMSEHSRKLGHKRKHEPIPSSP  309

Query  1125  KGVME  1139
              GV++
Sbjct  310   SGVID  314



>ref|XP_007205384.1| hypothetical protein PRUPE_ppa007350mg [Prunus persica]
 gb|EMJ06583.1| hypothetical protein PRUPE_ppa007350mg [Prunus persica]
Length=371

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 217/317 (68%), Gaps = 14/317 (4%)
 Frame = +3

Query  222   QEPQKL---PFLFDALYCEEE-----GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             +EPQ+L   P  FDAL+CEE      G++ G  +    C +   E++    +VLLE D  
Sbjct  5     EEPQELQNPPMAFDALFCEEGLEEDLGDN-GIEEESEGC-VGNMEKQSTFPLVLLENDFF  62

Query  378   WEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WED EL+SL+SKE++  + F+    +  L  AR EAVEW+L V +HY FS+ T +LAVNY
Sbjct  63    WEDDELASLISKEEQTHVCFSGSISDGPLMAARKEAVEWILSVKAHYGFSSLTTVLAVNY  122

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
              DR F  SL  +  KPWMSQLAAVAC+SLAAKVEE  VPLLLD QVE S+YVFEAKTIQR
Sbjct  123   FDR-FIASLRFRRDKPWMSQLAAVACVSLAAKVEEIHVPLLLDLQVESSKYVFEAKTIQR  181

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L W+MNPVTP SF D+I RR  LK HL  EFL RCE +LLS+I+D RFMC++
Sbjct  182   MELLVLSTLGWRMNPVTPNSFFDHIIRRFGLKIHLHWEFLWRCERLLLSVIADSRFMCFM  241

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ--FESA  1088
             PS++A+ATMLHVI  +      E Q QLM +L + K +V EC KLI E++         +
Sbjct  242   PSILATATMLHVIDEIEAFNPVEYQSQLMNVLKVSKDRVNECYKLILELSGSYGNIHNQS  301

Query  1089  YKRKYGAMPGSPKGVME  1139
             +KRK+ ++PGSP GV++
Sbjct  302   HKRKHLSVPGSPNGVID  318



>gb|KHN12816.1| Cyclin-D3-1 [Glycine soja]
Length=384

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 207/297 (70%), Gaps = 14/297 (5%)
 Frame = +3

Query  210   KMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCS---IeeqeeeeeesvvlleqDLLW  380
             KM  + P+ L    D LYC E+  HW + ++    +             +VVLLE DL W
Sbjct  13    KMAHRYPKPL---LDTLYCLEDHIHWEEEEQQVDYNEYSNTTTTNTNSSNVVLLEHDLFW  69

Query  381   EDGELSSLLSKEQENELFN-VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             +  EL SLL+KE +N+L N ++Q N  LA +R EAVEW+LKV + YSFS  TA+LAVNYL
Sbjct  70    DHEELPSLLAKEHQNQLSNTLLQNNLVLASSREEAVEWILKVNARYSFSTLTAVLAVNYL  129

Query  558   DRLFF-------LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             DR  F        +  +    PW++QL+AVACLSLAAK EET VPL +D QVEES+Y+FE
Sbjct  130   DRFLFSFRFQNDNNDNNNNNNPWLTQLSAVACLSLAAKFEETHVPLFIDLQVEESKYLFE  189

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKT++RME+LVLS L WKMNPVTP SFLDYI R+L LK +LC EFLRRCE VLLS+ +D 
Sbjct  190   AKTVKRMEILVLSTLGWKMNPVTPLSFLDYITRKLGLKGYLCWEFLRRCETVLLSVFADS  249

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             RFM YLPSV+A+AT++ V++ + P +G E Q+QL+GILGIDK KVEEC  L+ EV S
Sbjct  250   RFMGYLPSVLATATVMRVVNTVEPRLGVEYQDQLLGILGIDKEKVEECYNLMMEVVS  306



>gb|KHN45176.1| Cyclin-D3-2 [Glycine soja]
Length=362

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 204/311 (66%), Gaps = 22/311 (7%)
 Frame = +3

Query  246   LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQEN  425
             L D LYC E  E +G    + S +             LL+ D+  ++ EL+SLL KE  N
Sbjct  14    LLDTLYCSEAEEDYGHFLNNSSPA---------SPPFLLQSDMFSDEQELTSLLGKEHHN  64

Query  426   ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPW  605
              L   +Q NP L  AR EAVEW+LKV SHYSFSA TA+L+VNY DR  F S   Q  KPW
Sbjct  65    PLSTCLQTNPALDFARREAVEWILKVNSHYSFSALTAVLSVNYFDRFLF-SFRFQNDKPW  123

Query  606   MSQLAAVACLSLAAKVEETFVPLLLDFQ-VEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             M QLAAVACLS+AAKVEET VP L+D Q V+ES Y+FEAKTI++ME+LVLS L WKMNP 
Sbjct  124   MVQLAAVACLSIAAKVEETHVPFLIDLQQVDESRYLFEAKTIKKMEILVLSTLGWKMNPP  183

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
             TP SFLDY  RRL  K HLC EFL + +GVLLS++ D RFM YLPSV+A+ATM+HV+  +
Sbjct  184   TPLSFLDYFTRRLGSKDHLCWEFLSKSQGVLLSLLGDSRFMSYLPSVLATATMMHVVKSV  243

Query  963   VPTVGEESQEQLMGILGIDK---VKVEECQKLIKEVASRIQF------ESAYKRKY--GA  1109
              P +  E + QL GIL IDK    KV  C KL+ EV S  +       +   KRK+  G+
Sbjct  244   EPGLEAEYKSQLFGILRIDKEKPEKVNSCCKLLLEVWSGYEEEEQEQGKQCMKRKFGIGS  303

Query  1110  MPGSPKGVMEV  1142
             +PGSP GVM+V
Sbjct  304   IPGSPNGVMDV  314



>ref|XP_006487023.1| PREDICTED: cyclin-D3-1-like [Citrus sinensis]
 gb|KDO59793.1| hypothetical protein CISIN_1g017247mg [Citrus sinensis]
Length=375

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 217/315 (69%), Gaps = 27/315 (9%)
 Frame = +3

Query  243   FLFDALYC----------EEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGE  392
             FL DALYC          ++E +   Q +++P+C           S++LLEQDL WED E
Sbjct  12    FLLDALYCEEEELEDEVIDQEDDECSQ-NKNPAC---------LFSLLLLEQDLFWEDEE  61

Query  393   LSSLLSKEQENELFNVVQ---KNPD-LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             L SL SKE++  L    Q   K+ D L  ARSEAVEWVLKV +HY FS  TA+LA+NYLD
Sbjct  62    LLSLFSKEEQQLLKQETQTHYKDSDVLVVARSEAVEWVLKVNAHYGFSTLTAILAINYLD  121

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F  S   Q  KPWM QL AV CLSLAAKVEET VPLLLD QVE ++YVFE K IQRME
Sbjct  122   R-FLRSFHFQIDKPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEGAKYVFETKAIQRME  180

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LLVLS LEWKM+PVTP SFLD+I RRL LK+ L  EFL+RCE +LL+++SD R + YLPS
Sbjct  181   LLVLSTLEWKMHPVTPISFLDHIIRRLGLKTSLHWEFLKRCERLLLTLVSDSRSVSYLPS  240

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA--YK  1094
             V+A+ATM+H+I ++ P    + Q QL+G+L I K KV +C KLI E+A+     ++  +K
Sbjct  241   VLATATMMHIIDQVEPVNPVDYQNQLLGVLKISKEKVSDCYKLILELANAKTNANSNPHK  300

Query  1095  RKYGAMPGSPKGVME  1139
             RK+ A+PGSP GV++
Sbjct  301   RKFEAIPGSPGGVID  315



>ref|XP_006422956.1| hypothetical protein CICLE_v10028675mg [Citrus clementina]
 gb|ESR36196.1| hypothetical protein CICLE_v10028675mg [Citrus clementina]
Length=375

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 217/315 (69%), Gaps = 27/315 (9%)
 Frame = +3

Query  243   FLFDALYC----------EEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGE  392
             FL DALYC          ++E +   Q +++P+C           S++LLEQDL WED E
Sbjct  12    FLLDALYCEEEELEDEVIDQEDDECSQ-NKNPAC---------LFSLLLLEQDLFWEDEE  61

Query  393   LSSLLSKEQENELFNVVQ---KNPD-LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             L SL SKE++  L    Q   K+ D L  ARSEAVEWVLKV +HY FS  TA+LA+NYLD
Sbjct  62    LLSLFSKEEQQLLKQETQTHYKDSDVLVVARSEAVEWVLKVNAHYGFSTLTAILAINYLD  121

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F  S   Q  KPWM QL AV CLSLAAKVEET VPLLLD QVE ++YVFE K IQRME
Sbjct  122   R-FLRSFHFQIDKPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEGAKYVFETKAIQRME  180

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LLVLS LEWKM+PVTP SFLD+I RRL LK+ L  EFL+RCE +LL+++SD R + YLPS
Sbjct  181   LLVLSTLEWKMHPVTPISFLDHIIRRLGLKTSLHWEFLKRCERLLLTLVSDSRSVSYLPS  240

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA--YK  1094
             V+A+ATM+H+I ++ P    + Q QL+G+L I K KV +C KLI E+A+     ++  +K
Sbjct  241   VLATATMMHIIDQVEPVNPVDYQNQLLGVLKISKEKVSDCYKLILELANAKTNANSNPHK  300

Query  1095  RKYGAMPGSPKGVME  1139
             RK+ A+PGSP GV++
Sbjct  301   RKFEAIPGSPGGVID  315



>emb|CDP21104.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 207/305 (68%), Gaps = 12/305 (4%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIe--eqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             F  DALYCEEE   WG  + +   +             + LLEQDL WED EL SL SKE
Sbjct  21    FSLDALYCEEE--KWGDNNNNNGTATNCPSSLFPPPLHLPLLEQDLFWEDEELLSLFSKE  78

Query  417   QENELF----NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
             +E +      N   K+P  + AR EAVEW+LKV ++Y FS  TA+LA+NYLDR F  SL 
Sbjct  79    KETQHLASSGNANAKDPVFSAARREAVEWILKVNAYYGFSTLTAILAINYLDR-FLSSLH  137

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q  KPWM QLA++ CLSLAAKVEE  VPLLLDFQV +S+YVFEAKTIQ+MELL+LS L+
Sbjct  138   YQKDKPWMIQLASLTCLSLAAKVEEIQVPLLLDFQVLDSKYVFEAKTIQKMELLILSTLK  197

Query  765   WKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATML  944
             W+MNPVTP SFLD+I RRL LKSH+  EFLRRCE +LL+++ D  F  YLPSV+A+A ML
Sbjct  198   WRMNPVTPISFLDHIIRRLGLKSHVHWEFLRRCESLLLTVMPDSGFSSYLPSVLATAIML  257

Query  945   HVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSP  1124
             HVI ++ P    + + QL+ +LGI K KV +C + I  ++S     ++ KRKY  +P SP
Sbjct  258   HVIHQVDPYNAIDYENQLLEVLGISKTKVTDCYEAIAVLSST---SNSLKRKYDPVPSSP  314

Query  1125  KGVME  1139
              GVM+
Sbjct  315   LGVMD  319



>ref|XP_008391501.1| PREDICTED: cyclin-D3-2-like [Malus domestica]
Length=364

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 216/316 (68%), Gaps = 12/316 (4%)
 Frame = +3

Query  222   QEPQKL---PFLFDAL-YCEEEGEH----WGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             +EPQ+L   P  FD L +CEE  E      G  +   +C     +++    ++ LE D+ 
Sbjct  5     EEPQELQNPPMAFDPLLFCEEGFEEDLGDNGSEEESENCD-GFSKKQSSFPLIFLESDMF  63

Query  378   WEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WE+ ELSSL+SKE++  + F+    +  L  AR E VEW+L V +HY FS+ TA+LAVNY
Sbjct  64    WENDELSSLISKEEQTHVRFSGEISDGSLMAARKEVVEWILSVKAHYGFSSLTAILAVNY  123

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
              DR F  S   Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QVEE++YVFEAKTIQR
Sbjct  124   FDR-FIASRPFQRDKPWMSQLAAVACVSLAAKVEETHVPLLLDLQVEETKYVFEAKTIQR  182

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L W+MNPVTP S+ D+I RR  LKSHL  EFL RCE +LLS+I+D RF CYL
Sbjct  183   MELLVLSTLGWRMNPVTPNSYFDHIIRRFGLKSHLHWEFLWRCECLLLSVIADLRFTCYL  242

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PSV+A+ATML+VI  +      E Q QLM +L + K +V EC KLI+E+A  ++    +K
Sbjct  243   PSVLATATMLYVIDEIEAFNPVEYQNQLMNVLKVSKDRVNECYKLIQELAGSVE-NQGHK  301

Query  1095  RKYGAMPGSPKGVMEV  1142
             RK+ ++P SP GV++ 
Sbjct  302   RKHLSVPSSPNGVIDA  317



>ref|XP_003523970.1| PREDICTED: cyclin-D3-1-like [Glycine max]
 gb|KHN04476.1| Cyclin-D3-1 [Glycine soja]
Length=349

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 208/315 (66%), Gaps = 18/315 (6%)
 Frame = +3

Query  246   LFDALYCEEEGEHW-GQADRDPS-----------CSIeeqeeeeeesvvlleqDLLWEDG  389
             L D LYC EE  HW G+ + D +            S       E    +LLE D+ W++ 
Sbjct  9     LLDTLYCSEE--HWIGEGEFDQAEEEYGNSNSNSSSTLVNNSPESSPHLLLESDMFWDEQ  66

Query  390   ELSSLLSKEQENELFNV-VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL+SLL KEQ N L    +Q NP L  AR EAVEW+LKV +HYSFSA TA+LAVNY DR 
Sbjct  67    ELASLLEKEQHNPLSTCCLQSNPALEGARIEAVEWILKVNAHYSFSALTAVLAVNYFDRF  126

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQ-VEESEYVFEAKTIQRMEL  743
              F        KPWM++LAAVACLSLAAKV+ET VP L+D Q VEES Y+FEAKTI++ME+
Sbjct  127   LFSFRFQNDIKPWMTRLAAVACLSLAAKVDETHVPFLIDLQQVEESRYLFEAKTIKKMEI  186

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L WKMNP T  SFLDY  RRL LK HL  EFL + EGVLLS+I D RFM YLPSV
Sbjct  187   LILSTLGWKMNPPTSLSFLDYFTRRLGLKDHLFWEFLTKSEGVLLSLIGDSRFMSYLPSV  246

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKY  1103
             +A+ATM+ V+  + P++  E + QL GIL IDK KV  C KL+ E+ S  + +   KRK+
Sbjct  247   LATATMMQVLKSVEPSLEAEYKSQLFGILRIDKEKVNSCCKLMLELWSEFEGKQCMKRKF  306

Query  1104  GA--MPGSPKGVMEV  1142
             G   +PGSP GVM+V
Sbjct  307   GIGWIPGSPNGVMDV  321



>ref|XP_003525909.1| PREDICTED: cyclin-D3-1-like [Glycine max]
Length=362

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 204/311 (66%), Gaps = 22/311 (7%)
 Frame = +3

Query  246   LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQEN  425
             L D LYC E  E +G    + S +             LL+ D+  ++ EL+SLL KE  N
Sbjct  14    LLDTLYCSEAEEDYGHFLNNSSPA---------SPPFLLQSDMFSDEQELTSLLGKEHHN  64

Query  426   ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPW  605
              L   +Q NP L  AR EAVEW+LKV SHYSFSA TA+L+VNY DR  F S   Q  KPW
Sbjct  65    PLSTCLQTNPALDFARREAVEWMLKVNSHYSFSALTAVLSVNYFDRFLF-SFRFQNDKPW  123

Query  606   MSQLAAVACLSLAAKVEETFVPLLLDFQ-VEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             M QLAAVACLS+AAKVEET VP L+D Q V+ES Y+FEAKTI++ME+LVLS L WKMNP 
Sbjct  124   MVQLAAVACLSIAAKVEETHVPFLIDLQQVDESRYLFEAKTIKKMEILVLSTLGWKMNPP  183

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
             TP SFLDY  RRL  K HLC EFL + +GVLLS++ D RFM YLPSV+A+ATM+HV+  +
Sbjct  184   TPLSFLDYFTRRLGSKDHLCWEFLSKSQGVLLSLLGDSRFMSYLPSVLATATMMHVVKSV  243

Query  963   VPTVGEESQEQLMGILGIDK---VKVEECQKLIKEVASRIQF------ESAYKRKY--GA  1109
              P +  E + QL GIL IDK    KV  C KL+ EV S  +       +   KRK+  G+
Sbjct  244   EPGLEAEYKSQLFGILRIDKEKPEKVNSCCKLLLEVWSGYEEEEQEQGKQCMKRKFGIGS  303

Query  1110  MPGSPKGVMEV  1142
             +PGSP GVM+V
Sbjct  304   IPGSPNGVMDV  314



>emb|CAB61223.1| cyclin D3b [Antirrhinum majus]
Length=361

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 214/313 (68%), Gaps = 20/313 (6%)
 Frame = +3

Query  246   LFDALYCEEEGEHW------GQADRDPSCSIeeqeeeeee---svvlleqDLLWEDGELS  398
             +FDAL C EE  H+      G   +DP    +    +++E   +  L E DLLWED EL 
Sbjct  15    IFDALLCNEE--HFDEDLDLGSGLKDPGFINQIHHNQKKEEPFTTFLFEHDLLWEDDELV  72

Query  399   SLLSKEQENE------LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             +LLSKE+E E        +V+  +  L + R+E ++W+LKV  HY F+A TA+LAVNY D
Sbjct  73    NLLSKEKEQEQQAHLGYDDVMDSDGFLKRVRNEGIKWMLKVIGHYGFNAMTAVLAVNYYD  132

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F  ++  Q  KPWMSQLAAVACLS+  KVEET VPLLLDFQVEES+YVFEAKTIQRME
Sbjct  133   R-FITNVGFQKDKPWMSQLAAVACLSV--KVEETQVPLLLDFQVEESKYVFEAKTIQRME  189

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LLVL+ L+WKMNPVTP SF D+I RR EL +++ CEF++RCE V+LSII+D RF+ YLPS
Sbjct  190   LLVLTTLKWKMNPVTPISFFDHIVRRFELMNNVQCEFMKRCESVILSIITDYRFVRYLPS  249

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRK  1100
             V+A+ATM++VI  L P    E Q + + +L   K K ++C  LI EV +   +   +KRK
Sbjct  250   VVAAATMIYVIKELYPCDALEYQNEFVTVLRTSKEKTDDCHMLITEVINNQSYILCHKRK  309

Query  1101  YGAMPGSPKGVME  1139
             YG++P SP GV++
Sbjct  310   YGSIPSSPNGVID  322



>gb|AAQ19972.1| cyclin D3-2 [Euphorbia esula]
Length=355

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 212/309 (69%), Gaps = 12/309 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             ++  ++  +FD LYCEE+G  E +   + D        ++E   S VLLEQDL W D EL
Sbjct  2     EDSTQISLIFDGLYCEEQGIGEDFDDGNED------YVKKELSLSSVLLEQDLFWTDDEL  55

Query  396   SSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
              +L+SKE+E    F     +  L  AR EA++W+L+V   Y F+A + +LAVNY DR F 
Sbjct  56    LNLISKEKETHFSFGDFSSHGSLMVARKEAIDWILRVKGFYGFNALSCVLAVNYFDR-FI  114

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              SL     KPWM QLAAVACLSLAAK+EET VPLLLD QVEES+YVFEAKTI+RMELLVL
Sbjct  115   SSLVFTRDKPWMGQLAAVACLSLAAKMEETQVPLLLDLQVEESKYVFEAKTIKRMELLVL  174

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+MNPVTP  + D+I RRL LK+HL  EFLRRCE +LLS+ISD RFM Y PS++A+
Sbjct  175   STLQWRMNPVTPICYFDHIIRRLGLKNHLHWEFLRRCELLLLSVISDSRFMSYAPSILAT  234

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             + M+HVI  + P    E Q QL+ ++ I+K +V +C KLI E++ +   +  YKRKY + 
Sbjct  235   SIMIHVIKEVDPFSQMEYQNQLLDVIKINKEEVNQCYKLILELSGKQ--DQGYKRKYPSR  292

Query  1113  PGSPKGVME  1139
             PGSP GV++
Sbjct  293   PGSPNGVID  301



>ref|NP_001241910.1| uncharacterized protein LOC100804102 [Glycine max]
 gb|ACU19819.1| unknown [Glycine max]
Length=383

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 206/297 (69%), Gaps = 15/297 (5%)
 Frame = +3

Query  210   KMPFQEPQKLPFLFDALYCEEEGEHWG---QADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             KM  + P+ L    D LYC E+  HW    Q D +   S          +VVLLE DL W
Sbjct  13    KMAHRYPKPL---LDTLYCLEDHIHWEEEEQVDYN-EYSNTTTTNTNSSNVVLLEHDLFW  68

Query  381   EDGELSSLLSKEQENELFN-VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             +  EL SLL+KE +N+L N ++Q N  LA +R EAVEW+LKV + YSFS  TA+LAVNYL
Sbjct  69    DHEELPSLLAKEHQNQLSNTLLQNNLVLASSREEAVEWILKVNARYSFSTLTAVLAVNYL  128

Query  558   DRLFF-------LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             DR  F        +  +    PW++QL+AVACLSL AK EET VPL +D QVEES+Y+FE
Sbjct  129   DRFLFSFRFQNDNNDNNNNNNPWLTQLSAVACLSLTAKFEETHVPLFIDLQVEESKYLFE  188

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKT++RME+LVLS L WKMNPVTP SFLDYI R+L LK +LC EFLRRCE VLLS+ +D 
Sbjct  189   AKTVKRMEILVLSTLGWKMNPVTPLSFLDYITRKLGLKGYLCWEFLRRCETVLLSVFADS  248

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             RFM YLPSV+A+AT++ V++ + P +G E Q+QL+GILGIDK KVEEC  L+ EV S
Sbjct  249   RFMGYLPSVLATATVMRVVNTVEPRLGVEYQDQLLGILGIDKEKVEECYNLMMEVVS  305



>ref|XP_011099096.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum]
Length=370

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 211/306 (69%), Gaps = 12/306 (4%)
 Frame = +3

Query  246   LFDALYCEEE------GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLL  407
             +FDALYCEEE      G  +G   ++P    +  E +++    L E DL WED EL++LL
Sbjct  16    IFDALYCEEERFDECAGGGFGL--KEPEIE-DFNEIQQKPFAFLFEHDLFWEDDELATLL  72

Query  408   SKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             SKE++      +V+  +  L   R+EA++W+LKV   Y F+A TALLAVNY DR F  S 
Sbjct  73    SKEKKQARLTDDVIISDGSLKMVRNEAIKWMLKVIGCYGFNAMTALLAVNYYDR-FVTSR  131

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QVEES+Y+FEAKTIQRMELLVLS L
Sbjct  132   CFQKDKPWMSQLAAVACLSIAAKVEETQVPLLLDLQVEESKYLFEAKTIQRMELLVLSTL  191

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKMNPVTP SF D+IARR EL S+L  EFLRRCE V+LSII+DCR + YLPSV+A+ATM
Sbjct  192   QWKMNPVTPVSFFDHIARRFELISNLHWEFLRRCERVILSIITDCRLVHYLPSVIAAATM  251

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGS  1121
             ++VI  +      E Q QLM +L   K KV+ C KLI E    +   S  KRK+ ++P S
Sbjct  252   MYVIREIENCDAVEYQNQLMSVLRTSKEKVDGCHKLIVEAMDDLNRNSFCKRKHESIPSS  311

Query  1122  PKGVME  1139
             P GV++
Sbjct  312   PSGVID  317



>ref|XP_009367569.1| PREDICTED: cyclin-D3-2 [Pyrus x bretschneideri]
Length=364

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 215/316 (68%), Gaps = 12/316 (4%)
 Frame = +3

Query  222   QEPQKL---PFLFD-ALYCEEEGEH----WGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             +EPQ+L   P  FD +L+CEE  E      G  +   +C     +++    ++ LE D+ 
Sbjct  5     EEPQELQNPPMAFDPSLFCEEGFEEDLGDNGSEEESENCD-GFSKKQSSFPLIFLESDMF  63

Query  378   WEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WE+ ELSSL+SKE++  +  +    +  L  AR E VEW+L V +HY FS+ TA+LAVNY
Sbjct  64    WENDELSSLISKEEQTHVCISGEISDGSLMAARKEVVEWILSVKAHYGFSSLTAILAVNY  123

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
              DR F  S   Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QVEE++YVFEAKTIQR
Sbjct  124   FDR-FITSRPFQRDKPWMSQLAAVACVSLAAKVEETHVPLLLDLQVEETKYVFEAKTIQR  182

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L W+MNPVTP S+ D+I RR  LKSHL  EFL RCE +LLS+I+D RF CYL
Sbjct  183   MELLVLSTLGWRMNPVTPNSYFDHIIRRFGLKSHLHWEFLWRCERLLLSVIADLRFTCYL  242

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PSV+A+ATML+VI  +      E Q QLM +L + K  V EC KLI+E+A  ++    +K
Sbjct  243   PSVLATATMLYVIDEIEAFNPVEYQNQLMNVLKVSKDTVNECYKLIQELAGSVE-NQGHK  301

Query  1095  RKYGAMPGSPKGVMEV  1142
             RK+ ++P SP GV++ 
Sbjct  302   RKHLSVPSSPNGVIDA  317



>ref|XP_009372441.1| PREDICTED: cyclin-D3-2-like [Pyrus x bretschneideri]
Length=369

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 216/315 (69%), Gaps = 12/315 (4%)
 Frame = +3

Query  222   QEPQKL---PFLFDAL-YCEEEGEH----WGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             +EPQ+L   P  FD L +CEE  E      G  +   +C     ++     +V+LE D+ 
Sbjct  5     EEPQELQNPPMAFDLLLFCEEGFEEDLRDNGSDEESENCD-GFSKKHSSFPLVVLESDIF  63

Query  378   WEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WE+ ELSSL+SKE++  + F+    +  L  AR EAVEW+L V +HY FS+ T +LAVNY
Sbjct  64    WENDELSSLISKEEQTHVCFSGEISDGSLMAARKEAVEWILSVKAHYGFSSLTTVLAVNY  123

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
              DR F  S   Q  KPWMSQLAAVAC+SLAAKVEET VPLLLD QV+ES+YVFEAKTIQR
Sbjct  124   FDR-FIASRPFQRDKPWMSQLAAVACVSLAAKVEETHVPLLLDLQVKESKYVFEAKTIQR  182

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L W+MNPVTP S+ D+I RR  LK HL  EFL RCE +LLS+I+D RF CYL
Sbjct  183   MELLVLSTLAWRMNPVTPNSYFDHIIRRFGLKIHLHWEFLWRCERLLLSVIADSRFTCYL  242

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PSV+A+ATML+VI  +      E Q QLM +L + K +V EC KLI E++ R++ +S +K
Sbjct  243   PSVLATATMLYVIDEIEAFNPVEYQNQLMNLLKVSKDRVNECSKLILELSGRVENQS-HK  301

Query  1095  RKYGAMPGSPKGVME  1139
             RK+ ++P SP GV+ 
Sbjct  302   RKHLSVPSSPNGVIN  316



>gb|AAS48460.1| cyclin D3-2 [Euphorbia esula]
Length=355

 Score =   292 bits (747),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 212/309 (69%), Gaps = 12/309 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             ++  ++  +FD LYCEE+G  E +   + D        ++E   S VLLEQDL W D EL
Sbjct  2     EDSTQISLIFDGLYCEEQGIVEDFDDGNED------YVKKELSLSSVLLEQDLFWTDDEL  55

Query  396   SSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
              +L+SKE+E+   F     +  L  AR EA++W+L+V   Y F+A + +LAVNY DR F 
Sbjct  56    LNLISKEKESHFSFGNFSSDGSLMVARKEAIDWILRVKGFYGFNALSCVLAVNYFDR-FI  114

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              SL     KPWM QLAAVACLSLAAK+EET VPLLLD QVEES+YVFEAKTI+RMELLVL
Sbjct  115   SSLVFTRDKPWMGQLAAVACLSLAAKMEETQVPLLLDLQVEESKYVFEAKTIKRMELLVL  174

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+MNPVTP  + D+I RRL LK+HL  EFLRRCE +LLS+ISD RFM Y PS++A+
Sbjct  175   STLQWRMNPVTPICYFDHIIRRLGLKNHLHWEFLRRCELLLLSVISDSRFMSYAPSILAT  234

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
               M+HVI  + P    E Q QL+ ++ I+K +V +C KLI E++ +   +  +KRKY + 
Sbjct  235   LIMIHVIKEVDPFSQMEYQNQLLDVIKINKEEVNQCYKLILELSGKQ--DQGFKRKYPSR  292

Query  1113  PGSPKGVME  1139
             PGSP GV++
Sbjct  293   PGSPNGVID  301



>ref|XP_009788121.1| PREDICTED: cyclin-D3-1-like [Nicotiana sylvestris]
Length=358

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 213/308 (69%), Gaps = 11/308 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
              + Q   FL DALYCEEE       D         +E+     + LLEQDL WE+ EL S
Sbjct  9     NQEQTQSFLLDALYCEEERWEESLEDE------ISEEKTRSFPLPLLEQDLYWENEELLS  62

Query  402   LLSKEQEN-ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             L +KE+E    F+ ++ +P L  AR+EAV+W+LKV +HY FS  TA+LA+NY DR F  S
Sbjct  63    LFTKEKETISNFDTIKTDPLLCLARNEAVKWILKVNAHYGFSTLTAILAINYFDR-FISS  121

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             +  Q  K WM QL AV CLSLAAKVEET VPLLLDFQVE+++YVFEAKTIQRMELLVLS+
Sbjct  122   VHFQKDKAWMIQLVAVTCLSLAAKVEETQVPLLLDFQVEDAKYVFEAKTIQRMELLVLSS  181

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+MNPVTP SFL +I RRL LKSH+  EFL++CE +LL +I+DCRF+CY+PSV+A+AT
Sbjct  182   LKWRMNPVTPLSFLGHIIRRLGLKSHIHWEFLKQCERLLLLVIADCRFLCYMPSVLATAT  241

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPG  1118
             MLHVI ++ P    + Q QL+ +L I K KV +C +LI E++       ++KRKY +   
Sbjct  242   MLHVIHQVEPCNAVDYQNQLLEVLNISKEKVNDCYELITELSYN---SISHKRKYESPIN  298

Query  1119  SPKGVMEV  1142
             SP  V++ 
Sbjct  299   SPSSVIDT  306



>ref|XP_007047384.1| D3-type cyclin isoform 2, partial [Theobroma cacao]
 gb|EOX91541.1| D3-type cyclin isoform 2, partial [Theobroma cacao]
Length=368

 Score =   291 bits (744),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 211/309 (68%), Gaps = 6/309 (2%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEE--GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             Q+ Q  P + D LYCEEE  GE   + +    C  E  ++E    +  +E DL WED  L
Sbjct  9     QQIQSPPLILDGLYCEEEDLGECSFEENGSQICG-ETVKKEAFLPLFFIEHDLFWEDDAL  67

Query  396   SSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
              SL+SKE+E  L +  V  +  L  AR EA+EW+ KV + Y+F+A T +LAVNY DR F 
Sbjct  68    LSLMSKEKETHLGYIAVNSDESLVLARKEALEWIFKVKALYAFNALTIVLAVNYFDR-FI  126

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              SL+ Q  KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVF++KTIQRMELLVL
Sbjct  127   SSLKFQKDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEESKYVFDSKTIQRMELLVL  186

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+MNPVTP SF D+I RRL L++HL  EFLRRCE +LL +I+D RFM Y+PS++A+
Sbjct  187   STLQWRMNPVTPISFFDHITRRLGLRTHLHWEFLRRCERLLLFLIADSRFMLYIPSILAA  246

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGA  1109
             ATMLHVI  + P    E Q+QL+G+L   + KV  C KLI   + S  +    +KRK+ +
Sbjct  247   ATMLHVIKEVEPCHYLEYQKQLIGVLKTCEDKVNACYKLILGLLESHCKGNEGHKRKHRS  306

Query  1110  MPGSPKGVM  1136
             +P SP  V+
Sbjct  307   IPSSPNDVI  315



>ref|XP_010540382.1| PREDICTED: cyclin-D3-3-like [Tarenaya hassleriana]
Length=363

 Score =   290 bits (743),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 212/312 (68%), Gaps = 12/312 (4%)
 Frame = +3

Query  222   QEPQKLPFLF--DALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW-EDGE  392
             QEPQ  P LF  D+LYC EE         + S S+    +++   V + + DLLW ED E
Sbjct  18    QEPQLKPPLFCRDSLYCCEESWEELGEHEEESFSVVNGGDDDLFPVSVGQ-DLLWCEDEE  76

Query  393   LSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             LS+LLSKE+       ++ +P L +AR EAV+W+L+V SHYSFSA TALLAVNY DR FF
Sbjct  77    LSALLSKEE----LKTLEPDPCLNQARIEAVDWILRVVSHYSFSALTALLAVNYFDR-FF  131

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
               +  Q +KPWMSQL AVACLSLAAKVEE  VPLLLD QVEES+Y+FEAK I +ME+LVL
Sbjct  132   SDIHFQAEKPWMSQLTAVACLSLAAKVEEVDVPLLLDIQVEESKYMFEAKAIHKMEILVL  191

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+M+PVT  SFLDY   RL LK  L  E  RRCE VL+S+ISD RF+ YLPSVMA+
Sbjct  192   SALQWRMHPVTALSFLDYFIMRLGLKDFLSSELARRCELVLISVISDSRFLLYLPSVMAT  251

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA-SRIQFESAYKRKYG-  1106
             ATMLHVIS   P++ E  + QL G+  ID  KV++C +L+KE A +        KRK+G 
Sbjct  252   ATMLHVISSFAPSLTELYRNQLKGMAKIDMEKVDKCLELMKEAAPASRHGNQTNKRKFGL  311

Query  1107  -AMPGSPKGVME  1139
              A P SP  VME
Sbjct  312   IASPSSPNTVME  323



>dbj|BAE80325.1| cyclin D3-2 [Camellia sinensis]
Length=372

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 219/310 (71%), Gaps = 18/310 (6%)
 Frame = +3

Query  243   FLFDALYCEEE------GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             F+FD LYCEEE      GE +G      +C      E  +  +V LE D  W+D EL SL
Sbjct  19    FVFDGLYCEEEHFEDDLGE-YGLEQGSDNCD-----ENVKGPLVFLEHDWDWDDDELVSL  72

Query  405   LSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             +SKE+E  L  +V+  +  L  AR E+V+W+L+V +HY F+  T +LAVNY DR F  SL
Sbjct  73    ISKEKETHLGLSVLNSDESLMVARRESVDWILRVIAHYGFTVLTTVLAVNYFDR-FISSL  131

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q +KPWMSQL AVACLSLAAKVEET VPLLLDFQVEES++VFEAKTIQRMELLVLS L
Sbjct  132   SFQREKPWMSQLVAVACLSLAAKVEETQVPLLLDFQVEESKFVFEAKTIQRMELLVLSTL  191

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKMNPVTP SF+D+I RR   K++L  EFL RCE +LLS I+D RF CYLPSV+A+ATM
Sbjct  192   QWKMNPVTPLSFVDHIVRRFGFKTNLHLEFLWRCERLLLSAITDSRFGCYLPSVLAAATM  251

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA---SRIQFESAYKRKYGAM  1112
             LHVI  + P+   + Q +LM +L + K KV++C KLI E+    S++Q ++ +KRKY ++
Sbjct  252   LHVIKEVEPSNVLDCQNELMDVLKMSKDKVDDCYKLILELPGNNSQMQCQT-HKRKYQSI  310

Query  1113  PGSPKGVMEV  1142
             P SP GV++V
Sbjct  311   PNSPNGVIDV  320



>ref|XP_011008776.1| PREDICTED: cyclin-D3-3-like [Populus euphratica]
Length=370

 Score =   290 bits (742),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 208/309 (67%), Gaps = 11/309 (4%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleq--DLLWEDGELS  398
             Q L    D LYCEE+G  E +  A  D +  + +Q  ++E+++  +    DL WED EL 
Sbjct  12    QSLALALDGLYCEEDGFGEDYSCALDDETSEVYDQNVKKEQTLSSVLLEEDLFWEDNELL  71

Query  399   SLLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
              L+SKE+E  +   +V  ++  L   R EAVEW L+V +HY FSA T +LAVNY DR F 
Sbjct  72    FLISKEKETHVVFDSVGSRDGSLMVVRREAVEWFLRVKAHYGFSALTGVLAVNYFDR-FI  130

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              S   Q  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTI+RMEL VL
Sbjct  131   SSSRFQRDKPWMGQLAAVACLSLAAKVEETHVPLLLDLQVEDAKYVFEAKTIKRMELWVL  190

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L W+MNPVT  SF D+I RRL LK+HL  EFL RCE +LLS+ISD RFM YLPS++A+
Sbjct  191   STLHWRMNPVTSISFFDHIIRRLGLKTHLHWEFLWRCERLLLSVISDSRFMSYLPSILAT  250

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV-ASRIQFESAYKRKYGA  1109
             ATMLHVI  + P    + Q QLM +L  ++ +V EC KLI E   S+ Q    +KRKY +
Sbjct  251   ATMLHVIKEVEPRNQLQYQTQLMAVLKTNEDEVNECYKLILEQPGSQNQ---RHKRKYLS  307

Query  1110  MPGSPKGVM  1136
              P SP GV+
Sbjct  308   TPNSPNGVI  316



>gb|AFK45806.1| unknown [Lotus japonicus]
Length=390

 Score =   290 bits (743),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 194/263 (74%), Gaps = 7/263 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             DL WED EL+SL SKE  Q    +N V  +P L++ R EAV+W+LKV +HY FSA TA L
Sbjct  76    DLFWEDEELNSLFSKEKIQHQNYYNDVNSDPFLSQPRHEAVKWMLKVNAHYGFSALTATL  135

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             AV Y D  F LS   Q++KPWM QLAAV C+SLAAKVEET VPLLLD QV+++++VFEAK
Sbjct  136   AVTYFDN-FLLSFHFQSEKPWMIQLAAVTCISLAAKVEETQVPLLLDLQVQDAKFVFEAK  194

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
             TI +MELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  EFLRRCE +LLS++ D RF
Sbjct  195   TILKMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHLHWEFLRRCEHLLLSVLLDSRF  254

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE  1082
             +  LPSV+A+ATMLHVI ++  + G E ++QL+G+L I+K KV+EC   + E+ +   ++
Sbjct  255   VGVLPSVLATATMLHVIDQIEKSDGVEYKKQLLGVLKINKGKVDECYDAMLELTNANDYD  314

Query  1083  SA---YKRKY-GAMPGSPKGVME  1139
                   KRKY   +PGSP GV++
Sbjct  315   DNKKLNKRKYEEIIPGSPSGVID  337



>dbj|BAH15074.1| cyclin D3 [Ipomoea batatas]
Length=361

 Score =   290 bits (741),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 212/308 (69%), Gaps = 22/308 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQA-DRDPSCS----IeeqeeeeeesvvlleqDLLWEDGELSSLLSK  413
             FDALYCEEE   WG+  D + S S    I  +E+ +   + LL+QDL WED EL SL +K
Sbjct  10    FDALYCEEE--QWGEVLDSEGSGSEVSEIPRKEDSDSPVLFLLDQDLCWEDEELLSLFAK  67

Query  414   EQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
             E +  L         L+  R++AV W+LKV +HY FS  T  LAVNYLDR F   L+ Q 
Sbjct  68    ETDTHL----SFEASLSIPRTQAVRWILKVNAHYGFSPLTPTLAVNYLDR-FLSGLQYQE  122

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
              KPWM QLAAVACLSLAAKVEET VPLLLDFQVE++E+VF+AKTIQ+MELLVLS L+W+M
Sbjct  123   DKPWMIQLAAVACLSLAAKVEETHVPLLLDFQVEDAEFVFDAKTIQKMELLVLSTLKWRM  182

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
             NPVTP SFLD+I RRL LK+HL  EF  +CE ++LS + D RF+ +LPSV+A+ATMLHVI
Sbjct  183   NPVTPLSFLDHITRRLGLKNHLHWEFFTKCESLILSFMPDSRFVRFLPSVLATATMLHVI  242

Query  954   SRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM------P  1115
              +L P+   + Q QL+G+L I K KV +C +LIKE++S     ++ KR Y  +      P
Sbjct  243   HQLEPSNAVDYQNQLLGVLKISKEKVNDCYELIKELSST----ASNKRSYSNLLCLLHDP  298

Query  1116  GSPKGVME  1139
              SP  V++
Sbjct  299   NSPSAVID  306



>ref|XP_008452603.1| PREDICTED: cyclin-D3-3-like [Cucumis melo]
Length=349

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 193/291 (66%), Gaps = 6/291 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
              L D+LYC E+    G +   P       +        +   D  WED EL+SL SKE  
Sbjct  25    LLLDSLYCFEDEIEDGHSQSQPKFQPFSIDLNINSPNSVFLSD--WEDDELASLFSKENR  82

Query  423   NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKP  602
             N+L N +  NP LA ARS+AV+W+LKV SH+SF+A TA+LAV+Y+DR F  +     +KP
Sbjct  83    NKLHNALPHNPSLAAARSKAVDWILKVNSHHSFTAHTAVLAVDYVDR-FLSTPHFHIEKP  141

Query  603   WMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             WM+ L A+A LSLAAKVEET VPLLLD QVEE+EY FEAKTI RME+LVLS L W+MNPV
Sbjct  142   WMTHLTAIASLSLAAKVEETQVPLLLDLQVEENEYFFEAKTITRMEILVLSTLLWRMNPV  201

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
              P SFLDYI RRL  K  LC E L +CE +LLS+I DCRF+C+ PSV+A+A +  VI+ +
Sbjct  202   NPLSFLDYIVRRLGFKDQLCSELLCKCEQLLLSVIKDCRFVCFRPSVIATAIIFQVINDI  261

Query  963   VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAY---KRKYG  1106
              P +  +   QLMG L IDK K+EEC + I E +S+ +  + +   KR++G
Sbjct  262   EPHLAAKYHSQLMGFLQIDKDKMEECSRFILEASSKGRQRNEWKNNKRRFG  312



>ref|XP_008361403.1| PREDICTED: cyclin-D3-2-like [Malus domestica]
Length=369

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 215/314 (68%), Gaps = 10/314 (3%)
 Frame = +3

Query  222   QEPQKL---PFLFDAL-YCEE---EGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             +EPQ+L   P  FD L +CEE   E      +D++        +++    +V++E D+ W
Sbjct  5     EEPQELQNPPVAFDLLLFCEEGFEEDLRDNGSDQESENCDGFSKKQSSFPLVVMESDIFW  64

Query  381   EDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             E+ ELSSL+SKE++  + F+    +  L  AR EAVEW+L V +HY FS+ T +LAVNY 
Sbjct  65    ENDELSSLISKEEQTHVCFSGEISDGSLMAARKEAVEWILSVRAHYGFSSLTTVLAVNYF  124

Query  558   DRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRM  737
             DR F  S   Q  K WMSQLAAVAC+SLAAKVEET VPLLLD QVEES+YVFEAKTIQRM
Sbjct  125   DR-FIASRPFQRDKLWMSQLAAVACVSLAAKVEETHVPLLLDLQVEESKYVFEAKTIQRM  183

Query  738   ELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLP  917
             ELLVLS L W+MNPVTP S+ D+I RR  LK HL  EFL RCE +LLS+I+D RF CYLP
Sbjct  184   ELLVLSTLGWRMNPVTPNSYFDHIIRRFGLKIHLHWEFLWRCERLLLSVIADSRFTCYLP  243

Query  918   SVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKR  1097
             SV+A+ATML+VI  +      E Q QLM +L + K +V EC KLI E++  ++ +S +KR
Sbjct  244   SVLATATMLYVIDEIEAFNPXEYQNQLMNLLKVSKDRVNECSKLILELSGSVENQS-HKR  302

Query  1098  KYGAMPGSPKGVME  1139
             K+ ++P SP GV+ 
Sbjct  303   KHLSVPSSPNGVIN  316



>ref|XP_011005820.1| PREDICTED: cyclin-D3-3-like [Populus euphratica]
Length=370

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 212/324 (65%), Gaps = 21/324 (6%)
 Frame = +3

Query  207   KKMPFQEPQKL-----PFLFDALYCEEEGEHWGQADRDPSCSI------eeqeeeeeesv  353
             KKM F + Q         + D LYCEEEG  +G    D SC        +  ++E+  S 
Sbjct  2     KKMSFLQEQDTHRQSPALVLDGLYCEEEG--FGG---DYSCGFDDEICDQNIKKEQTLSS  56

Query  354   vlleqDLLWEDGELSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSA  527
             VLL+QDL WED EL SL+SKE+E  +      + D  L  AR EAVEW L+V +HY FSA
Sbjct  57    VLLQQDLFWEDNELLSLISKEKETHVRFESGGSIDGSLMVARREAVEWFLRVKAHYGFSA  116

Query  528   QTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEY  707
              T +LAVNY DR F  S   Q  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++Y
Sbjct  117   LTGVLAVNYFDR-FISSSRFQRDKPWMGQLAAVACLSLAAKVEETHVPLLLDLQVEDAKY  175

Query  708   VFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSII  887
             +FEAKTI+RMELLVLS L+W+MNPVT  SF D+I RRL LK+HL  EFL RCE +LLS+I
Sbjct  176   IFEAKTIKRMELLVLSTLQWRMNPVTSISFFDHIIRRLGLKTHLHWEFLWRCERLLLSVI  235

Query  888   SDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             SD RFM YLPS++A+ TMLHVI    P    E Q+QLM +L   + +V EC KLI E + 
Sbjct  236   SDSRFMSYLPSILATVTMLHVIKEGDPRNQLEYQKQLMAVLKTSEDEVNECYKLIIERSG  295

Query  1068  RIQFESAYKRKYGAMPGSPKGVME  1139
                     KRKY + P SP GV++
Sbjct  296   SQN--QCLKRKYLSTPSSPNGVID  317



>gb|ABK93388.1| unknown [Populus trichocarpa]
Length=371

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 209/309 (68%), Gaps = 21/309 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq---------DLLWEDGELSS  401
              D LYCEE+G  +G+   D SCS++++  +  E  V  EQ         DL WED EL S
Sbjct  18    LDGLYCEEDG--FGE---DYSCSLDDETSQVYEQNVKKEQNLSSVLLEQDLFWEDNELLS  72

Query  402   LLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+SKE+E      +V  ++  L   R EAVEW L+V +HY FSA T +LAVNY DR F  
Sbjct  73    LISKEKETHFVFDSVGSRDGSLMVVRREAVEWFLRVKAHYGFSALTGVLAVNYFDR-FIS  131

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S   +  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTI+RMEL VLS
Sbjct  132   SSRFRRDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEDAKYVFEAKTIKRMELWVLS  191

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L W+MNPVT  SF D+I RRL LK+H+  EFL RCE +LLS+ISD RFM YLPS++A+A
Sbjct  192   TLHWRMNPVTSISFFDHIIRRLGLKTHMHWEFLWRCERLLLSVISDSRFMSYLPSILATA  251

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAM  1112
             TMLHVI  + P    + Q QLM +L  ++ +V EC KLI ++  S+ Q    +KRKY + 
Sbjct  252   TMLHVIKEVEPRNQLQYQTQLMAVLKTNEDEVNECYKLILEQQGSQNQ---RHKRKYLST  308

Query  1113  PGSPKGVME  1139
             P SP GV++
Sbjct  309   PSSPNGVID  317



>ref|XP_002306487.2| cyclin D3-2 family protein [Populus trichocarpa]
 gb|EEE93483.2| cyclin D3-2 family protein [Populus trichocarpa]
Length=371

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 210/309 (68%), Gaps = 21/309 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq---------DLLWEDGELSS  401
              D LYCEE+G  +G+   D SCS++++  +  E  V  EQ         DL WED EL S
Sbjct  18    LDGLYCEEDG--FGE---DYSCSLDDETSQVYEQNVKKEQNLSPVLLEQDLFWEDNELLS  72

Query  402   LLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+SKE+E  +   +V  ++  L   R EAVEW L+V +HY FSA T +LAVNY DR F  
Sbjct  73    LISKEKETHVVFDSVGSRDGSLMVVRREAVEWFLRVKAHYGFSALTGVLAVNYFDR-FIS  131

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S   +  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTI+RMEL VLS
Sbjct  132   SSRFRRDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEDAKYVFEAKTIKRMELWVLS  191

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L W+MNPVT  SF D+I RRL LK+H+  EFL RCE +LLS+ISD RFM YLPS++A+A
Sbjct  192   TLHWRMNPVTSISFFDHIIRRLGLKTHMHWEFLWRCERLLLSVISDSRFMSYLPSILATA  251

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAM  1112
             TMLHVI  + P    + Q QLM +L  ++ +V EC KLI ++  S+ Q    +KRKY + 
Sbjct  252   TMLHVIKEVEPRNQLQYQTQLMAVLKTNEDEVNECYKLILEQQGSQNQ---RHKRKYLST  308

Query  1113  PGSPKGVME  1139
             P SP GV++
Sbjct  309   PSSPNGVID  317



>emb|CAN88861.1| D3-type cyclin [Populus trichocarpa]
Length=371

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 209/309 (68%), Gaps = 21/309 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq---------DLLWEDGELSS  401
              D LYCEE+G  +G+   D SCS++++  +  E  V  EQ         DL WED EL S
Sbjct  18    LDGLYCEEDG--FGE---DYSCSLDDETSQVYEQNVKKEQNLSPVLLEQDLFWEDNELLS  72

Query  402   LLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+SKE+E      +V  ++  L   R EAVEW L+V +HY FSA T +LAVNY DR F  
Sbjct  73    LISKEKETHFVFDSVGSRDGSLMVVRREAVEWFLRVKAHYGFSALTGVLAVNYFDR-FIS  131

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S   +  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTI+RMEL VLS
Sbjct  132   SSRFRRDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEDAKYVFEAKTIKRMELWVLS  191

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L W+MNPVT  SF D+I RRL LK+H+  EFL RCE +LLS+ISD RFM YLPS++A+A
Sbjct  192   TLHWRMNPVTSISFFDHIIRRLGLKTHMHWEFLWRCERLLLSVISDSRFMSYLPSILATA  251

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAM  1112
             TMLHVI  + P    + Q QLM +L  ++ +V EC KLI ++  S+ Q    +KRKY + 
Sbjct  252   TMLHVIKEVEPRNQLQYQTQLMAVLKTNEDEVNECYKLILEQQGSQNQ---RHKRKYLST  308

Query  1113  PGSPKGVME  1139
             P SP GV++
Sbjct  309   PSSPNGVID  317



>ref|XP_004168271.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
Length=347

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/290 (52%), Positives = 190/290 (66%), Gaps = 5/290 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
              L D+LYC E+    G ++  P                +   D  WED EL SL SKE  
Sbjct  25    LLLDSLYCFEDEIEDGHSNSQPKFQPFSINLNINSPNSVFLSD--WEDDELVSLFSKENG  82

Query  423   NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKP  602
             N+L N +  NP LA ARS+AV W+LKV SHYSFSA TA+LAV+Y+DR F  +     +KP
Sbjct  83    NKLHNTLPHNPSLAAARSKAVHWILKVNSHYSFSAHTAVLAVDYVDR-FLSTPHFHIEKP  141

Query  603   WMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             WM+ L A+A LSLAAKVEET VPLLLD QVEE+EY FEAKTI RME+LVLS L W+MNPV
Sbjct  142   WMTHLTAIASLSLAAKVEETQVPLLLDLQVEENEYFFEAKTITRMEILVLSTLVWRMNPV  201

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
              P SFLDYI RRL  K  LC + L +CE +LLS+I DCRF+C+LPSV+A+A +  VI+ +
Sbjct  202   NPLSFLDYIVRRLGFKDQLCSQLLCKCERLLLSVIIDCRFVCFLPSVLATAIIFQVINDI  261

Query  963   VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--SAYKRKYG  1106
              P +  +   QLMG L IDK K+EEC + I E + + Q +     K+++G
Sbjct  262   EPHLATKYHNQLMGFLQIDKDKMEECSRFILEASWKGQRKEWKNNKQRFG  311



>ref|XP_004141274.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
 gb|KGN55234.1| hypothetical protein Csa_4G641660 [Cucumis sativus]
Length=347

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/290 (52%), Positives = 190/290 (66%), Gaps = 5/290 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
              L D+LYC E+    G ++  P                +   D  WED EL SL SKE  
Sbjct  25    LLLDSLYCFEDEVEDGHSNSQPKFQPFSINLNINSPNSVFLSD--WEDDELVSLFSKENG  82

Query  423   NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKP  602
             N+L N +  NP LA ARS+AV W+LKV SHYSFSA TA+LAV+Y+DR F  +     +KP
Sbjct  83    NKLHNTLPHNPSLAAARSKAVHWILKVNSHYSFSAHTAVLAVDYVDR-FLSTPHFHIEKP  141

Query  603   WMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             WM+ L A+A LSLAAKVEET VPLLLD QVEE+EY FEAKTI RME+LVLS L W+MNPV
Sbjct  142   WMTHLTAIASLSLAAKVEETQVPLLLDLQVEENEYFFEAKTITRMEILVLSTLVWRMNPV  201

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
              P SFLDYI RRL  K  LC + L +CE +LLS+I DCRF+C+LPSV+A+A +  VI+ +
Sbjct  202   NPLSFLDYIVRRLGFKDQLCSQLLCKCERLLLSVIIDCRFVCFLPSVLATAIIFQVINDI  261

Query  963   VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--SAYKRKYG  1106
              P +  +   QLMG L IDK K+EEC + I E + + Q +     K+++G
Sbjct  262   EPHLATKYHNQLMGFLQIDKDKMEECSRFILEASWKGQRKEWKNNKQRFG  311



>emb|CAN88860.1| D3-type cyclin [Populus trichocarpa]
Length=367

 Score =   287 bits (735),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 208/311 (67%), Gaps = 16/311 (5%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEGEHWGQADRDPSCSI------eeqeeeeeesvvlleqDLLWEDGE  392
             Q    + D LYCEEEG  +G+   D SC        +  ++E+  S VLL+QDL WED E
Sbjct  12    QSPALVLDGLYCEEEG--FGE---DYSCGFDDEIGDQNIKKEQTLSSVLLQQDLFWEDNE  66

Query  393   LSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             L SL+SKE+E  +      + D  L  AR EAVEW L+V +HY FSA T +LAVNY DR 
Sbjct  67    LLSLISKEKETHVRFDGGGSIDGSLMVARREAVEWFLRVKAHYGFSALTGVLAVNYFDR-  125

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  S   Q  K WM QLAAVACLSLAAKVEET VPLLLD QVE+++Y+FEAKTI+RMELL
Sbjct  126   FISSSRFQRDKSWMGQLAAVACLSLAAKVEETHVPLLLDLQVEDAKYIFEAKTIKRMELL  185

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS L+W+MNPVT  SF D+I RRL LK+HL  EFL RCE +LLS+ISD RFM YLPS++
Sbjct  186   VLSTLQWRMNPVTSISFFDHIIRRLGLKTHLHWEFLWRCERLLLSVISDSRFMSYLPSIL  245

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG  1106
             A+ TMLHVI    P    E Q QLM +L  ++ +V EC KLI E +        +KRKY 
Sbjct  246   ATVTMLHVIKEGDPRNQLEYQNQLMAVLKTNEDEVNECYKLIIEPSGSQN--QRHKRKYL  303

Query  1107  AMPGSPKGVME  1139
             + P SP GV++
Sbjct  304   STPSSPNGVID  314



>ref|XP_002518702.1| cyclin d, putative [Ricinus communis]
 gb|EEF43627.1| cyclin d, putative [Ricinus communis]
Length=395

 Score =   288 bits (737),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 195/267 (73%), Gaps = 11/267 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFNV--VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTA  536
             DL WEDGEL SL SKE  Q++++FNV  V+K+P L+ A  EAVEW+ KV +HY FSA TA
Sbjct  82    DLFWEDGELLSLFSKEEEQKSQVFNVKNVEKDPSLSTAHQEAVEWMFKVNAHYGFSALTA  141

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNY DR  F S   Q  KPWM QL AV CLS+AAKVEET VPLLLD QVE+++YVFE
Sbjct  142   ILAVNYFDRFLFSSY-YQRDKPWMIQLVAVTCLSIAAKVEETQVPLLLDLQVEDTKYVFE  200

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  EFLRRCE +LL+++S  
Sbjct  201   AKTIQRMELLVLSALKWKMHPVTPLSFLDHIIRRLGLKNHLHWEFLRRCERLLLTVVSVI  260

Query  897   RF-MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR-  1070
                + YLPSV+A+ATM++VI ++ P    + Q QL+G+L + K KV +C +LI E++   
Sbjct  261   YLXISYLPSVLATATMMYVIDQVEPFNPVDYQNQLLGVLKLSKEKVNDCYELILELSKGR  320

Query  1071  ----IQFESAYKRKYGAMPGSPKGVME  1139
                   +  + KRK+  MP SP GV++
Sbjct  321   SNGCYGYNKSNKRKFEPMPSSPSGVID  347



>ref|XP_007047383.1| Cyclin d3,3 isoform 1 [Theobroma cacao]
 gb|EOX91540.1| Cyclin d3,3 isoform 1 [Theobroma cacao]
Length=452

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 211/309 (68%), Gaps = 6/309 (2%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEE--GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             Q+ Q  P + D LYCEEE  GE   + +    C  E  ++E    +  +E DL WED  L
Sbjct  9     QQIQSPPLILDGLYCEEEDLGECSFEENGSQICG-ETVKKEAFLPLFFIEHDLFWEDDAL  67

Query  396   SSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
              SL+SKE+E  L +  V  +  L  AR EA+EW+ KV + Y+F+A T +LAVNY DR F 
Sbjct  68    LSLMSKEKETHLGYIAVNSDESLVLARKEALEWIFKVKALYAFNALTIVLAVNYFDR-FI  126

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              SL+ Q  KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVF++KTIQRMELLVL
Sbjct  127   SSLKFQKDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEESKYVFDSKTIQRMELLVL  186

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+MNPVTP SF D+I RRL L++HL  EFLRRCE +LL +I+D RFM Y+PS++A+
Sbjct  187   STLQWRMNPVTPISFFDHITRRLGLRTHLHWEFLRRCERLLLFLIADSRFMLYIPSILAA  246

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGA  1109
             ATMLHVI  + P    E Q+QL+G+L   + KV  C KLI   + S  +    +KRK+ +
Sbjct  247   ATMLHVIKEVEPCHYLEYQKQLIGVLKTCEDKVNACYKLILGLLESHCKGNEGHKRKHRS  306

Query  1110  MPGSPKGVM  1136
             +P SP  V+
Sbjct  307   IPSSPNDVI  315



>gb|KDP47128.1| hypothetical protein JCGZ_22124 [Jatropha curcas]
Length=375

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 194/268 (72%), Gaps = 13/268 (5%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNV--VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             DL WEDGEL SL SKE+E E   NV  V+ N  L+ AR +AVEW+LKV +HY+FS  TA+
Sbjct  61    DLFWEDGELLSLFSKEKEQETHINVKNVETNSSLSVARLDAVEWMLKVNAHYAFSVLTAI  120

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNYLDR F  S   Q  KPWM QL AV CLSLAAKVEET VPLLLD QVE+++Y+FEA
Sbjct  121   LAVNYLDR-FLSSPYFQQDKPWMIQLVAVTCLSLAAKVEETQVPLLLDLQVEDTKYMFEA  179

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRMELLVLS L+WKM+ VTP SFLD+I RRL LK++L  EF +RCE +LL+++SD R
Sbjct  180   KTIQRMELLVLSTLKWKMHSVTPLSFLDHIIRRLGLKTNLHWEFFKRCEHLLLTVVSDSR  239

Query  900   FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR---  1070
              + YLPSV+A+ATM+HVI ++ P    + Q QL+G+L + K KV++C +LI EV+ R   
Sbjct  240   SISYLPSVLATATMMHVIDQVEPLNSIDYQNQLLGVLKMSKEKVKDCYELILEVSKRKSN  299

Query  1071  -----IQFESAYKRKYG-AMPGSPKGVM  1136
                    +  + KRKY   +P SP GV+
Sbjct  300   YNKNGKSYSYSLKRKYNEPIPSSPSGVI  327



>ref|XP_007143039.1| hypothetical protein PHAVU_007G038400g [Phaseolus vulgaris]
 gb|ESW15033.1| hypothetical protein PHAVU_007G038400g [Phaseolus vulgaris]
Length=393

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 213/332 (64%), Gaps = 26/332 (8%)
 Frame = +3

Query  219   FQEPQKLPFLFDALYC-----EEEGEHWGQADRDPSCSIeeqeeeeees--vvlleqDLL  377
              Q  + +  + DALYC     EEE E       + +C +            ++LLEQDL 
Sbjct  10    LQHNENVSSVLDALYCDEAKWEEEDEDSDVTTNNDACGVHVHHSAGASLFPLLLLEQDLF  69

Query  378   WEDGELSSLLSKE--QENELFNV-------------VQKNPDLAKARSEAVEWVLKVTSH  512
             WED ELSSL SKE  Q  +++               V  NP  ++ R EAVEW+LKV +H
Sbjct  70    WEDEELSSLFSKEKLQHEQVYGCNNLNSDSNDNNNHVHLNPCFSQPRREAVEWMLKVNAH  129

Query  513   YSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQV  692
             Y FSA TA LAV YLDR F LS   Q +KPWM QL AV C+SLAAKVEET VPLLLD QV
Sbjct  130   YGFSALTATLAVTYLDR-FLLSFHFQREKPWMIQLVAVTCISLAAKVEETQVPLLLDLQV  188

Query  693   EESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGV  872
             ++++YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  EFLR CE +
Sbjct  189   QDTKYVFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHLHWEFLRHCEHL  248

Query  873   LLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
             LLS++ D RF+  LPSV+A+ATMLHVI ++  + G E + QL+ +L I K KV+EC   I
Sbjct  249   LLSVLLDSRFVGCLPSVLATATMLHVIDQIEHSGGMEYKNQLLSVLKISKEKVDECYNAI  308

Query  1053  KEVASRIQFESA---YKRKYGAMPGSPKGVME  1139
              + ++   +      YKRKY  +P SP GV++
Sbjct  309   LQRSNANNYGLNNNIYKRKYEEIPDSPSGVID  340



>ref|XP_002310704.2| cyclin D3-2 family protein [Populus trichocarpa]
 gb|EEE91154.2| cyclin D3-2 family protein [Populus trichocarpa]
Length=370

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 212/324 (65%), Gaps = 21/324 (6%)
 Frame = +3

Query  207   KKMPFQEPQKL-----PFLFDALYCEEEGEHWGQADRDPSCSI------eeqeeeeeesv  353
             KKM F + Q         + D LYCEEEG  +G+   D SC        +  ++E+  S 
Sbjct  2     KKMSFLQEQDTHRQSPALVLDGLYCEEEG--FGE---DYSCGFDDEIGDQNIKKEQTLSS  56

Query  354   vlleqDLLWEDGELSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSA  527
             VLL+QDL WED EL SL+SKE+E  +      + D  L  AR EAVEW L+V +HY FSA
Sbjct  57    VLLQQDLFWEDNELLSLISKEKETHVRFDGGGSIDGSLMVARREAVEWFLRVKAHYGFSA  116

Query  528   QTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEY  707
              T +LAVNY DR F  S   Q  K WM QLAAVACLSLAAKVEET VPLLLD QVE+++Y
Sbjct  117   LTGVLAVNYFDR-FISSSRFQRDKSWMGQLAAVACLSLAAKVEETHVPLLLDLQVEDAKY  175

Query  708   VFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSII  887
             +FEAKTI+RMELLVLS L+W+MNPVT  SF D+I RRL LK+ L  EFL RCE +LLS+I
Sbjct  176   IFEAKTIKRMELLVLSTLQWRMNPVTSISFFDHIIRRLGLKTQLHWEFLWRCERLLLSVI  235

Query  888   SDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             SD RFM YLPS++A+ TMLHVI    P    E Q QLM +L  ++ +V EC KLI E + 
Sbjct  236   SDSRFMSYLPSILATVTMLHVIKEGDPRNQLEYQNQLMAVLKTNEDEVNECYKLIIEPSG  295

Query  1068  RIQFESAYKRKYGAMPGSPKGVME  1139
                    +KRKY + P SP GV++
Sbjct  296   SQN--QRHKRKYLSTPSSPNGVID  317



>ref|XP_007017141.1| D3-type cyclin isoform 2 [Theobroma cacao]
 gb|EOY14366.1| D3-type cyclin isoform 2 [Theobroma cacao]
Length=327

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 201/309 (65%), Gaps = 47/309 (15%)
 Frame = +3

Query  231   QKLPFLFDALYCEEEG-------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             Q   F+ DALYC EE        +H+ + + + SC       +     +LLEQDL WED 
Sbjct  6     QNSTFVVDALYCSEENWDEEVGEDHFLEVEEE-SC-YNNGINKSNPFPILLEQDLFWEDD  63

Query  390   ELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLF  569
             ELSSLLSKE++N+L++ +Q N + A AR EAVEW+LKV +HYSFSA TA+LAVNYLDR F
Sbjct  64    ELSSLLSKEEQNQLYDSLQTNGNPAGARREAVEWMLKVNAHYSFSALTAVLAVNYLDR-F  122

Query  570   FLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLV  749
               +   Q +KPWMSQLAAVACLSLAAKVEET VPLLLD QVEE+                
Sbjct  123   LFNFRFQNEKPWMSQLAAVACLSLAAKVEETQVPLLLDLQVEEN----------------  166

Query  750   LSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMA  929
                                  RRL LK HLC EFLRRC  +LLS+ISD RFMCYLPSVMA
Sbjct  167   ---------------------RRLGLKDHLCWEFLRRCGRILLSVISDSRFMCYLPSVMA  205

Query  930   SATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGA  1109
             +ATMLHV+  + P +  E Q QL+GILGIDK KV++C KLI E+A+R+Q   + KR++ +
Sbjct  206   TATMLHVVDSVEPNLRVEYQNQLLGILGIDKEKVDKCCKLIIELATRVQGNQSNKRRFSS  265

Query  1110  MPGSPKGVM  1136
             +PGSP GVM
Sbjct  266   IPGSPNGVM  274



>gb|KHG22908.1| Cyclin-D3-1 -like protein [Gossypium arboreum]
Length=374

 Score =   286 bits (731),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 213/312 (68%), Gaps = 10/312 (3%)
 Frame = +3

Query  228   PQKLP-FLFDALYCEEEGEHWGQADRDPSC-SIeeqeeeeeesvvlleqDLLWEDGELSS  401
             P+  P FL DALYCEEE +     + + SC             ++LLEQDL WEDGEL S
Sbjct  13    PENHPSFLLDALYCEEEADAGEVLEEESSCVGCNNGGNPSFFPLLLLEQDLFWEDGELLS  72

Query  402   LLSKEQENE--LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L +KE E +   FNV   +  LA AR EA EW+LKV + + FS  TA+L++NYLDR F  
Sbjct  73    LFAKETEQQPSCFNV-GTDESLAMARREAAEWMLKVNARFGFSTLTAVLSINYLDR-FLS  130

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             + + Q   PWM QL AV CLSLAAKVEET VPLLLD QVEE++YVFEAKTIQRMELLVLS
Sbjct  131   TFQFQRDNPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEETKYVFEAKTIQRMELLVLS  190

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+WKM+P+TP SFLD+I RRL LK+HL  EFL+RCE +LL +ISD R + YLPSV+A+A
Sbjct  191   TLKWKMHPITPLSFLDHIIRRLGLKTHLHWEFLKRCERLLLCVISDSRSIHYLPSVLATA  250

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE---SAYKRKY-  1103
             TM+HVI ++      + Q QL+ +L I K KV +C KLI +V++R Q +    A KRK  
Sbjct  251   TMMHVIDQVELFNPIDYQNQLLSVLKISKEKVNDCYKLILDVSTRPQAQGNGGACKRKVE  310

Query  1104  GAMPGSPKGVME  1139
               +P SP GV++
Sbjct  311   ERVPSSPSGVID  322



>gb|AAO72990.1| cyclin D [Populus alba]
Length=371

 Score =   285 bits (730),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 209/309 (68%), Gaps = 21/309 (7%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleq---------DLLWEDGELSS  401
              D LYCEE+G  +G+   D SC ++++  +  +  V  EQ         DL WED EL S
Sbjct  18    LDGLYCEEDG--FGE---DYSCGLDDETSQVYDQNVKKEQNLSSVLLEQDLFWEDSELLS  72

Query  402   LLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+SKE+E  +   +V  ++  L   R EAVEW L+V +HY FSA T +LAVNY DR F  
Sbjct  73    LISKEKETHVVFDSVGSRDGSLMVVRREAVEWFLRVKAHYGFSALTGVLAVNYFDR-FIS  131

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S   +  KPWM QLAAVACLSLAAKVEET VPLLLD QVE+++YVFEAKTI+RMEL VLS
Sbjct  132   SSRFRRDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEDAKYVFEAKTIKRMELWVLS  191

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L W+MNPVT  SF D+I RRL LK+H+  EFL RCE +LLS+ISD RFM YLPS++A+A
Sbjct  192   TLHWRMNPVTSISFFDHIIRRLGLKTHMHWEFLWRCERLLLSVISDSRFMSYLPSILATA  251

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAM  1112
             TMLHVI  + P    + Q QLM +L  ++ +V EC +LI ++  S+ Q    +KRKY + 
Sbjct  252   TMLHVIKEVEPRNQLQYQTQLMAVLKTNEDEVNECYRLILEQPGSQNQ---RHKRKYLST  308

Query  1113  PGSPKGVME  1139
             P SP GV++
Sbjct  309   PSSPNGVID  317



>dbj|BAE06272.1| cyclin D [Scutellaria baicalensis]
Length=372

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 210/318 (66%), Gaps = 14/318 (4%)
 Frame = +3

Query  219   FQEPQKL---PFLFDALYCEEEG-----EHWGQADRDPSCSIeeqeeeeeesvvlleqDL  374
             FQE + L   P +FDALYC+EE         G   ++P  + +  E        L E DL
Sbjct  5     FQEHESLLQNP-IFDALYCDEERFDECVGGAGSGFKEPEIN-DFNEIHNNPFAFLFEHDL  62

Query  375   LWEDGELSSLLSKE--QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              WE  EL +LL+KE  Q +  F+ +  +  L   R+EA+ W+LKV +HY F+A TA+LAV
Sbjct  63    FWESEELDALLTKEKTQTHLTFDEINSDASLKAMRNEAINWMLKVIAHYGFNALTAVLAV  122

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S+  Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QVEES+Y+FEAKTI
Sbjct  123   NYYDR-FITSVCFQKDKPWMSQLAAVACLSVAAKVEETQVPLLLDLQVEESKYLFEAKTI  181

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS L+W+MNPVTP SF D+IARR E   +L   FLRRCE ++LSII+DCR + 
Sbjct  182   QRMELLVLSTLQWRMNPVTPISFFDHIARRFEFVKNLHSVFLRRCESLILSIITDCRLVK  241

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQFES  1085
             Y PSV+ASA M++ I         E ++QL+ +L   K KV++C+KLI + +      + 
Sbjct  242   YFPSVIASAAMIYAIREFETPDALEYEDQLLSVLRTSKDKVDDCRKLIVDAMYGGFSHKP  301

Query  1086  AYKRKYGAMPGSPKGVME  1139
              YKRKY ++P SP GV++
Sbjct  302   CYKRKYESIPSSPSGVID  319



>gb|KDP31992.1| hypothetical protein JCGZ_12453 [Jatropha curcas]
Length=365

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 187/258 (72%), Gaps = 4/258 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DL WED EL +L+SKE++    F+ +  +     AR EA++WVL+V +HY F+A T++LA
Sbjct  58    DLFWEDNELLALISKEKDTHFDFHNIFSDGSSMVARKEAIDWVLRVKAHYGFTALTSVLA  117

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNY DR F  +L+    KPWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVFEAKT
Sbjct  118   VNYFDR-FISTLKFPRDKPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEESKYVFEAKT  176

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             ++RMELLVLS L+W+MNPVTP SF D+I RRL LK+HL  EFLRRCE +LLS+I+D RF 
Sbjct  177   MKRMELLVLSTLQWRMNPVTPISFFDHIIRRLGLKNHLHWEFLRRCERLLLSVIADSRFT  236

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
              YLPS+ A+A MLHVI  +      E Q QLM ++ I + KV+EC K I E++      S
Sbjct  237   SYLPSIFATAIMLHVIKEVEACNQVEYQNQLMAVIKISEDKVKECYKHILELSGSQN--S  294

Query  1086  AYKRKYGAMPGSPKGVME  1139
             + KRK+  +P SP GV++
Sbjct  295   SSKRKHSWIPSSPSGVID  312



>ref|XP_010095313.1| hypothetical protein L484_009281 [Morus notabilis]
 gb|EXB59524.1| hypothetical protein L484_009281 [Morus notabilis]
Length=400

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 219/343 (64%), Gaps = 46/343 (13%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGEL  395
             +E Q  P + DAL+CEEEG  E  G+ + +       +  ++ +++VLLE DL WED EL
Sbjct  8     EELQNPPMVLDALFCEEEGLGEDLGENEEN-------EIAKKPQALVLLENDLFWEDDEL  60

Query  396   SSLLSKEQENELFNV----VQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
              +L++KE E   F+     +  +  L  AR EAV W+  V +HY FSA T +LAVNY DR
Sbjct  61    GNLIAKE-ERPWFDFDCGDLSSDGSLVAARKEAVHWIFTVNAHYGFSALTTVLAVNYFDR  119

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  SL+ Q  KPWMSQLAAVACLSLAAK+EET VPLLLD QVEES +VFEAKTIQRMEL
Sbjct  120   -FISSLQFQRDKPWMSQLAAVACLSLAAKMEETHVPLLLDLQVEESRFVFEAKTIQRMEL  178

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             LVLS L+W+M+PVTP SF  +I RRL LK+HL  EFL RCE +LLS+I D +F+CYLPSV
Sbjct  179   LVLSTLKWRMHPVTPISFFSHIVRRLGLKTHLHWEFLWRCERLLLSVIPDSKFVCYLPSV  238

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKV--------------------------  1025
             +A+ATMLHVI+ + P    E Q+QL+ +L I++V                          
Sbjct  239   LATATMLHVINEIEPYNPVEYQDQLLSVLKINEVYNLIPWLPFKCFHTWWTNKSNLVMML  298

Query  1026  --KVEECQKLIKEVASRIQFESAY---KRKYGAMPGSPKGVME  1139
                V EC KL+ E +    +   +   KRK+ ++PGSP GV++
Sbjct  299   QDTVNECYKLMLETSGGHGYSQRHGHSKRKHVSVPGSPNGVID  341



>ref|XP_006425980.1| hypothetical protein CICLE_v10025890mg [Citrus clementina]
 gb|ESR39220.1| hypothetical protein CICLE_v10025890mg [Citrus clementina]
Length=371

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 187/262 (71%), Gaps = 9/262 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPD----LAKARSEAVEWVLKVTSHYSFSAQTA  536
             DL W+D EL SL+ KE++    N V  +P     L  AR E VEWVL+V +H+ F+A TA
Sbjct  61    DLFWDDNELLSLICKEKKE---NFVPSDPISDEILILARKEVVEWVLRVKAHFGFTALTA  117

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNY DR F LS   Q  KPWM QL AVACLSLAAKV+ET VPLLLD QV++ +YVFE
Sbjct  118   ILAVNYFDR-FILSHSFQKDKPWMGQLVAVACLSLAAKVDETQVPLLLDLQVKDPKYVFE  176

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRMELLVLS L+W+MNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D 
Sbjct  177   AKTIQRMELLVLSTLQWRMNPVTPISFFDHIVRRLGLKTHLHWEFLYRCEHLLLSVIADS  236

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ  1076
             RFMCYLPS +A+ATMLH I  + P    E Q  LMG+L I + K++EC  LI E++    
Sbjct  237   RFMCYLPSTLATATMLHTIQEVEPCNPVEHQNLLMGVLNISQDKLKECYLLILELSRGNG  296

Query  1077  FES-AYKRKYGAMPGSPKGVME  1139
              ++ + KRK+  +PGSP  +++
Sbjct  297   SQNQSCKRKHFPLPGSPSCIID  318



>ref|XP_007042498.1| Cyclin-D3-1 [Theobroma cacao]
 gb|EOX98329.1| Cyclin-D3-1 [Theobroma cacao]
Length=393

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 210/320 (66%), Gaps = 24/320 (8%)
 Frame = +3

Query  243   FLFDALYC-----------EEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             FL DALYC            + GE   Q     SC+           ++LLEQD+ WEDG
Sbjct  22    FLLDALYCEEEKWEEEEDENDVGEVLQQEMSSRSCN--NARNPSLFPLLLLEQDMFWEDG  79

Query  390   ELSSLLSKEQENELF----NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             EL SL SKE++ +      N V+ +  LA AR EAVEW+LKV ++Y F+  TA+L++NYL
Sbjct  80    ELLSLFSKEKQQQAAYLNPNNVETDEPLAVARREAVEWMLKVNAYYGFTTLTAVLSINYL  139

Query  558   DRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRM  737
             DR F      Q  KPWM  L AV CLSLAAKVEET VPLLLD QVEE++Y+FEAK IQRM
Sbjct  140   DR-FLSRFHFQRDKPWMIHLVAVTCLSLAAKVEETQVPLLLDLQVEEAKYLFEAKNIQRM  198

Query  738   ELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLP  917
             ELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  EFLRRCE +LL +ISD R + YLP
Sbjct  199   ELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHLHWEFLRRCERLLLCVISDSRSVHYLP  258

Query  918   SVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES----  1085
             SV+A+ATM+HVI ++ P    + Q QL+ +L I K +V +C KLI ++++R Q  +    
Sbjct  259   SVLATATMMHVIGQVEPFNPIDYQNQLLSVLKISKERVNDCCKLILDLSTRPQNNAYSSN  318

Query  1086  --AYKRKYGAMPGSPKGVME  1139
                +KRK   +P SP GV++
Sbjct  319   PHPHKRKLEMVPSSPSGVID  338



>ref|XP_006466552.1| PREDICTED: cyclin-D3-2-like [Citrus sinensis]
 gb|KDO79076.1| hypothetical protein CISIN_1g017406mg [Citrus sinensis]
Length=371

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 187/262 (71%), Gaps = 9/262 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPD----LAKARSEAVEWVLKVTSHYSFSAQTA  536
             DL W+D EL SL+ KE++    N V  +P     L  AR E VEWVL+V +H+ F+A TA
Sbjct  61    DLFWDDNELLSLICKEKKE---NFVPSDPISDEILILARKEVVEWVLRVKAHFGFTALTA  117

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNY DR F LS   Q  KPWM QL AVACLSLAAKV+ET VPLLLD QV++ +YVFE
Sbjct  118   ILAVNYFDR-FILSHSFQKDKPWMGQLVAVACLSLAAKVDETQVPLLLDLQVKDPKYVFE  176

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRMELLVLS L+W+MNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D 
Sbjct  177   AKTIQRMELLVLSTLQWRMNPVTPISFFDHIVRRLGLKTHLHWEFLYRCEHLLLSVIADS  236

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ  1076
             RFMCYLPS +A+ATMLH I  + P    E Q  LMG+L I + K++EC  LI E++    
Sbjct  237   RFMCYLPSTLATATMLHTIQEVEPCNPVEHQNLLMGVLNISQDKLKECYLLILELSRGNG  296

Query  1077  FES-AYKRKYGAMPGSPKGVME  1139
              ++ + KRK+  +PGSP  +++
Sbjct  297   SQNQSCKRKHFPLPGSPSCIID  318



>ref|XP_008236568.1| PREDICTED: cyclin-D3-1 [Prunus mume]
Length=398

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 189/268 (71%), Gaps = 12/268 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQEN---------ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSF  521
             DL WED EL SL SKE++          ++ N   ++  ++ AR EAV W+LKV +HY F
Sbjct  76    DLFWEDEELVSLFSKEEQQQTHFIKHLEDMGNEAAEHSLISVARREAVLWMLKVNAHYGF  135

Query  522   SAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             +A TA+LA+NY DR F  SL  Q  KPWM QL AV CLSLAAKVEET VPLLLD QV ++
Sbjct  136   TALTAILAINYFDR-FISSLRFQRDKPWMVQLVAVTCLSLAAKVEETQVPLLLDLQVVDT  194

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS  881
             +YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+ L  EFL+RCE +LLS
Sbjct  195   KYVFEAKTIQRMELLVLSTLQWKMHPVTPLSFLDHIIRRLGLKTLLHWEFLKRCERLLLS  254

Query  882   IISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV  1061
             ++ D RF+ YLPSV+A+ATM+ VI  + P    E Q QL+G+L I K KV +C  LI E+
Sbjct  255   VVVDSRFIGYLPSVLATATMMRVIDHVEPCNAMEYQNQLLGVLKISKEKVNDCYSLILEL  314

Query  1062  --ASRIQFESAYKRKYGAMPGSPKGVME  1139
               A    + + +KRK+  +PGSP GV++
Sbjct  315   SKAYDCGYNNPHKRKHEQIPGSPSGVID  342



>ref|XP_007199910.1| hypothetical protein PRUPE_ppa006773mg [Prunus persica]
 gb|EMJ01109.1| hypothetical protein PRUPE_ppa006773mg [Prunus persica]
Length=395

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 189/268 (71%), Gaps = 12/268 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQEN---------ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSF  521
             DL WED EL SL SKE++          ++ N   ++  ++ AR EAV W+LKV +HY F
Sbjct  73    DLFWEDEELVSLFSKEEQQQTHFIKHLEDMGNEAAEHSLISVARREAVLWMLKVNAHYGF  132

Query  522   SAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             +A TA+LA+NY DR F  SL  Q  KPWM QL AV CLSLAAKVEET VPLLLD QV ++
Sbjct  133   TALTAILAINYFDR-FISSLHFQRDKPWMVQLVAVTCLSLAAKVEETQVPLLLDLQVVDT  191

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS  881
             +YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+ L  EFL+RCE +LLS
Sbjct  192   KYVFEAKTIQRMELLVLSTLQWKMHPVTPLSFLDHIIRRLGLKTLLHWEFLKRCERLLLS  251

Query  882   IISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV  1061
             ++ D RF+ YLPSV+A+ATM+ VI  + P    E Q QL+G+L I K KV +C  LI E+
Sbjct  252   VVFDSRFIGYLPSVLATATMMRVIDHVEPCNSMEYQNQLLGVLKISKEKVNDCYSLILEL  311

Query  1062  --ASRIQFESAYKRKYGAMPGSPKGVME  1139
               A    + + +KRK+  +PGSP GV++
Sbjct  312   SKAYDCGYNNPHKRKHEQIPGSPSGVID  339



>ref|XP_011001003.1| PREDICTED: cyclin-D3-1-like [Populus euphratica]
Length=353

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 207/316 (66%), Gaps = 16/316 (5%)
 Frame = +3

Query  201   SRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeee------svvll  362
              + ++  Q+ Q   FL DALYCEE     G+ + D    + ++            S+ LL
Sbjct  10    GQNELSTQQEQNTSFLLDALYCEE-----GKWEDDSEEEVLQESSSVNNPSGDLFSISLL  64

Query  363   eqDLLWEDGELSSLLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             EQDL WED EL SL SKEQE +     N V  +P L++AR EAVEW+LKV +H+ FSA T
Sbjct  65    EQDLFWEDEELLSLFSKEQEQQASVSVNNVASDPFLSRARQEAVEWMLKVIAHHGFSALT  124

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             ++LA+NYLDR        +  +PWM QL AV CLSLAAKVEET VPLLLD QVE+++Y+F
Sbjct  125   SILAINYLDRFLVSPCYQRDNRPWMIQLVAVTCLSLAAKVEETHVPLLLDLQVEDTKYLF  184

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+++  EFLRRCE +LL ++SD
Sbjct  185   EAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTNVHWEFLRRCEHLLLYVVSD  244

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR-  1070
              R  CYLPSV+A+ATM+HVI ++      + Q QL+ +L I K KV  C  LI E++   
Sbjct  245   SRSGCYLPSVLATATMMHVIDQVETFNPIDYQTQLLNVLKITKEKVNGCYDLILELSRTR  304

Query  1071  -IQFESAYKRKYGAMP  1115
              I      KRK+   P
Sbjct  305   AIANNKPKKRKFEPTP  320



>ref|XP_002524919.1| cyclin d, putative [Ricinus communis]
 gb|EEF37416.1| cyclin d, putative [Ricinus communis]
Length=276

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 173/224 (77%), Gaps = 3/224 (1%)
 Frame = +3

Query  468   ARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAA  647
             AR EAV+WV++V +HY F+A T++LAVNY DR F LSL+    KPWM QLAAVACLSLAA
Sbjct  3     ARKEAVDWVMRVKAHYGFTALTSVLAVNYFDR-FVLSLKFPNDKPWMGQLAAVACLSLAA  61

Query  648   KVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLEL  827
             KVEET VPLLLD QVEE++YVFEAKTI+RMELL LS L+W+MNP+TP SF D+I RRL L
Sbjct  62    KVEETQVPLLLDLQVEEAKYVFEAKTIKRMELLALSTLQWRMNPITPISFFDHIIRRLGL  121

Query  828   KSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGI  1007
             K+HL  EFLRRCE +LLS+ISD RFM YLPSV+A+A MLHVI  + P    + Q QLM +
Sbjct  122   KNHLHWEFLRRCESLLLSVISDSRFMSYLPSVLATAIMLHVIKEVEPCNQVQYQNQLMSV  181

Query  1008  LGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGVME  1139
             + I + KV EC KLI E++   Q +S  KRK+ +MP SP G+++
Sbjct  182   IKISENKVNECYKLILELSGN-QNKSC-KRKHPSMPRSPNGIID  223



>emb|CAN88858.1| D3-type cyclin [Populus trichocarpa]
Length=347

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 208/310 (67%), Gaps = 8/310 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             Q+ Q   FL DALYCEE    W + + +     E     +   + LLEQDL WED EL S
Sbjct  5     QQEQNASFLLDALYCEEG--RW-EDESEEEVLQESTFVNDLFPLSLLEQDLFWEDEELLS  61

Query  402   LLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             L SKEQE +     N V  +P L++AR EAVEW+LKV +HY FSA T++LA NYLDR   
Sbjct  62    LFSKEQEQQASVSVNNVADDPFLSRARQEAVEWMLKVIAHYGFSALTSILAFNYLDRFLS  121

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
                  +  +PWM QL AV CLSLAAKVEET VP LLD QVE+++YVFEAKTIQRMELLVL
Sbjct  122   GPCYQRDSRPWMIQLVAVTCLSLAAKVEETHVPFLLDLQVEDTKYVFEAKTIQRMELLVL  181

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+WKM+PVTP SFLD+I RRL LK+H+  EFLRRCE +LLS++SD R + YLPSV+A+
Sbjct  182   STLKWKMHPVTPLSFLDHIIRRLGLKTHVHWEFLRRCEHLLLSVVSDSRSVSYLPSVLAT  241

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR--IQFESAYKRKYG  1106
             ATM+HVI ++      + Q QL+ +L I K KV  C  LI E++    I    + KRK+ 
Sbjct  242   ATMMHVIDQVETFNPIDYQNQLLDVLKITKEKVNGCYGLILELSRNRTIANNKSQKRKFE  301

Query  1107  AMPGSPKGVM  1136
              MP SP GV+
Sbjct  302   PMPSSPSGVI  311



>ref|XP_008373097.1| PREDICTED: cyclin-D3-1 [Malus domestica]
 ref|XP_008346385.1| PREDICTED: cyclin-D3-1-like [Malus domestica]
Length=389

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 212/333 (64%), Gaps = 35/333 (11%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCE-----------------EEGEHW--GQADRDPSCSIeeqeeeee  344
             Q PQ    L DAL CE                   GE++  G + ++P+C          
Sbjct  9     QNPQSHTLLLDALLCEEDKWEEEDDGEVVEQEVSSGENYNNGVSGKNPNCP-------SL  61

Query  345   esvvlleqDLLWEDGELSSLLSKEQENELFNVVQ------KNPDLAKARSEAVEWVLKVT  506
               ++LLEQDL WED EL SL SKE++ +   V        ++  ++ AR +AV W+LKV 
Sbjct  62    FPILLLEQDLFWEDDELVSLFSKEEQEQTHFVKHMEGMGTEDSLISAARRDAVLWMLKVN  121

Query  507   SHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDF  686
             +H+ F+A TA+LAVNY DR F  S   Q  KPWM QL AV CLSLAAKVEET VPLLLD 
Sbjct  122   AHHGFTALTAILAVNYFDR-FISSFHFQRDKPWMVQLVAVTCLSLAAKVEETEVPLLLDL  180

Query  687   QVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCE  866
             QVE+++Y FEAKTIQRME+LVLS L+W+M+PVTP SFLD+I RRL LK+HL  EFL+RCE
Sbjct  181   QVEDTKYFFEAKTIQRMEILVLSALQWRMHPVTPLSFLDHIIRRLGLKTHLHWEFLKRCE  240

Query  867   GVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQK  1046
              +LLS++ D RF+ YLPSV+A+ATM+ VI ++ P    E Q QL+G+L I K KV+ C  
Sbjct  241   RLLLSVVFDSRFVRYLPSVLATATMMRVIDQVEPWNAIEYQNQLLGVLKISKEKVBHCYS  300

Query  1047  LI--KEVASRIQFESAYKRKYGAMPGSPKGVME  1139
             LI   + A      S  KRK+  +PGSP GV++
Sbjct  301   LILDYDYACCNNKNSTNKRKHDQIPGSPSGVID  333



>ref|XP_002298743.1| hypothetical protein POPTR_0001s30920g [Populus trichocarpa]
 gb|EEE83548.1| hypothetical protein POPTR_0001s30920g [Populus trichocarpa]
Length=386

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 210/312 (67%), Gaps = 12/312 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeees--vvlleqDLLWEDGEL  395
             Q+ Q   FL DALYCEE     G+ + +    + ++     +   + LLEQDL WED EL
Sbjct  17    QQEQNASFLLDALYCEE-----GRWEDESEEEVLQESTFVNDLFPLSLLEQDLFWEDEEL  71

Query  396   SSLLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
              SL SKEQE +     N V  +P L++AR EAVEW+LKV +HY FSA T++LA NYLDR 
Sbjct  72    LSLFSKEQEQQASVSVNNVADDPFLSRARQEAVEWMLKVIAHYGFSALTSILAFNYLDRF  131

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
                    +  +PWM QL AV CLSLAAKVEET VP LLD QVE+++YVFEAKTIQRMELL
Sbjct  132   LSGPCYQRDSRPWMIQLVAVTCLSLAAKVEETHVPFLLDLQVEDTKYVFEAKTIQRMELL  191

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             VLS L+WKM+PVTP SFLD+I RRL LK+H+  EFLRRCE +LLS++SD R + YLPSV+
Sbjct  192   VLSTLKWKMHPVTPLSFLDHIIRRLGLKTHVHWEFLRRCEHLLLSVVSDSRSVSYLPSVL  251

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR--IQFESAYKRK  1100
             A+ATM+HVI ++      + Q QL+ +L I K KV  C  LI E++    I    + KRK
Sbjct  252   ATATMMHVIDQVETFNPIDYQNQLLDVLKITKEKVNGCYGLILELSRNRTIANNKSQKRK  311

Query  1101  YGAMPGSPKGVM  1136
             +  MP SP GV+
Sbjct  312   FEPMPSSPSGVI  323



>gb|AAV41032.1| cyclin D-like protein [Nicotiana tabacum]
Length=367

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 212/310 (68%), Gaps = 6/310 (2%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             + Q L  +FD L+CEE+         + SC++E+ E   ++++ LLE D+ WED +L +L
Sbjct  6     DTQLLNPIFDGLFCEEDRFLDDDDLGEWSCTLEQVENNVKKTLPLLECDMFWEDDQLVTL  65

Query  405   LSKEQENEL-FNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+KE+E+ L F+ +  + D  L + R EA++W+L+V +HY F+A TA+LAVNY DR F  
Sbjct  66    LAKEKESHLGFDCLISDGDGLLVEVRKEALDWMLRVIAHYGFTAMTAVLAVNYFDR-FVS  124

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
              L  Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QV +S +VFEAKTIQRMELLVLS
Sbjct  125   GLCFQKDKPWMSQLAAVACLSIAAKVEETQVPLLLDLQVADSRFVFEAKTIQRMELLVLS  184

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+WKMNPVTP SF+D+I RR    S+L  +FLRRCE ++L II+D R + Y PSV+A+A
Sbjct  185   TLKWKMNPVTPLSFIDHIMRRFGFMSNLHLDFLRRCERLILGIITDSRLLYYSPSVIATA  244

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--SAYKRKYGA  1109
              M  VI+ + P    E Q QLM +L + +   EEC  LI E+     +    + KRK+ +
Sbjct  245   VMFFVINEIEPCNAMEYQNQLMSVLKVKQDSFEECHDLILELMGTPGYNICQSLKRKHQS  304

Query  1110  MPGSPKGVME  1139
             +PGSP GV++
Sbjct  305   VPGSPSGVID  314



>ref|NP_001237151.1| cyclin d3 [Glycine max]
 gb|AAS13371.1| cyclin d3 [Glycine max]
Length=396

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 191/282 (68%), Gaps = 26/282 (9%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFN------------------VVQKNPDLAKARSEAVE  488
             DL WED EL+SL SKE  Q  E ++                   V  +  L++ R EAVE
Sbjct  62    DLFWEDEELNSLFSKEKVQHEEAYDYNNLNSDDNSNDHSNNNNNVLSDSCLSQPRREAVE  121

Query  489   WVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFV  668
             W+LKV +HY FSA TA LAV YLDR F LS   Q +KPWM QL AV C+SLAAKVEET V
Sbjct  122   WILKVNAHYGFSALTATLAVTYLDR-FLLSFHFQREKPWMIQLVAVTCISLAAKVEETQV  180

Query  669   PLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCE  848
             PLLLD QV++++YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  E
Sbjct  181   PLLLDLQVQDTKYVFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHLHWE  240

Query  849   FLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVK  1028
             FLRRCE +LLS++ D RF+  LPSV+A+ATMLHVI ++    G E + QL+ +L I K K
Sbjct  241   FLRRCEHLLLSVLLDSRFVGCLPSVLATATMLHVIDQIKHNGGMEYKTQLLSVLKISKEK  300

Query  1029  VEECQKLIKEVASRIQF-----ESAYKRKYGAMPGSPKGVME  1139
             V+EC   I +++   ++      +  KRKY  +P SP GV++
Sbjct  301   VDECYNAILQLSKANKYGHNNINNTSKRKYEQIPSSPSGVID  342



>emb|CBI33773.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 3/229 (1%)
 Frame = +3

Query  459   LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLS  638
             L  AR++AVEW+LKV +HY FSA TA+LAVNY DR F  S   Q  KPWMSQLAAV CLS
Sbjct  29    LTVARTKAVEWMLKVNAHYGFSALTAVLAVNYFDR-FLSSSCFQRDKPWMSQLAAVTCLS  87

Query  639   LAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARR  818
             LAAKV+ET VPLLLD QVEE++YVFEAKTIQRMELLVLS+L+WKMNPVTP SF D+I RR
Sbjct  88    LAAKVDETDVPLLLDLQVEETKYVFEAKTIQRMELLVLSSLQWKMNPVTPISFFDHIIRR  147

Query  819   LELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQL  998
             L LK+HL  EFL RCE +LLS+I+D RF+CYLPS +A+ATMLH+I+ + P    E Q QL
Sbjct  148   LGLKTHLHWEFLERCERLLLSVIADSRFLCYLPSTLATATMLHIITEVEPCNPLEYQNQL  207

Query  999   MGILGIDKVKVEECQKLIKE-VASRIQFES-AYKRKYGAMPGSPKGVME  1139
             + +L I K  V++C KLI E + S    ++  +KRK+ ++P SP G+ +
Sbjct  208   LSVLKISKNDVDDCYKLILEFLGSHGHTQNQTHKRKHLSLPSSPSGIFD  256



>ref|XP_004496963.1| PREDICTED: cyclin-D3-1-like [Cicer arietinum]
Length=381

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 216/327 (66%), Gaps = 25/327 (8%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDP------------SCSIeeqeeeeeesvvlle  365
             Q  Q +  L D+LYC+EE   W   D D             + ++          ++ LE
Sbjct  6     QHNQNVSSLLDSLYCDEEK--WEDEDNDNEEQSDVTTTTTTNIAVVHLNSTSLFPLLFLE  63

Query  366   qDLLWEDGELSSLLSKEQ-ENELFNVVQKNPD-------LAKARSEAVEWVLKVTSHYSF  521
             Q L ++D EL+SL +KE+ + + +  + KN D       +++ R EAV+W+LKV +HY F
Sbjct  64    QHLFFQDEELNSLFTKEKTQQQSYEDLMKNVDFDSTKSLISQPRREAVQWILKVNAHYGF  123

Query  522   SAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             SA TA LAV Y D+ F LS   Q +KPWM QL AV C+SLAAKVEET VPLLLD QV+++
Sbjct  124   SALTATLAVTYFDK-FLLSFHFQKEKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDT  182

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS  881
             +YVFEAKTIQRMELL+LS L+WKM+PVTP SFLD+I RRL LK++L  EFLRRCE ++LS
Sbjct  183   KYVFEAKTIQRMELLILSTLKWKMHPVTPLSFLDHIIRRLGLKTNLHWEFLRRCENLILS  242

Query  882   IISDCRFMCYLPSVMASATMLHVISRLVPT-VGEESQEQLMGILGIDKVKVEECQKLIKE  1058
             ++ D RF+  LPSV+A+ATMLHVI ++  +  G + + QL+G+L I+K KV+EC   I +
Sbjct  243   LLLDSRFVGCLPSVLATATMLHVIDQIEQSDDGLDYKNQLLGVLKINKEKVDECYNEIIQ  302

Query  1059  VASRIQFESAYKRKYGAMPGSPKGVME  1139
             V +     S+ KRKY  +P SP GV++
Sbjct  303   VTNCNNL-SSTKRKYDEIPDSPSGVID  328



>ref|XP_011088217.1| PREDICTED: cyclin-D3-1 [Sesamum indicum]
Length=372

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 203/321 (63%), Gaps = 18/321 (6%)
 Frame = +3

Query  213   MPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlle------qDL  374
             M   +        D LYCEEE   WG  + +   S         +    L       QDL
Sbjct  1     MAVHQNSNKSLFDDVLYCEEEK--WGDVEDEEEESGGAVTFNHHDRNPSLSPLLLLEQDL  58

Query  375   LWEDGELSSLLSKEQENELF--NVVQKNP---DLAKARSEAVEWVLKVTSHYSFSAQTAL  539
              W+D EL SL  KE++      N V++      L+ +R EAVEW+LK+ +HY FSA TA+
Sbjct  59    FWDDEELHSLFCKEKQTSCLKTNNVKETSFSFALSLSRKEAVEWILKINAHYGFSALTAI  118

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNYLDR F  SL  Q  KPWM QLAAV CLSLAAKVEET VPLLLD QVE ++YVFEA
Sbjct  119   LAVNYLDR-FLSSLSFQKDKPWMMQLAAVTCLSLAAKVEETHVPLLLDLQVEGTKYVFEA  177

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRME+LVLS L+W+MNPVTP SFLD+I RRL LKS++  EFLR CE +LLS+ISD R
Sbjct  178   KTIQRMEVLVLSALKWRMNPVTPLSFLDHIIRRLGLKSYVHWEFLRNCENLLLSVISDSR  237

Query  900   FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF  1079
             F  YLPSVMA+ATMLHVI ++ PT     + QL+ +L I K +V++C ++I ++ S    
Sbjct  238   FTLYLPSVMATATMLHVIHQVEPTNAIHYENQLLAVLKISKGEVDDCYEVISDILSN---  294

Query  1080  ESAYKRK-YGAMPGSPKGVME  1139
              +  KRK +     S  G++ 
Sbjct  295   SNPLKRKIWQVESSSADGIIN  315



>emb|CAB40540.1| cyclin D3 [Medicago sativa]
Length=378

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 215/314 (68%), Gaps = 20/314 (6%)
 Frame = +3

Query  246   LFDALYCEEE------GE--HWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             LFDALYC+EE      GE    G+     + + +  +      ++LLEQ+L  ED EL++
Sbjct  14    LFDALYCDEEKWEDDEGEVVDEGEQSDVTTTNYDILDSTSLLPLLLLEQNLFNEDEELNT  73

Query  402   LLSKE---QEN---ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             L SKE   QE    +L NV+  +  L++ R EAVEW+LKV +HY FSA TA LAVNYLDR
Sbjct  74    LFSKEKIQQETYYEDLKNVINFDS-LSQPRREAVEWMLKVNAHYGFSALTATLAVNYLDR  132

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F LS   Q +KPWM QL AV C+SLAAKVEET VPLLLD QV++++YVFEAKTIQRMEL
Sbjct  133   -FLLSFHFQKEKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDTKYVFEAKTIQRMEL  191

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L+WKM+PVT  SFLD+I RRL LK++L  EFLRRCE +LLS++ D RF+  +PSV
Sbjct  192   LILSTLKWKMHPVTTHSFLDHIIRRLGLKTNLHWEFLRRCENLLLSVLLDSRFVGCVPSV  251

Query  924   MASATMLHVISRLVPT--VGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKR  1097
             +A+ATMLHVI ++  +   G + + QL+ +L   K KV+EC   I  + +   +   +KR
Sbjct  252   LATATMLHVIDQIEQSDDHGVDYKNQLLNVLKTSKEKVDECYNAILHLTNANNY--GHKR  309

Query  1098  KYGAMPGSPKGVME  1139
             KY  +PGSP GV++
Sbjct  310   KYEEIPGSPSGVID  323



>gb|KDO79077.1| hypothetical protein CISIN_1g017406mg [Citrus sinensis]
Length=372

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 187/263 (71%), Gaps = 10/263 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPD----LAKARSEAVEWVLKVTSHYSFSAQTA  536
             DL W+D EL SL+ KE++    N V  +P     L  AR E VEWVL+V +H+ F+A TA
Sbjct  61    DLFWDDNELLSLICKEKKE---NFVPSDPISDEILILARKEVVEWVLRVKAHFGFTALTA  117

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNY DR F LS   Q  KPWM QL AVACLSLAAKV+ET VPLLLD QV++ +YVFE
Sbjct  118   ILAVNYFDR-FILSHSFQKDKPWMGQLVAVACLSLAAKVDETQVPLLLDLQVKDPKYVFE  176

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRMELLVLS L+W+MNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D 
Sbjct  177   AKTIQRMELLVLSTLQWRMNPVTPISFFDHIVRRLGLKTHLHWEFLYRCEHLLLSVIADS  236

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKV-KVEECQKLIKEVASRI  1073
             RFMCYLPS +A+ATMLH I  + P    E Q  LMG+L I +  K++EC  LI E++   
Sbjct  237   RFMCYLPSTLATATMLHTIQEVEPCNPVEHQNLLMGVLNISQQDKLKECYLLILELSRGN  296

Query  1074  QFES-AYKRKYGAMPGSPKGVME  1139
               ++ + KRK+  +PGSP  +++
Sbjct  297   GSQNQSCKRKHFPLPGSPSCIID  319



>ref|XP_004501551.1| PREDICTED: cyclin-D3-2-like [Cicer arietinum]
Length=357

 Score =   276 bits (707),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 194/260 (75%), Gaps = 3/260 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             D+ W + EL SLL+K+QEN +   ++ N  L   R E++EW++KV  +YSFSA TA+LAV
Sbjct  45    DMSWNNEELKSLLAKQQENSICIFLETNSVLESDRRESIEWMMKVKVYYSFSALTAVLAV  104

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR  F S   Q +KPWM+ LAAVA LSLAAK+EET VPLLLD QVE+S ++FEAKTI
Sbjct  105   NYLDRFLF-SFRFQNEKPWMTHLAAVASLSLAAKMEETQVPLLLDLQVEDSRFLFEAKTI  163

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSII-SDCRFM  905
             Q+ME+LVLS L WKMNP TP SF+D+I RRL LK  LC EFL+RCE VLLSII SD RF+
Sbjct  164   QKMEILVLSTLGWKMNPATPLSFIDFIIRRLGLKDRLCWEFLKRCESVLLSIIRSDFRFL  223

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKL-IKEVASRIQFE  1082
              YLPSV+A+A M+HV + + P +G+E Q QL+GILGI+K KV+EC KL +K      + +
Sbjct  224   SYLPSVLATAIMIHVFNSVEPNLGDEYQIQLLGILGINKEKVDECGKLMLKMWTGYEEGK  283

Query  1083  SAYKRKYGAMPGSPKGVMEV  1142
                KRK+ ++P SP GVM+V
Sbjct  284   QCKKRKFVSIPSSPNGVMDV  303



>ref|XP_002313139.1| cyclin D3 family protein [Populus trichocarpa]
 ref|XP_006379187.1| hypothetical protein POPTR_0009s10060g [Populus trichocarpa]
 emb|CAN88859.1| D3-type cyclin [Populus trichocarpa]
 gb|EEE87094.1| cyclin D3 family protein [Populus trichocarpa]
 gb|ERP56984.1| hypothetical protein POPTR_0009s10060g [Populus trichocarpa]
Length=353

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 206/316 (65%), Gaps = 16/316 (5%)
 Frame = +3

Query  201   SRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeee------svvll  362
              + ++  Q+ Q   FL DALYCEE     G+ + D    + ++            S+ LL
Sbjct  10    GQNELSTQQEQNTSFLLDALYCEE-----GKWEDDSEEEVLQESPSVNNPSGDLFSISLL  64

Query  363   eqDLLWEDGELSSLLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             EQDL WED EL SL SKEQE +     N V  +P L++AR EAVEW+LKV +H+ FSA T
Sbjct  65    EQDLFWEDEELLSLFSKEQEQQASVSVNNVASDPFLSRARQEAVEWMLKVIAHHGFSALT  124

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             ++LA+NYLDR        +  + WM QL AV CLSLAAKVEET VPLLLD QVE+++Y+F
Sbjct  125   SILAINYLDRFLVSPCYQRDNRSWMIQLVAVTCLSLAAKVEETHVPLLLDLQVEDTKYLF  184

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+++  EFLRRCE +LL ++SD
Sbjct  185   EAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTNVHWEFLRRCEHLLLYVVSD  244

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR-  1070
              R  CYLPSV+A+ATM+HVI ++      + Q QL+ +L I K KV  C  LI E++   
Sbjct  245   SRSGCYLPSVLATATMMHVIDQVETFNPIDYQTQLLDVLKITKEKVNGCYGLILELSRTR  304

Query  1071  -IQFESAYKRKYGAMP  1115
              I      KRK+   P
Sbjct  305   AIANNKPKKRKFEPTP  320



>ref|XP_009335011.1| PREDICTED: cyclin-D3-1 [Pyrus x bretschneideri]
Length=389

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 184/265 (69%), Gaps = 9/265 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELF------NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQ  530
             DL WED EL SL SKE++ +         +  ++  ++ AR +AV W+LKV +HY F+A 
Sbjct  70    DLFWEDDELVSLFSKEEQQQTHFGKHMEGMGTEDSLISAARRDAVLWMLKVNAHYGFTAL  129

Query  531   TALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYV  710
             TA+LAVNY DR F  SL  Q  KPWM QL AV CLSLAAKVEET VPLLLD QVE ++Y 
Sbjct  130   TAILAVNYFDR-FISSLHFQRDKPWMVQLVAVTCLSLAAKVEETEVPLLLDLQVEGTKYF  188

Query  711   FEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIIS  890
             FEAKTIQRME+LVLS L W+M+PVTP SFLD+I RRL LK+HL  EFL+RCE +LLS++ 
Sbjct  189   FEAKTIQRMEILVLSALHWRMHPVTPLSFLDHIIRRLGLKTHLHWEFLKRCERLLLSVVF  248

Query  891   DCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI--KEVA  1064
             D RF+ YLPSV+A+ATM+ VI ++ P    E Q QL+G+L I K KV +C  LI   + A
Sbjct  249   DSRFVRYLPSVLATATMMRVIDQVEPWNAIEYQNQLLGVLKISKEKVNDCYSLIIDYDYA  308

Query  1065  SRIQFESAYKRKYGAMPGSPKGVME  1139
                   S  KRK+  +PGSP  V++
Sbjct  309   CSNNKNSTNKRKHDQIPGSPSAVID  333



>ref|XP_009795658.1| PREDICTED: cyclin-D3-2-like [Nicotiana sylvestris]
Length=368

 Score =   275 bits (702),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 212/311 (68%), Gaps = 7/311 (2%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEGEHWGQADRDP-SCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             + Q L  +FD LYCEE+       D    SC++E+ E   ++++ LLE D+ WED +L +
Sbjct  6     DTQLLNPIFDGLYCEEDRFLDDHDDLGEWSCTLEQVENNLKKTLPLLECDMFWEDDQLVT  65

Query  402   LLSKEQENEL-FNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             LL+KE+E+ L F+ +  + D  L + R +A++W+L+V +HY F+A TA+LAVNY DR F 
Sbjct  66    LLAKEKESHLGFDCLISDGDGFLVEVRKDALDWMLRVIAHYGFTAMTAVLAVNYFDR-FV  124

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
               L  Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QV +S +VFEAKTIQRMELLVL
Sbjct  125   SGLCFQKDKPWMSQLAAVACLSIAAKVEETQVPLLLDLQVADSRFVFEAKTIQRMELLVL  184

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+WKMNPVTP SF+D+I RR    S++  +FLRRCE ++L II+D R + Y PSV+A+
Sbjct  185   STLKWKMNPVTPLSFIDHIMRRFGFMSNIHLDFLRRCERLILGIITDSRLLHYPPSVIAT  244

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV--ASRIQFESAYKRKYG  1106
             A M  VI+ + P    E Q QL  +L + +   EEC+ LI E+   S  +     KRK+ 
Sbjct  245   AAMYFVINEIEPCNAMEYQNQLTSVLKVKQDSFEECRDLILELIGTSGYKICQGVKRKHQ  304

Query  1107  AMPGSPKGVME  1139
             ++PGSP GV++
Sbjct  305   SVPGSPSGVID  315



>gb|KHN06756.1| Cyclin-D3-1 [Glycine soja]
Length=401

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 191/282 (68%), Gaps = 26/282 (9%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFN------------------VVQKNPDLAKARSEAVE  488
             DL WED EL+S+ SKE  Q  E +                    V  +  L++ R EAVE
Sbjct  67    DLFWEDEELNSIFSKEKVQHEEAYGYNNLNSDDDNNNNNNSNNNVHLDSCLSQPRREAVE  126

Query  489   WVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFV  668
             W+LKV +HY FSA TA LAV YLDR F LS   Q +KPWM QL AV C+SLAAKVEET V
Sbjct  127   WMLKVNAHYGFSALTATLAVTYLDR-FLLSFHFQREKPWMIQLVAVTCISLAAKVEETQV  185

Query  669   PLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCE  848
             PLLLD QV++++Y+FEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL L++HL  E
Sbjct  186   PLLLDLQVQDTKYLFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLRTHLHWE  245

Query  849   FLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVK  1028
             FLRRCE +LLS++ D RF+  LPSV+A+ATMLHVI ++  + G E + QL+ +L I K K
Sbjct  246   FLRRCEHLLLSVLLDSRFVGCLPSVLATATMLHVIDQIQHSGGIEYKTQLLSVLKISKEK  305

Query  1029  VEECQKLIKEVASRIQF-----ESAYKRKYGAMPGSPKGVME  1139
             V+EC   I +++   ++      +  KRKY  +P SP GV++
Sbjct  306   VDECYNAILQLSKANKYGHNNINNTSKRKYEQIPSSPSGVID  347



>gb|KHN42377.1| Cyclin-D3-1 [Glycine soja]
Length=394

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 190/281 (68%), Gaps = 25/281 (9%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFNVVQKNPD-------------------LAKARSEAV  485
             DL WED EL+SL SKE  Q  E ++    N D                   L++ R EAV
Sbjct  62    DLFWEDEELNSLFSKEKVQHEEAYDYNNLNSDDNNSNDNNNNNNNVLLDSCLSQPRREAV  121

Query  486   EWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETF  665
             EW+LKV +HY FSA TA LAV YLDR F LS   Q +KPWM QL AV C+SLAAKVEET 
Sbjct  122   EWILKVNAHYGFSALTATLAVTYLDR-FLLSFHFQREKPWMIQLVAVTCISLAAKVEETQ  180

Query  666   VPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCC  845
             VPLLLD QV++++YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+HL  
Sbjct  181   VPLLLDLQVQDTKYVFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHLHW  240

Query  846   EFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKV  1025
             EFLRRCE +LLS++ D RF+  LPSV+A+ATMLHVI ++    G E + QL+ +L I K 
Sbjct  241   EFLRRCEHLLLSVLLDSRFVGCLPSVLATATMLHVIDQIKHNGGMEYKNQLLSVLKISKE  300

Query  1026  KVEECQKLIKEVA---SRIQFESAYKRKYGAMPGSPKGVME  1139
             KV+EC   I +++   +     +  KRKY  +P SP GV++
Sbjct  301   KVDECYNAILQLSNVNNYGHNNNTSKRKYEQIPSSPSGVID  341



>ref|XP_004287998.1| PREDICTED: cyclin-D3-2-like [Fragaria vesca subsp. vesca]
Length=376

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 184/259 (71%), Gaps = 2/259 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DL WE+ EL SL+SKE++  + F+    +  L  AR EA+ W+L V SHY FS  T +LA
Sbjct  67    DLFWEEDELVSLISKEKQTHVCFSGSISDGSLTLARKEALVWILSVKSHYGFSCLTTVLA  126

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             +NY DR F  SL  Q  KPWM+QL AVACLSLAAKVEET +PLLLD QVEES+YVFEA+T
Sbjct  127   MNYFDR-FSSSLVFQKDKPWMTQLTAVACLSLAAKVEETHMPLLLDLQVEESKYVFEART  185

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVL+ L+W+MNPVTP SF D++ RRL LK+HL  EFL RCE +LL +I+D RF+
Sbjct  186   IQRMELLVLTTLDWRMNPVTPNSFFDHMIRRLGLKTHLHSEFLWRCERLLLCVIADTRFL  245

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
              +LPS++A+A ML+VI+ +      E Q Q++ +L + +  V EC KLI  V+ R     
Sbjct  246   VFLPSIVAAAIMLYVINEIETFNPVEYQNQVLSVLKVSQGTVSECYKLILVVSVRTVQNQ  305

Query  1086  AYKRKYGAMPGSPKGVMEV  1142
              +KRK+ ++P SP GV ++
Sbjct  306   GHKRKHSSIPSSPSGVTDI  324



>ref|XP_003536622.1| PREDICTED: cyclin-D3-1-like isoform 1 [Glycine max]
Length=402

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 191/283 (67%), Gaps = 27/283 (10%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE--QENELFN-------------------VVQKNPDLAKARSEAV  485
             DL WED EL+S+ SKE  Q  E +                     V  +  L++ R EAV
Sbjct  67    DLFWEDEELNSIFSKEKVQHEEAYGYNNLNSDDDNNNNNNTSNNNVHLDSCLSQPRREAV  126

Query  486   EWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETF  665
             EW+LKV +HY FSA TA LAV YLDR F LS   Q +KPWM QL AV C+SLAAKVEET 
Sbjct  127   EWMLKVNAHYGFSALTATLAVTYLDR-FLLSFHFQREKPWMIQLVAVTCISLAAKVEETQ  185

Query  666   VPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCC  845
             VPLLLD QV++++Y+FEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL L++HL  
Sbjct  186   VPLLLDLQVQDTKYLFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLRTHLHW  245

Query  846   EFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKV  1025
             EFLRRCE +LLS++ D RF+  LPSV+A+ATMLHVI ++  + G E + QL+ +L I K 
Sbjct  246   EFLRRCEHLLLSVLLDSRFVGCLPSVLATATMLHVIDQIQHSGGIEYKTQLLSVLKISKE  305

Query  1026  KVEECQKLIKEVASRIQF-----ESAYKRKYGAMPGSPKGVME  1139
             KV+EC   I +++   ++      +  KRKY  +P SP GV++
Sbjct  306   KVDECYNAILQLSKANKYGHNNINNTSKRKYEQIPSSPSGVID  348



>ref|XP_004509104.1| PREDICTED: cyclin-D3-3-like [Cicer arietinum]
Length=378

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 205/321 (64%), Gaps = 16/321 (5%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGE-----HWGQADRDPSCSIeeqeeeeeesvvlleqDLLWED  386
             ++ Q  P   DAL CEE+            D + + +    ++ +    +LL+ DL WE 
Sbjct  5     EQQQHSPSFLDALLCEEQNNFEDDFDANVTDSETNTNDPSTKKFQSLPSILLDNDLFWEH  64

Query  387   GELSSLLSKEQENELFNVVQKNPDLA-------KARSEAVEWVLKVTSHYSFSAQTALLA  545
              EL SL+SKE+E  LF+ +  N +L         +R EAV WV +V SHY FSA T +LA
Sbjct  65    DELVSLISKEKETHLFSSLDDNNNLIVVDGSLEDSRVEAVNWVSRVCSHYGFSALTTVLA  124

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNY DR F  SL+ Q  KPWM+QL AVACLSLAAK+EET VPLLLD QVE+S +VFEAKT
Sbjct  125   VNYFDR-FITSLKFQKDKPWMTQLTAVACLSLAAKMEETHVPLLLDLQVEDSRFVFEAKT  183

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR-F  902
             IQRMELLVLS L+W+M+PVTP SF ++I RRL LKS L  EF+ RCE VLL +I D +  
Sbjct  184   IQRMELLVLSTLKWRMHPVTPISFFEHIVRRLGLKSRLHWEFMWRCERVLLHVIVDSKAM  243

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE--VASRIQ  1076
             M YLPS +A+ATM+HVI  + P    E  +QLMG+L I + +V +C KL+ +  V     
Sbjct  244   MSYLPSTLAAATMIHVIKEIEPFNATEYIDQLMGLLKISEEQVNQCYKLMLKLLVCHDGI  303

Query  1077  FESAYKRKYGAMPGSPKGVME  1139
             +    KRK+ + P SP GVM+
Sbjct  304   YSLHQKRKHLSEPSSPGGVMD  324



>gb|AAQ54560.1| cyclin D3 [Malus domestica]
Length=213

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = +3

Query  372  LLWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
            L W++ EL SLLSKE E NEL   +Q +P LA AR EAV+W+L+V SHYSFSA +A+LA 
Sbjct  12   LFWDNEELISLLSKESEQNELQKPLQISPSLAGARREAVDWMLRVASHYSFSALSAVLAA  71

Query  549  NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
            +Y D  F  SL+ Q +KPWM+QLAAVAC+SLAAKVEET VPLLLDFQVE+S+YVFEA+TI
Sbjct  72   DYFDG-FLSSLQLQVEKPWMTQLAAVACISLAAKVEETQVPLLLDFQVEDSKYVFEARTI  130

Query  729  QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
            +RME+LVLS L+WKMNPVTP SF+DYI RRL LK+HLC E L+RCE VLLS+ISD RFM 
Sbjct  131  KRMEILVLSTLQWKMNPVTPISFIDYITRRLGLKNHLCWEVLKRCELVLLSLISDSRFMS  190

Query  909  YLPSVMASATMLHVISRLVP  968
            +LPSV+A+A MLHV++ + P
Sbjct  191  FLPSVVATAIMLHVVNNIEP  210



>emb|CAA61334.1| cyclin [Medicago sativa]
Length=386

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 216/320 (68%), Gaps = 30/320 (9%)
 Frame = +3

Query  246   LFDALYCE--------------EEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             LFDALYC+              +EG    Q+D   + + +  +      ++LLEQ+L  E
Sbjct  20    LFDALYCDEEEKWEDDDEGEVVDEG---AQSDV-TTTNYDILDSTSLLPLLLLEQNLFNE  75

Query  384   DGELSSLLSKE---QEN---ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             D EL++L SKE   QE    +L NV+  +  L++ R EAVEW+LKV +HY FSA TA LA
Sbjct  76    DEELNTLFSKEITQQETYYEDLKNVINFDS-LSQPRREAVEWMLKVNAHYGFSALTATLA  134

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNYLDR F LS   Q +KPWM QL AV C+SLAAKVEET VPLLLD QV++++YVFEAKT
Sbjct  135   VNYLDR-FLLSFHFQKEKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDTKYVFEAKT  193

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELL+LS L+WKM+PVT  SFLD+I RRL LK++L  EFLRRCE +LLS++ D RF+
Sbjct  194   IQRMELLILSTLKWKMHPVTTHSFLDHIIRRLGLKTNLHWEFLRRCENLLLSVLLDSRFV  253

Query  906   CYLPSVMASATMLHVISRLVPT--VGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF  1079
               +PSV+A+ATMLHVI ++  +   G + + QL+ +L I K KV+EC   I  + +   +
Sbjct  254   GCVPSVLATATMLHVIDQIEQSDDNGVDYKNQLLNVLKISKEKVDECYNAILHLTNANNY  313

Query  1080  ESAYKRKYGAMPGSPKGVME  1139
                +KRKY  +PGSP GV++
Sbjct  314   --GHKRKYEEIPGSPSGVID  331



>ref|XP_010550351.1| PREDICTED: cyclin-D3-2-like [Tarenaya hassleriana]
Length=372

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 209/326 (64%), Gaps = 33/326 (10%)
 Frame = +3

Query  222   QEPQKLPF-LFDALYCEEE-------------GEHWGQADR---DPSCSIeeqeeeeees  350
             ++ Q  PF + D LYCEEE             G+ W ++D     PS            +
Sbjct  6     EDTQNAPFCVLDGLYCEEESGFVEDLVGTDGDGDSWERSDECVEKPS----------FFA  55

Query  351   vvlleqDLLWEDGELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSA  527
             +VL EQD+ W++ ELSSL SKE+E +  F     +  L   R EA++W+ +V S+Y FS+
Sbjct  56    LVLSEQDMSWDEDELSSLTSKEKETKPCFCDKMLDQFLVLCRKEALDWIFRVKSYYGFSS  115

Query  528   QTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEY  707
              TALLAVNY DR F  S++ QT+KPWMSQLAAVACLSLAAKVEE  VPLLLD QVEE+ Y
Sbjct  116   LTALLAVNYFDR-FITSIKFQTEKPWMSQLAAVACLSLAAKVEEIQVPLLLDLQVEEARY  174

Query  708   VFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSII  887
             VFEAKTIQRMELLVLS L+W+M+PVTP SF D+I RRL  KS L CEF+RRCE +LLS+I
Sbjct  175   VFEAKTIQRMELLVLSTLQWRMHPVTPLSFFDHIIRRLGSKSQLHCEFMRRCERLLLSVI  234

Query  888   SDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
              D RFM Y  SV+A+A M++V+    P    E Q QLM +L +D+ K  EC +L+ + A 
Sbjct  235   VDTRFMRYTSSVLATAIMIYVMKDFKPCDEAEHQSQLMSLLKVDQEKANECYELLLDFAG  294

Query  1068  RIQFESAYKRKYG-AMPGSPKGVMEV  1142
                  +  KR+    +P SP GV ++
Sbjct  295   S---HNPNKRRLNLPVPASPTGVFDI  317



>ref|XP_009620630.1| PREDICTED: cyclin-D3-2-like [Nicotiana tomentosiformis]
 emb|CAA09854.1| cyclin D3.2 protein [Nicotiana tabacum]
Length=367

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 210/310 (68%), Gaps = 6/310 (2%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             + Q L  +FD LYCEE+         + S ++E+     ++++ LLE D+ WED +L +L
Sbjct  6     DTQLLNPIFDVLYCEEDRFLDDDDLGEWSSTLEQVGNNVKKTLPLLECDMFWEDDQLVTL  65

Query  405   LSKEQENEL-FNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             L+KE+E+ L F+ +  + D  L + R EA++W+L+V +HY F+A TA+LAVNY DR F  
Sbjct  66    LTKEKESHLGFDCLISDGDGFLVEVRKEALDWMLRVIAHYGFTAMTAVLAVNYFDR-FVS  124

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
              L  Q  KPWMSQLAAVACLS+AAKVEET VPLLLD QV +S +VFEAKTIQRMELLVLS
Sbjct  125   GLCFQKDKPWMSQLAAVACLSIAAKVEETQVPLLLDLQVADSRFVFEAKTIQRMELLVLS  184

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+WKMNPVTP SF+D+I RR    ++L  +FLRRCE ++L II+D R + Y PSV+A+A
Sbjct  185   TLKWKMNPVTPLSFIDHIMRRFGFMTNLHLDFLRRCERLILGIITDSRLLHYPPSVIATA  244

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--SAYKRKYGA  1109
              +  VI+ + P    E Q QLM +L + +   EEC  LI E+     +    + KRK+ +
Sbjct  245   VVYFVINEIEPCNAMEYQNQLMTVLKVKQDSFEECHDLILELMGTSGYNICQSLKRKHQS  304

Query  1110  MPGSPKGVME  1139
             +PGSP GV++
Sbjct  305   VPGSPSGVID  314



>emb|CDP02536.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 200/316 (63%), Gaps = 27/316 (9%)
 Frame = +3

Query  243   FLFDALYCEEE----------GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGE  392
              +FD LYCEEE          G    ++D    C         ++S+ LLE DL WED E
Sbjct  19    LIFDGLYCEEERFDEVLGSGLGFEQDESDYYYYCD--------KKSLTLLENDLFWEDEE  70

Query  393   LSSLLSKEQENELFNVVQKNPD----LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             L SLLSKE+E  L N    N D    L  AR E V W+L+V  HY F+  TA+LAV+Y D
Sbjct  71    LVSLLSKEKEAHLGNNRSSNLDSDGLLIVARKEGVGWMLRVIGHYGFTPMTAVLAVSYYD  130

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
             R F  SL  Q  KPWMSQLAAVACLS+AAKVEE  VPLLLDFQVE +++VFEAKTIQRME
Sbjct  131   R-FISSLCFQRDKPWMSQLAAVACLSIAAKVEEIQVPLLLDFQVESAKFVFEAKTIQRME  189

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LLVLS L+WKM  VTP SF+D+I RR  L ++   EFL+RCE +LLS+I D + + YLPS
Sbjct  190   LLVLSTLQWKMKLVTPLSFIDHIVRRFGLMTNRNLEFLKRCEDLLLSVIVDAKLVHYLPS  249

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAY---  1091
             V+ASATML V+  + P    E Q QLM  L + K  + EC KLI E+    Q    Y   
Sbjct  250   VIASATMLIVVKDIDPCRLMEYQNQLMDALKVSKETINECYKLILEIMDD-QGNKHYQNG  308

Query  1092  KRKYGAMPGSPKGVME  1139
             KRK+  +PGSP GV++
Sbjct  309   KRKHQPIPGSPNGVVD  324



>ref|XP_004304033.1| PREDICTED: cyclin-D3-1-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 183/255 (72%), Gaps = 3/255 (1%)
 Frame = +3

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
              WED EL SL +KEQ+    ++   +  L   R EAVEW+LKV +HY F+A TA+LAVNY
Sbjct  76    FWEDEELLSLFAKEQQQPRTHL--NDAVLVARRREAVEWMLKVNAHYGFTALTAILAVNY  133

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
              DR F  S+  Q  KPWM QL +VAC+SLAAKVEET VPLLLD QVE+++YVFEAKT+QR
Sbjct  134   FDR-FISSVHFQRDKPWMVQLVSVACISLAAKVEETEVPLLLDLQVEDTKYVFEAKTVQR  192

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELLVLS L+W+M+PVTP SFLD+I RRL LK+ L  EFL+RCE +L+S++ D R + YL
Sbjct  193   MELLVLSTLQWRMHPVTPVSFLDHIIRRLGLKTSLHWEFLKRCESLLMSLVLDSRCIGYL  252

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYK  1094
             PSV+A+ATM+ VI  + P    E Q QL+G+L I K  V +C  LI E+++     +  K
Sbjct  253   PSVLATATMMRVIDIVEPCRAVEYQTQLLGVLKISKEMVNDCYTLILEMSNYGCKNNPLK  312

Query  1095  RKYGAMPGSPKGVME  1139
             RK+  +PGSP GV++
Sbjct  313   RKHEQIPGSPSGVID  327



>dbj|BAA33153.1| cyclin D [Pisum sativum]
Length=384

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 12/265 (5%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQEN------ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQ  530
             +L  +D EL++L SKE+        +L NVV     L++ R EAV+W+LKV +HY+FS  
Sbjct  66    NLFSQDEELTTLFSKEKTQQETYYEDLKNVVDF-VSLSQPRREAVQWMLKVNAHYAFSPL  124

Query  531   TALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYV  710
             TA LAV Y DR F L+   Q  KPWM QL AV C+SLAAKVEET VPLLLD QV++++YV
Sbjct  125   TATLAVTYFDR-FLLTFHFQKDKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDTKYV  183

Query  711   FEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIIS  890
             FEAKTIQRMELL+LS L+WKM+PVTP SFLD+I  RL LK++L  EFLRRCE +LLS++ 
Sbjct  184   FEAKTIQRMELLILSTLKWKMHPVTPHSFLDHIITRLGLKTNLHWEFLRRCENLLLSVLL  243

Query  891   DCRFMCYLPSVMASATMLHVISRLVPT--VGEESQEQLMGILGIDKVKVEECQKLIKEVA  1064
             D RF+  +PSV+A+ATMLHVI ++  +   G + + QL+ IL I+K KV+EC   I EV 
Sbjct  244   DSRFVGCVPSVLATATMLHVIDQIEESDDNGVDYKNQLLSILKINKEKVDECYNAIVEVT  303

Query  1065  SRIQFESAYKRKYGAMPGSPKGVME  1139
             +   +   +KRKY  +PGSP GV++
Sbjct  304   NENNY--GHKRKYEQIPGSPSGVID  326



>gb|KEH44125.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=384

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 190/265 (72%), Gaps = 11/265 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE---QE---NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQ  530
             +L  +D EL++L SKE   QE   ++L NV+  +  L + R EAVEW+LKV +HY FSA 
Sbjct  68    NLFNKDEELNTLFSKEKIQQETYYDDLKNVMNFDS-LTQPRREAVEWMLKVNAHYGFSAL  126

Query  531   TALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYV  710
             TA LAVNYLDR F LS   Q +KPWM QL AV C+SLAAKVEET VPLLLD QV++++YV
Sbjct  127   TATLAVNYLDR-FLLSFHFQKEKPWMIQLVAVTCISLAAKVEETQVPLLLDLQVQDTKYV  185

Query  711   FEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIIS  890
             FEAKTIQRMELL+LS L+WKM+PVT  SFLD+I RRL LK++L  EFLRRCE +LLS++ 
Sbjct  186   FEAKTIQRMELLILSTLKWKMHPVTTHSFLDHIIRRLGLKTNLHWEFLRRCENLLLSVLL  245

Query  891   DCRFMCYLPSVMASATMLHVISRLVPTVGE--ESQEQLMGILGIDKVKVEECQKLIKEVA  1064
             D RF+  +PSV+A+ATMLHVI ++  +     + + QL+ +L I K KV+EC   I  + 
Sbjct  246   DSRFVGCVPSVLATATMLHVIDQIEQSDDNDVDYKNQLLNVLKISKEKVDECYNAILHLT  305

Query  1065  SRIQFESAYKRKYGAMPGSPKGVME  1139
             +   +    KRKY  +PGSP GV++
Sbjct  306   NTNNY-GYNKRKYEEIPGSPSGVID  329



>ref|XP_006379186.1| hypothetical protein POPTR_0009s10060g [Populus trichocarpa]
 gb|ERP56983.1| hypothetical protein POPTR_0009s10060g [Populus trichocarpa]
Length=296

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 194/286 (68%), Gaps = 14/286 (5%)
 Frame = +3

Query  201   SRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeee------svvll  362
              + ++  Q+ Q   FL DALYCEE     G+ + D    + ++            S+ LL
Sbjct  10    GQNELSTQQEQNTSFLLDALYCEE-----GKWEDDSEEEVLQESPSVNNPSGDLFSISLL  64

Query  363   eqDLLWEDGELSSLLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             EQDL WED EL SL SKEQE +     N V  +P L++AR EAVEW+LKV +H+ FSA T
Sbjct  65    EQDLFWEDEELLSLFSKEQEQQASVSVNNVASDPFLSRARQEAVEWMLKVIAHHGFSALT  124

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             ++LA+NYLDR        +  + WM QL AV CLSLAAKVEET VPLLLD QVE+++Y+F
Sbjct  125   SILAINYLDRFLVSPCYQRDNRSWMIQLVAVTCLSLAAKVEETHVPLLLDLQVEDTKYLF  184

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK+++  EFLRRCE +LL ++SD
Sbjct  185   EAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTNVHWEFLRRCEHLLLYVVSD  244

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKV  1031
              R  CYLPSV+A+ATM+HVI ++      + Q QL+ +L I K+ +
Sbjct  245   SRSGCYLPSVLATATMMHVIDQVETFNPIDYQTQLLDVLKITKLHL  290



>ref|NP_001233794.1| cyclin D3.1 [Solanum lycopersicum]
 emb|CAB51788.1| cyclin D3.1 [Solanum lycopersicum]
 emb|CAB60836.1| CycD3;1 [Solanum lycopersicum]
Length=359

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 204/301 (68%), Gaps = 6/301 (2%)
 Frame = +3

Query  246   LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQEN  425
             L D LYCEE+   +   D     S++   E  ++++ LLE D+ WE  EL++LLSKE E 
Sbjct  16    LLDGLYCEED--RFLDDDLGEWSSLDVGNENVKKTLPLLECDMFWEHDELATLLSKENEF  73

Query  426   EL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKP  602
              L F  +  +  L  AR EA++W+L+V ++Y F+A TA+LAVNY DR F      Q  KP
Sbjct  74    HLGFQSLISDGSLMGARKEALDWMLRVIAYYGFTATTAVLAVNYFDR-FVSGWCFQKDKP  132

Query  603   WMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             WMSQLAAVACLS+AAKVEET VPLLLD QV +S +VFEAKTIQRMELLVLS L+WKMN V
Sbjct  133   WMSQLAAVACLSIAAKVEETQVPLLLDLQVADSRFVFEAKTIQRMELLVLSTLKWKMNLV  192

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
             TP SF+D+I RR    S+L  +FL++CE ++L II+D R + Y PSV+A+A+M +VI+ +
Sbjct  193   TPLSFIDHIMRRFGFMSNLHMDFLKKCERLILDIITDSRLLHYPPSVIATASMFYVINDI  252

Query  963   VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--SAYKRKYGAMPGSPKGVM  1136
              P+   E Q QLM +L + K   EEC  LI E+     ++   + KRK+ ++PGSP GV+
Sbjct  253   EPSNAMEYQNQLMSVLKVRKDIFEECHDLILELMDTACYKLCQSLKRKHHSVPGSPSGVI  312

Query  1137  E  1139
             +
Sbjct  313   D  313



>ref|XP_010558895.1| PREDICTED: cyclin-D3-2-like [Tarenaya hassleriana]
Length=368

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 201/323 (62%), Gaps = 26/323 (8%)
 Frame = +3

Query  222   QEPQKLPF-LFDALYCEEE--------------GEHWGQADRDPSCSIeeqeeeeeesvv  356
             ++ +  PF + D LYCEEE              G+ W ++D          ++    +++
Sbjct  9     EDTRNAPFCVLDGLYCEEESGFVEDLVVGTDGDGDLWDKSDE-------FSQKSPFFTLI  61

Query  357   lleqDLLWEDGELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             L EQD+ W+D EL SL SKE E +  F     +  L   R EA++W+ +V SHY  S+ T
Sbjct  62    LPEQDMFWDDDELLSLASKENETKPCFCDKILDEFLVLCRKEALDWIFRVKSHYGLSSLT  121

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             ALLAVNY DR F  S++ QT+KPWMSQLAAVACLSLAAKVEE  VPLLLD QVEE+ YVF
Sbjct  122   ALLAVNYFDR-FITSIKFQTEKPWMSQLAAVACLSLAAKVEEIQVPLLLDLQVEEARYVF  180

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+W+M+PVTP SF D+I RR   KSH   EF+RRCE +LLS+I D
Sbjct  181   EAKTIQRMELLVLSTLQWRMHPVTPISFFDHIIRRFGSKSHHHWEFMRRCERLLLSVIVD  240

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI  1073
              RFM Y PSV+A+A M++V+    P    E Q QLM +L + + K  EC +L+ E+    
Sbjct  241   SRFMSYTPSVLATAIMIYVMKEFKPCDEAEYQSQLMNLLKVSQEKANECYELLLEINGSQ  300

Query  1074  QFESAYKRKYGAMPGSPKGVMEV  1142
                   +R    +P SP GV E 
Sbjct  301   NM--GKRRSNLRVPASPTGVFEA  321



>ref|XP_010691714.1| PREDICTED: cyclin-D3-1-like [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 199/294 (68%), Gaps = 12/294 (4%)
 Frame = +3

Query  216   PFQEPQ-KLPF-LFDALYCEEEGEHWGQADR--------DPSCSIeeqeeeeeesvvlle  365
             P QE Q + PF + DALYCEEE       +         + + +           ++LLE
Sbjct  3     PSQEFQEQNPFSVLDALYCEEEKWEDEDENDNDEEIRSFERNNNGGGGGGSGLLPLLLLE  62

Query  366   qDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             QDL WED EL SL  KE E   F +   +  L+  R EAVEW+LKV S+Y F   T +LA
Sbjct  63    QDLFWEDEELQSLFFKETEGR-FEMGSFDISLSSLRKEAVEWILKVNSYYGFCTLTCVLA  121

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNYLD+ +  S   Q  KPW+ QLAAV CLSLAAKVEET+VPLLLD QVE  +Y+FEAKT
Sbjct  122   VNYLDK-YLSSFHFQKDKPWVFQLAAVTCLSLAAKVEETYVPLLLDLQVESGKYMFEAKT  180

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             +Q+MELLVL+ LEWKMNPVTP SF D+I RRL LK+HL  EFLRRCEG+LLS++SD RFM
Sbjct  181   VQKMELLVLTTLEWKMNPVTPLSFFDHIIRRLGLKNHLHWEFLRRCEGLLLSLLSDWRFM  240

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
              ++PSV+A+ATM+HVI ++ P+   + Q QL+G+L I K KV +C +LI E +S
Sbjct  241   SFVPSVLATATMMHVIDQIEPSNPVDYQNQLLGVLNISKDKVNDCYQLIVEKSS  294



>ref|XP_003550037.1| PREDICTED: cyclin-D3-2-like [Glycine max]
 gb|KHN27072.1| Cyclin-D3-2 [Glycine soja]
Length=371

 Score =   266 bits (681),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 179/262 (68%), Gaps = 8/262 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DL WED EL SL++KE E  L F+ V  N  L   R EAV W+ KV  HY FSA T +LA
Sbjct  60    DLFWEDEELVSLIAKEGETHLCFHGVVANGALEGPRVEAVNWISKVCGHYGFSALTTVLA  119

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNY DR F  SL+ Q  KPWM+QL AVACLSLA K EET VPLLLD QVEES +VFEAKT
Sbjct  120   VNYFDR-FITSLKFQNDKPWMTQLTAVACLSLAVKTEETHVPLLLDLQVEESRFVFEAKT  178

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVLS L+W+M+PVTP SF ++I RRL LKS L  EFL RCE VLL++I+D R M
Sbjct  179   IQRMELLVLSTLKWRMHPVTPISFFEHIVRRLGLKSRLHWEFLWRCERVLLNVIADSRVM  238

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
              YLPS +A+ATM+ VI  +      E  +QL+G+L I + +V +C K+I+++     +E 
Sbjct  239   SYLPSTLAAATMIRVIKEIESFNATEYIDQLLGLLKISEEQVNQCYKIIQKLLG--CYEG  296

Query  1086  AY----KRKYGAMPGSPKGVME  1139
              Y    KRK  + PGSP  V +
Sbjct  297   IYSLHQKRKRLSEPGSPGAVTD  318



>gb|ACU23438.1| unknown [Glycine max]
Length=371

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 179/262 (68%), Gaps = 8/262 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DL WED EL SL++KE E  L F+ V  N  L   R EAV W+ KV  HY FSA T +LA
Sbjct  60    DLFWEDEELVSLIAKEGETHLCFHGVVANGALEGPRVEAVNWISKVCGHYGFSALTTVLA  119

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNY DR F  SL+ Q  KPWM+QL AVACLSLA K EET VPLLLD QVEES +VFEAKT
Sbjct  120   VNYFDR-FITSLKFQNDKPWMTQLTAVACLSLAVKTEETHVPLLLDLQVEESRFVFEAKT  178

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVLS L+W+M+PVTP SF ++I RRL LKS L  EFL RCE VLL++I+D R M
Sbjct  179   IQRMELLVLSTLKWRMHPVTPISFFEHIVRRLGLKSRLHWEFLWRCERVLLNVIADSRVM  238

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
              YLPS +A+ATM+ VI  +      E  +QL+G+L I + +V +C K+I+++     +E 
Sbjct  239   SYLPSTLAAATMIRVIKEIESFNATEYIDQLLGLLKISEEQVNQCYKIIQKLLG--CYEG  296

Query  1086  AY----KRKYGAMPGSPKGVME  1139
              Y    KRK  + PGSP  V +
Sbjct  297   IYSLHQKRKRLSEPGSPGAVTD  318



>ref|XP_007155890.1| hypothetical protein PHAVU_003G240500g [Phaseolus vulgaris]
 gb|ESW27884.1| hypothetical protein PHAVU_003G240500g [Phaseolus vulgaris]
Length=371

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 199/310 (64%), Gaps = 13/310 (4%)
 Frame = +3

Query  240   PFLFDALYCEEEGEHWGQADRDPS---CSIeeqeeeeeesvvl----leqDLLWEDGELS  398
             P + DAL CEE      + D D S   C I   +    +   L    L+ DL WED EL 
Sbjct  12    PSILDALLCEERDTF--EEDLDASGADCEINNDDPSGRKLQSLPLVLLQNDLFWEDEELV  69

Query  399   SLLSKEQENELFNVVQ-KNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             SL+SKE E    +++   +  L  +R EAV W+ KV  HY FSA T +LAVNY DR F  
Sbjct  70    SLISKEGETHSCSLIAIADGPLEGSRVEAVNWISKVCGHYGFSALTTVLAVNYFDR-FIP  128

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             SL   T KPWM+QL AVACLSLAAK EET VPLLLD QVEES +VFEAKTIQRMELLVLS
Sbjct  129   SLRFHTDKPWMTQLTAVACLSLAAKTEETHVPLLLDLQVEESRFVFEAKTIQRMELLVLS  188

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+W+M+PVTP SF ++I RRL LKS L  EFL RCE VLL++ +D R M YLPS +A+A
Sbjct  189   TLKWRMHPVTPISFFEHIVRRLGLKSRLHWEFLWRCERVLLNVTADSRAMSYLPSTLAAA  248

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ--FESAYKRKYGA  1109
             TM+HVI  +      +  +QL+G+L I + +V +C KL++++  R +  +    KRK  +
Sbjct  249   TMIHVIKEIESFNATKYIDQLLGLLKISEEQVNQCYKLMQKILGRNEGIYSLHQKRKRLS  308

Query  1110  MPGSPKGVME  1139
              P SP G+++
Sbjct  309   EPSSPGGILD  318



>ref|XP_006425979.1| hypothetical protein CICLE_v10025890mg [Citrus clementina]
 gb|ESR39219.1| hypothetical protein CICLE_v10025890mg [Citrus clementina]
Length=282

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 162/222 (73%), Gaps = 8/222 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPD----LAKARSEAVEWVLKVTSHYSFSAQTA  536
             DL W+D EL SL+ KE++    N V  +P     L  AR E VEWVL+V +H+ F+A TA
Sbjct  61    DLFWDDNELLSLICKEKKE---NFVPSDPISDEILILARKEVVEWVLRVKAHFGFTALTA  117

Query  537   LLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFE  716
             +LAVNY DR F LS   Q  KPWM QL AVACLSLAAKV+ET VPLLLD QV++ +YVFE
Sbjct  118   ILAVNYFDR-FILSHSFQKDKPWMGQLVAVACLSLAAKVDETQVPLLLDLQVKDPKYVFE  176

Query  717   AKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDC  896
             AKTIQRMELLVLS L+W+MNPVTP SF D+I RRL LK+HL  EFL RCE +LLS+I+D 
Sbjct  177   AKTIQRMELLVLSTLQWRMNPVTPISFFDHIVRRLGLKTHLHWEFLYRCEHLLLSVIADS  236

Query  897   RFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDK  1022
             RFMCYLPS +A+ATMLH I  + P    E Q  LMG+L I +
Sbjct  237   RFMCYLPSTLATATMLHTIQEVEPCNPVEHQNLLMGVLNISQ  278



>ref|NP_190576.1| cyclin-D3-3 [Arabidopsis thaliana]
 sp|Q9SN11.1|CCD33_ARATH RecName: Full=Cyclin-D3-3; AltName: Full=G1/S-specific cyclin-D3-3; 
Short=CycD3;3 [Arabidopsis thaliana]
 emb|CAB62115.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AAK96569.1| AT3g50070/F3A4_150 [Arabidopsis thaliana]
 gb|AAL36079.1| AT3g50070/F3A4_150 [Arabidopsis thaliana]
 gb|AAM65041.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AEE78623.1| cyclin-D3-3 [Arabidopsis thaliana]
Length=361

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 198/307 (64%), Gaps = 15/307 (5%)
 Frame = +3

Query  222   QEPQKLPF-LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELS  398
             +E Q  PF + D L+CEEE E   Q D    C  E  E+    ++ L + D+LW+D ELS
Sbjct  7     EESQNAPFCVLDGLFCEEESEFHEQVDL---CD-ESVEKFPFLNLGLSDHDMLWDDDELS  62

Query  399   SLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             +L+SK QE  L++ +  +  L   R +A++W+ KV SHY F++ TALLAVNY DR F  S
Sbjct  63    TLISK-QEPCLYDEILDDEFLVLCREKALDWIFKVKSHYGFNSLTALLAVNYFDR-FITS  120

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
              + QT KPWMSQL A+ACLSLAAKVEE  VP LLDFQVEE+ YVFEAKTIQRMELLVLS 
Sbjct  121   RKFQTDKPWMSQLTALACLSLAAKVEEIRVPFLLDFQVEEARYVFEAKTIQRMELLVLST  180

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+M+PVTP SF D+I RR   KSH   EFL RCE +LLSII D RF+ + PSV+A+A 
Sbjct  181   LDWRMHPVTPISFFDHIIRRYSFKSHHQLEFLSRCESLLLSIIPDSRFLSFSPSVLATAI  240

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM--  1112
             M+ VI  L        Q QLM +L +D  KV +C +L+      +    + KR    M  
Sbjct  241   MVSVIRDLKMCDEAVYQSQLMTLLKVDSEKVNKCYELV------LDHSPSKKRMMNWMQQ  294

Query  1113  PGSPKGV  1133
             P SP GV
Sbjct  295   PASPIGV  301



>emb|CDX76265.1| BnaA08g11350D [Brassica napus]
Length=365

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 200/310 (65%), Gaps = 9/310 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             +E     FL DALYCEEE   W   +     S            VLLEQDL WED +L +
Sbjct  10    REEHSTSFLLDALYCEEEK--WDDEEVVEENSSYSSSSSTTSPFVLLEQDLFWEDEDLVA  67

Query  402   LLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             L +KE+E EL  +   +  LA  R EAV W+L+V SHY FS   A+LA+ YLD+ F  S 
Sbjct  68    LFTKEEEEELSCL--DDLYLATDRKEAVGWILRVNSHYGFSTLAAVLAITYLDK-FICSY  124

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMELL+LS L
Sbjct  125   SLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTIQRMELLILSTL  184

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKM+ VTP SFLD+I RRL LK++   +FL RC  +LLS+ISD RF+ Y PSV+A+ATM
Sbjct  185   QWKMHLVTPLSFLDHIIRRLGLKNNAHWDFLNRCHRLLLSVISDSRFVGYRPSVVAAATM  244

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI--KEVASRIQFESAYKRKYGAMP  1115
             + VI ++ P      Q +L+ +L I K KVE C  LI    +  +I+ +++ KRK    P
Sbjct  245   MRVIDQVEPFDPLSHQTKLLNVLNITKEKVEPCYNLILQDRIGLQIETQTSRKRKSRDSP  304

Query  1116  G--SPKGVME  1139
                SP  V++
Sbjct  305   SLISPSCVID  314



>ref|XP_011000145.1| PREDICTED: cyclin-D3-1-like [Populus euphratica]
Length=386

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 203/310 (65%), Gaps = 8/310 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             Q+ Q   F  DALYCEE    W + + +     E     +   + LLEQDL WED EL S
Sbjct  17    QQEQNASFQLDALYCEEG--RW-EDESEEEVLQESTFVNDLFPLSLLEQDLFWEDEELLS  73

Query  402   LLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             L SKE+E +     N V  +P L++AR EAVEW+LKV +HY FS  T++LA NYLDR   
Sbjct  74    LFSKEEEQQASVSVNNVADDPFLSRARQEAVEWMLKVIAHYGFSTLTSILAFNYLDRFLS  133

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
                  +  +PWM QL AV CLSLAAKVEET VP LLD QVE+++YVFEA TIQRMELLVL
Sbjct  134   GPCYQRDSRPWMIQLVAVTCLSLAAKVEETHVPFLLDLQVEDTKYVFEAITIQRMELLVL  193

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+WKM+PVTP  FLD+I RRL LK+H+  EFLRRCE +LLS++SD R + YLPSV+A+
Sbjct  194   STLKWKMHPVTPLPFLDHIIRRLGLKTHVHWEFLRRCEHLLLSVVSDSRSVSYLPSVLAT  253

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASR--IQFESAYKRKYG  1106
             ATM+HVI ++      + Q QL+ +L I K KV  C  LI E++         + KRK+ 
Sbjct  254   ATMMHVIDQVESFNPIDYQNQLLEVLKITKEKVNGCYGLILELSRNRTTANNKSQKRKFE  313

Query  1107  AMPGSPKGVM  1136
              +P SP GV+
Sbjct  314   PVPSSPSGVI  323



>ref|XP_010547997.1| PREDICTED: cyclin-D3-1-like [Tarenaya hassleriana]
Length=385

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 156/315 (50%), Positives = 206/315 (65%), Gaps = 13/315 (4%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlle------qDLLWE  383
             ++ Q   FL DALYCEEE   WG  +      + E       S           QDL WE
Sbjct  18    EQEQSSSFLLDALYCEEET--WGDDEEGEVVELSENTSFSSSSSPSPSPFFVLDQDLFWE  75

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D EL SL +KEQE+EL ++   +  L+  R EAV+W+L+V+S Y FS  TA+LA+ YLDR
Sbjct  76    DEELISLFAKEQEHELSSL--DDAYLSSDRKEAVDWILRVSSQYGFSTLTAVLAMKYLDR  133

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL AV CLSLAAKVEET VPLL+D QVEE++YVFEAKTIQRMEL
Sbjct  134   -FICSYSLQRDKPWMLQLVAVTCLSLAAKVEETRVPLLIDLQVEETKYVFEAKTIQRMEL  192

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L WKM+ +TP SFLD+I RRL LK+++  +FLRRCE +LLS++SD RF+ YLPSV
Sbjct  193   LILSTLGWKMHHITPISFLDHIIRRLGLKNNVHWDFLRRCERLLLSVVSDSRFVGYLPSV  252

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA-SRIQFESAYKRK  1100
             +A+ATM+HVI ++     +  Q++L+ +L + K KV+ C  LI E+  +R +     KRK
Sbjct  253   LAAATMMHVIEQVEHFDPKLYQDKLLDVLKLSKEKVKTCYDLILELPLNRNENPFNRKRK  312

Query  1101  YG-AMPGSPKGVMEV  1142
             +  +   SP  V++ 
Sbjct  313   FHESTLSSPSCVIDT  327



>ref|XP_010107865.1| hypothetical protein L484_027452 [Morus notabilis]
 gb|EXC17265.1| hypothetical protein L484_027452 [Morus notabilis]
Length=400

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 184/282 (65%), Gaps = 29/282 (10%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPD---------------------LAKARSEAV  485
             DL WED EL SL +KE++    N   + PD                     L  AR EAV
Sbjct  62    DLFWEDEELVSLFAKEEQQ---NKQTQYPDFEEEEEEEEEEEEEEENSMSFLKLARREAV  118

Query  486   EWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETF  665
             EW+LKV  HY F+A TA+LA+NYLDR F  SL  Q  KPWM  L  V CLSLAAKVEET 
Sbjct  119   EWILKVNGHYGFTALTAVLAINYLDR-FLSSLRFQRDKPWMIHLVTVTCLSLAAKVEETQ  177

Query  666   VPLLLDFQVEES-EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLC  842
             VPLLLD QV +S +YVFEAKTIQRMELLVLS L+WKM+PVTP SFLD+I RRL LK++L 
Sbjct  178   VPLLLDLQVNDSSKYVFEAKTIQRMELLVLSTLQWKMHPVTPLSFLDHIVRRLGLKTNLH  237

Query  843   CEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDK  1022
              EFLRRCE +LLS+ SD RF+ +LPSV+A+ATM+ VI  + P    E + QL+ +L + +
Sbjct  238   WEFLRRCERLLLSLFSDSRFIGFLPSVLATATMMRVIDHVEPCNAIEYKTQLLSVLKLSE  297

Query  1023  VKVEECQKLIKEVASRIQFESAY--KRKYG-AMPGSPKGVME  1139
              KVE+C  LI E++S       Y  KRK    +P SP GV++
Sbjct  298   EKVEKCYTLIVELSSGYTNNYGYNNKRKINEEVPSSPSGVID  339



>gb|AAL47480.1| cyclin D3 [Helianthus tuberosus]
Length=357

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 183/267 (69%), Gaps = 15/267 (6%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENE-----LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             DL WE  EL SL +KEQE +       +  + +P +  AR EAV+W+LKV S Y F+  T
Sbjct  54    DLSWEHEELVSLFTKEQEQQKQTPCTLSFGKTSPSVFAARKEAVDWILKVKSCYGFTPLT  113

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             A+LA+NYLDR F  SL  Q  KPWM QL AV+CLSLAAKVEET VPLLLD QVE+++Y+F
Sbjct  114   AILAINYLDR-FLSSLHFQEDKPWMIQLVAVSCLSLAAKVEETQVPLLLDLQVEDTKYLF  172

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAK IQ+MELLV+S L+W+MNPVTP SFLD+I RRL L  H+  +F ++CE ++L ++SD
Sbjct  173   EAKNIQKMELLVMSTLKWRMNPVTPISFLDHIVRRLGLTDHVHWDFFKKCEAMILCLVSD  232

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI  1073
              RF+CY PSV+A+ATMLHV+  + P    + + QL+ +L   K  + EC +LI E+A   
Sbjct  233   SRFVCYKPSVLATATMLHVVDEIDPPNCIDYKSQLLDLLKTTKDDINECYELIVELA---  289

Query  1074  QFESAYKRKYGA-----MPGSPKGVME  1139
              ++   KRK+ A      P SP GV++
Sbjct  290   -YDHHNKRKHDANETTTNPVSPAGVID  315



>ref|XP_009108745.1| PREDICTED: cyclin-D3-1-like [Brassica rapa]
Length=368

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 203/311 (65%), Gaps = 9/311 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADR-DPSCSIeeqeeeeeesvvlleqDLLWEDGELS  398
             +E     FL DALYCEEE   W   +  + + S            VLLEQDL WED +L 
Sbjct  10    REEHSTSFLLDALYCEEEK--WDDEEVVEENSSYSSFSSSTTSPFVLLEQDLFWEDEDLV  67

Query  399   SLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             +L +KE++ EL + +  +  LA  R EAV W+L+V SHY FS   A+LA+ YLD+ F  S
Sbjct  68    TLFTKEEDQELISCLD-DVYLATDRKEAVGWILRVNSHYGFSTLAAVLAITYLDK-FICS  125

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
                Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMELL+LS 
Sbjct  126   YSLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTIQRMELLILST  185

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+WKM+ +TP SFLD+I RRL LK++   +FL RC  +LLS+ISD RF+ Y PSV+A+AT
Sbjct  186   LQWKMHLITPISFLDHIIRRLGLKNNAHWDFLNRCHRLLLSVISDSRFVGYRPSVVAAAT  245

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI--KEVASRIQFESAYKRKYGAM  1112
             M+ VI ++ P      Q +L+ +L I K KVE C  LI    +  +I+ +++ KRK    
Sbjct  246   MMRVIDQVEPFDPLSHQTKLLNVLNITKEKVEPCYNLILQDRIGLQIETQTSRKRKSRDS  305

Query  1113  PG--SPKGVME  1139
             P   SP  V++
Sbjct  306   PSLISPSCVID  316



>gb|KEH31486.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=359

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 180/263 (68%), Gaps = 9/263 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFN---VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             D+ WED E+ SL+ KE+E  L N   V+  +  L ++R E V WV +V +HY FS  T +
Sbjct  47    DMFWEDDEVLSLIMKEKETHLINDDFVIDGS--LNESRVEGVNWVSRVCAHYGFSTLTTV  104

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNY DR F  SL+ Q  KPWM+QL AVACLSLAAK+EET VPLLLDFQVEES +VFEA
Sbjct  105   LAVNYFDR-FVTSLKFQKDKPWMTQLTAVACLSLAAKMEETHVPLLLDFQVEESRFVFEA  163

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRMELLVLS L+W+M PVTP SF ++I RRL LKS L  EF+ RCE VLL +I D R
Sbjct  164   KTIQRMELLVLSTLKWRMLPVTPISFFEHIVRRLGLKSRLHWEFMWRCEKVLLHVIVDSR  223

Query  900   -FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE--VASR  1070
               M YLPS +A+ATM+HVI  + P    E  EQL+G+L I + +V +C KL+ +  V   
Sbjct  224   VMMSYLPSTLAAATMIHVIKEIEPFNATEYIEQLLGLLKISEEQVNQCYKLMLKLLVCDD  283

Query  1071  IQFESAYKRKYGAMPGSPKGVME  1139
               +    KRK  + P SP GV++
Sbjct  284   GIYSLHQKRKRVSEPSSPGGVID  306



>gb|KHG22216.1| Cyclin-D3-2 -like protein [Gossypium arboreum]
Length=337

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 188/283 (66%), Gaps = 7/283 (2%)
 Frame = +3

Query  222   QEPQKLPFL-FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELS  398
             Q+ Q  P +  D L CEEE    G    + + S    E+E    + L E DL WED EL 
Sbjct  9     QQIQSPPLMNLDGLLCEEED--LGVYSFEENGSEIPAEKENFVPLFLNEHDLFWEDDELI  66

Query  399   SLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             SL+SKE++      V   PD  L  AR EA++WV KV +HY F+A T +LAVNY DR F 
Sbjct  67    SLMSKEKQTHQ-GYVDFFPDESLVLARKEALDWVFKVKAHYGFNALTMVLAVNYFDR-FI  124

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
             LS + Q   PWM+QL  VACLSLA KVEET VPLLLD QVEE+ YVF++ TIQRMELLVL
Sbjct  125   LSFKFQEDTPWMAQLTIVACLSLATKVEETQVPLLLDLQVEEARYVFDSNTIQRMELLVL  184

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+MNPVTP SF D+I RRL L++HL  +FLRRCE +LL +I+D RF+ Y PS++A+
Sbjct  185   STLQWRMNPVTPISFFDHITRRLGLRTHLHWDFLRRCEHLLLFLITDSRFVTYTPSILAA  244

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV  1061
             ATMLHVI  + P    E Q+QL+ +L   + KV  C KLI E+
Sbjct  245   ATMLHVIKEVEPCHYPEYQKQLIAVLKACEDKVNACYKLISEL  287



>ref|NP_001275355.1| D-type cyclin family 3 subgroup 1 [Solanum tuberosum]
 gb|ABY25838.1| D-type cyclin family 3 subgroup 1 [Solanum tuberosum]
Length=363

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 182/260 (70%), Gaps = 4/260 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             D+ WE  EL++LLSKE+E  L F  +  +  L   R EA++W+L+V  +Y F+A TA+LA
Sbjct  59    DMFWEHDELATLLSKEKEFHLGFESLISDGSLMGVRKEALDWMLRVIGYYGFTATTAVLA  118

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             V+Y DR F   L  Q  KPWM QLAAVACLS+AAKVEET VPLLLD QV +S++VFEAKT
Sbjct  119   VSYFDR-FVSGLXFQKDKPWMIQLAAVACLSIAAKVEETQVPLLLDLQVADSKFVFEAKT  177

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQRMELLVLS L+WKMN VTP SF+D+I RR    ++L  +FL++CE ++L II+D R +
Sbjct  178   IQRMELLVLSTLKWKMNLVTPLSFIDHIMRRFGFMTNLHLDFLKKCERLILDIITDSRLL  237

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE-  1082
              Y PSV+A+A+M +VI+ + P    E Q QLM +L + K   EEC  LI E+     ++ 
Sbjct  238   HYPPSVIATASMFYVINEIEPNNAMEYQNQLMSVLKVRKDSFEECNDLILELMGTSCYKL  297

Query  1083  -SAYKRKYGAMPGSPKGVME  1139
               + KRK+ ++PGSP GV++
Sbjct  298   CQSLKRKHHSVPGSPSGVID  317



>ref|XP_003524659.1| PREDICTED: cyclin-D3-2-like [Glycine max]
 gb|KHN19833.1| Cyclin-D3-2 [Glycine soja]
Length=383

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 191/300 (64%), Gaps = 22/300 (7%)
 Frame = +3

Query  204   RKKMPF----QEPQKLPFLFDALYCEE----------EGEHWGQADRDPSCSIeeqeeee  341
             R+KM      Q     P   D+L CEE           G+     + DPS       + +
Sbjct  11    RRKMALGDDAQHHSHSPSFLDSLLCEERETFEEDFDANGDECETENNDPSV-----IKSQ  65

Query  342   eesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSF  521
                +VL + DL WED EL SL++KE E  L +    +  L   R EAV WV KV+ HY F
Sbjct  66    PLPLVLYDNDLFWEDDELVSLIAKEGETHLRSF--SDGALEGPRVEAVNWVSKVSGHYGF  123

Query  522   SAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             SA T +LAVNY DR F  SL+ Q  KPWM+QLAAVACLSLAAK EET VPLLLD QVEES
Sbjct  124   SALTTVLAVNYFDR-FITSLKFQRDKPWMTQLAAVACLSLAAKTEETHVPLLLDLQVEES  182

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLS  881
              +VFEAKTIQRMELLVLS L+W+M PVTP SF ++I RRL LKS L  EFL RCE VLL+
Sbjct  183   RFVFEAKTIQRMELLVLSTLKWRMLPVTPISFFEHIVRRLGLKSRLHWEFLWRCERVLLN  242

Query  882   IISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV  1061
             II+D R M YLPS +A+ATM+HVI  +      E  +QL+G+L I + +V +C ++I+++
Sbjct  243   IIADSRVMSYLPSTLAAATMIHVIKEIESFNATEYIDQLLGLLKISEEQVNKCYRIIQKL  302



>ref|NP_195142.1| cyclin-D3-1 [Arabidopsis thaliana]
 sp|P42753.3|CCD31_ARATH RecName: Full=Cyclin-D3-1; AltName: Full=Cyclin-delta-3; Short=Cyclin-d3; 
AltName: Full=G1/S-specific cyclin-D3-1; Short=CycD3;1 
[Arabidopsis thaliana]
 emb|CAA17556.1| cyclin delta-3 [Arabidopsis thaliana]
 emb|CAB80133.1| cyclin delta-3 [Arabidopsis thaliana]
 dbj|BAD95437.1| cyclin delta-3 [Arabidopsis thaliana]
 gb|AEE86335.1| cyclin-D3-1 [Arabidopsis thaliana]
Length=376

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 197/304 (65%), Gaps = 12/304 (4%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK+   +E Q   FL DALYCEEE   W   D                  V+L+QDL WE
Sbjct  4     RKEEESREEQSNSFLLDALYCEEE--KWD--DEGEEVEENSSLSSSSSPFVVLQQDLFWE  59

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L SKE+E  L  +   +  L+  R EAV W+L+V +HY FS   A+LA+ YLD+
Sbjct  60    DEDLVTLFSKEEEQGLSCL--DDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAITYLDK  117

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMEL
Sbjct  118   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMEL  176

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS LEWKM+ +TP SF+D+I RRL LK++   +FL +C  +LLS+ISD RF+ YLPSV
Sbjct  177   LILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKCHRLLLSVISDSRFVGYLPSV  236

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRIQFESA  1088
             +A+ATM+ +I ++ P      Q  L+G+L + K KV+ C  LI       +  +IQ +S+
Sbjct  237   VAAATMMRIIEQVDPFDPLSYQTNLLGVLNLTKEKVKTCYDLILQLPVDRIGLQIQIQSS  296

Query  1089  YKRK  1100
              KRK
Sbjct  297   KKRK  300



>dbj|BAH15073.1| cyclin D3 [Ipomoea batatas]
Length=344

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 205/320 (64%), Gaps = 10/320 (3%)
 Frame = +3

Query  195   SSSRKKMPFQEPQKLPFLFDALYCEEEG--EHWGQADRDPSCSIeeqeeeeeesvvlleq  368
             + S+K   F+    + F  DAL+CEEE   E  G   R  +    E    ++  +  LE 
Sbjct  5     THSQKDQAFESRNPI-FSPDALFCEEERFEEDVGGWSRFQTDDYAEISVLKKPLLTFLES  63

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED EL +LLSKE++      V  +  L  AR+EAV+W+LKV  HY F+A TA+LAV
Sbjct  64    DLFWEDDELLALLSKEKD---IGCVDLDQSLMLARNEAVDWMLKVIRHYGFNALTAVLAV  120

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F   +  Q  KPWMSQLAAVAC+S+AAKVEE  VPLLLD QV E++++FEAKTI
Sbjct  121   NYFDR-FISGVCFQRDKPWMSQLAAVACVSIAAKVEEIQVPLLLDLQVAETKFLFEAKTI  179

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS L+W+MN VTP SF+D+I RR +L ++L  EFL  CE ++LS+I+D R + 
Sbjct  180   QRMELLVLSTLQWRMNLVTPISFIDHIIRRFKLMTNLHWEFLGLCERLILSVIADSRLLQ  239

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS---RIQF  1079
             YLPSV+A+A M  VI  + P    + + +L+ +L I K KV+EC  LI E+       Q 
Sbjct  240   YLPSVVATAIMFTVIKEIEPCNAMKYKNELVCLLQISKEKVDECYNLIIELTGGKRNKQH  299

Query  1080  ESAYKRKYGAMPGSPKGVME  1139
                 KRKY   PGSP GV++
Sbjct  300   CQHPKRKYEPEPGSPNGVID  319



>emb|CDY57741.1| BnaC03g77070D [Brassica napus]
Length=365

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 199/310 (64%), Gaps = 9/310 (3%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             +E     FL DALYCEEE   W   +     S            VLLEQDL WED +L +
Sbjct  10    REEHSTSFLLDALYCEEEK--WDDEEVVEENSSYSSSSSTTSPFVLLEQDLYWEDEDLVT  67

Query  402   LLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             L +KE+E  L  +   +  LA  R EAV W+L+V +HY FS   A+LA+ YLD+ F  S 
Sbjct  68    LFTKEEEQGLSCL--DDVYLATDRKEAVGWILRVNAHYGFSTLAAVLAITYLDK-FICSY  124

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
               Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMELL+LS L
Sbjct  125   SLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTIQRMELLILSTL  184

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +WKM+ VTP SFLD+I RRL LK++   +FL RC  +LL++ISD RF+ Y PSV+A+ATM
Sbjct  185   QWKMHLVTPLSFLDHIIRRLGLKNNAHWDFLNRCHRLLLTVISDSRFVGYRPSVVAAATM  244

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI--KEVASRIQFESAYKRKYGAMP  1115
             + VI ++ P      Q +L+ +L I K KVE C  LI    +  +I+ +++ KRK    P
Sbjct  245   MRVIYQVEPFDPLSHQTKLLNVLNITKEKVEPCYNLILQDRIGLQIETQTSRKRKSRDSP  304

Query  1116  G--SPKGVME  1139
                SP  V++
Sbjct  305   SLISPSCVID  314



>ref|XP_009116335.1| PREDICTED: cyclin-D3-1 [Brassica rapa]
Length=373

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 176/252 (70%), Gaps = 5/252 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E  L  V   +  LA  R EAV W+L+V SHY FS   A+LA+
Sbjct  61    DLFWEDEDLVTLFSKEEEQGLGCV--DDVYLATDRKEAVGWILRVNSHYGFSTLAAVLAI  118

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  119   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTI  177

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+WKM+ VTP SFLD+I RRL LK++   +FL RC  ++LS+ISD RF+ 
Sbjct  178   QRMELLILSTLQWKMHLVTPLSFLDHIIRRLGLKNNSHWDFLNRCHRLILSVISDSRFVG  237

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE--  1082
             YLPSV+A+ATM+ +I ++ P      Q +L+G+L I K KV+ C  LI E+   +Q E  
Sbjct  238   YLPSVVAAATMMRIIEQVEPFDPLSYQTKLLGVLNITKEKVKSCYDLILELPMGLQIETQ  297

Query  1083  SAYKRKYGAMPG  1118
             S  KRK G  P 
Sbjct  298   SRRKRKSGESPS  309



>emb|CAA58287.1| cyclin delta-3 [Arabidopsis thaliana]
Length=376

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 197/304 (65%), Gaps = 12/304 (4%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK+   +E Q   FL DALYCEEE   W   D                  V+L+QDL WE
Sbjct  4     RKEEESREEQSNSFLLDALYCEEE--KWD--DEGEEVEENSSLSSSSSPFVVLQQDLFWE  59

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L SKE+E  L  +   +  L+  R EAV W+L+V +HY FS   A+LA+ YLD+
Sbjct  60    DEDLVTLFSKEEEQGLSCL--DDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAITYLDK  117

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMEL
Sbjct  118   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMEL  176

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS LEWKM+ +TP SF+D+I RRL LK++   +FL +C  +LLS+ISD RF+ YLPSV
Sbjct  177   LILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKCHRLLLSVISDSRFVGYLPSV  236

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRIQFESA  1088
             +A+ATM+ +I ++ P      Q  L+G+L + K KV+ C  LI       +  +IQ +S+
Sbjct  237   VAAATMMRIIEQVDPFDPLSYQTNLLGVLNLTKEKVKTCYDLILQLPVDRICLQIQIQSS  296

Query  1089  YKRK  1100
              KRK
Sbjct  297   KKRK  300



>ref|XP_010028178.1| PREDICTED: cyclin-D3-3-like [Eucalyptus grandis]
 gb|KCW54857.1| hypothetical protein EUGRSUZ_I00802 [Eucalyptus grandis]
Length=377

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 200/318 (63%), Gaps = 18/318 (6%)
 Frame = +3

Query  228   PQKLPFLFDALYCEEEG----------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             P   PF  D LYCE+E           E+ G   RD  C I++              DL 
Sbjct  13    PTAPPFSPDGLYCEDETFGEDLADNACEYAGGGARDGLCEIKDPTLPPSLLGQ----DLF  68

Query  378   WEDGELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WEDGEL+SL+S+E      ++ +  +  +A AR +AV W+L+V  HY F   TA+LAVNY
Sbjct  69    WEDGELASLVSRETGTHPCWDELISDGSVALARKDAVGWILRVHGHYGFRPLTAMLAVNY  128

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR FFLS   Q  +PW+SQL A+ACLS+AAKVEET VP+LLD QV  +++VFE++TIQR
Sbjct  129   LDR-FFLSRSYQRDRPWISQLVALACLSVAAKVEETQVPILLDLQVANAKFVFESRTIQR  187

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELL++S L+W+MN VTP SF D+I RR  L ++L  +F   CE +LLS+++D R   +L
Sbjct  188   MELLLMSTLDWRMNSVTPISFFDHILRRFGLTTNLHRQFFWMCERLLLSVVADVRLASFL  247

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ--FESA  1088
             PSV+A+A ML+V   + P +  E  +QL+ +L I++ +V EC +LI E++          
Sbjct  248   PSVVATAAMLYVNKEIEPCICSEFLDQLLSLLKINEDRVNECYELILELSIDHPEILNYK  307

Query  1089  YKRKYGAMPGSPKGVMEV  1142
             +KRK G++P SP GV++ 
Sbjct  308   HKRKRGSVPSSPSGVIDT  325



>ref|XP_008440318.1| PREDICTED: cyclin-D3-3 [Cucumis melo]
Length=342

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 203/307 (66%), Gaps = 10/307 (3%)
 Frame = +3

Query  243   FLFDALYCEE----EGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLS  410
             FL DAL+CEE    E      +D D       ++++   +  LLE D LW D +L SL+S
Sbjct  18    FLLDALFCEELCCDEDLPVNGSDEDTQYWETLRKDQPFLAFNLLENDPLWADNQLHSLIS  77

Query  411   KEQENELFNVVQKNPD-LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLES  587
             KE++ ++      + D L +AR+EA+ W+ +V  HY+FS  T+LLAVNY DR F  ++  
Sbjct  78    KEEQTQVSYASMCSDDYLIEARNEALSWIFRVKHHYAFSVLTSLLAVNYFDR-FVSNVRF  136

Query  588   QTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEW  767
             Q  KPWMSQLAAVACLSLAAKVEET VPLLLD QV ES++VFEAKTIQRMELLVLS L+W
Sbjct  137   QRDKPWMSQLAAVACLSLAAKVEETQVPLLLDLQVVESKFVFEAKTIQRMELLVLSALQW  196

Query  768   KMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLH  947
             KM+PVTP SF  +I RRL LK+++  E L R +  LLSII+D RF+CYLPSV+ASAT+L+
Sbjct  197   KMHPVTPISFFHHIIRRLPLKNNMLWELLGRFQNHLLSIIADHRFLCYLPSVLASATILY  256

Query  948   VISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE---VASRIQFESAYKRKYGAMPG  1118
             +IS + P    E Q + + +L I+K  ++EC K I +       +Q  S   ++   M G
Sbjct  257   IISEIAPYNFLEYQNEFLSVLKINKNCLDECYKFILDSLGSHDSLQNLSDQSQQMCEM-G  315

Query  1119  SPKGVME  1139
             SP  VM+
Sbjct  316   SPCDVMD  322



>ref|XP_006291328.1| hypothetical protein CARUB_v10017462mg [Capsella rubella]
 gb|EOA24226.1| hypothetical protein CARUB_v10017462mg [Capsella rubella]
Length=371

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 175/259 (68%), Gaps = 11/259 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQE--NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             D+ W+D ELSSL+SKE+E    L++ +  +  L   R +A+ W+ KV SHY F++ TALL
Sbjct  60    DMFWDDDELSSLISKEEELKPSLYDEILGDEFLVLCREKALAWIFKVKSHYGFNSLTALL  119

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             AVNY DR F  S + QT KPWMSQL AVACLSLAAKVEE  VPLLLDFQVEE+ YVFEAK
Sbjct  120   AVNYFDR-FITSRKFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVEEARYVFEAK  178

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
             TIQRMELLVLS L+W+M+PVT  S+ D+I RR   KSH   EFL RCE +LLSI+ D RF
Sbjct  179   TIQRMELLVLSTLDWRMHPVTAISYFDHIIRRYSFKSHQQLEFLTRCESLLLSIVPDSRF  238

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE  1082
             + + PSV+A+A M+ VI  L      E Q QLM +L ++K KV +C +L+      +   
Sbjct  239   LSFSPSVLATAIMVSVIGDLKMCDEAEYQSQLMTLLKVNKEKVNKCYELV------LDHS  292

Query  1083  SAYKRKYGAM--PGSPKGV  1133
              + KR    M  P SP GV
Sbjct  293   PSKKRMMNWMQQPASPIGV  311



>gb|AID60128.1| cyclin D-type protein [Brassica napus]
 emb|CDX75405.1| BnaA01g02970D [Brassica napus]
Length=373

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 179/257 (70%), Gaps = 4/257 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E  L  V   +  LA  R EAV W+L+V SHY FS   A+LA+
Sbjct  61    DLFWEDEDLVTLFSKEEEQGLGCV--DDVYLATDRKEAVGWILRVNSHYGFSTLAAVLAI  118

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  119   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTI  177

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+WKM+ VTP SFLD+I RRL LK++   +FL  C  ++LS+ISD RF+ 
Sbjct  178   QRMELLILSTLQWKMHLVTPLSFLDHIIRRLGLKNNAHWDFLNSCHRLILSVISDSRFVG  237

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             YLPSV+A+ATM+ +I ++ P      Q +L+G+L + K KV+ C  LI E+   +Q E+ 
Sbjct  238   YLPSVVAAATMMRIIEQVEPFDPLSYQTKLLGVLNMTKEKVKSCYDLILELPMGLQIETQ  297

Query  1089  YKRKYGAMPGSPKGVME  1139
              +RK  +   SP  V++
Sbjct  298   SRRKRKS-SDSPSCVID  313



>ref|XP_004142001.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
 ref|XP_004157204.1| PREDICTED: cyclin-D3-2-like [Cucumis sativus]
Length=375

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 188/275 (68%), Gaps = 6/275 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEH----WGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLS  410
             FL DAL+CEE   H       +D D       ++++   +   LE D LW D +L SL+S
Sbjct  18    FLLDALFCEELCCHEDLPVNASDDDTQYWETLRKDQPFLAFNFLENDPLWADNQLHSLIS  77

Query  411   KEQENELFNVVQKNPD-LAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLES  587
             KE++ ++      + D L +AR+EA+ W+ +V  HY+FS  T+LLAVNY DR F  ++  
Sbjct  78    KEEQTQVSYASMTSDDYLIEARNEALSWIFRVKHHYAFSVLTSLLAVNYFDR-FVSNVRF  136

Query  588   QTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEW  767
             Q  KPWMSQLAAVACLSLAAKVEET VPLLLD QV ES++VFEAKTIQRMELLVLS L+W
Sbjct  137   QRDKPWMSQLAAVACLSLAAKVEETQVPLLLDLQVVESKFVFEAKTIQRMELLVLSALQW  196

Query  768   KMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLH  947
             KM+PVTP SF  +I RRL LK+ +  E L R +  LLSII+D RF+CYLPS++ASAT+L+
Sbjct  197   KMHPVTPISFFHHIIRRLPLKNDMLWELLGRFQNHLLSIIADHRFLCYLPSILASATILY  256

Query  948   VISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
              IS + P    E Q + + +L I+K +++EC K I
Sbjct  257   TISEIAPYNFLEYQNEFLSVLKINKNRLDECYKFI  291



>ref|XP_010530750.1| PREDICTED: cyclin-D3-1 [Tarenaya hassleriana]
Length=383

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 182/259 (70%), Gaps = 3/259 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED EL SL +KE+E E       +  L+  R EAV+W+L+V SHY FS  TA+LA+
Sbjct  67    DLFWEDEELISLFTKEREQEHELSCLDDVYLSSDRKEAVDWILRVNSHYGFSTLTAVLAM  126

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR F  S   Q  KPWM QL AV CLSLAAKVEE  VPLL+D QVEE++YVFEAKTI
Sbjct  127   NYLDR-FVCSYSLQRDKPWMLQLVAVTCLSLAAKVEEIQVPLLVDLQVEETKYVFEAKTI  185

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L WKM+ V+P SFLD+I RRL LK+++  +FL+RCE +LLS++SD RF+ 
Sbjct  186   QRMELLILSTLRWKMHLVSPISFLDHIIRRLGLKNNVHWDFLKRCERLLLSVVSDSRFVG  245

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             YLPSV+A+ATM+HVI ++ P   +  Q +L+ +L + K KV+ C  LI E+   +  +  
Sbjct  246   YLPSVLATATMMHVIEQVEPFDPKLYQNKLLAVLKLSKEKVKTCYNLILELPVNLNEDPI  305

Query  1089  YKRK--YGAMPGSPKGVME  1139
             ++++  + +   SP  V++
Sbjct  306   HRKRKIHESTLSSPSCVID  324



>gb|EPS71859.1| hypothetical protein M569_02902, partial [Genlisea aurea]
Length=312

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 195/314 (62%), Gaps = 25/314 (8%)
 Frame = +3

Query  219   FQEPQKLP---FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             F +P+  P     FDALYCEEEG      D++ S     ++E           DL+W+D 
Sbjct  5     FPKPESFPNNLLHFDALYCEEEG-----FDQEFSSGFTTKDEIHSRH------DLIWDDE  53

Query  390   ELSSLLSKEQEN--ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             E+S+LLS+E+E     ++    +  L  AR+EA++W+LKV S Y F+  TA LA +Y   
Sbjct  54    EISTLLSREKEQCRVSYSAAILDASLKTARNEAIKWMLKVISRYGFAPTTAFLAADYYSN  113

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  SL  Q  KPWMS LAAVACLS+A+K+EET VPLL D QV+ES +VFE+KTIQRMEL
Sbjct  114   -FITSLSFQRDKPWMSHLAAVACLSIASKLEETHVPLLSDLQVDESMFVFESKTIQRMEL  172

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             LVLS  +WKMN VTP SF D+ +RR  L     CEF + CE +LL +ISD RF+ + PSV
Sbjct  173   LVLSTHKWKMNHVTPISFFDHFSRRFSLH----CEFSKSCEAILLPVISDIRFVEFPPSV  228

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQFESAYKRK  1100
             +A+A M +V+ +L P   E S+ ++  +LG++K  V+ C KLI E V    Q   + KR 
Sbjct  229   IAAAAMKYVLRKLNPNNAENSENEIATVLGLNKECVDGCHKLIAEAVGGNEQLVGSKKRS  288

Query  1101  YGAMPGSPKGVMEV  1142
             +   P SP GV++ 
Sbjct  289   F---PSSPSGVIDA  299



>emb|CDY01425.1| BnaA07g11980D [Brassica napus]
Length=354

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 191/300 (64%), Gaps = 16/300 (5%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDL-LWEDGELSSLLSKEQEN  425
              D LYCEEE    G A+ D    +   +E   +   L  +D+ LW+D EL SL+SKE E 
Sbjct  21    LDELYCEEEC---GFAEED----LVGLDENVVKFQFLPLKDMFLWDDDELQSLISKENEA  73

Query  426   ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPW  605
                     +  L   R EA+EWVL+V SHY F++ TALLAVNY DR F  S+  QT KPW
Sbjct  74    NHHPYQTLDECLVSRRKEALEWVLRVKSHYGFASSTALLAVNYFDR-FITSVRFQTDKPW  132

Query  606   MSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVT  785
             MSQL AVACLSLAAKVEE  VPLL+  QVEE+ YVFEAKTIQ+MELL+LS L+W+M+PVT
Sbjct  133   MSQLVAVACLSLAAKVEEIHVPLLIHLQVEEARYVFEAKTIQKMELLLLSTLQWRMHPVT  192

Query  786   PFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLV  965
             P SF D+I RRL  + H   E    CE +L+S+++D RFM Y+PSV+A+A M+HV+  L 
Sbjct  193   PISFFDHIIRRLGSECHQQLELFSNCERLLISVVTDARFMSYVPSVLATAIMIHVVKDLK  252

Query  966   PTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMP-GSPKGVMEV  1142
             P    E Q QLM +L +++ KV EC +L+      ++   + KR    +   SP GV ++
Sbjct  253   PCEQVEYQSQLMTLLKVNQEKVNECYELL------LEHNPSKKRMMNWLDQDSPSGVFDL  306



>gb|KHG04117.1| Cyclin-D3-2 -like protein [Gossypium arboreum]
 gb|KHG14153.1| Cyclin-D3-2 -like protein [Gossypium arboreum]
 gb|KHG16721.1| Cyclin-D3-2 -like protein [Gossypium arboreum]
Length=361

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 175/255 (69%), Gaps = 6/255 (2%)
 Frame = +3

Query  381   EDGELSSLLSKE-QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             +D EL  L+SKE Q +  +  V  N  L  AR +A+    KV  HY F+A T +LAVNY 
Sbjct  57    QDDELFVLMSKEKQTHHGYIDVNLNKPLVLARKQALGLFFKVKEHYGFNALTMVLAVNYF  116

Query  558   DRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRM  737
             DR F  SL+ Q   PWMSQLAAVACLSLAAKVEE  VPLLLD QVEES+YVF++KTIQRM
Sbjct  117   DR-FISSLKLQQDNPWMSQLAAVACLSLAAKVEEAQVPLLLDLQVEESDYVFDSKTIQRM  175

Query  738   ELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLP  917
             ELLVLS L+W+MNP+TP SF ++I  RL LKSHL  EFL  CE +LL +I+D RFM Y+P
Sbjct  176   ELLVLSTLQWRMNPITPISFFNHITSRLGLKSHLHFEFLHSCEHLLLLVITDSRFMLYIP  235

Query  918   SVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-VASRIQFESAYK  1094
             S++A+ATMLHVI  + P    E Q+QL+G+L I + +V  C +LI E + SR       K
Sbjct  236   SILAAATMLHVIKDIEPCHYVEYQKQLIGVLKICEDEVNSCYELISELLESR---GHKRK  292

Query  1095  RKYGAMPGSPKGVME  1139
             R+    P SP GV++
Sbjct  293   RRLVPSPSSPNGVID  307



>ref|XP_010426550.1| PREDICTED: cyclin-D3-3-like isoform X1 [Camelina sativa]
Length=379

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 199/320 (62%), Gaps = 24/320 (8%)
 Frame = +3

Query  222   QEPQKLPF--LFDALYCEEE----GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             +E Q  P+  + D L+CEEE     +  G+   D  C  E  ++     + L +QD+ W+
Sbjct  7     EESQNAPYCVVLDGLFCEEEKTEFDDEGGEQQVDLCCE-EGVKKFPFLQLGLSDQDMFWD  65

Query  384   DGELSSLLSKEQENEL--------FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             D ELS+L+SKE E +L        ++ +  +  L   R +A++W+ KV SHY F++ TAL
Sbjct  66    DDELSNLISKEAEEDLSRKKPSLYYDEILDDEFLVLCREKALDWIFKVKSHYGFNSLTAL  125

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNY DR F  S   Q+ KPWMSQL AVACLSLAAKVEE  VPLLLDFQVEE+ YVFEA
Sbjct  126   LAVNYFDR-FITSRMFQSDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVEEARYVFEA  184

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRMELLVLS LEW+M+PVTP S+ D+I RR   +SH   +FL RCE +LLSI+ D R
Sbjct  185   KTIQRMELLVLSTLEWRMHPVTPISYFDHIIRRYSFQSHQQLDFLTRCESLLLSIVPDSR  244

Query  900   FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF  1079
             F+ Y PSV+A+A M+ VI           Q QLM +L ++K KV +C +L+      +  
Sbjct  245   FLSYSPSVLATAIMVSVIRDSKMCDEAVYQSQLMTLLKVNKEKVNKCYELV------LDH  298

Query  1080  ESAYKR--KYGAMPGSPKGV  1133
               + KR   +   P SP GV
Sbjct  299   SPSKKRMMNWIQQPASPVGV  318



>ref|XP_006404065.1| hypothetical protein EUTSA_v10010471mg [Eutrema salsugineum]
 gb|ESQ45518.1| hypothetical protein EUTSA_v10010471mg [Eutrema salsugineum]
Length=369

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 173/258 (67%), Gaps = 10/258 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQE--NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             D+LW+D ELS L+SKE+E    L + +  +  L   R +A++W+ +V SHY F++ TALL
Sbjct  57    DMLWDDDELSGLISKEEELKPRLCDGILDDEFLVLCREKALDWIFRVKSHYGFNSLTALL  116

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             AVNY DR F  S   QT KPWMSQL AVACLSLAAKVEE  VPLLLD QVEE+ YVFEAK
Sbjct  117   AVNYFDR-FITSRMFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVEEARYVFEAK  175

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
             TIQRMELL+LS L+W+M+PVTP SF D+I RR   KSH   EFL RCE +LLSI+ D RF
Sbjct  176   TIQRMELLILSTLQWRMHPVTPISFFDHITRRHSSKSHQQLEFLSRCESLLLSIVPDSRF  235

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE  1082
             + Y PSV+A+A M+ VI  L      E + QLM +L +D  KV +C +L+      +   
Sbjct  236   LSYSPSVLATAIMVSVIRDLKTCDEAEYEYQLMTLLKVDSEKVNKCYELV------LDHS  289

Query  1083  SAYKRKYGAM-PGSPKGV  1133
              + KR    M P SP GV
Sbjct  290   PSKKRMMNWMQPASPIGV  307



>gb|EYU37644.1| hypothetical protein MIMGU_mgv1a008148mg [Erythranthe guttata]
Length=383

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 169/242 (70%), Gaps = 9/242 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELF---NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             DL W+D EL +L  KE+E  L         +  L+ AR EAVEW+LK+ + Y FS  TA+
Sbjct  53    DLFWDDEELQTLFCKERETCLKPREAGFVASSSLSSARKEAVEWILKINARYGFSPLTAI  112

Query  540   LAVNYLDRLFF----LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEY  707
             LAVNYLDR        S E + Q PWM QL A  CLSLAAKVEET VPLLLD QVE ++Y
Sbjct  113   LAVNYLDRFLSSLQGFSNEEKKQPPWMMQLCAATCLSLAAKVEETHVPLLLDLQVEGTKY  172

Query  708   VFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSII  887
             VFEAKTIQRME+LVLS+L+W+MNPVTP SFLD++ RRL LKS+L  +FLR  E +LLS +
Sbjct  173   VFEAKTIQRMEILVLSSLKWRMNPVTPLSFLDHVIRRLGLKSNLHWDFLRNSENLLLSFV  232

Query  888   SDCRFMCYLPSVMASATMLHVISRLVPTVGE--ESQEQLMGILGIDKVKVEECQKLIKEV  1061
             SD RFM Y+PSV+A+ATMLHVI R+ P        + QL+ +L I K +V+EC ++I EV
Sbjct  233   SDPRFMLYMPSVLATATMLHVIRRVEPCNNAIVAYENQLLSVLNISKEEVDECYEVISEV  292

Query  1062  AS  1067
              S
Sbjct  293   IS  294



>ref|XP_002866711.1| CYCD3_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42970.1| CYCD3_2 [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 173/258 (67%), Gaps = 9/258 (3%)
 Frame = +3

Query  372   LLWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              LW+D EL SL+SKE E N  F     +  L   R EA++WV +V SHY FS+ TA+LAV
Sbjct  62    FLWDDDELMSLISKENETNPCFGEEILDGFLVSCRKEALDWVFRVKSHYGFSSLTAILAV  121

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S++ QT KPWMSQL AVA LSLAAKVEE  VPLLLD QVEE+ YVFEAKTI
Sbjct  122   NYFDR-FMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLLLDLQVEEARYVFEAKTI  180

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+W+M+PVTP SF D+I RR   K H   +F R+CE +L+S+I+D RFM 
Sbjct  181   QRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKWHQQLDFFRKCERLLISVIADMRFMS  240

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             Y PSV+A+A M  VI  L P    E Q Q+M +L +++ KV EC +L+      ++   +
Sbjct  241   YFPSVLATAIMFFVIEELKPCDEVEYQSQIMTLLKVNQEKVNECYELL------LEHNPS  294

Query  1089  YKRKYGAMP-GSPKGVME  1139
              KR    +   SP GV++
Sbjct  295   KKRMMNLLDQDSPSGVLD  312



>ref|XP_009103438.1| PREDICTED: cyclin-D3-2 [Brassica rapa]
Length=354

 Score =   250 bits (639),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 191/300 (64%), Gaps = 16/300 (5%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDL-LWEDGELSSLLSKEQEN  425
              D LYCEEE    G A+ D    +   +E   +   L  +D+ LW+D EL SL+SKE E 
Sbjct  21    LDELYCEEEC---GFAEED----LVGLDENVVKFQFLPLKDMFLWDDDELQSLISKENET  73

Query  426   ELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKPW  605
                     +  L   R EA+EWVL+V SHY F++ TALLAVNY DR F  S++ QT KPW
Sbjct  74    NHHPYQTLDECLVSRRKEALEWVLRVKSHYGFASSTALLAVNYFDR-FITSVKLQTDKPW  132

Query  606   MSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVT  785
             MSQL AVACLSLAAKVEE  VPLL+  QVEE+ YVFEAKTIQ+MELL+LS L+W+M+PVT
Sbjct  133   MSQLVAVACLSLAAKVEEIHVPLLIHLQVEEARYVFEAKTIQKMELLLLSTLQWRMHPVT  192

Query  786   PFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLV  965
             P SF D+I RRL  + H   E    CE +L+S+++D RFM Y+PSV+A+A M+HV+  L 
Sbjct  193   PISFFDHIIRRLGSECHQQLELFSNCERLLISVVTDARFMSYVPSVLATAIMIHVVKDLK  252

Query  966   PTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMP-GSPKGVMEV  1142
             P    E Q QL  +L +++ KV EC +L+      ++   + KR    +   SP GV ++
Sbjct  253   PCEQVEYQSQLRTLLEVNQEKVNECYELL------LEHNPSKKRMMNWLDQDSPSGVFDL  306



>ref|XP_006393923.1| hypothetical protein EUTSA_v10004441mg [Eutrema salsugineum]
 gb|ESQ31209.1| hypothetical protein EUTSA_v10004441mg [Eutrema salsugineum]
Length=367

 Score =   251 bits (640),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 186/280 (66%), Gaps = 8/280 (3%)
 Frame = +3

Query  240   PF-LFDALYCEEEG----EHWGQADRDPSCSIeeqeeeeeesvvlleqDL-LWEDGELSS  401
             PF + D LYCEEE     E     D      +E+ +E  E+   L   D+ LW+D EL S
Sbjct  17    PFCVLDGLYCEEESGFVEEDLVGIDSGGLDLLEKSDENVEKFQFLPLMDMSLWDDDELLS  76

Query  402   LLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLS  578
             LLSKE E N        +  L   R EA++WV +V SH+  ++ TALLAVNY DR F  S
Sbjct  77    LLSKENETNHFLRDETLDGFLVSCRKEALDWVFRVKSHFRLTSLTALLAVNYFDR-FITS  135

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             ++ +T KPWMSQL AVACLSLAAKVEE  VPLL+D QVEE+ Y+FEAKTIQRMELL+L+ 
Sbjct  136   IKFETDKPWMSQLVAVACLSLAAKVEEIHVPLLIDLQVEEARYIFEAKTIQRMELLILTT  195

Query  759   LEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASAT  938
             L+W+M+PVTP SF D+I RR   K H   +F R+CE +L+S+I+D RFM Y+PSV+A+A 
Sbjct  196   LQWRMHPVTPISFFDHIVRRFGSKCHQQLDFFRKCERLLISVIADARFMSYIPSVLATAI  255

Query  939   MLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE  1058
             M++VI  L P    E Q QLM +L +++ KV EC +L+ E
Sbjct  256   MIYVIKDLKPCEEVEYQSQLMTLLKVNQEKVNECYELMLE  295



>ref|XP_006412266.1| hypothetical protein EUTSA_v10025486mg [Eutrema salsugineum]
 gb|ESQ53719.1| hypothetical protein EUTSA_v10025486mg [Eutrema salsugineum]
Length=375

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 198/304 (65%), Gaps = 9/304 (3%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK    +E Q   FL DALYCEEE     + +                  VLL+QDL WE
Sbjct  4     RKDDEIREEQSTSFLLDALYCEEEKWE-DEGEEFEEVEENSSFSSSSSPFVLLQQDLFWE  62

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L SKE+E  L  +   +  L+K R EAV W+L+V +HY FS   A+LA+ YLD+
Sbjct  63    DKDLVTLFSKEEEQGLGCL--DDVYLSKDRKEAVGWILRVNAHYGFSTLAAVLAITYLDK  120

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++Y+FEAKTIQRMEL
Sbjct  121   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYLFEAKTIQRMEL  179

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L+WKM+ +TP SFLD+I RRL LK++   +FL RC  +LLS+ISD RF+ YLPSV
Sbjct  180   LILSTLQWKMHLITPISFLDHIIRRLGLKNNAHWDFLNRCHRLLLSVISDSRFVGYLPSV  239

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEEC-----QKLIKEVASRIQFESA  1088
             +A+ATM+ +I ++ P      Q +L+G+L I K KV+ C     Q  +  +  +I+ +S+
Sbjct  240   VAAATMMRIIEQVEPFDPILYQTKLLGVLNITKEKVQTCYDHILQVPVDRIGLQIETQSS  299

Query  1089  YKRK  1100
              KRK
Sbjct  300   RKRK  303



>ref|XP_002877727.1| CYCD3_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53986.1| CYCD3_3 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 172/257 (67%), Gaps = 10/257 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             D+ W+D EL +L+SK QE  L++ +  +  L   R +A++W+ KV SHY F++ TALLAV
Sbjct  54    DMFWDDDELLTLISK-QEPCLYDEILDDEFLVLCREKALDWIFKVKSHYGFNSLTALLAV  112

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S + QT KPWMSQL A+ACLSLAAKVEE  VPLLLDFQVEE+ YVFEAKTI
Sbjct  113   NYFDR-FITSRKFQTDKPWMSQLTALACLSLAAKVEEIRVPLLLDFQVEEARYVFEAKTI  171

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS LEWKM+PVT  SF D+I RR   KSH   EFL RCE +LLSI+ D RF+ 
Sbjct  172   QRMELLVLSTLEWKMHPVTAISFFDHIIRRYSFKSHQQLEFLSRCESLLLSIVPDSRFLR  231

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             + PSV+A+A M+ VI         + Q QLM +L +D  KV +C +L+      +    +
Sbjct  232   FSPSVLATAIMVSVIRDFKMCDEADYQSQLMTLLKVDSEKVNKCYELV------LDHSPS  285

Query  1089  YKRKYGAM--PGSPKGV  1133
              KR    M  P SP GV
Sbjct  286   NKRMMNWMQQPASPIGV  302



>emb|CDY12825.1| BnaC07g16080D [Brassica napus]
Length=358

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 159/227 (70%), Gaps = 1/227 (0%)
 Frame = +3

Query  378   WEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYL  557
             W+D EL SL+SKE E         +  L   R EA+ WV +V SHY F++ TALLAVNY 
Sbjct  58    WDDDELQSLISKENETNHHPYQTLDECLVSRRKEALNWVFRVKSHYGFASSTALLAVNYF  117

Query  558   DRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRM  737
             DR F  S++ QT KPWMSQL AVACLSLAAKVEE  VPLL+  QVEE+ YVFEAKTIQRM
Sbjct  118   DR-FITSVKFQTDKPWMSQLVAVACLSLAAKVEEIHVPLLIHLQVEEARYVFEAKTIQRM  176

Query  738   ELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLP  917
             ELLVLS L+W+M+PVTP SF D+I RRL  + H   E    CE +L+S+++D RFM Y+P
Sbjct  177   ELLVLSTLQWRMHPVTPISFFDHIIRRLGSECHQQLELFSNCERLLISVVTDTRFMSYVP  236

Query  918   SVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE  1058
             SV+A+A M+HVI  L P    E Q QLM +L +++ KV EC +L+ E
Sbjct  237   SVLATAIMIHVIKGLKPCEQVEYQSQLMTLLKVNQEKVNECYELLLE  283



>ref|XP_010556430.1| PREDICTED: cyclin-D3-1-like [Tarenaya hassleriana]
Length=361

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 198/311 (64%), Gaps = 28/311 (9%)
 Frame = +3

Query  249   FDALYCEEEGEHWGQADRDP---SCSIeeqeeeeeesvvlleqDLLWEDGELS--SLLSK  413
             FD+L+C +E    G  +      SCS    E            ++L ED EL   +LL+K
Sbjct  20    FDSLFCSDETYEEGSDNESRAHYSCSYNITE------------NMLCEDDELELEALLAK  67

Query  414   EQENELFNVVQKN----PDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF-LS  578
             E E  +  +  +     PD++ AR EAVEW+L  TS + FS  TAL AV++LDR  F   
Sbjct  68    EAEQGISPLFGRTREPYPDVSGARREAVEWILHATSRHCFSPTTALFAVDFLDRFIFRFE  127

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVE-ESEYVFEAKTIQRMELLVLS  755
                + QKPW+++LAA+ CLSLAAKVEE  VPLLLD QVE  S+++FEAKTIQ+ME+LVLS
Sbjct  128   GFRRDQKPWITELAAIGCLSLAAKVEEIHVPLLLDLQVEGTSKFMFEAKTIQKMEILVLS  187

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+W+MNPVT  SFL  I++R  LK  +  EFLRRCE  +LSI+SD RF  +LPS +A+A
Sbjct  188   TLQWRMNPVTSLSFLHRISKRFGLKGRIGFEFLRRCELTILSIVSDYRFTLHLPSTVAAA  247

Query  936   TMLHVISRLVP-TVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             T LHV++ +V  T+  E ++QLM IL IDK  +E+C + +  ++S  Q  S  KRK G +
Sbjct  248   TALHVVNSVVTSTIASEYEKQLMSILRIDKDNLEQCLRFVS-LSSHGQLRS--KRKLGGV  304

Query  1113  -PGSPKGVMEV  1142
              PGSP GVM+ 
Sbjct  305   APGSPNGVMDA  315



>gb|KFK28418.1| hypothetical protein AALP_AA8G512200 [Arabis alpina]
Length=359

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 164/230 (71%), Gaps = 9/230 (4%)
 Frame = +3

Query  378   WEDGELSSLLSKEQENELFNVVQKNPD--LAKARSEAVEWVLKVTSHYSFSAQTALLAVN  551
             WED EL SL+SKE E      V K  D  L   R EA++WV +V SHY FS+ T LLAVN
Sbjct  61    WEDDELMSLISKENET-----VPKFLDGFLVPCRKEALDWVFRVKSHYGFSSLTFLLAVN  115

Query  552   YLDRLFFLSLESQTQ-KPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             Y DR F  S++ QT  KPWM QL AVACLSLAAKVEE  VPLL+D QVEE+ YVFEAKTI
Sbjct  116   YFDR-FVTSVKFQTDVKPWMYQLVAVACLSLAAKVEEIHVPLLIDLQVEEARYVFEAKTI  174

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+W+M+PVTP SF D+I RR   K HL  EF R+CE +L+SI++D RF+C
Sbjct  175   QRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKCHLQLEFFRKCERLLISIVADTRFLC  234

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE  1058
             Y+PSV+A+A M++VI  L      E Q QLM +L ++K KV EC +L+ E
Sbjct  235   YVPSVLATAVMIYVIKDLKQCEEVEYQSQLMTLLKVNKEKVTECYELLLE  284



>ref|XP_009138263.1| PREDICTED: cyclin-D3-1-like [Brassica rapa]
Length=368

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 196/304 (64%), Gaps = 8/304 (3%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK+   +E Q   FL DALYCEEE     +   +   +           +VLL+QDL WE
Sbjct  4     RKEDESREEQSTSFLLDALYCEEEKWEDEEETEEVEENSSFSSSSPTSPLVLLQQDLYWE  63

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L SKE+E  L  + +    LA  R EAV W+L+V + Y FS  TA+LA+ YLD+
Sbjct  64    DEDLVTLFSKEEEQRLSRLDEVY--LATDRKEAVGWILRVNARYGFSTLTAVLAITYLDK  121

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL +VACLSLAAKVEE  +PLLLDFQVEE++YVFEAKTIQRMEL
Sbjct  122   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEEVHIPLLLDFQVEETKYVFEAKTIQRMEL  180

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L+WKM+ VTP SFLD+I RRL LK++   +FL RC  ++LS+ISD RF+ YLPSV
Sbjct  181   LLLSTLQWKMHLVTPLSFLDHIIRRLGLKNNSHWDFLNRCHRLILSVISDSRFVGYLPSV  240

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRIQFESA  1088
             +A+ATM+ +I ++        Q  L+G+L I K KVE C  LI       +  +I+ +S 
Sbjct  241   VAAATMMRIIDQVETFDPLSHQTNLLGVLNITKEKVEACYNLILQLPLDHMGLQIETQSC  300

Query  1089  YKRK  1100
              KRK
Sbjct  301   RKRK  304



>emb|CDY69708.1| BnaCnng64910D [Brassica napus]
Length=374

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 175/254 (69%), Gaps = 8/254 (3%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E  L  V   +  LA  R EAV W+L+V S Y FS   A+LA+
Sbjct  61    DLFWEDEDLVTLFSKEEEQGLSCV--DDVYLATDRKEAVGWILRVNSRYGFSTLAAVLAI  118

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  119   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTI  177

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+WKM+ VTP SFLD+I RRL LK++   +FL  C  ++LS+ISD RF+ 
Sbjct  178   QRMELLILSTLQWKMHLVTPLSFLDHIIRRLGLKNNAHWDFLNSCHRLILSVISDSRFVG  237

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEV-----ASRI  1073
             YLPSV+A+ATM+ +I ++ P      Q +L+G+L I K KV+ C  LI E+       +I
Sbjct  238   YLPSVVAAATMMRIIEQVEPFDPLSYQTKLLGVLNITKEKVKSCYDLILELPMGRMGLQI  297

Query  1074  QFESAYKRKYGAMP  1115
             + ++  KRK G  P
Sbjct  298   ETQTRRKRKSGESP  311



>ref|XP_010437660.1| PREDICTED: cyclin-D3-1-like [Camelina sativa]
Length=375

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 195/302 (65%), Gaps = 20/302 (7%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWG----QADRDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             ++ Q   FL DALYCEEE +       Q + + S S            VLL+QDL WED 
Sbjct  10    RQEQSNSFLLDALYCEEEEQWGEDEGEQVEENSSFS----------PFVLLQQDLYWEDE  59

Query  390   ELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLF  569
             +L +LL+KE+E         +  L+  R EAV W+L+V +HY FS   A+LA+ YLD+ F
Sbjct  60    DLVTLLTKEEEQAGLGTCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAITYLDK-F  118

Query  570   FLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLV  749
               S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMELL+
Sbjct  119   ICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMELLI  178

Query  750   LSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMA  929
             LS LEWKM+  TP SF+D+I RRL LK++   +FL RC  +LLS+ISD +F+ YLPSV+A
Sbjct  179   LSTLEWKMHLTTPISFVDHIIRRLGLKNNAHWDFLNRCNRLLLSVISDSKFVGYLPSVVA  238

Query  930   SATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRIQFESAYK  1094
             +ATML +I ++ P      Q  L+G L + K KV+ C  LI       +  +IQ +S+ K
Sbjct  239   AATMLRIIEQVEPFDPLSYQTNLLGALHLTKEKVKTCYDLILQLPMDRIGLQIQNQSSRK  298

Query  1095  RK  1100
             RK
Sbjct  299   RK  300



>ref|XP_010503676.1| PREDICTED: cyclin-D3-3-like [Camelina sativa]
Length=379

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 173/268 (65%), Gaps = 23/268 (9%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDL-----------AKARSEAVEWVLKVTSHY  515
             D+ W+D ELS+L+SKE E +LF   +K P L              R +A++W+ KV SHY
Sbjct  61    DMFWDDDELSNLISKEAEEDLF---KKKPSLYYDEILDDEFLVLCREKALDWIFKVKSHY  117

Query  516   SFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVE  695
              F++ TALLAVNY DR F  S   Q+ KPWMSQL AVACLSLAAKVEE  VPLLLDFQV+
Sbjct  118   GFNSLTALLAVNYFDR-FITSRMFQSDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVQ  176

Query  696   ESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVL  875
             E+ YVFEAKTIQRMELLVLS LEW+M+PVT  S+ D+I RR   +SH   +FL RCE +L
Sbjct  177   EARYVFEAKTIQRMELLVLSTLEWRMHPVTAISYFDHIIRRYRFQSHQQLDFLSRCESLL  236

Query  876   LSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIK  1055
             LSI+ D RF+ Y PSV+A+A M+ VI           Q QLM +L ++K KV +C +L+ 
Sbjct  237   LSIVPDSRFLSYSPSVLATAIMVSVIRDFKMCDEAVYQSQLMTLLKVNKAKVNKCYELV-  295

Query  1056  EVASRIQFESAYKR--KYGAMPGSPKGV  1133
                  +    + KR   +   P SP GV
Sbjct  296   -----LDHSPSKKRMMNWIQQPASPIGV  318



>ref|XP_010447126.1| PREDICTED: cyclin-D3-1-like [Camelina sativa]
Length=376

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 171/249 (69%), Gaps = 6/249 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L +KE+E         +  L+  R EAV W+L+V +HY FS   A+LA+
Sbjct  55    DLYWEDEDLVTLFTKEEEQAELGSCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAI  114

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  115   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTI  173

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS LEWKM+ +TP SF+D+I RRL LK++   +FL RC  +LLS+ISD +F+ 
Sbjct  174   QRMELLILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNRCNRLLLSVISDSKFVG  233

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRI  1073
             YLPSV+A+ATML +I ++ P      Q  L+G L + K KV+ C  LI       +  +I
Sbjct  234   YLPSVVAAATMLRIIEQVEPFDPLSYQTNLLGALHLTKEKVKTCYDLILQLPMDRIGLQI  293

Query  1074  QFESAYKRK  1100
             Q +S+ KRK
Sbjct  294   QNQSSRKRK  302



>ref|NP_001289918.1| cyclin-D3-1 [Camelina sativa]
 gb|AID81889.1| D-type cyclin [Camelina sativa]
Length=378

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 170/249 (68%), Gaps = 6/249 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E         +  L+  R EAV W+L+V +HY FS   A+LA+
Sbjct  53    DLYWEDEDLVTLFSKEEEQAGLGTCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAI  112

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  113   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTI  171

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS LEWKM+ +TP SF+D+I RRL L ++   +FL RC  +LLS+ISD +F+ 
Sbjct  172   QRMELLILSTLEWKMHLITPISFVDHIIRRLGLTNNAHWDFLNRCNRLLLSVISDSKFVG  231

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRI  1073
             YLPSV+A+ATML +I ++ P      Q  L+G L + K KV+ C  LI       +  +I
Sbjct  232   YLPSVVAAATMLRIIEQVEPFDPLSYQTNLLGALHLTKEKVKTCYDLIIQLPLDRIGLQI  291

Query  1074  QFESAYKRK  1100
             Q +S+ KRK
Sbjct  292   QNQSSRKRK  300



>ref|XP_009101665.1| PREDICTED: cyclin-D3-3-like [Brassica rapa]
 emb|CDX83112.1| BnaA01g21120D [Brassica napus]
Length=352

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/306 (47%), Positives = 185/306 (60%), Gaps = 20/306 (7%)
 Frame = +3

Query  225   EPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             E Q  PF    L+CEEE  H  + D           +     +  L+ D+LW+D ELSSL
Sbjct  8     EVQNAPFCM--LFCEEERSHELEGDE-------SVVKFPFFHLGFLDHDMLWDDDELSSL  58

Query  405   LSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSL  581
             +SKE E     +    +  L   R +A++W+ +V ++Y F+A TALLAVNY DR F  S 
Sbjct  59    ISKENELRPCLSDTVLDEFLVLCREKALDWIFRVKTYYGFNALTALLAVNYFDR-FLTSR  117

Query  582   ESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNL  761
             + QT KPWMSQL AVACLSLAAKVEE  VPLLLD QV ++ YVFEAKTIQRMELL+LS L
Sbjct  118   KFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVGDARYVFEAKTIQRMELLILSTL  177

Query  762   EWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             +W+M+PVTP S+ D+I RR   KSH   EFL RCE +LLSI+ D RF+ Y PSV+A+A M
Sbjct  178   QWRMHPVTPISYFDHIFRRCSSKSHHDLEFLSRCESLLLSIVPDSRFLSYSPSVLATAIM  237

Query  942   LHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGS  1121
             + V+         E + QLM +L +D  KV +C +L+ +             K    P S
Sbjct  238   VSVVGDFTTCDEAEYESQLMTLLKVDPEKVNKCYELVLD---------HIPSKKRMQPAS  288

Query  1122  PKGVME  1139
             P GV +
Sbjct  289   PTGVFD  294



>emb|CDY49278.1| BnaA03g50910D [Brassica napus]
Length=369

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 196/305 (64%), Gaps = 9/305 (3%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK+   +E Q   FL DALYCEEE     +  ++   +           +VLL+QDL WE
Sbjct  4     RKEDESREEQSTSFLLDALYCEEEKWEDEEEAQEVEENSSFSSSSPTSPLVLLQQDLYWE  63

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L SKE+E  L  +   +  LA  R EAV W+L+V + Y FS  TA+LA+ YLD+
Sbjct  64    DEDLVTLFSKEEEQRLSRL--DDVYLATDRKEAVGWILRVNARYGFSTLTAVLAITYLDK  121

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVE-ESEYVFEAKTIQRME  740
              F  S   Q  KPWM QL +VACLSLAAKVEE  VPLLLDFQV  E++YVFEAKTIQRME
Sbjct  122   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEEVHVPLLLDFQVNVETKYVFEAKTIQRME  180

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LL+LS L+WKM+ VTP SFLD+I RRL LK++   +FL RC  ++LS+ISD RF+ YLPS
Sbjct  181   LLLLSTLQWKMHLVTPLSFLDHIIRRLGLKNNSHWDFLNRCHRLILSVISDSRFVGYLPS  240

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-----KEVASRIQFES  1085
             V+A+ATM+ +I ++        Q  L+G+L I K KVE C  LI       +  +I+ +S
Sbjct  241   VVAAATMMRIIDQVETFDPLSHQTNLLGVLNITKEKVEACYNLILQLPLDHMGLQIETQS  300

Query  1086  AYKRK  1100
               KRK
Sbjct  301   CRKRK  305



>gb|KFK30046.1| hypothetical protein AALP_AA7G210000 [Arabis alpina]
Length=367

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/302 (49%), Positives = 196/302 (65%), Gaps = 7/302 (2%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
             FL DALYCEEE     + +++               +VLL+QDL WED +L +L SKE+E
Sbjct  15    FLLDALYCEEEKWEDEEDEQEEVEESPSFSSSSSTPLVLLQQDLFWEDKDLVTLYSKEEE  74

Query  423   NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQKP  602
              EL      +  L+  R +AV W+L+V +HY FS   A+LA+ YLD+ F  S   Q  KP
Sbjct  75    QEL--TCLHDVYLSTDRKQAVGWILRVNAHYGFSTLAAVLAITYLDK-FICSYSLQRDKP  131

Query  603   WMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPV  782
             WM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTIQRMELL+LS L+WKM+ +
Sbjct  132   WMLQLVSVACLSLAAKVEETHVPLLLDFQVEETKYVFEAKTIQRMELLILSTLQWKMHLI  191

Query  783   TPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRL  962
             TP SFLD+I RRL LK++   +FL R   +LLS+ISD RF+ +LPSV+A+ATM+ +I ++
Sbjct  192   TPISFLDHIIRRLGLKNNAHWDFLNRSHRLLLSVISDSRFVGFLPSVVAAATMMRIIDQV  251

Query  963   VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA---SRIQFESAYKRKYGAMPGSPKGV  1133
              P      Q  L+ +L I K KV+ C  LI ++      +Q E+  KRK      SP  V
Sbjct  252   EPFDPISYQTNLLNVLNITKEKVQTCYDLILQLPFDHMGLQIETR-KRKLHESSSSPSCV  310

Query  1134  ME  1139
             ++
Sbjct  311   ID  312



>ref|XP_010515372.1| PREDICTED: cyclin-D3-3 [Camelina sativa]
Length=378

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 173/265 (65%), Gaps = 17/265 (6%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENEL--------FNVVQKNPDLAKARSEAVEWVLKVTSHYSFS  524
             D+ W+D ELS+L+SKE E +L        ++ +  +  L   R +A++W+ KV SHY F+
Sbjct  60    DMFWDDDELSNLISKEAEEDLSKKKPSLCYDEILDDEFLVLCREKALDWIFKVKSHYGFN  119

Query  525   AQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESE  704
             + TALLAVNY DR F  S   Q+ KPWMSQL AVACLSLAAKVEE  VPLLLDFQVEE+ 
Sbjct  120   SLTALLAVNYFDR-FITSRMFQSDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVEEAR  178

Query  705   YVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSI  884
             YVFEAKTIQRMELLVLS LEW+M+PVT  S+ D+I RR   +SH   +FL RCE +LLSI
Sbjct  179   YVFEAKTIQRMELLVLSTLEWRMHPVTAISYFDHIIRRYRFQSHQQLDFLSRCESLLLSI  238

Query  885   ISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVA  1064
             + D RF+ Y PSV+A+A M+ VI           Q QLM +L ++K KV +C +L+    
Sbjct  239   VPDSRFLSYSPSVLATAIMVTVIRDFKMCDEAVYQSQLMTLLKVNKEKVNKCYELV----  294

Query  1065  SRIQFESAYKR--KYGAMPGSPKGV  1133
               +    + KR   +   P SP GV
Sbjct  295   --LDHSPSKKRMMNWIQQPASPIGV  317



>emb|CDY30607.1| BnaAnng03820D [Brassica napus]
Length=353

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 149/307 (49%), Positives = 193/307 (63%), Gaps = 17/307 (6%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             +E Q  PF    L+CEE+   + + D D SC  +  E+     +  L++ + WE+ ELSS
Sbjct  7     EEIQNAPFCM--LFCEEDSSGFDEEDED-SCD-KSDEKFPFFHLGFLDRSMSWEEDELSS  62

Query  402   LLSKEQE---NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             L+SKE E   +     V  +  LA  R +AV+W+L+V SHY FS+ TALLAVNY DR F 
Sbjct  63    LVSKENEFRPSLTEEGVLDDEYLALCREKAVDWILRVKSHYGFSSLTALLAVNYFDR-FI  121

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              S + QT+ PWMSQL A+ACLSLAAKVEE  VPLL+D QVEE+ YVFEAKTIQRMELL+L
Sbjct  122   TSRKFQTEFPWMSQLTALACLSLAAKVEEVRVPLLVDLQVEEASYVFEAKTIQRMELLIL  181

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+M+PVTP S+LD+I RR   KSH   EFL RCE +LLSI+ D RFM Y  S +A+
Sbjct  182   STLQWRMHPVTPISYLDHIIRRFSFKSHQQLEFLSRCESLLLSIVPDSRFMSYSSSELAA  241

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             A M+ V          E + QLM +L +D  KV +C +L+        F+    +K    
Sbjct  242   AIMVSVFRGFKTCDESEYESQLMTLLKVDSEKVNKCYELV--------FDHIPSKK-RMQ  292

Query  1113  PGSPKGV  1133
             P SP GV
Sbjct  293   PASPTGV  299



>ref|XP_004140711.1| PREDICTED: cyclin-D3-1-like [Cucumis sativus]
 ref|XP_004161435.1| PREDICTED: cyclin-D3-1-like [Cucumis sativus]
 gb|KGN57504.1| hypothetical protein Csa_3G199660 [Cucumis sativus]
Length=376

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 185/269 (69%), Gaps = 12/269 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE-----QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             DL  +D  L S+LSKE     Q N     +  +P ++ ARS A+ W+LKV SHY FS  T
Sbjct  56    DLSGDDERLLSMLSKETEQLKQSNLELEALLMDPSVSAARSSAIHWMLKVQSHYGFSTLT  115

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             A+LA+ Y DR F LS   ++ KPWM+QL AV CLSLAAKVEE  VPLLLD QVE+++YVF
Sbjct  116   AILAIAYFDR-FLLSFHFKSDKPWMNQLVAVTCLSLAAKVEEIQVPLLLDLQVEDAKYVF  174

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+W+M+ VTP+SFLD+I +RL LK++L  EF RR E +LLS++SD
Sbjct  175   EAKTIQRMELLVLSTLQWRMHLVTPYSFLDHIVKRLGLKNNLHLEFFRRSEYLLLSLLSD  234

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI  1073
              RF+ YLPSV+A+ATM+ VI ++ P    E Q++L+G+L ++K KV+ C  L+ E +   
Sbjct  235   SRFVGYLPSVLATATMMEVIDQIEPHKKLEHQDKLLGVLKMNKEKVQCCYDLVVEHSKAY  294

Query  1074  QFE-----SAYKRKY-GAMPGSPKGVMEV  1142
                     + +KRK+    P SP GV++ 
Sbjct  295   NNGFYHPINPHKRKHEQQAPDSPNGVIDA  323



>ref|XP_008456160.1| PREDICTED: cyclin-D3-1-like [Cucumis melo]
Length=376

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 184/269 (68%), Gaps = 12/269 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE-----QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             DL  +D  L S+LSKE     Q N     +  +P ++ ARS AV W+LKV SHY FS  T
Sbjct  56    DLSGDDERLLSMLSKETEQLKQTNLELEALLMDPSVSAARSSAVHWMLKVQSHYGFSTLT  115

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             A+LA+ Y DR F LS   ++ KPWM+QL AV CLSLAAK+EE  VPLLLD QVE+++YVF
Sbjct  116   AILAIAYFDR-FLLSFHFRSDKPWMNQLVAVTCLSLAAKLEEIQVPLLLDLQVEDAKYVF  174

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+W+M+ VTP+SFLD+I +RL LK+ L  EF RR E +LLS++SD
Sbjct  175   EAKTIQRMELLVLSTLQWRMHLVTPYSFLDHIVKRLGLKNDLHLEFFRRSEYLLLSLLSD  234

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKE-----  1058
              RF+ YLPSV+A+ATM+ VI ++ P    E Q++L+G+L ++K KV+ C  L+ E     
Sbjct  235   SRFVGYLPSVLATATMMEVIDQIEPHKKLEHQDKLLGVLKMNKEKVQCCYDLVVEHSKAY  294

Query  1059  VASRIQFESAYKRKY-GAMPGSPKGVMEV  1142
             V       + +KRK+    P SP GV++ 
Sbjct  295   VDGFYHPINTHKRKHEQQAPDSPNGVIDA  323



>ref|XP_006280663.1| hypothetical protein CARUB_v10026622mg [Capsella rubella]
 gb|EOA13561.1| hypothetical protein CARUB_v10026622mg [Capsella rubella]
Length=368

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 173/258 (67%), Gaps = 9/258 (3%)
 Frame = +3

Query  372   LLWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              LW+D EL SL+SKE E N  F     +  L   R EA++WV +V SH  F++ TA+LAV
Sbjct  63    FLWDDDELLSLISKENETNPCFGDGILDEFLVSCRREALDWVFRVKSHLGFTSLTAILAV  122

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  +++ Q  KPWMSQL AVACLSLAAKVEE  VPLLLD QVEE+ YVFEAKTI
Sbjct  123   NYFDR-FMATIKFQADKPWMSQLVAVACLSLAAKVEEIRVPLLLDLQVEEARYVFEAKTI  181

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+W+M+PVTP SF D+I RR   +     EF R+CE +L+S+++D RFM 
Sbjct  182   QRMELLILSTLQWRMHPVTPISFFDHIIRRFGSERLQQLEFFRKCERLLISVVADTRFMS  241

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             Y+PSV+A+A M++VI  L P    E Q Q++ +L +++ KV EC +L+      ++   +
Sbjct  242   YIPSVLATAIMIYVIKELKPCDQVEYQSQILTLLKVNQNKVNECYELL------LEHNPS  295

Query  1089  YKRKYG-AMPGSPKGVME  1139
              KRK       SP G+ +
Sbjct  296   KKRKMNWPDQDSPSGIFD  313



>ref|XP_011092549.1| PREDICTED: cyclin-D3-1-like isoform X2 [Sesamum indicum]
Length=358

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 143/287 (50%), Positives = 191/287 (67%), Gaps = 20/287 (7%)
 Frame = +3

Query  246   LFDALYCEEEGE---HWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             LFDALYCEE+ E    +    R+ +            S++ LE DL W+D EL SL  KE
Sbjct  12    LFDALYCEEQSEIVQDFPTRGRERN--------LLLPSLLFLEHDLFWDDEELRSLFRKE  63

Query  417   QENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQ  590
             +E ++     + +    + +R EAV  +LK+  ++ FS  TA+LAVNYLDR     +  Q
Sbjct  64    REIKIEPETCLHRESRFSLSRREAVVCILKINRNHGFSTLTAILAVNYLDRFLSSCVGFQ  123

Query  591   TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWK  770
              +KPWM QLAAVACLSLAAKVEET VPLLLD QV +S+YVFEAKTIQRMELLVLS+L+W+
Sbjct  124   REKPWMMQLAAVACLSLAAKVEETHVPLLLDLQVGDSKYVFEAKTIQRMELLVLSSLKWR  183

Query  771   MNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV---MASATM  941
             MN VTP SFLD+I RRL LKS++  EFLR CE +LLS++ D R +CYLPSV   +A+ATM
Sbjct  184   MNAVTPLSFLDHIVRRLGLKSYVHWEFLRSCEDLLLSVLPDSRMVCYLPSVVAALATATM  243

Query  942   LHVISRLVPTVGE----ESQEQLMGILGIDKVKVEECQKLIKEVASR  1070
             LHVI +L   +      + +  L+ +L   K +V++C ++I +V S+
Sbjct  244   LHVIHQLQVELRNGNAFDYENHLLTLLKTTKEEVDDCYEVISDVVSK  290



>gb|KHG07268.1| Cyclin-D3-2 -like protein [Gossypium arboreum]
Length=348

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 199/309 (64%), Gaps = 24/309 (8%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHW-GQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELS  398
             Q+ Q  P++ DAL CEE G    G++           ++E    + L+E DL WED EL 
Sbjct  8     QQIQSPPWILDALCCEENGNKICGESG--------TVKKETFLPLFLIEHDLFWEDDELI  59

Query  399   SLLSKEQENEL-FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             SL+SKE+E  L +  V  +  L  AR +A+EW+ KV +H+ F+A T +LAVNY DR FF 
Sbjct  60    SLMSKEKETHLCYKDVNSDESLVLARKDALEWIFKVKAHHRFNALTIVLAVNYFDR-FFA  118

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S + Q   PWM QLAAVACLSLAAKVEET VPLLLD QVEES+YVF++KTIQRMELLVLS
Sbjct  119   SFKFQKDNPWMGQLAAVACLSLAAKVEETQVPLLLDLQVEESKYVFDSKTIQRMELLVLS  178

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+W+MNPVTP SF D+I RRL L++HL  EFL  CE +LL              + A+A
Sbjct  179   TLKWRMNPVTPISFFDHITRRLGLRTHLHWEFLHSCEHLLLI------------LIAAAA  226

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAM  1112
             TML+VI  + P    E ++QL+ +L   + +V+ C +L+ K + S  +   A KRK+G M
Sbjct  227   TMLYVIKEIEPCHYLEYRKQLLRVLKTCEDEVDVCYELVSKLLESDCKQNEARKRKHGQM  286

Query  1113  PGSPKGVME  1139
              GSP GV++
Sbjct  287   QGSPDGVID  295



>gb|ABV23488.1| cyclin D3-1 [Cucumis sativus]
Length=376

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 185/269 (69%), Gaps = 12/269 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKE-----QENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             DL  +D  L S+LSKE     Q N     +  +P ++ ARS A+ W+LKV SHY FS  T
Sbjct  56    DLSGDDERLLSMLSKETEQLKQSNLELEALLMDPSVSAARSSAIHWMLKVQSHYGFSTLT  115

Query  534   ALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVF  713
             A+LA+ Y DR F LS   ++ KPWM+QL AV CLSLAAKVEE  VPLLLD QVE+++YVF
Sbjct  116   AILAIAYFDR-FLLSFHFKSDKPWMNQLVAVTCLSLAAKVEEIQVPLLLDLQVEDAKYVF  174

Query  714   EAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISD  893
             EAKTIQRMELLVLS L+W+M+ VTP+SFLD+I +R+ LK++L  EF RR E +LLS++SD
Sbjct  175   EAKTIQRMELLVLSTLQWRMHLVTPYSFLDHIVKRIGLKNNLHLEFFRRSEYLLLSLLSD  234

Query  894   CRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRI  1073
              RF+ YLPSV+A+ATM+ VI ++ P    E Q++L+G++ ++K KV+ C  L+ E +   
Sbjct  235   SRFVGYLPSVLATATMMEVIDQIEPHKKLEHQDKLLGVVKMNKEKVQCCYDLVVEHSKAY  294

Query  1074  QFE-----SAYKRKY-GAMPGSPKGVMEV  1142
                     + +KRK+    P SP GV++ 
Sbjct  295   NNGFYHPINPHKRKHEQQAPDSPNGVIDA  323



>dbj|BAM10425.1| cyclin, partial [Salix japonica]
Length=192

 Score =   237 bits (604),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  402  LLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
            L SKEQE +     N V ++P LA+AR EAVEW+LKV +HY FSA T++LA NYLDR  +
Sbjct  1    LFSKEQEQQASASVNNVAEDPFLARARQEAVEWMLKVIAHYGFSALTSILAFNYLDRFLY  60

Query  573  LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
                 +  +PWM QL AV CLSLAAKVEET VP LLD QVE+++YVFEAKTIQRMELLVL
Sbjct  61   GPCYQRDSRPWMIQLVAVTCLSLAAKVEETHVPFLLDLQVEDTKYVFEAKTIQRMELLVL  120

Query  753  SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
            S L+WKM+PVTP SFLD+I RRL LK+ +  EFLRRCE +LLS +SD R + Y PSV+A+
Sbjct  121  STLKWKMHPVTPLSFLDHIIRRLGLKTQVHWEFLRRCEHLLLSAVSDSRSVSYPPSVLAT  180

Query  933  ATMLHVISRL  962
            ATM+HVI + 
Sbjct  181  ATMMHVIDQF  190



>ref|NP_201527.1| cyclin-D3-2 [Arabidopsis thaliana]
 sp|Q9FGQ7.1|CCD32_ARATH RecName: Full=Cyclin-D3-2; AltName: Full=G1/S-specific cyclin-D3-2; 
Short=CycD3;2 [Arabidopsis thaliana]
 dbj|BAB09645.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AAL32723.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AAM13253.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AAM65082.1| cyclin D3-like protein [Arabidopsis thaliana]
 gb|AED98321.1| cyclin-D3-2 [Arabidopsis thaliana]
Length=367

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 173/258 (67%), Gaps = 9/258 (3%)
 Frame = +3

Query  372   LLWEDGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
              LW+D E+ SL+SKE E N  F     +  L   R EA++WVL+V SHY F++ TA+LAV
Sbjct  62    FLWDDDEILSLISKENETNPCFGEQILDGFLVSCRKEALDWVLRVKSHYGFTSLTAILAV  121

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S++ QT KPWMSQL AVA LSLAAKVEE  VPLLLD QVEE+ Y+FEAKTI
Sbjct  122   NYFDR-FMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLLLDLQVEEARYLFEAKTI  180

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+W+M+PVTP SF D+I RR   K H   +F R+CE +L+S+I+D RFM 
Sbjct  181   QRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKWHQQLDFCRKCERLLISVIADTRFMR  240

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             Y PSV+A+A M+ V   L P    E Q Q+  +L +++ KV EC +L+      ++   +
Sbjct  241   YFPSVLATAIMILVFEELKPCDEVEYQSQITTLLKVNQEKVNECYELL------LEHNPS  294

Query  1089  YKRKYGAMP-GSPKGVME  1139
              KR    +   SP GV++
Sbjct  295   KKRMMNLVDQDSPSGVLD  312



>ref|XP_010526969.1| PREDICTED: cyclin-D3-1-like [Tarenaya hassleriana]
Length=384

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 172/259 (66%), Gaps = 5/259 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED EL SL +KE E         +  L+  R +AV+W+L+V SHY FS  TA LA+
Sbjct  75    DLFWEDEELVSLFAKEHEQGHEISCLDDVYLSSDRKKAVDWILRVNSHYGFSTLTAALAI  134

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR F  +   Q  KPWM QL AV CLSLAAKVE T  PLL++ QVEE+EYVF+AKTI
Sbjct  135   NYLDR-FVCNFSLQGDKPWMLQLVAVTCLSLAAKVEGTQAPLLINLQVEETEYVFQAKTI  193

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS L+WKM+ +TP SFLD+I + L LK++   +F+RRCE +LLS+ISD RF+ 
Sbjct  194   QRMELLVLSTLQWKMHRITPISFLDHILKGLGLKNNFHWDFVRRCEHLLLSVISDSRFVG  253

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             YLPSV+A ATM+HVI ++        Q +L+ ++ + K KV  C  LI E++     E+ 
Sbjct  254   YLPSVIAVATMMHVIEQVGHFDSISYQNKLLEVVKLRKEKVTACHNLILELSLNSN-ENP  312

Query  1089  YKRKYGA---MPGSPKGVM  1136
             + RK      MP SP  V+
Sbjct  313   FHRKRKIQQPMPSSPNCVI  331



>ref|XP_006283905.1| hypothetical protein CARUB_v10005023mg [Capsella rubella]
 gb|EOA16803.1| hypothetical protein CARUB_v10005023mg [Capsella rubella]
Length=386

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 170/247 (69%), Gaps = 4/247 (2%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E    +    +  L+  R EAV W+L+V +HY FS   A+LA+
Sbjct  57    DLFWEDEDLVTLFSKEEEQAGLSSCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAI  116

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  +PWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  117   TYLDK-FICSYSVQRDRPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTI  175

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS LEW+M+ +TP SF+D+I RRL LK++   +FL RC  +LLS+ISD +F+ 
Sbjct  176   QRMELLILSTLEWRMHLITPISFVDHIIRRLGLKNNAHWDFLNRCHRLLLSVISDSKFVG  235

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI---KEVASRIQF  1079
             YLPSV+A+ATM+ +I ++ P      Q  L+  L + K KV+ C  LI     +  +I  
Sbjct  236   YLPSVVAAATMMRIIEQVEPFDPLSYQTNLLAALNLTKEKVKTCYDLIIQLDRIGLQILN  295

Query  1080  ESAYKRK  1100
             +S+ KRK
Sbjct  296   QSSRKRK  302



>ref|XP_011092548.1| PREDICTED: cyclin-D3-1-like isoform X1 [Sesamum indicum]
Length=360

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 192/289 (66%), Gaps = 22/289 (8%)
 Frame = +3

Query  246   LFDALYCEEEGE---HWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKE  416
             LFDALYCEE+ E    +    R+ +            S++ LE DL W+D EL SL  KE
Sbjct  12    LFDALYCEEQSEIVQDFPTRGRERN--------LLLPSLLFLEHDLFWDDEELRSLFRKE  63

Query  417   QENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQ  590
             +E ++     + +    + +R EAV  +LK+  ++ FS  TA+LAVNYLDR     +  Q
Sbjct  64    REIKIEPETCLHRESRFSLSRREAVVCILKINRNHGFSTLTAILAVNYLDRFLSSCVGFQ  123

Query  591   TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWK  770
              +KPWM QLAAVACLSLAAKVEET VPLLLD QV +S+YVFEAKTIQRMELLVLS+L+W+
Sbjct  124   REKPWMMQLAAVACLSLAAKVEETHVPLLLDLQVGDSKYVFEAKTIQRMELLVLSSLKWR  183

Query  771   MNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV---MASATM  941
             MN VTP SFLD+I RRL LKS++  EFLR CE +LLS++ D R +CYLPSV   +A+ATM
Sbjct  184   MNAVTPLSFLDHIVRRLGLKSYVHWEFLRSCEDLLLSVLPDSRMVCYLPSVVAALATATM  243

Query  942   LHVISRLVPTVGE----ESQEQLMGILGIDKVK--VEECQKLIKEVASR  1070
             LHVI +L   +      + +  L+ +L   KV+  V++C ++I +V S+
Sbjct  244   LHVIHQLQVELRNGNAFDYENHLLTLLKTTKVQEEVDDCYEVISDVVSK  292



>ref|XP_010444674.1| PREDICTED: cyclin-D3-2-like [Camelina sativa]
Length=369

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 190/309 (61%), Gaps = 12/309 (4%)
 Frame = +3

Query  231   QKLPF-LFDALYCEEE-GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSL  404
             Q  PF + D LYCEEE G    +       S++E     +   + L    LW+D EL SL
Sbjct  11    QNAPFCVLDGLYCEEETGFVEDEDLDGDLDSVDESVAATKFQFLPLLDMFLWDDDELMSL  70

Query  405   LSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF-LS  578
             +SKE E N  F     +      R EA++W  ++ SH+ F++ TA+LAVNY DR    + 
Sbjct  71    ISKENETNPCFGDEILDGFWVSCRKEALDWFFRIKSHHGFTSLTAILAVNYFDRFMTTIK  130

Query  579   LESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSN  758
             L++   KPWMSQL AVACLSLAAKVEE  VPLL D QVEE+ YVFEAKTIQRMELLVLS 
Sbjct  131   LQTDNNKPWMSQLVAVACLSLAAKVEEIHVPLLFDLQVEEARYVFEAKTIQRMELLVLST  190

Query  759   LEWKMNPVTPFSFLDYIARRLELK-SHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
             L+W+M+PVTP SF D+  RR   +  H   +F  +CE +L+S+++D RFM Y+PSV+A+A
Sbjct  191   LQWRMHPVTPISFFDHFIRRFGSECHHQQLDFFGKCERLLISVVADTRFMSYIPSVLATA  250

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYG-AM  1112
              M++VI  L P   +E Q QL+ +L +D+ KV EC +L+      ++   + KRK     
Sbjct  251   IMIYVIKDLKPCDEDEYQSQLLTLLKVDQNKVNECYELL------LEHNPSKKRKMNWPD  304

Query  1113  PGSPKGVME  1139
               SP GV +
Sbjct  305   QDSPSGVFD  313



>emb|CDX68573.1| BnaC01g26510D [Brassica napus]
Length=352

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 188/313 (60%), Gaps = 23/313 (7%)
 Frame = +3

Query  213   MPFQEPQKL---PFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             M FQE +++   PF    L+CEEE  H  + D           +     +  L+ D+LW+
Sbjct  1     MAFQEEEEVLNAPFCM--LFCEEERSHELEGDE-------SVVKFPFFHLGFLDHDMLWD  51

Query  384   DGELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLD  560
             D EL SL+SKE E     +    +  L   R +A++W+ +V ++Y F+A TALLAVNY D
Sbjct  52    DDELLSLISKENELRPCLSDTVLDEFLVLCREKALDWIFRVKTYYGFNALTALLAVNYFD  111

Query  561   RLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRME  740
               F  S + QT KPWMSQL AVACLSLAAKVEE  VPLLLD QV ++ YVFEAKTIQRME
Sbjct  112   T-FLTSRKFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVGDARYVFEAKTIQRME  170

Query  741   LLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPS  920
             LL+LS L+W+M+PVTP S+ D+I RR   KSH   EFL RCE +LLSI+ D RF+ Y PS
Sbjct  171   LLILSTLQWRMHPVTPISYFDHIIRRCSSKSHHDLEFLSRCESLLLSIVPDSRFLSYSPS  230

Query  921   VMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRK  1100
             V+A+A M+ V+         E + QLM +L +D  KV +C +L+ +             K
Sbjct  231   VLATAIMVSVVGDSTTCDEAEYESQLMTLLKVDPEKVNKCYELVLD---------HIPSK  281

Query  1101  YGAMPGSPKGVME  1139
                 P SP GV +
Sbjct  282   KRMQPASPTGVFD  294



>gb|ABR18175.1| unknown [Picea sitchensis]
Length=368

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 183/263 (70%), Gaps = 12/263 (5%)
 Frame = +3

Query  375   LWEDGELSSLLSKEQENELF--NVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             LW+DGEL++   +E    L+  N V+KN   AKAR +AV+W+LKV +HY F   TA+L++
Sbjct  58    LWDDGELAAFAERET---LYVPNPVEKNSSEAKARQDAVDWILKVHAHYGFGPVTAVLSI  114

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NYLDR F  + + Q  KPWM+QLAAVACLSLAAK++ET VPLLLDFQVEE++Y+FE++TI
Sbjct  115   NYLDR-FLSANQLQQDKPWMTQLAAVACLSLAAKMDETEVPLLLDFQVEEAKYLFESRTI  173

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS LEW+M+PVTP S++D+ +R + L++H C  F  RC+ +LL+ + D +F+ 
Sbjct  174   QRMELLVLSTLEWRMSPVTPLSYIDHASRMIGLENHHCWIFTMRCKEILLNTLRDAKFLG  233

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI--KEVASRIQFE  1082
             +LPSV+A+A MLHVI  +      + + +L+  + ++K   E C  L+   E +S   F 
Sbjct  234   FLPSVVAAAIMLHVIKEIELVNPYQYENRLLSAMKVNKDMCERCIGLLIAPESSSLGSFS  293

Query  1083  SAYKRKYGA----MPGSPKGVME  1139
                KRK  +    +PGSP GV++
Sbjct  294   LGLKRKSSSVNIPIPGSPDGVLD  316



>emb|CDX72453.1| BnaC07g44750D [Brassica napus]
Length=360

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 193/304 (63%), Gaps = 10/304 (3%)
 Frame = +3

Query  204   RKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             RK+   +E Q   FL DALYCEEE       + +   +           +VLL+QDL W+
Sbjct  4     RKEDESREEQSNSFLLDALYCEEEKW--EDEEEEVEENSSFSSSSPTSPLVLLQQDLFWQ  61

Query  384   DGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             D +L +L +KE+E  L         LA  R EAV W+L+V + Y FS   A+LA+ YLD+
Sbjct  62    DQDLVTLFTKEEEQRL--TCLDEVYLATDRKEAVGWILRVNARYGFSTLAAVLAITYLDK  119

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S   Q  KPWM QL +VACLSLAAKVEE  VPLLLDFQVEE++YVFEAKTIQRMEL
Sbjct  120   -FICSYSLQRDKPWMLQLVSVACLSLAAKVEEVHVPLLLDFQVEETKYVFEAKTIQRMEL  178

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L+WKM+ VTP SFLD+I RRL LK++   +FL RC  ++LS+ISD RF+ YLPSV
Sbjct  179   LLLSTLQWKMHLVTPLSFLDHIIRRLGLKNNSHWDFLNRCHRLILSVISDSRFVGYLPSV  238

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKL-----IKEVASRIQFESA  1088
             +A+ATM+ +I ++        Q  L+G+L I K KVE C  L     I  +  +I+ +S 
Sbjct  239   VAAATMMRIIEQVELFDPLSHQNNLLGVLNITKEKVEPCYNLILQLPIDHMGLQIETQSC  298

Query  1089  YKRK  1100
              KRK
Sbjct  299   RKRK  302



>ref|XP_009115688.1| PREDICTED: cyclin-D3-3-like [Brassica rapa]
Length=353

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 191/307 (62%), Gaps = 17/307 (6%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSS  401
             +E Q  PF    L+CEE+   + + D D SC  +   +     +  L++ + WE+ ELSS
Sbjct  7     EEIQNAPFCM--LFCEEDSSGFDEEDED-SCD-KSDGKFPFFHLGFLDRSMSWEEDELSS  62

Query  402   LLSKEQE---NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
             L+ KE +   +     V  +  LA  R +AV+W+L+V SHY FS+ TALLAVNY DR F 
Sbjct  63    LIFKENDFRPSLTEEGVLDDEYLALCREKAVDWILRVKSHYGFSSLTALLAVNYFDR-FI  121

Query  573   LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
              S + QT+ PWMSQL A+ACLSLAAKVEE  VPLL+D QVEE+ YVFEAKTIQRMELL+L
Sbjct  122   TSRKFQTEFPWMSQLTALACLSLAAKVEEVRVPLLVDLQVEEASYVFEAKTIQRMELLIL  181

Query  753   SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
             S L+W+M+PVTP S+LD+I RR   KSH   EFL RCE +LLSI+ D RF+ Y  S +A+
Sbjct  182   STLQWRMHPVTPISYLDHIIRRFSFKSHQQLEFLSRCESLLLSIVPDSRFLSYSSSELAA  241

Query  933   ATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM  1112
             A M+ V          E + QLM +L +D  KV +C +L+        F+    +K    
Sbjct  242   AIMVSVFRGFKTCDESEYESQLMTLLKVDSEKVNKCYELV--------FDHIPSKK-RMQ  292

Query  1113  PGSPKGV  1133
             P SP GV
Sbjct  293   PASPTGV  299



>emb|CDY17742.1| BnaC08g21500D [Brassica napus]
Length=355

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 167/257 (65%), Gaps = 12/257 (5%)
 Frame = +3

Query  378   WEDGELSSLLSKEQE---NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             WE+ ELSSL+SKE E   +     V  +  LA  R +AV+W+L+V SHY FS+ TALLAV
Sbjct  56    WEEDELSSLISKENEFRPSLTEEGVLDDEYLALCREKAVDWILRVKSHYGFSSLTALLAV  115

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S + QT+ PWMSQL A+ACLSLAAKVEE  VPLL+D QVEE+ YVFEAKTI
Sbjct  116   NYFDR-FITSRKFQTEFPWMSQLTALACLSLAAKVEEVRVPLLVDLQVEEASYVFEAKTI  174

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L W+++PVTP S+LD+I RR   KSH   EFL RCE +LLSI+ D RF+ 
Sbjct  175   QRMELLILSTLHWRVHPVTPISYLDHIIRRFSFKSHQQLEFLSRCESLLLSIVPDSRFLS  234

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             Y  S +A+A M+ V          E + QLM +L +D  KV +C +L+        F+  
Sbjct  235   YSSSELAAAIMVSVFRGFKTCDESEYESQLMTLLRVDSEKVHKCYELV--------FDHI  286

Query  1089  YKRKYGAMPGSPKGVME  1139
                K    P SP GV +
Sbjct  287   PSTKRMQQPPSPTGVFD  303



>ref|XP_010464289.1| PREDICTED: cyclin-D3-2-like [Camelina sativa]
Length=368

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 170/260 (65%), Gaps = 10/260 (4%)
 Frame = +3

Query  372   LLWEDGELSSLLSKEQE-NELFNVVQKNPDL-AKARSEAVEWVLKVTSHYSFSAQTALLA  545
              LW+D EL SL+SKE+E N  F   +         R EA++W  +V SH+ F++ TA+LA
Sbjct  58    FLWDDDELMSLISKEKETNPCFGGDEILDGFWVSCRKEALDWFFRVNSHHGFTSSTAILA  117

Query  546   VNYLDRLFF-LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             VNY DR    + L++   KPWMSQL AVACLSLAAKVEE  VPLL D QVEE+ YVFEAK
Sbjct  118   VNYFDRFMTTIKLQTDNNKPWMSQLVAVACLSLAAKVEEIHVPLLFDLQVEEARYVFEAK  177

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRF  902
             TIQRMELLVLS L+W+M+PVTP SF D+  RR   + H   +F  +CE +L+S+++D RF
Sbjct  178   TIQRMELLVLSTLQWRMHPVTPISFFDHFIRRFGSECHQQLDFFGKCERLLISVVADTRF  237

Query  903   MCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE  1082
             M Y+PSV+A+A M++VI  L P    E Q QL+ +L +D+ +V EC +L+      ++  
Sbjct  238   MSYVPSVIATAIMIYVIKDLKPCDEVEYQSQLLTLLKVDQNEVNECYELL------LEHN  291

Query  1083  SAYKRKYG-AMPGSPKGVME  1139
              + KRK       SP GV +
Sbjct  292   PSKKRKMNWPDQDSPSGVFD  311



>ref|XP_002869170.1| CYCD3_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45429.1| CYCD3_1 [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 160/228 (70%), Gaps = 3/228 (1%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED +L +L SKE+E  L  +   +  L+  R EAV W+L+V +HY FS   A LA+
Sbjct  58    DLFWEDEDLVTLFSKEEEQRLSCL--DDVYLSTDRKEAVGWILRVNAHYGFSTLAAALAI  115

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
              YLD+ F  S   Q  KPWM QL +VACLSLAAKVEET VPLLLDFQVEE++YVFEAKTI
Sbjct  116   TYLDK-FICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTI  174

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELL+LS L+WKM+ +TP SF+D+I RRL LK++   +FL +C  +LL +ISD RF+ 
Sbjct  175   QRMELLILSTLQWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKCHRLLLYVISDSRFVG  234

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
             YLPSV+A+ATM+ +I +  P      Q  L+G L + K KV+ C  LI
Sbjct  235   YLPSVVAAATMMRIIEQFEPFDPPSYQTNLLGALNLTKEKVKTCYDLI  282



>dbj|BAM10426.1| cyclin, partial [Salix japonica]
Length=192

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +3

Query  402  LLSKEQENEL---FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFF  572
            L SKE+E +     + V+ +P L++AR EAVEW+L+V +HY FS  T++LA+NYLDR   
Sbjct  1    LFSKEEEQQASVGVSNVESDPFLSRARQEAVEWMLRVIAHYGFSVLTSILAINYLDRFLA  60

Query  573  LSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVL  752
                 +  KPWM QL AV CLSLAAKVEET V LLLD QVE+++Y+FEAKTIQRMELLVL
Sbjct  61   SPCFQRDSKPWMIQLVAVTCLSLAAKVEETHVHLLLDLQVEDTKYLFEAKTIQRMELLVL  120

Query  753  SNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMAS  932
            S L+WKM+PVTP SFLD+I RRL LK+++  EFLRRCE +LLS++SD R + YLPSV+A+
Sbjct  121  STLKWKMHPVTPLSFLDHIIRRLGLKNNVHWEFLRRCEHLLLSVVSDSRSVRYLPSVLAT  180

Query  933  ATMLHVISRL  962
            ATM+HVI ++
Sbjct  181  ATMMHVIDQV  190



>gb|EPS70339.1| hypothetical protein M569_04420, partial [Genlisea aurea]
Length=244

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 168/241 (70%), Gaps = 14/241 (6%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQ-KNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
             DL+W+D EL +L SK++E+           DL   R EAVEWVL++ SHY FSA TA+LA
Sbjct  11    DLMWDDEELQTLFSKQEESFAGETAAVSGGDLP--RKEAVEWVLRINSHYGFSASTAILA  68

Query  546   VNYLDRLFFLSLES-QTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVE-ESEYVFEA  719
             V+YLDR  FLS  S Q +KPWM QLAAVACLSLAAKVEET+VPLLLD QVE  ++Y FEA
Sbjct  69    VSYLDR--FLSGRSFQKEKPWMVQLAAVACLSLAAKVEETYVPLLLDLQVEGATKYAFEA  126

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKS----HLCCEFLRRCEGVLLSII  887
             KTIQRMELL+LS+L+W+MN VTP SF+D+  RRL LK+    +L  EFLRRCE +LL II
Sbjct  127   KTIQRMELLILSSLKWRMNSVTPLSFIDHGMRRLGLKNSNDDNLNWEFLRRCENLLLIII  186

Query  888   SDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVAS  1067
             SD RF  Y PSV+A ATM++        V E    Q++ +L I   +V++C   + E ++
Sbjct  187   SDSRFRRYSPSVLAGATMIYASGNGGAAVDE---CQVISMLRISIEEVKQCCNFLSETSA  243

Query  1068  R  1070
             +
Sbjct  244   K  244



>gb|KCW54856.1| hypothetical protein EUGRSUZ_I00802 [Eucalyptus grandis]
Length=363

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 189/318 (59%), Gaps = 32/318 (10%)
 Frame = +3

Query  228   PQKLPFLFDALYCEEEG----------EHWGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             P   PF  D LYCE+E           E+ G   RD  C I++              DL 
Sbjct  13    PTAPPFSPDGLYCEDETFGEDLADNACEYAGGGARDGLCEIKDPTLPPSLLGQ----DLF  68

Query  378   WEDGELSSLLSKEQENE-LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             WEDGEL+SL+S+E      ++ +  +  +A AR +AV W+L+V  HY F   TA+LAVNY
Sbjct  69    WEDGELASLVSRETGTHPCWDELISDGSVALARKDAVGWILRVHGHYGFRPLTAMLAVNY  128

Query  555   LDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQR  734
             LDR FFLS   Q  +PW+SQL A+ACLS+AAKVEET VP+LLD              +QR
Sbjct  129   LDR-FFLSRSYQRDRPWISQLVALACLSVAAKVEETQVPILLD--------------LQR  173

Query  735   MELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYL  914
             MELL++S L+W+MN VTP SF D+I RR  L ++L  +F   CE +LLS+++D R   +L
Sbjct  174   MELLLMSTLDWRMNSVTPISFFDHILRRFGLTTNLHRQFFWMCERLLLSVVADVRLASFL  233

Query  915   PSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ--FESA  1088
             PSV+A+A ML+V   + P +  E  +QL+ +L I++ +V EC +LI E++          
Sbjct  234   PSVVATAAMLYVNKEIEPCICSEFLDQLLSLLKINEDRVNECYELILELSIDHPEILNYK  293

Query  1089  YKRKYGAMPGSPKGVMEV  1142
             +KRK G++P SP GV++ 
Sbjct  294   HKRKRGSVPSSPSGVIDT  311



>emb|CAA09769.1| cyclin D3 [Oxybasis rubra]
Length=349

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 196/323 (61%), Gaps = 22/323 (7%)
 Frame = +3

Query  198   SSRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLL  377
             + +++ PF   Q  P   D LYCEE+   +   D D   S+   +  +          + 
Sbjct  12    TEQEQQPFS--QNSPLFLDCLYCEEKYWDYDYHDEDDFGSLNSSKLHDCSL-------IC  62

Query  378   WEDGE---LSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLA  545
              ED E   L++L+SKE++ N     +  N  + + R EA+EW+++V  H++FS  T +L 
Sbjct  63    CEDDEEIQLNALVSKEEKINFDEGDLGGNQLVMETRREALEWMIRVNYHHNFSVITLVLG  122

Query  546   VNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             VNY DR F LS   Q + PWM+ LAAVACLSLA+KVEET VPLLLDFQVE  E +FEAK 
Sbjct  123   VNYFDR-FMLSFGFQKEMPWMTHLAAVACLSLASKVEETHVPLLLDFQVEH-EQIFEAKV  180

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             +QRMELLVL +   KMN VTP S+  ++ R+L+LK H  C+ L RCE +++S+I D RF+
Sbjct  181   VQRMELLVLQHSNGKMNAVTPLSYFGHLIRKLKLKPHFHCKILTRCENIIVSVILDPRFL  240

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
             CY+PSV+A+A+M+  +  +      E Q  +M  L +DKVKVE+C   I+EV+S    E 
Sbjct  241   CYVPSVLAAASMVQTLKEIGLWSILEHQNDIMNTLKLDKVKVEDCYNFIQEVSSN---EK  297

Query  1086  AYKRKY----GAMPGSPKGVMEV  1142
             A KRK+     +   +P  V+E+
Sbjct  298   ARKRKWYNNISSANRNPNNVLEL  320



>ref|XP_010426551.1| PREDICTED: cyclin-D3-3-like isoform X2 [Camelina sativa]
Length=369

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 190/320 (59%), Gaps = 34/320 (11%)
 Frame = +3

Query  222   QEPQKLPF--LFDALYCEEE----GEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWE  383
             +E Q  P+  + D L+CEEE     +  G+   D  C  E  ++     + L +QD+ W+
Sbjct  7     EESQNAPYCVVLDGLFCEEEKTEFDDEGGEQQVDLCCE-EGVKKFPFLQLGLSDQDMFWD  65

Query  384   DGELSSLLSKEQENEL--------FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTAL  539
             D ELS+L+SKE E +L        ++ +  +  L   R +A++W+ KV SHY F++ TAL
Sbjct  66    DDELSNLISKEAEEDLSRKKPSLYYDEILDDEFLVLCREKALDWIFKVKSHYGFNSLTAL  125

Query  540   LAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEA  719
             LAVNY DR F  S   Q+ KPWMSQL AVACLSLAAKVEE  VPLLLDFQVEE+ YVFEA
Sbjct  126   LAVNYFDR-FITSRMFQSDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVEEARYVFEA  184

Query  720   KTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCR  899
             KTIQRMELLVLS LEW+M+PVTP S+ D+I RR   +SH   +FL R            R
Sbjct  185   KTIQRMELLVLSTLEWRMHPVTPISYFDHIIRRYSFQSHQQLDFLTRY----------SR  234

Query  900   FMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQF  1079
             F+ Y PSV+A+A M+ VI           Q QLM +L ++K KV +C +L+      +  
Sbjct  235   FLSYSPSVLATAIMVSVIRDSKMCDEAVYQSQLMTLLKVNKEKVNKCYELV------LDH  288

Query  1080  ESAYKR--KYGAMPGSPKGV  1133
               + KR   +   P SP GV
Sbjct  289   SPSKKRMMNWIQQPASPVGV  308



>dbj|BAM10429.1| cyclin, partial [Salix japonica]
Length=222

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +3

Query  597   KPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMN  776
             K WM QLAAVACLSLAAKVEET VPLLLD QVE+++Y+FEAKTI+RMELLVLS L+W+MN
Sbjct  2     KSWMCQLAAVACLSLAAKVEETHVPLLLDLQVEDAKYIFEAKTIKRMELLVLSTLQWRMN  61

Query  777   PVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVIS  956
             PVT  SF D+I RRL LK+HL  EFL RCE +LLS+ISD RFM YLPS++A+ TMLHVI 
Sbjct  62    PVTSISFFDHIIRRLGLKTHLHWEFLWRCERLLLSVISDSRFMYYLPSILATVTMLHVIK  121

Query  957   RLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGVM  1136
              + P    ESQ QLM +L  ++ +V EC KLI E++        +KRKY + PGSP GV+
Sbjct  122   EVDPCNQLESQNQLMAVLKTNEDEVNECYKLIIELSG--SQNQCHKRKYLSKPGSPNGVI  179

Query  1137  E  1139
             +
Sbjct  180   D  180



>ref|XP_004159904.1| PREDICTED: cyclin-D3-1-like [Cucumis sativus]
 gb|KGN43901.1| Cyclin D3.2 protein [Cucumis sativus]
Length=376

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 145/340 (43%), Positives = 196/340 (58%), Gaps = 38/340 (11%)
 Frame = +3

Query  201   SRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             S K    Q      F FD L+C E+  H  +        I         +   L   L+ 
Sbjct  5     SNKHTTTQRLHNSLFFFDLLHCTEQQHHQTE------LPIFLNNGATTTTNFPLSHFLIS  58

Query  381   EDGELSSLLSKEQENELFN------VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             ED EL+ LLSKE++  L +      ++Q +  L+ AR+E ++W+LKV + Y FS+ TALL
Sbjct  59    EDEELAYLLSKEKDQNLQHHAVLETLIQTDNALSLARTEVIDWLLKVNAFYGFSSLTALL  118

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             A+NYLDR+       Q  KPWM QL AV C+SLAAK+EE  VPLLLD QVE+S+Y+FE K
Sbjct  119   AINYLDRILS-GPHFQRDKPWMLQLLAVTCISLAAKIEEIRVPLLLDLQVEDSKYIFEPK  177

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKS-HLCCEFLRRCEGVLLSIISDCR  899
             TIQRMELLVL+ L+WKM+PVTP SFL  I +   +K+ ++  EFLRRCE VLLSI+SD R
Sbjct  178   TIQRMELLVLTALQWKMHPVTPVSFLGIITKEFVMKNQYIQKEFLRRCERVLLSIVSDSR  237

Query  900   FMCYLPSVMASATMLHVISRLVP-TVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ  1076
              +  LPSVMA + M+ V+  +      EE Q+ L+  L I+K +V+EC K+I E  ++  
Sbjct  238   SVGILPSVMAVSAMVSVVEEMGNCNPLEEFQDHLLNALKINKGRVKECCKVIMEAKAK--  295

Query  1077  FESAYKRKY-------------------GAMPGSPKGVME  1139
                + KRK+                    A  GSP GV+E
Sbjct  296   --GSMKRKHVEEKAETGESSEVETEEEEEAEVGSPNGVIE  333



>emb|CDY23022.1| BnaC07g31650D [Brassica napus]
Length=329

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 173/283 (61%), Gaps = 27/283 (10%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQAD----RDPSCSIeeqeeeeeesvvlleqDLLWEDG  389
             +E Q  PF    L+CEEE     + D    + PS  +   +            D+LW+D 
Sbjct  7     EETQNAPFCM--LFCEEESISVFEEDESVVKSPSFHLGFPDH-----------DMLWDDD  53

Query  390   ELSSLLSKEQENELFNVVQKNPDLAKA--RSEAVEWVLKVTSHYSFSAQTALLAVNYLDR  563
             EL  L+SK+ E +   +  K  D  K+  R  A+ W+ +V  +Y FS+ TALLAVNY DR
Sbjct  54    ELLGLISKQDELKP-CLSDKALDEFKSLCRENALGWIFRVKGYYGFSSLTALLAVNYFDR  112

Query  564   LFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMEL  743
              F  S + QT KPWMSQL AVACLSLAAKVEE  VPLLLD QV E+ YVFEAKTIQRMEL
Sbjct  113   -FITSRKFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVGEARYVFEAKTIQRMEL  171

Query  744   LVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSV  923
             L+LS L+W+M+PVTP SF D+I RR    SH   EF  RCE +LLSI+ D RF+ Y PSV
Sbjct  172   LILSTLQWRMHPVTPISFFDHIIRRYSFNSH---EFFSRCESLLLSIVHDSRFLSYTPSV  228

Query  924   MASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
             +A+A M+ V          E + QLM +L +D  KV +C +L+
Sbjct  229   LATAIMVSVARDFKEA---EYESQLMTLLKVDPEKVNKCYELV  268



>gb|AAM77274.1|AF519811_1 cyclin D3.2 protein [Lagenaria siceraria]
Length=380

 Score =   228 bits (581),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 178/256 (70%), Gaps = 21/256 (8%)
 Frame = +3

Query  372   LLWEDGELSSLLSKEQENEL------FNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQT  533
             L++ED EL+ LLSKE++  L        +VQ +  L+ AR+EA++W+LKV + Y FS+ T
Sbjct  61    LVYEDEELNHLLSKEKDQNLQTGAVLKTLVQTDNALSLARTEAIDWLLKVNAFYGFSSLT  120

Query  534   ALLAVNYLDRL----FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEES  701
             ALLA+NYLDR+    +F     Q  KPWM QLAAV C+SLAAKVEE  VPLLLD QVE+S
Sbjct  121   ALLAINYLDRILSGPYF-----QRDKPWMLQLAAVTCISLAAKVEEIRVPLLLDLQVEDS  175

Query  702   EYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKS-HLCCEFLRRCEGVLL  878
             +Y+FEAKTIQRMELLVL+ L+WKM+PV P SFL  I + L +K+ ++  EFLRRCE +LL
Sbjct  176   KYIFEAKTIQRMELLVLTALQWKMHPVAPVSFLGIITKGLGMKNQYIQREFLRRCERILL  235

Query  879   SIISDCRFMCYLPSVMASATMLHVISRLVP-TVGEESQEQLMGILGIDKVKVEECQKLIK  1055
             S++SD R +  LPS+MA + M+ V+  +      EE Q+QL+  L I+K +V+EC K+I 
Sbjct  236   SLVSDSRSVGILPSIMAVSAMVSVVEEMGNCNPLEEFQDQLLNALKINKGRVKECCKVIM  295

Query  1056  EVASRIQFESAYKRKY  1103
             E     + + + KRK+
Sbjct  296   EA----KIKGSGKRKH  307



>ref|XP_004136965.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-D3-1-like [Cucumis sativus]
Length=370

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 188/309 (61%), Gaps = 19/309 (6%)
 Frame = +3

Query  201   SRKKMPFQEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLW  380
             S K    Q      F FD L+C E+  H  +        I         +   L   L+ 
Sbjct  5     SNKHTTTQRLHNSLFFFDLLHCTEQQHHQTE------LPIFLNNGATTTTNFPLSHFLIS  58

Query  381   EDGELSSLLSKEQENELFN------VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALL  542
             ED EL+ LLSKE++  L +      ++Q +  L+ AR+E ++W+LKV + Y FS+ TALL
Sbjct  59    EDEELAYLLSKEKDQNLQHHAVLETLIQTDNALSLARTEVIDWLLKVNAFYGFSSLTALL  118

Query  543   AVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAK  722
             A+NYLDR+       Q  KPWM QL AV C+SLAAK+EE  VPLLLD QVE+S+Y+FE K
Sbjct  119   AINYLDRILS-GPHFQRDKPWMLQLLAVTCISLAAKIEEIRVPLLLDLQVEDSKYIFEPK  177

Query  723   TIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKS-HLCCEFLRRCEGVLLSIISDCR  899
             TIQRMELLVL+ L+WKM+PVTP SFL  I +   +K+ ++  EFLRRCE VLLSI+SD R
Sbjct  178   TIQRMELLVLTALQWKMHPVTPVSFLGIITKEFVMKNQYIQKEFLRRCERVLLSIVSDSR  237

Query  900   FMCYLPSVMASATMLHVISRLVP-TVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQ  1076
              +  LPSVMA + M+ V+  +      EE Q+ L+  L I+K +V+EC K+I E  ++  
Sbjct  238   SVGILPSVMAVSAMVSVVEEMGNCNPLEEFQDHLLNALKINKGRVKECCKVIMEAKAK--  295

Query  1077  FESAYKRKY  1103
                + KRK+
Sbjct  296   --GSMKRKH  302



>ref|XP_009136535.1| PREDICTED: cyclin-D3-3-like [Brassica rapa]
Length=328

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/282 (49%), Positives = 174/282 (62%), Gaps = 25/282 (9%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvll----eqDLLWEDG  389
             +E Q  PF    L+CEEE           SCS+ E++E   +S          D+LW+D 
Sbjct  7     EETQNAPFCM--LFCEEE-----------SCSVFEEDESVVKSPSFHLGFLYHDMLWDDD  53

Query  390   ELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL  L+SK+ E     +    +  L   R  A+ W+ +V  +Y FS+ TALLAVNY DR 
Sbjct  54    ELLGLISKQDELKPCLSDKALDEFLYLCRENALGWIFRVKGYYGFSSLTALLAVNYFDR-  112

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  S + QT KPWMSQL AVACLSLAAKVEE  VPLLLD QV E+ YVFEAKTIQRMELL
Sbjct  113   FITSRKFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVGEARYVFEAKTIQRMELL  172

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             +LS L+W+M+PVTP SF D+I RR    SH   +FL RCE +LLSI+ D RF+ Y PSV+
Sbjct  173   ILSTLQWRMHPVTPVSFFDHIIRRYSSNSH---QFLSRCESLLLSIVHDSRFLSYTPSVL  229

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
             A+A M+ V          E + QLM +L +D  KV +C +L+
Sbjct  230   ATAIMVSVARDFKEA---EYESQLMTLLKVDPEKVNKCYELV  268



>ref|XP_003538806.1| PREDICTED: cyclin-D3-3-like isoform X1 [Glycine max]
 gb|KHN42110.1| Cyclin-D3-2 [Glycine soja]
Length=335

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 154/224 (69%), Gaps = 2/224 (1%)
 Frame = +3

Query  471   RSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQTQ-KPWMSQLAAVACLSLAA  647
             R   V  + K+++ + FS  T +LAVNY DR F  +L  Q++ KPWM+QL AVAC+SLAA
Sbjct  63    RHHVVRLISKLSNFHGFSPLTTVLAVNYFDR-FVATLRFQSELKPWMTQLTAVACVSLAA  121

Query  648   KVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLEL  827
             KVEET VPLL DFQVEES+++FEAKTIQRMELLVLS LEWKMNPVTP SF  +    L L
Sbjct  122   KVEETRVPLLSDFQVEESKFLFEAKTIQRMELLVLSTLEWKMNPVTPISFFQHFLTSLGL  181

Query  828   KSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGI  1007
             K HL  E LRRC+ +LLS+I+D R M YLPS +A+A M+HVI  + P    E + QL+G+
Sbjct  182   KRHLHSESLRRCQRLLLSVIADSRVMSYLPSTVAAAIMIHVIKEIEPLNATEYRNQLLGL  241

Query  1008  LGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMPGSPKGVME  1139
             L   + +V+EC KL+  +    +     +RK  + P SP GV++
Sbjct  242   LKTSEEQVDECYKLMLRLLVCSKGIHNLRRKRLSEPSSPDGVID  285



>gb|AAK54466.1| cyclin D3 [Helianthus annuus]
Length=308

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 170/262 (65%), Gaps = 12/262 (5%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WE  EL SL +KE+E +       +  L+  R EAV+W+LKV   + F+  TA+LA+
Sbjct  42    DLCWEHEELVSLFTKEEEQQKQTPWPSSCTLS-FRKEAVDWILKVKGCHGFTPLTAILAI  100

Query  549   NYLDRLFFLSLESQ-TQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKT  725
             NYLDR F  SL  Q    PWM  L AV CLSLAAK++ET VPLLLD Q+EES+++FEAK 
Sbjct  101   NYLDR-FLSSLHFQKANTPWMIHLVAVTCLSLAAKIQETHVPLLLDLQLEESKFLFEAKN  159

Query  726   IQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFM  905
             IQ+ ELLV+S L+W+MN VTP SFLD+I RRL L +HL  +F ++CE ++L +++D RF+
Sbjct  160   IQKTELLVMSTLKWRMNLVTPISFLDHIVRRLGLSNHLHWDFFKKCEAMILYLVADSRFV  219

Query  906   CYLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFES  1085
             CY PSV+A+ATML V+  + PT     + QL+ +L   K  + EC KL+ +++    +++
Sbjct  220   CYKPSVLATATMLCVVEEIDPTNSIGYKSQLLDLLKTTKDHINECYKLVMDLS----YDN  275

Query  1086  AYKRKYG-----AMPGSPKGVM  1136
               K K         P SP G +
Sbjct  276   HNKGKRDENERTIYPVSPAGFI  297



>emb|CDY02095.1| BnaA03g40720D [Brassica napus]
Length=328

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 136/282 (48%), Positives = 174/282 (62%), Gaps = 25/282 (9%)
 Frame = +3

Query  222   QEPQKLPFLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvll----eqDLLWEDG  389
             +E Q  PF    L+CEEE           SCS+ E++E   +S          D+LW+D 
Sbjct  7     EETQNAPFCM--LFCEEE-----------SCSVFEEDESVVKSPSFHLGFLHHDMLWDDD  53

Query  390   ELSSLLSKEQE-NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRL  566
             EL  L+SK+ E     +    +  L+  R  A+ W+ +V  +Y FS+ TALLAVNY DR 
Sbjct  54    ELLGLISKQDELKPCLSDKALDEFLSLCRENALGWIFRVKGYYGFSSLTALLAVNYFDR-  112

Query  567   FFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELL  746
             F  S + QT KPWMSQL AVACLSLAAKVEE  VPLLLD QV E+ YVFEAKTIQRMELL
Sbjct  113   FITSRKFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDLQVGEARYVFEAKTIQRMELL  172

Query  747   VLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVM  926
             +LS L+W+M+PVTP SF D+I RR    S    +FL RCE +LLSI+ D RF+ Y PSV+
Sbjct  173   ILSTLQWRMHPVTPISFFDHIIRRYSSNSR---QFLSRCESLLLSIVHDSRFLSYTPSVL  229

Query  927   ASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLI  1052
             A+A M+ V          E + QLM +L +D  KV +C +L+
Sbjct  230   ATAIMVSVARDFKEA---EYESQLMTLLKVDPEKVNKCYELV  268



>ref|XP_003516610.1| PREDICTED: cyclin-D3-2-like [Glycine max]
Length=334

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 152/225 (68%), Gaps = 3/225 (1%)
 Frame = +3

Query  471   RSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT-QKPWMSQLAAVACLSLAA  647
             R + V W+  V+  ++F+  T +LAVNY DR F  +L  Q+ QKPWM+ LAA+AC+SLAA
Sbjct  61    RHDVVRWISTVSDFHAFAPLTTVLAVNYFDR-FVTTLRFQSEQKPWMTHLAALACVSLAA  119

Query  648   KVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLEL  827
             KVEET VPLL DFQV ES+++FEAKTIQ+MELLVLS LEWKMNPVTP SF  +   RL L
Sbjct  120   KVEETRVPLLFDFQVGESKFLFEAKTIQKMELLVLSTLEWKMNPVTPISFFQHFLARLGL  179

Query  828   KSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGI  1007
             K HL  EFL RC+ +LLS+I+D R M YLPS +A+A M+H+I  + P    E Q QL G+
Sbjct  180   KRHLHSEFLCRCQRLLLSVIADSRVMSYLPSTLAAAIMIHIIKEIEPLNATEYQNQLPGL  239

Query  1008  LGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMP-GSPKGVME  1139
             L   + +V EC KLI  +          +RK  + P  SP GV++
Sbjct  240   LKTSEEQVNECYKLILGLYVCSNGIHNLRRKRLSEPSSSPDGVID  284



>gb|ACY82354.1| transcription factor cyclin D3a [Oreocharis dinghushanensis]
Length=254

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 169/268 (63%), Gaps = 36/268 (13%)
 Frame = +3

Query  213  MPFQEPQKLPFLFDALYCEEEGEHW----------------------GQADRDPSCSIee  326
            M F +   L F  D+L+CEEE  HW                      G +D D   +   
Sbjct  1    MSFHQLNPL-FTIDSLHCEEE--HWDTNEEILENNTRNYFFIAEEGVGDSDLDKDSN---  54

Query  327  qeeeeeesvvlleqDLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVT  506
            +    E  V  LEQ+ L ED EL  LL+KE+ NE+ +  + +P    +R EAVEW+L VT
Sbjct  55   KFVNPESFVGFLEQNSLGEDEELKCLLAKEKGNEVCDGFEPSP----SRGEAVEWILNVT  110

Query  507  SHYSFSAQTALLAVNYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDF  686
             +YSFSA TA+LAVNYLDR F     S  +KPWM+QL AVACLSLAAKVEET VPLLLD 
Sbjct  111  GYYSFSALTAVLAVNYLDR-FLYGFHSHREKPWMTQLVAVACLSLAAKVEETQVPLLLDL  169

Query  687  QVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCE  866
            QVEE++YVFE+KTIQRMELLVLS L+WKMNPVTP SFLDYI+R L LKS L    LRR E
Sbjct  170  QVEEAKYVFESKTIQRMELLVLSTLQWKMNPVTPHSFLDYISRSLGLKSSLSNYVLRRFE  229

Query  867  GVLLSIISDCRFMCYLPSVMASATMLHV  950
             +LLSIIS  +   Y   ++   +++HV
Sbjct  230  CLLLSIISGRKLYIY---ILTLVSIMHV  254



>gb|KFK34267.1| hypothetical protein AALP_AA5G122800 [Arabis alpina]
Length=355

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 185/309 (60%), Gaps = 30/309 (10%)
 Frame = +3

Query  231   QKLPF-LFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLL  407
             Q  P+ + D L CEEE     Q D     S       ++        D+ ++D EL SL+
Sbjct  10    QNAPYCILDGLICEEESGFDEQVDLPLKFSFFHVGFTDQ--------DMFYDDDELLSLI  61

Query  408   SKEQE----NELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFL  575
             SKE+E      +F+       L   R ++++W+ +V SHY F++ TALLAVNY DR F  
Sbjct  62    SKEEELKPCEGIFDEF-----LVLCREKSLDWIFRVKSHYGFNSLTALLAVNYFDR-FIT  115

Query  576   SLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLS  755
             S   QT KPWMSQL AVACLSLAAKVEE  VPLLLDFQVEE+ YVFEAKTIQRMELL+LS
Sbjct  116   SRMFQTDKPWMSQLTAVACLSLAAKVEEIRVPLLLDFQVEEARYVFEAKTIQRMELLILS  175

Query  756   NLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASA  935
              L+W+M+PVTP SF D+I RR  L+     EFL  CE +LLSI+ D RFM Y  SV+A+A
Sbjct  176   TLQWRMHPVTPISFFDHIIRRFNLQ----FEFLSSCESLLLSIVPDSRFMSYSSSVLATA  231

Query  936   TMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAM-  1112
              M+ VI         E + QLM +L ++K KV +C +L+      +    + KR    M 
Sbjct  232   IMVSVIRDFKTCDEAEYESQLMTLLKVNKEKVNKCYELV------LDHTPSKKRMMNWMQ  285

Query  1113  PGSPKGVME  1139
             P SP GV +
Sbjct  286   PASPIGVFD  294



>gb|KHN36259.1| Cyclin-D3-2 [Glycine soja]
Length=334

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 151/225 (67%), Gaps = 3/225 (1%)
 Frame = +3

Query  471   RSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT-QKPWMSQLAAVACLSLAA  647
             R + V W+  V+  ++F+  T +LAVNY DR F  +L  Q+ QKPWM+ LAA+AC+SLAA
Sbjct  61    RHDVVRWISTVSDFHAFAPLTTVLAVNYFDR-FVTTLRFQSEQKPWMTHLAALACVSLAA  119

Query  648   KVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMNPVTPFSFLDYIARRLEL  827
             KVEET VPLL DFQV ES+++FEAKTIQ+MELLVLS LEWKMNPVTP SF  +   RL L
Sbjct  120   KVEETRVPLLFDFQVGESKFLFEAKTIQKMELLVLSTLEWKMNPVTPISFFQHFLARLGL  179

Query  828   KSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVISRLVPTVGEESQEQLMGI  1007
             K HL  EFL RC+ +LLS+I+D R M YLPS +A+A  +H+I  + P    E Q QL G+
Sbjct  180   KRHLHSEFLCRCQRLLLSVIADSRVMSYLPSTLAAAITIHIIKEIEPLNATEYQNQLPGL  239

Query  1008  LGIDKVKVEECQKLIKEVASRIQFESAYKRKYGAMP-GSPKGVME  1139
             L   + +V EC KL+  +          +RK  + P  SP GV++
Sbjct  240   LKTSEEQVNECYKLMLGLYVSSNGIHNLRRKRLSEPSSSPDGVID  284



>gb|EYU34556.1| hypothetical protein MIMGU_mgv1a009276mg [Erythranthe guttata]
Length=347

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 177/264 (67%), Gaps = 10/264 (4%)
 Frame = +3

Query  369   DLLWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAV  548
             DL WED E+++LLSKE+      VV  +     +R++AV WVL+V + + F+A TA LAV
Sbjct  48    DLFWEDEEITTLLSKEKTQP--GVVNSDTPFNTSRNDAVSWVLRVVTRHGFAAATAALAV  105

Query  549   NYLDRLFFLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             NY DR F  S+  Q  KPWM QLAAVAC+S+AAK+EET VPLLLD QVEES+YVFE +T+
Sbjct  106   NYFDR-FITSIFFQRDKPWMGQLAAVACVSVAAKMEETQVPLLLDLQVEESKYVFEGRTV  164

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS L+W+MN VTP SF+D+I RR +L ++L  +F RRCE VL+SI++DCR + 
Sbjct  165   QRMELLVLSTLQWRMNLVTPISFVDHIVRRFDLFTNLHFDFFRRCERVLISILTDCRLVH  224

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
             Y+PSV+A + M +VI             QLM  LG  + K+++C KLI +V      +  
Sbjct  225   YIPSVIAGSIMKYVIGEFEHFDELGYLNQLMSALGTTEEKIDDCYKLITDVMDHDDGDDD  284

Query  1089  Y------KRKYGA-MPGSPKGVME  1139
             Y      KRK G  +P SP GV++
Sbjct  285   YGYKFRHKRKSGTYVPSSPSGVVD  308



>ref|XP_010246564.1| PREDICTED: cyclin-D3-3-like [Nelumbo nucifera]
Length=324

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 174/284 (61%), Gaps = 21/284 (7%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
             F+ D LYC+EE E      R+                +LL+ D  WE+ EL  LLSKE +
Sbjct  55    FVVDDLYCKEEDERNNNIGRN----------------LLLDHDQFWEEIELHLLLSKEAQ  98

Query  423   NE---LFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLESQT  593
                    N  + +  L  AR  AVEW+LKV   YSFSA T +L+V+YLD+ F  +L+ Q 
Sbjct  99    THPDPTLNNCETDVSLTSARRNAVEWILKVGGQYSFSALTLVLSVSYLDQ-FLSTLQIQI  157

Query  594   QKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKM  773
              KPWM QL AVACLSLAAK+EET VPLLLD Q  E+ YVFE K++QRMELLVLS L+WKM
Sbjct  158   DKPWMMQLIAVACLSLAAKLEETHVPLLLDLQAVEARYVFEPKSVQRMELLVLSTLKWKM  217

Query  774   NPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVI  953
              PVTP  F+++   +L+ K+    E     E VLLS+++D RF+CY PS +A+A M++VI
Sbjct  218   YPVTPICFINHFIEKLDAKTCYQXELRILSEHVLLSVVTDSRFVCYRPSELAAAIMIYVI  277

Query  954   SRL-VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFE  1082
             +R    +     +++L+ IL I   ++E C +LI   +S +Q +
Sbjct  278   NRTRANSQSVNYKKKLLSILKISTDRLEGCNQLIVGSSSDVQIQ  321



>dbj|BAM10427.1| cyclin, partial [Salix japonica]
Length=233

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = +3

Query  597   KPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLEWKMN  776
             K WM QLAAVACLSLAAKVEET+VPLLLD QVE+++YVFEAKTI+RMEL VLS L W+MN
Sbjct  2     KSWMCQLAAVACLSLAAKVEETYVPLLLDLQVEDAKYVFEAKTIKRMELWVLSTLHWRMN  61

Query  777   PVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATMLHVIS  956
             PVT  SF D+I RRL LK+HL  EFL RCE +LLS+ISD R + YLPS++A+ATMLHVI 
Sbjct  62    PVTSISFFDHIIRRLGLKTHLHWEFLWRCERLLLSVISDSRSVSYLPSILATATMLHVIK  121

Query  957   RLVPTVGEESQEQLMGILGIDKVKVEECQKLI-KEVASRIQFESAYKRKYGAMPGSPKGV  1133
              + P    E Q QLM +L   + +V EC KLI ++  S+ Q     KRKY + P SP GV
Sbjct  122   EVEPRNQLEYQNQLMAVLKTSEDEVNECYKLILEQPGSQSQ---CLKRKYLSTPSSPNGV  178

Query  1134  M  1136
             +
Sbjct  179   I  179



>gb|EPS68559.1| hypothetical protein M569_06207, partial [Genlisea aurea]
Length=255

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 167/258 (65%), Gaps = 29/258 (11%)
 Frame = +3

Query  375   LWEDGELSSLLSKEQENELFNVVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNY  554
             L ED EL  +L KEQE E    V        +R+EAVEW+L + ++ SFS QTA+LA NY
Sbjct  1     LQEDQELECMLKKEQELE----VGDGFPFPISRAEAVEWMLNMVAYVSFSPQTAVLATNY  56

Query  555   LDRLF--FLSLESQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTI  728
             LDR    F    +   KPW++ LAAVACLSLAAKVEET VPLLL  QVE S+YVFE KTI
Sbjct  57    LDRFLIAFKKSNADDDKPWITHLAAVACLSLAAKVEETHVPLLLHLQVE-SKYVFEPKTI  115

Query  729   QRMELLVLSNLEWKMNPVTPFSFLDYIARRLELKSHLCCEFLRRCEGVLLSIISDCRFMC  908
             QRMELLVLS LEWKMNPVTP +FL +      L S +   F+ RCE +LLS+++DCRFM 
Sbjct  116   QRMELLVLSTLEWKMNPVTPLTFLHH------LSSQMGRFFITRCESLLLSVLADCRFMG  169

Query  909   YLPSVMASATMLHVISRLVPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESA  1088
               PS +A+ATM++V+    P++      Q+ GILG+++ KVEE  +L++EV         
Sbjct  170   CSPSSLAAATMVYVM----PSIA----GQVAGILGMEQEKVEEWCRLMEEV--------E  213

Query  1089  YKRKYGAMPGSPKGVMEV  1142
             + ++      SP GV+++
Sbjct  214   FNKRIWLDVESPMGVVDI  231



>ref|XP_008454979.1| PREDICTED: cyclin-D3-3 [Cucumis melo]
Length=378

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 195/330 (59%), Gaps = 45/330 (14%)
 Frame = +3

Query  243   FLFDALYCEEEGEHWGQADRDPSCSIeeqeeeeeesvvlleqDLLWEDGELSSLLSKEQE  422
             F FD L+C E   H  +        +         +   L   L+ ED EL+ LLSKE++
Sbjct  18    FFFDLLHCTEHQHHHTE--------LPIFLNNGATNNFPLSHFLISEDEELAYLLSKEKD  69

Query  423   NELFN------VVQKNPDLAKARSEAVEWVLKVTSHYSFSAQTALLAVNYLDRLFFLSLE  584
               L        ++Q +  L+ AR+EA++W+LKV + Y FS+ TALLA+NYLDR+      
Sbjct  70    QNLQTHAVLETLIQTDNALSLARTEAIDWLLKVNAFYGFSSLTALLAINYLDRILS-GPH  128

Query  585   SQTQKPWMSQLAAVACLSLAAKVEETFVPLLLDFQVEESEYVFEAKTIQRMELLVLSNLE  764
              Q  KPWM QL AV C+SLAAK+EE  VPLLLD QVE+S+Y+FE KTIQRMELLVL+ L+
Sbjct  129   FQRDKPWMLQLLAVTCISLAAKIEEIRVPLLLDLQVEDSKYIFEPKTIQRMELLVLTALQ  188

Query  765   WKMNPVTPFSFLDYIARRLELKS-HLCCEFLRRCEGVLLSIISDCRFMCYLPSVMASATM  941
             WKM+PVTP SFL  I +  E+K+ ++  EFLRRCE VLLSI+SD R +  LPSVMA + M
Sbjct  189   WKMHPVTPVSFLGIITKGFEMKNQYIQREFLRRCERVLLSIVSDSRSVGILPSVMAVSVM  248

Query  942   LHVISRL--VPTVGEESQEQLMGILGIDKVKVEECQKLIKEVASRIQFESAYKRKY----  1103
             + V+  +   P + EE Q+ L+  L I+K +V+EC K+I E  ++     + KRK+    
Sbjct  249   VSVVEEMGNCPPL-EEFQDHLLNALKINKGRVKECCKVIMEAKAK----GSMKRKHVEEK  303

Query  1104  ------------------GAMPGSPKGVME  1139
                                A  GSP GVME
Sbjct  304   AETEESSEAETDQEEEEAEAEVGSPNGVME  333



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4696885476248