BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21594_g1_i4 len=1099 path=[1:0-242 244:243-416 418:417-456
@458@!:457-973 975:974-1098]

Length=1099
                                                                      Score     E

ref|XP_009627312.1|  PREDICTED: chlorophyll a-b binding protein, ...    452   2e-156   
emb|CDP03055.1|  unnamed protein product                                452   4e-156   
ref|XP_004251698.1|  PREDICTED: chlorophyll a-b binding protein, ...    451   4e-156   
ref|XP_011093862.1|  PREDICTED: chlorophyll a-b binding protein, ...    433   7e-149   
ref|XP_006345258.1|  PREDICTED: chlorophyll a-b binding protein, ...    432   1e-148   
gb|KDP33938.1|  hypothetical protein JCGZ_07509                         431   5e-148   
ref|XP_009759850.1|  PREDICTED: chlorophyll a-b binding protein, ...    429   3e-147   
ref|XP_002277280.1|  PREDICTED: chlorophyll a-b binding protein, ...    425   9e-146   Vitis vinifera
ref|XP_010687546.1|  PREDICTED: chlorophyll a-b binding protein, ...    422   1e-144   
ref|XP_007202451.1|  hypothetical protein PRUPE_ppa010035mg             420   2e-143   
ref|XP_008242266.1|  PREDICTED: chlorophyll a-b binding protein, ...    417   1e-142   
ref|XP_006474704.1|  PREDICTED: chlorophyll a-b binding protein, ...    417   1e-142   
ref|XP_002516245.1|  chlorophyll A/B binding protein, putative          418   2e-142   Ricinus communis
ref|XP_006381597.1|  chlorophyll A-B binding family protein             415   7e-142   
gb|EYU25834.1|  hypothetical protein MIMGU_mgv1a012037mg                415   8e-142   
gb|ABK96605.1|  unknown                                                 415   1e-141   Populus trichocarpa x Populus deltoides
ref|XP_008242265.1|  PREDICTED: chlorophyll a-b binding protein, ...    415   1e-141   
gb|KHN12296.1|  Chlorophyll a-b binding protein, chloroplastic          414   2e-141   
ref|XP_004288997.1|  PREDICTED: chlorophyll a-b binding protein, ...    414   2e-141   
gb|KHG29329.1|  Chlorophyll a-b binding, chloroplastic                  414   4e-141   
ref|XP_003546513.1|  PREDICTED: chlorophyll a-b binding protein, ...    412   9e-141   
ref|XP_010099098.1|  Chlorophyll a-b binding protein                    413   1e-140   
ref|NP_001276216.1|  chlorophyll a-b binding protein, chloroplast...    411   2e-140   
ref|XP_007012597.1|  Photosystem I light harvesting complex gene ...    411   3e-140   
gb|KHN42786.1|  Chlorophyll a-b binding protein, chloroplastic          409   1e-139   
emb|CAN69989.1|  hypothetical protein VITISV_024400                     408   2e-139   Vitis vinifera
ref|XP_006474703.1|  PREDICTED: chlorophyll a-b binding protein, ...    409   4e-139   
ref|XP_006474702.1|  PREDICTED: chlorophyll a-b binding protein, ...    408   6e-139   
ref|XP_011039957.1|  PREDICTED: chlorophyll a-b binding protein, ...    407   9e-139   
ref|XP_010272798.1|  PREDICTED: chlorophyll a-b binding protein 7...    407   1e-138   
ref|XP_009418009.1|  PREDICTED: chlorophyll a-b binding protein, ...    406   2e-138   
ref|XP_010531966.1|  PREDICTED: chlorophyll a-b binding protein, ...    407   2e-138   
gb|EYU25833.1|  hypothetical protein MIMGU_mgv1a012037mg                406   4e-138   
ref|XP_010932388.1|  PREDICTED: chlorophyll a-b binding protein, ...    405   7e-138   
ref|XP_006452840.1|  hypothetical protein CICLE_v10009205mg             405   1e-137   
ref|XP_006452839.1|  hypothetical protein CICLE_v10009205mg             405   1e-137   
ref|XP_010459573.1|  PREDICTED: chlorophyll a-b binding protein, ...    404   2e-137   
ref|XP_007012598.1|  Photosystem I light harvesting complex gene ...    404   3e-137   
ref|XP_007138637.1|  hypothetical protein PHAVU_009G225500g             403   4e-137   
ref|XP_004488100.1|  PREDICTED: chlorophyll a-b binding protein 7...    403   5e-137   
ref|XP_010477121.1|  PREDICTED: chlorophyll a-b binding protein, ...    403   8e-137   
ref|NP_173349.1|  PSI type II chlorophyll a/b-binding protein (Lh...    402   9e-137   Arabidopsis thaliana [mouse-ear cress]
gb|AAO22627.1|  putative light-harvesting chlorophyll a/b binding...    402   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784474.1|  PREDICTED: chlorophyll a-b binding protein, ...    402   1e-136   
gb|KFK44053.1|  hypothetical protein AALP_AA1G210000                    402   2e-136   
ref|XP_004488099.1|  PREDICTED: chlorophyll a-b binding protein 7...    402   2e-136   
ref|XP_002890321.1|  hypothetical protein ARALYDRAFT_472139             401   4e-136   
ref|XP_006416532.1|  hypothetical protein EUTSA_v10008493mg             399   1e-135   
gb|AFK42470.1|  unknown                                                 399   2e-135   
ref|XP_010498326.1|  PREDICTED: chlorophyll a-b binding protein, ...    399   5e-135   
ref|XP_008450947.1|  PREDICTED: chlorophyll a-b binding protein, ...    398   6e-135   
emb|CDX96677.1|  BnaA08g22200D                                          397   1e-134   
emb|CDX83783.1|  BnaC08g18620D                                          396   2e-134   
ref|NP_001289223.1|  chlorophyll a-b binding protein, chloroplastic     396   3e-134   
ref|XP_008389009.1|  PREDICTED: chlorophyll a-b binding protein, ...    396   3e-134   
ref|XP_009110297.1|  PREDICTED: chlorophyll a-b binding protein, ...    395   6e-134   
ref|XP_004144043.1|  PREDICTED: chlorophyll a-b binding protein, ...    394   2e-133   
ref|XP_006306445.1|  hypothetical protein CARUB_v10012387mg             394   3e-133   
gb|AAF82226.1|AC069143_2  Contains similarity to a chlorophyll a/...    392   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AES65592.2|  light-harvesting complex I chlorophyll A/B-bindin...    392   2e-132   
ref|XP_004161120.1|  PREDICTED: chlorophyll a-b binding protein, ...    391   2e-132   
ref|XP_003595341.1|  Chlorophyll a-b binding protein                    390   8e-132   
ref|XP_010049390.1|  PREDICTED: chlorophyll a-b binding protein, ...    387   6e-131   
gb|AFK45037.1|  unknown                                                 375   8e-126   
gb|AAA57542.1|  PSI type II chlorophyll a/b-binding protein             373   4e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956926.1|  PREDICTED: chlorophyll a-b binding protein 7...    371   3e-124   
ref|XP_004956925.1|  PREDICTED: chlorophyll a-b binding protein 7...    371   4e-124   
ref|XP_004956924.1|  PREDICTED: chlorophyll a-b binding protein 7...    369   2e-123   
ref|NP_001063275.1|  Os09g0439500                                       365   3e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667517.1|  PREDICTED: uncharacterized protein LOC100273...    364   9e-122   
gb|EEC84641.1|  hypothetical protein OsI_31519                          364   1e-121   Oryza sativa Indica Group [Indian rice]
tpg|DAA40157.1|  TPA: hypothetical protein ZEAMMB73_160322              362   2e-121   
ref|NP_001141336.1|  hypothetical protein                               363   2e-121   Zea mays [maize]
ref|XP_010238211.1|  PREDICTED: chlorophyll a-b binding protein 7...    361   3e-120   
ref|XP_003576571.1|  PREDICTED: chlorophyll a-b binding protein 7...    359   9e-120   
dbj|BAJ86784.1|  predicted protein                                      350   4e-116   
dbj|BAJ88556.1|  predicted protein                                      350   5e-116   
dbj|BAJ94030.1|  predicted protein                                      349   1e-115   
gb|AFK40780.1|  unknown                                                 315   6e-103   
ref|XP_002299309.1|  chlorophyll a/b-binding protein type II prec...    315   3e-102   Populus trichocarpa [western balsam poplar]
sp|P13869.1|CB12_PETHY  RecName: Full=Chlorophyll a-b binding pro...    312   2e-101   Petunia x hybrida [garden petunia]
ref|XP_006352516.1|  PREDICTED: chlorophyll a-b binding protein 7...    312   4e-101   
ref|XP_003528751.1|  PREDICTED: chlorophyll a-b binding protein 7...    311   7e-101   
ref|XP_006484100.1|  PREDICTED: chlorophyll a-b binding protein, ...    311   7e-101   
ref|XP_011086789.1|  PREDICTED: chlorophyll a-b binding protein, ...    311   7e-101   
ref|XP_007044017.1|  Chlorophyll a-b binding protein 7, chloropla...    311   7e-101   
gb|KHG11922.1|  Chlorophyll a-b binding 7, chloroplastic                310   2e-100   
emb|CDP13340.1|  unnamed protein product                                310   2e-100   
ref|XP_006438030.1|  hypothetical protein CICLE_v10031886mg             313   3e-100   
ref|XP_011036086.1|  PREDICTED: chlorophyll a-b binding protein 7...    309   3e-100   
ref|XP_007139043.1|  hypothetical protein PHAVU_009G260200g             309   4e-100   
ref|XP_011002123.1|  PREDICTED: chlorophyll a-b binding protein 7...    309   5e-100   
ref|XP_010044808.1|  PREDICTED: chlorophyll a-b binding protein 7...    308   5e-100   
ref|XP_010100230.1|  Chlorophyll a-b binding protein                    309   6e-100   
ref|XP_004248339.1|  PREDICTED: chlorophyll a-b binding protein 7...    308   8e-100   
emb|CAA57492.1|  Type II chlorophyll a/b binding protein from pho...    308   8e-100   Pisum sativum [garden pea]
ref|XP_003548018.1|  PREDICTED: chlorophyll a-b binding protein 7...    308   8e-100   
gb|ABK95601.1|  unknown                                                 308   9e-100   Populus trichocarpa [western balsam poplar]
gb|ABK95596.1|  unknown                                                 308   9e-100   Populus trichocarpa [western balsam poplar]
ref|XP_006848348.1|  hypothetical protein AMTR_s00013p00180670          308   9e-100   
ref|XP_002303791.1|  chlorophyll a/b-binding protein type II prec...    308   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010917526.1|  PREDICTED: chlorophyll a-b binding protein, ...    308   1e-99    
ref|NP_001239987.1|  uncharacterized protein LOC100794944               308   1e-99    
ref|XP_011020754.1|  PREDICTED: chlorophyll a-b binding protein 7...    308   2e-99    
ref|XP_010669087.1|  PREDICTED: chlorophyll a-b binding protein, ...    308   2e-99    
ref|XP_002514914.1|  chlorophyll A/B binding protein, putative          307   2e-99    Ricinus communis
ref|XP_010655886.1|  PREDICTED: chlorophyll a-b binding protein, ...    307   2e-99    
ref|XP_010531194.1|  PREDICTED: chlorophyll a-b binding protein 7...    307   2e-99    
gb|KDP26804.1|  hypothetical protein JCGZ_17962                         306   4e-99    
ref|XP_010531186.1|  PREDICTED: chlorophyll a-b binding protein 7...    306   4e-99    
ref|XP_009405484.1|  PREDICTED: chlorophyll a-b binding protein 7...    308   4e-99    
gb|ABY63668.1|  chloroplast chlorophyll a/b binding protein             306   5e-99    
ref|NP_001060090.1|  Os07g0577600                                       306   8e-99    Oryza sativa Japonica Group [Japonica rice]
gb|KDO81901.1|  hypothetical protein CISIN_1g024422mg                   306   8e-99    
gb|EYU25891.1|  hypothetical protein MIMGU_mgv1a025195mg                305   9e-99    
gb|AGV54278.1|  light-harvesting complex I protein Lhca2                306   9e-99    
ref|XP_003637339.1|  Chlorophyll a-b binding protein                    306   9e-99    
gb|AFK35880.1|  unknown                                                 305   1e-98    
ref|XP_010905185.1|  PREDICTED: chlorophyll a-b binding protein 7...    305   1e-98    
gb|AGV54335.1|  chlorophyll A/B binding protein 7 chloroplastic-l...    305   1e-98    
gb|AFK45885.1|  unknown                                                 305   1e-98    
gb|KHN15861.1|  Chlorophyll a-b binding protein 7, chloroplastic        305   1e-98    
ref|XP_008805305.1|  PREDICTED: chlorophyll a-b binding protein 7...    305   1e-98    
ref|XP_009587026.1|  PREDICTED: chlorophyll a-b binding protein, ...    305   2e-98    
ref|XP_009787153.1|  PREDICTED: chlorophyll a-b binding protein, ...    305   3e-98    
emb|CAN72005.1|  hypothetical protein VITISV_033663                     305   3e-98    Vitis vinifera
ref|XP_002984998.1|  light-harvesting complex                           304   3e-98    
ref|XP_002986188.1|  light-harvesting complex                           304   4e-98    
ref|XP_007139044.1|  hypothetical protein PHAVU_009G260200g             304   5e-98    
ref|XP_008446036.1|  PREDICTED: chlorophyll a-b binding protein 7...    303   7e-98    
ref|XP_006657881.1|  PREDICTED: chlorophyll a-b binding protein 7...    303   7e-98    
ref|XP_004510609.1|  PREDICTED: chlorophyll a-b binding protein 7...    303   7e-98    
ref|XP_004135326.1|  PREDICTED: chlorophyll a-b binding protein 7...    303   9e-98    
ref|XP_009415903.1|  PREDICTED: chlorophyll a-b binding protein 7...    303   1e-97    
emb|CAA41406.1|  Type II chlorophyll a /b-binding protein               303   2e-97    Pinus sylvestris [Scotch pine]
ref|XP_009104311.1|  PREDICTED: chlorophyll a-b binding protein, ...    301   2e-97    
gb|EPS71951.1|  chlorophyll a-b binding protein 7, chloroplastic        301   2e-97    
gb|ABK21282.1|  unknown                                                 302   3e-97    Picea sitchensis
gb|KHN16392.1|  Chlorophyll a-b binding protein 7, chloroplastic        308   4e-97    
dbj|BAJ34383.1|  unnamed protein product                                300   6e-97    
ref|XP_007222715.1|  hypothetical protein PRUPE_ppa009903mg             301   7e-97    
ref|XP_008801837.1|  PREDICTED: chlorophyll a-b binding protein 7...    300   8e-97    
emb|CAC81065.1|  putative chlorophyll A-B binding protein of LHCI...    301   1e-96    Picea abies
ref|XP_007135346.1|  hypothetical protein PHAVU_010G121400g             300   1e-96    
ref|NP_001147224.1|  chlorophyll a-b binding protein                    299   2e-96    Zea mays [maize]
ref|XP_002876615.1|  Lhca2 protein                                      299   2e-96    
ref|XP_009138769.1|  PREDICTED: chlorophyll a-b binding protein, ...    299   3e-96    
ref|XP_009372280.1|  PREDICTED: chlorophyll a-b binding protein, ...    299   3e-96    
ref|XP_008340223.1|  PREDICTED: chlorophyll a-b binding protein, ...    299   4e-96    
gb|AHM26638.1|  a-b binding protein                                     299   4e-96    
emb|CAB71077.1|  Lhca2 protein                                          298   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191706.2|  photosystem I light harvesting complex protein        298   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389866.1|  PREDICTED: chlorophyll a-b binding protein, ...    301   5e-96    
emb|CCI55397.1|  PSI antenna protein Lhca2                              298   6e-96    
ref|XP_010469082.1|  PREDICTED: chlorophyll a-b binding protein, ...    298   8e-96    
ref|XP_010512495.1|  PREDICTED: chlorophyll a-b binding protein, ...    298   8e-96    
ref|XP_004510608.1|  PREDICTED: chlorophyll a-b binding protein 7...    298   1e-95    
ref|XP_008446035.1|  PREDICTED: chlorophyll a-b binding protein 7...    298   1e-95    
ref|XP_010413397.1|  PREDICTED: chlorophyll a-b binding protein, ...    297   1e-95    
emb|CDY51572.1|  BnaCnng21010D                                          297   1e-95    
ref|XP_006291716.1|  hypothetical protein CARUB_v10017882mg             297   1e-95    
pdb|2WSC|2  Chain 2, Improved Model Of Plant Photosystem I              298   1e-95    
gb|EMT28434.1|  hypothetical protein F775_43774                         296   3e-95    
ref|XP_008222160.1|  PREDICTED: chlorophyll a-b binding protein, ...    296   3e-95    
ref|XP_010250717.1|  PREDICTED: chlorophyll a-b binding protein, ...    296   3e-95    
ref|XP_004310079.1|  PREDICTED: chlorophyll a-b binding protein, ...    296   3e-95    
emb|CAA59049.1|  LHCI-680, photosystem I antenna protein                295   7e-95    Hordeum vulgare [barley]
ref|XP_006836612.1|  hypothetical protein AMTR_s00131p00114510          293   9e-95    
gb|ABO71660.2|  LhCa2 protein                                           295   1e-94    Brassica juncea [brown mustard]
gb|AGT16124.1|  chlorophyll a-b binding protein                         295   1e-94    
ref|XP_006402477.1|  hypothetical protein EUTSA_v10006165mg             295   2e-94    
ref|XP_003562834.1|  PREDICTED: chlorophyll a-b binding protein 7...    294   2e-94    
ref|XP_004310078.1|  PREDICTED: chlorophyll a-b binding protein, ...    294   4e-94    
emb|CAA55864.1|  type II LHCI                                           293   4e-94    Lolium temulentum
ref|NP_001130616.1|  chlorophyll a-b binding protein                    293   7e-94    Zea mays [maize]
ref|XP_004958124.1|  PREDICTED: chlorophyll a-b binding protein 7...    292   1e-93    
ref|XP_001778557.1|  predicted protein                                  292   2e-93    
ref|XP_003637475.1|  Chlorophyll a-b binding protein                    293   3e-93    
ref|NP_001148893.1|  chlorophyll a-b binding protein                    290   2e-92    Zea mays [maize]
ref|XP_001782439.1|  predicted protein                                  286   4e-92    
gb|EMS51363.1|  putative polygalacturonase                              299   1e-91    
emb|CDY53917.1|  BnaA07g38250D                                          307   1e-91    
ref|XP_009415902.1|  PREDICTED: chlorophyll a-b binding protein 7...    287   4e-91    
gb|KDO81899.1|  hypothetical protein CISIN_1g024422mg                   285   7e-91    
ref|XP_001786080.1|  predicted protein                                  281   3e-89    
gb|AAB65793.1|  photosystem I antenna protein                           274   2e-86    Oryza sativa [red rice]
ref|XP_006368879.1|  hypothetical protein POPTR_0001s13800g             265   1e-83    
pdb|2O01|2  Chain 2, The Structure Of A Plant Photosystem I Super...    264   1e-83    
gb|EAZ44873.1|  hypothetical protein OsJ_29513                          265   4e-83    Oryza sativa Japonica Group [Japonica rice]
gb|ACN28086.1|  unknown                                                 261   1e-82    Zea mays [maize]
ref|XP_001782441.1|  predicted protein                                  257   4e-80    
ref|XP_001758295.1|  predicted protein                                  257   1e-79    
pdb|3LW5|2  Chain 2, Improved Model Of Plant Photosystem I              236   4e-73    
gb|ACF23028.1|  ST49-6                                                  235   5e-72    Eutrema halophilum
gb|EMS53700.1|  Chlorophyll a-b binding protein 7, chloroplastic        222   8e-67    
gb|ABK24236.1|  unknown                                                 221   7e-66    Picea sitchensis
gb|ACN40598.1|  unknown                                                 219   2e-65    Picea sitchensis
gb|AEZ49173.1|  chlorophyll a/b binding protein 4                       215   7e-64    
ref|XP_008783815.1|  PREDICTED: chlorophyll a-b binding protein 4...    215   9e-64    
ref|XP_011047180.1|  PREDICTED: chlorophyll a-b binding protein P...    214   2e-63    
ref|XP_004137413.1|  PREDICTED: chlorophyll a-b binding protein P...    214   2e-63    
emb|CEF99235.1|  Chlorophyll A-B binding protein, plant                 213   5e-63    
ref|XP_006368875.1|  hypothetical protein POPTR_0001s13800g             210   5e-63    
emb|CAA78932.1|  Lhca4 protein,Type 4 protein of light-harvesting...    213   6e-63    Pinus sylvestris [Scotch pine]
ref|NP_001061884.1|  Os08g0435900                                       213   7e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002514741.1|  chlorophyll A/B binding protein, putative          213   7e-63    Ricinus communis
ref|XP_009388762.1|  PREDICTED: chlorophyll a-b binding protein 4...    213   8e-63    
gb|EAZ07102.1|  hypothetical protein OsI_29351                          212   9e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_006374463.1|  Chlorophyll a-b binding protein 4                  213   9e-63    
gb|ACU19413.1|  unknown                                                 209   1e-62    Glycine max [soybeans]
gb|ACJ85068.1|  unknown                                                 212   1e-62    Medicago truncatula
ref|XP_006374464.1|  hypothetical protein POPTR_0015s07340g             212   1e-62    
ref|XP_006659431.1|  PREDICTED: chlorophyll a-b binding protein P...    212   1e-62    
ref|XP_010258312.1|  PREDICTED: chlorophyll a-b binding protein 4...    212   1e-62    
emb|CAA78901.1|  Lhca4 protein,Type 4 protein of light-harvesting...    212   1e-62    Pinus sylvestris [Scotch pine]
ref|XP_007509312.1|  unknown                                            211   1e-62    
ref|XP_002947520.1|  light harvesting complex A                         212   1e-62    
gb|AAC67557.1|  chlorophyll a/b-binding protein presursor               212   1e-62    Oryza sativa [red rice]
ref|XP_003081427.1|  PSI-associated light-harvesting chlorophyll ...    211   2e-62    
ref|XP_002877563.1|  chlorophyll a/b-binding protein                    212   2e-62    
gb|ABK22868.1|  unknown                                                 211   2e-62    Picea sitchensis
gb|EPS72553.1|  chlorophyll a /b binding protein                        210   2e-62    
ref|XP_003075175.1|  PSI-associated light-harvesting chlorophyll ...    211   2e-62    
ref|XP_011087238.1|  PREDICTED: chlorophyll a-b binding protein 4...    211   2e-62    
gb|EYU24360.1|  hypothetical protein MIMGU_mgv1a012416mg                211   3e-62    
ref|NP_190331.3|  chlorophyll a-b binding protein 4                     211   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587071.1|  PREDICTED: chlorophyll a-b binding protein P...    211   3e-62    
ref|XP_001419664.1|  chlorophyll a/b binding, possibly photosyste...    210   3e-62    Ostreococcus lucimarinus CCE9901
ref|XP_009618704.1|  PREDICTED: chlorophyll a-b binding protein P...    211   4e-62    
gb|KDP31267.1|  hypothetical protein JCGZ_11643                         211   4e-62    
gb|EAZ07099.1|  hypothetical protein OsI_29348                          210   5e-62    Oryza sativa Indica Group [Indian rice]
ref|XP_010547822.1|  PREDICTED: chlorophyll a-b binding protein 4...    211   5e-62    
ref|XP_010546068.1|  PREDICTED: chlorophyll a-b binding protein 4...    211   5e-62    
ref|XP_009804068.1|  PREDICTED: chlorophyll a-b binding protein 4...    210   6e-62    
ref|XP_010426187.1|  PREDICTED: chlorophyll a-b binding protein 4...    210   7e-62    
ref|XP_010257811.1|  PREDICTED: chlorophyll a-b binding protein 4...    210   7e-62    
ref|XP_009773617.1|  PREDICTED: chlorophyll a-b binding protein P...    210   8e-62    
ref|XP_010515052.1|  PREDICTED: chlorophyll a-b binding protein 4...    210   1e-61    
ref|XP_008453211.1|  PREDICTED: chlorophyll a-b binding protein P...    210   1e-61    
ref|XP_004973512.1|  PREDICTED: chlorophyll a-b binding protein P...    209   1e-61    
ref|XP_010235157.1|  PREDICTED: chlorophyll a-b binding protein 4...    209   1e-61    
ref|XP_010550595.1|  PREDICTED: chlorophyll a-b binding protein 4...    209   1e-61    
ref|XP_010030046.1|  PREDICTED: chlorophyll a-b binding protein 4...    211   1e-61    
gb|ACB05669.1|  chloroplast chlorophyll a/b binding protein             209   1e-61    Capsicum annuum
ref|XP_010322569.1|  PREDICTED: chlorophyll a-b binding protein 4...    209   1e-61    
ref|XP_004236014.1|  PREDICTED: chlorophyll a-b binding protein 4...    211   1e-61    
ref|XP_009149912.1|  PREDICTED: chlorophyll a-b binding protein 4...    209   1e-61    
ref|XP_004138171.1|  PREDICTED: chlorophyll a-b binding protein P...    209   2e-61    
ref|XP_004513901.1|  PREDICTED: chlorophyll a-b binding protein P...    209   2e-61    
gb|KHG01496.1|  Chlorophyll a-b binding P4, chloroplastic               209   2e-61    
ref|XP_006291725.1|  hypothetical protein CARUB_v10017894mg             209   2e-61    
ref|XP_010678492.1|  PREDICTED: chlorophyll a-b binding protein 4...    209   2e-61    
ref|XP_001780681.1|  predicted protein                                  207   2e-61    
gb|KHG21243.1|  Chlorophyll a-b binding 4, chloroplastic -like pr...    209   2e-61    
emb|CBI15210.3|  unnamed protein product                                208   3e-61    
ref|XP_002505087.1|  chlorophyll a/b-binding protein, psi-associa...    208   3e-61    Micromonas commoda
ref|XP_006354774.1|  PREDICTED: chlorophyll a-b binding protein 4...    208   5e-61    
ref|XP_006404376.1|  hypothetical protein EUTSA_v10010659mg             208   5e-61    
ref|XP_003523016.2|  PREDICTED: chlorophyll a-b binding protein P...    209   5e-61    
gb|KHN01874.1|  Chlorophyll a-b binding protein P4, chloroplastic       208   6e-61    
ref|XP_002284856.1|  PREDICTED: chlorophyll a-b binding protein 4...    208   6e-61    Vitis vinifera
gb|ACF78906.1|  unknown                                                 204   7e-61    Zea mays [maize]
ref|XP_009398171.1|  PREDICTED: chlorophyll a-b binding protein 4...    207   7e-61    
ref|XP_008802578.1|  PREDICTED: chlorophyll a-b binding protein 4...    207   7e-61    
gb|KDO55546.1|  hypothetical protein CISIN_1g025674mg                   207   8e-61    
gb|ACG35965.1|  chlorophyll a-b binding protein 4                       207   9e-61    Zea mays [maize]
gb|ACA66262.1|  chloroplast chlorophyll a/b binding protein precu...    207   1e-60    
ref|XP_010937179.1|  PREDICTED: chlorophyll a-b binding protein 4...    207   1e-60    
gb|ACF86037.1|  unknown                                                 207   1e-60    Zea mays [maize]
ref|XP_006440616.1|  hypothetical protein CICLE_v10021861mg             207   1e-60    
gb|KFK34045.1|  hypothetical protein AALP_AA5G094700                    207   1e-60    
ref|XP_007138174.1|  hypothetical protein PHAVU_009G186500g             207   1e-60    
ref|XP_004299348.1|  PREDICTED: chlorophyll a-b binding protein P...    206   2e-60    
gb|KHN26254.1|  Chlorophyll a-b binding protein P4, chloroplastic       207   2e-60    
ref|XP_009339094.1|  PREDICTED: chlorophyll a-b binding protein P...    207   2e-60    
ref|NP_001275056.1|  chlorophyll a-b binding protein 4, chloropla...    206   2e-60    
ref|XP_002961446.1|  light-harvesting complex                           206   2e-60    
ref|XP_003527087.2|  PREDICTED: chlorophyll a-b binding protein P...    207   2e-60    
gb|AGU28447.1|  light-harvesting chlorophyll-protein complex I su...    205   2e-60    
ref|XP_006477466.1|  PREDICTED: chlorophyll a-b binding protein P...    206   2e-60    
gb|AFK37078.1|  unknown                                                 206   2e-60    
ref|XP_001416356.1|  Photosystem I light harvesting complex, chlo...    204   2e-60    
gb|AAR19267.2|  chlorophyll a/b binding protein presusor                206   2e-60    
emb|CAC84491.1|  putative chlorophyll a/b-binding protein type 4        206   3e-60    
gb|KFK27969.1|  hypothetical protein AALP_AA8G455000                    206   3e-60    
ref|XP_007209497.1|  hypothetical protein PRUPE_ppa010291mg             206   3e-60    
ref|XP_010939818.1|  PREDICTED: chlorophyll a-b binding protein 4...    206   4e-60    
ref|XP_003578105.1|  PREDICTED: chlorophyll a-b binding protein 1...    205   5e-60    
gb|AGV54882.1|  chlorophyll A/B binding protein P4 chloroplastic-...    205   5e-60    
gb|AFW62278.1|  chlorophyll a-b binding protein 4                       205   5e-60    
ref|NP_001150371.1|  LOC100284001                                       205   6e-60    
ref|XP_002507489.1|  chlorophyll a/b-binding protein, chloroplast...    205   6e-60    
gb|AAB40979.1|  light harvesting complex a                              206   6e-60    
gb|ABV44672.1|  photosystem I light-harvesting complex type 4 pro...    204   7e-60    
ref|XP_001698519.1|  light-harvesting protein of photosystem I          205   8e-60    
dbj|BAD06918.1|  light-harvesting chlorophyll-a/b protein of phot...    205   9e-60    
sp|Q9SQL2.1|CB24_PEA  RecName: Full=Chlorophyll a-b binding prote...    204   1e-59    
gb|AGZ15388.1|  PSI light-harvesting antenna chlorophyll a/b-bind...    204   1e-59    
ref|XP_006827292.1|  hypothetical protein AMTR_s00010p00264770          204   1e-59    
ref|XP_010093602.1|  Chlorophyll a-b binding protein P4                 204   1e-59    
gb|ACG30344.1|  chlorophyll a-b binding protein 4                       204   1e-59    
ref|XP_008393169.1|  PREDICTED: chlorophyll a-b binding protein P...    204   1e-59    
ref|XP_007037388.1|  Light-harvesting chlorophyll-protein complex...    204   2e-59    
ref|XP_009369279.1|  PREDICTED: chlorophyll a-b binding protein P...    204   2e-59    
emb|CDP12284.1|  unnamed protein product                                203   3e-59    
ref|XP_008374556.1|  PREDICTED: chlorophyll a-b binding protein P...    203   3e-59    
emb|CAA57877.1|  light-harvesting chlorophyll a /b binding protein      201   7e-59    
gb|ABD37879.1|  light-harvesting chlorophyll-a/b binding protein ...    201   2e-58    
dbj|BAJ89800.1|  predicted protein                                      201   2e-58    
gb|AAF90200.1|AF287276_2  chlorophyll a/b-binding protein precursor     200   3e-58    
emb|CCI55399.1|  PSI antenna protein Lhca4                              201   3e-58    
tpg|DAA05920.1|  TPA: chloroplast light-harvesting complex I prot...    200   3e-58    
gb|EMS64136.1|  Chlorophyll a-b binding protein 1B-20, chloroplastic    200   4e-58    
tpg|DAA05942.1|  TPA: chloroplast light-harvesting complex I prot...    200   5e-58    
ref|WP_039310946.1|  hypothetical protein                               198   5e-58    
gb|KEH33314.1|  light-harvesting complex I chlorophyll A/B-bindin...    197   8e-58    
ref|XP_002964438.1|  light-harvesting complex                           199   2e-57    
ref|XP_002975356.1|  light-harvesting complex                           198   2e-57    
pdb|2WSC|4  Chain 4, Improved Model Of Plant Photosystem I              198   3e-57    
gb|ABD37903.1|  light-harvesting chlorophyll-a/b binding protein ...    196   7e-57    
gb|EYU24361.1|  hypothetical protein MIMGU_mgv1a012416mg                194   2e-56    
tpg|DAA41205.1|  TPA: hypothetical protein ZEAMMB73_510089              194   3e-56    
ref|XP_010550593.1|  PREDICTED: chlorophyll a-b binding protein 4...    196   4e-56    
gb|EMT16884.1|  hypothetical protein F775_43922                         197   6e-56    
gb|ABD37907.1|  light-harvesting chlorophyll-a/b binding protein ...    193   3e-55    
ref|XP_001698070.1|  light-harvesting protein of photosystem I          192   4e-55    
ref|XP_003056428.1|  chlorophyll a/b-binding protein, chloroplast...    191   1e-54    
ref|XP_005645057.1|  light-harvesting complex I protein                 190   5e-54    
tpg|DAA05901.1|  TPA: chloroplast light-harvesting complex I prot...    187   7e-54    
tpg|DAA41204.1|  TPA: hypothetical protein ZEAMMB73_510089              187   7e-54    
ref|XP_002454598.1|  hypothetical protein SORBIDRAFT_04g034130          189   8e-54    
gb|AHM26636.1|  a-b binding protein                                     186   2e-53    
ref|XP_003570571.1|  PREDICTED: chlorophyll a-b binding protein 4...    188   2e-53    
gb|AAL74385.1|AF359117_1  LHC I type II chlorophyll binding protein     184   2e-53    
ref|XP_010675790.1|  PREDICTED: chlorophyll a-b binding protein 4...    187   5e-53    
gb|EYU25420.1|  hypothetical protein MIMGU_mgv1a011943mg                187   5e-53    
gb|ACF86226.1|  unknown                                                 187   7e-53    
ref|NP_001148187.1|  LOC100281795                                       187   1e-52    
ref|XP_002946247.1|  hypothetical protein VOLCADRAFT_108856             186   1e-52    
gb|EEC82322.1|  hypothetical protein OsI_26601                          191   1e-52    
ref|XP_008239927.1|  PREDICTED: chlorophyll a-b binding protein P...    186   2e-52    
ref|XP_005651070.1|  hypothetical protein COCSUDRAFT_52367              185   3e-52    
gb|ABD37882.1|  light-harvesting chlorophyll-a/b binding protein ...    185   3e-52    
gb|AFW73581.1|  chlorophyll a-b binding protein 4                       187   4e-52    
dbj|BAJ98426.1|  predicted protein                                      184   5e-52    
ref|XP_006305539.1|  hypothetical protein CARUB_v10010062mg             184   6e-52    
ref|XP_004954021.1|  PREDICTED: chlorophyll a-b binding protein P...    186   6e-52    
ref|XP_010059937.1|  PREDICTED: chlorophyll a-b binding protein 4...    185   7e-52    
ref|XP_006647960.1|  PREDICTED: chlorophyll a-b binding protein 7...    184   9e-52    
ref|XP_003603038.1|  Chlorophyll a-b binding protein                    184   1e-51    
gb|AAO16495.1|  light-harvesting complex I protein                      183   1e-51    
dbj|BAD06924.1|  light-harvesting chlorophyll-a/b protein of phot...    183   1e-51    
ref|XP_002957416.1|  light-harvesting protein of photosystem I          183   1e-51    
gb|EEC74057.1|  hypothetical protein OsI_09055                          184   1e-51    
ref|XP_009409310.1|  PREDICTED: chlorophyll a-b binding protein 4...    183   2e-51    
ref|NP_001048216.1|  Os02g0764500                                       182   3e-51    
gb|ABN10530.1|  Lhca5 protein                                           183   3e-51    
ref|XP_007510507.1|  unknown                                            181   5e-51    
gb|KDP38340.1|  hypothetical protein JCGZ_04265                         182   6e-51    
ref|XP_009107445.1|  PREDICTED: chlorophyll a-b binding protein 4...    180   3e-50    
ref|XP_006434778.1|  hypothetical protein CICLE_v10002178mg             181   3e-50    
gb|EMS52019.1|  Chlorophyll a-b binding protein P4, chloroplastic       181   3e-50    
ref|XP_010500206.1|  PREDICTED: chlorophyll a-b binding protein 4...    180   3e-50    
ref|XP_010108606.1|  Chlorophyll a-b binding protein P4                 180   3e-50    
ref|XP_010939425.1|  PREDICTED: chlorophyll a-b binding protein 4...    180   4e-50    
ref|XP_002510221.1|  chlorophyll A/B binding protein, putative          180   4e-50    
ref|XP_006374944.1|  chlorophyll A-B binding family protein             180   4e-50    
ref|XP_006473329.1|  PREDICTED: chlorophyll a-b binding protein P...    180   5e-50    
ref|NP_175137.1|  photosystem I light harvesting complex protein 5      179   5e-50    
dbj|BAH19631.1|  AT1G45474                                              179   5e-50    
emb|CDY43213.1|  BnaC08g04860D                                          179   6e-50    
ref|XP_011029950.1|  PREDICTED: chlorophyll a-b binding protein 4...    179   8e-50    
ref|XP_006828393.1|  hypothetical protein AMTR_s00060p00031820          179   9e-50    
emb|CDY17055.1|  BnaA08g04190D                                          179   9e-50    
ref|XP_010538121.1|  PREDICTED: chlorophyll a-b binding protein 4...    178   1e-49    
gb|KFK36161.1|  hypothetical protein AALP_AA4G086000                    178   1e-49    
gb|AAM65689.1|  light-harvesting complex protein                        178   2e-49    
ref|XP_008444623.1|  PREDICTED: chlorophyll a-b binding protein P...    178   2e-49    
ref|XP_008797264.1|  PREDICTED: chlorophyll a-b binding protein 4...    178   2e-49    
gb|AAD28768.1|AF134121_1  Lhca5 protein                                 177   2e-49    
gb|ABA01130.1|  chloroplast light harvesting complex I protein          177   3e-49    
ref|XP_009359490.1|  PREDICTED: chlorophyll a-b binding protein P...    177   3e-49    
ref|XP_006393637.1|  hypothetical protein EUTSA_v10011725mg             177   4e-49    
ref|XP_008393806.1|  PREDICTED: chlorophyll a-b binding protein P...    177   4e-49    
ref|XP_004150882.1|  PREDICTED: chlorophyll a-b binding protein 4...    177   4e-49    
ref|XP_004291112.1|  PREDICTED: chlorophyll a-b binding protein P...    176   4e-49    
gb|AFK47516.1|  unknown                                                 177   6e-49    
emb|CDP01357.1|  unnamed protein product                                177   6e-49    
ref|XP_010479098.1|  PREDICTED: chlorophyll a-b binding protein 4...    176   6e-49    
gb|AFK43193.1|  unknown                                                 175   6e-49    
ref|XP_009760096.1|  PREDICTED: chlorophyll a-b binding protein P...    177   7e-49    
ref|XP_008220221.1|  PREDICTED: chlorophyll a-b binding protein P...    176   9e-49    
ref|XP_002284724.1|  PREDICTED: chlorophyll a-b binding protein 4...    176   1e-48    
ref|XP_002891322.1|  light-harvesting complex protein                   176   1e-48    
dbj|BAD25284.1|  putative chlorophyll a/b-binding protein type II...    176   1e-48    
ref|XP_004501571.1|  PREDICTED: chlorophyll a-b binding protein 4...    176   2e-48    
ref|XP_010461501.1|  PREDICTED: chlorophyll a-b binding protein 4...    175   2e-48    
gb|ABJ99590.1|  type III chlorophyll a/b-binding protein                176   2e-48    
ref|XP_007017245.1|  Light-harvesting complex I protein Lhca5 iso...    175   2e-48    
ref|XP_007136682.1|  hypothetical protein PHAVU_009G064900g             175   3e-48    
gb|ABJ99591.1|  type III chlorophyll a/b-binding protein                175   3e-48    
ref|XP_007222188.1|  hypothetical protein PRUPE_ppa010039mg             175   4e-48    
ref|XP_005649543.1|  light-harvesting chlorophyll a/b-binding pro...    174   6e-48    
gb|ADE42967.1|  type III chlorophyll a/b binding protein                174   6e-48    
ref|XP_010112887.1|  Chlorophyll a-b binding protein 8                  174   1e-47    
ref|XP_011083846.1|  PREDICTED: chlorophyll a-b binding protein 4...    174   1e-47    
ref|XP_010270018.1|  PREDICTED: chlorophyll a-b binding protein 4...    173   1e-47    
gb|AFD54060.1|  morphogenesis protein                                   173   2e-47    
ref|XP_006647025.1|  PREDICTED: chlorophyll a-b binding protein 8...    173   2e-47    
gb|KHG00964.1|  Chlorophyll a-b binding P4, chloroplastic               172   4e-47    
ref|XP_010233979.1|  PREDICTED: chlorophyll a-b binding protein 8...    172   5e-47    
ref|XP_010252884.1|  PREDICTED: chlorophyll a-b binding protein 8...    172   6e-47    
gb|KHN29869.1|  Chlorophyll a-b binding protein 3, chloroplastic        172   7e-47    
ref|XP_001702730.1|  light-harvesting protein of photosystem I          171   7e-47    
ref|XP_003545381.1|  PREDICTED: chlorophyll a-b binding protein 3...    172   8e-47    
gb|EMS56059.1|  Chlorophyll a-b binding protein 8, chloroplastic        171   9e-47    
dbj|BAJ92159.1|  predicted protein                                      171   9e-47    
emb|CDY15020.1|  BnaCnng04230D                                          171   2e-46    
ref|XP_010547181.1|  PREDICTED: chlorophyll a-b binding protein 8...    171   2e-46    
gb|KFK40697.1|  hypothetical protein AALP_AA2G029600                    170   3e-46    
sp|Q36718.1|CB120_HORVU  RecName: Full=Chlorophyll a-b binding pr...    169   3e-46    
gb|ABD37905.1|  light-harvesting chlorophyll-a/b binding protein ...    169   3e-46    
ref|NP_001276264.1|  chlorophyll a-b binding protein 3, chloropla...    170   3e-46    
ref|XP_010551986.1|  PREDICTED: chlorophyll a-b binding protein 8...    170   3e-46    
ref|XP_009630364.1|  PREDICTED: chlorophyll a-b binding protein P...    170   3e-46    
pdb|2WSC|3  Chain 3, Improved Model Of Plant Photosystem I              170   3e-46    
dbj|BAJ91798.1|  predicted protein                                      170   3e-46    
ref|XP_008450298.1|  PREDICTED: chlorophyll a-b binding protein 8...    170   3e-46    
ref|XP_003528272.2|  PREDICTED: chlorophyll a-b binding protein 7...    170   4e-46    
prf||1609235A  chlorophyll a/b binding protein                          169   4e-46 
gb|ACU23907.1|  unknown                                                 169   5e-46    
emb|CDY47581.1|  BnaA01g22670D                                          169   5e-46    
ref|XP_004248217.1|  PREDICTED: chlorophyll a-b binding protein 8...    169   5e-46    
ref|XP_001691959.1|  light-harvesting protein of photosystem I          170   6e-46    
gb|ACJ13835.1|  chlorophyll binding protein                             164   6e-46    
ref|XP_011082880.1|  PREDICTED: chlorophyll a-b binding protein 8...    169   6e-46    
gb|ACJ13823.1|  chlorophyll binding protein                             164   7e-46    
sp|Q32904.1|CB23_PEA  RecName: Full=Chlorophyll a-b binding prote...    169   7e-46    
ref|XP_011008196.1|  PREDICTED: chlorophyll a-b binding protein 8...    169   9e-46    
ref|XP_011098101.1|  PREDICTED: chlorophyll a-b binding protein 8...    169   9e-46    
emb|CDY12903.1|  BnaA09g13710D                                          169   1e-45    
ref|XP_009104717.1|  PREDICTED: chlorophyll a-b binding protein 8...    169   1e-45    
emb|CDY57375.1|  BnaCnng31870D                                          168   1e-45    
ref|XP_002524566.1|  chlorophyll A/B binding protein, putative          168   1e-45    
ref|XP_005849804.1|  hypothetical protein CHLNCDRAFT_59626              167   1e-45    
ref|XP_009617701.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   1e-45    
ref|XP_009113128.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   1e-45    
ref|XP_008805513.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   1e-45    
pdb|2O01|4  Chain 4, The Structure Of A Plant Photosystem I Super...    164   2e-45    
ref|XP_009631536.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   2e-45    
ref|XP_005651069.1|  light-harvesting chlorophyll-a/b protein of ...    168   2e-45    
ref|XP_004139075.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   2e-45    
ref|XP_009783947.1|  PREDICTED: chlorophyll a-b binding protein 8...    168   2e-45    
sp|P27522.1|CB13_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    168   2e-45    
ref|XP_006431742.1|  hypothetical protein CICLE_v10002129mg             168   2e-45    
emb|CCI55398.1|  PSI antenna protein Lhca3                              168   2e-45    
ref|XP_009778440.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   3e-45    
ref|XP_006360010.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   3e-45    
gb|KDP45167.1|  hypothetical protein JCGZ_15032                         167   3e-45    
ref|XP_008380041.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   3e-45    
gb|AHM26631.1|  a-b binding protein                                     177   3e-45    
ref|XP_004251826.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   4e-45    
ref|XP_010692543.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   4e-45    
gb|ACJ13833.1|  chlorophyll binding protein                             162   4e-45    
ref|XP_006350000.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   4e-45    
gb|ABK96765.1|  unknown                                                 167   4e-45    
ref|XP_004303913.1|  PREDICTED: chlorophyll a-b binding protein 8...    167   5e-45    
ref|XP_006471243.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophyll ...    168   5e-45    
ref|XP_010418122.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   6e-45    
ref|XP_006302674.1|  hypothetical protein CARUB_v10020781mg             166   6e-45    
ref|XP_008342284.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   7e-45    
ref|XP_010473361.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   7e-45    
ref|XP_008229753.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   7e-45    
ref|XP_006374461.1|  hypothetical protein POPTR_0015s07340g             164   8e-45    
ref|XP_002273201.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   8e-45    
ref|XP_006391996.1|  hypothetical protein EUTSA_v10023636mg             166   8e-45    
ref|XP_002321218.1|  chlorophyll A-B binding family protein             166   8e-45    
emb|CDY26347.1|  BnaA03g60230D                                          166   9e-45    
ref|XP_010913989.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   1e-44    
ref|XP_005844196.1|  hypothetical protein CHLNCDRAFT_32710              166   1e-44    
dbj|BAJ33764.1|  unnamed protein product                                166   1e-44    
pdb|3LW5|4  Chain 4, Improved Model Of Plant Photosystem I              162   1e-44    
ref|XP_009390617.1|  PREDICTED: chlorophyll a-b binding protein 8...    166   1e-44    
ref|XP_005645059.1|  light harvesting complex a protein                 165   1e-44    
ref|XP_007142544.1|  hypothetical protein PHAVU_008G289700g             166   1e-44    
gb|AFW62280.1|  hypothetical protein ZEAMMB73_290736                    164   2e-44    
ref|XP_002993677.1|  light harvesting complex                           166   2e-44    
ref|XP_002989722.1|  light-harvesting complex                           166   2e-44    
ref|XP_002955817.1|  hypothetical protein VOLCADRAFT_106964             164   2e-44    
gb|EYU26223.1|  hypothetical protein MIMGU_mgv1a011622mg                165   2e-44    
ref|NP_176347.1|  PSI type III chlorophyll a/b-binding protein          165   2e-44    
ref|XP_007215737.1|  hypothetical protein PRUPE_ppa009110mg             166   3e-44    
ref|XP_002888084.1|  hypothetical protein ARALYDRAFT_475174             164   4e-44    
gb|EPS72213.1|  hypothetical protein M569_02545                         170   4e-44    
ref|XP_006374462.1|  hypothetical protein POPTR_0015s07340g             162   6e-44    
ref|XP_004491629.1|  PREDICTED: chlorophyll a-b binding protein 3...    164   6e-44    
ref|XP_004965906.1|  PREDICTED: chlorophyll a-b binding protein 8...    164   7e-44    
ref|XP_010036097.1|  PREDICTED: chlorophyll a-b binding protein 8...    163   8e-44    
gb|KDO55547.1|  hypothetical protein CISIN_1g025674mg                   162   9e-44    
ref|XP_002945875.1|  light harvesting complex a protein                 162   1e-43    



>ref|XP_009627312.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
tomentosiformis]
Length=260

 Score =   452 bits (1164),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/263 (83%), Positives = 235/263 (89%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I STA  +IP+R++H +  + G+  TC++  SR  RLNAGKEVSSVCEPLPPDRPL
Sbjct  1    MALAIHSTAFSSIPIRELHTKK-IPGKVSTCLL--SRKSRLNAGKEVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPEWL
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHSRWAMLAVAGILIPEWL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFIDN+SWYDAG REYFAD TTLFVVQ+ LMGWAEGRRWADI+ PGCVD+EP +PHK
Sbjct  118  ESLGFIDNFSWYDAGEREYFADSTTLFVVQLVLMGWAEGRRWADIMNPGCVDIEPKLPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKP  DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP
Sbjct  178  KKPISDVGYPGGLWFDPLMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGHNNIF+AF S 
Sbjct  238  IENLMSHLADPGHNNIFAAFGSQ  260



>emb|CDP03055.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   452 bits (1162),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 217/263 (83%), Positives = 238/263 (90%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALSIASTAL +IP  +I+ ++      + C++  SR   LNA K VSSVCEPLPPDRPL
Sbjct  1    MALSIASTALSSIPTSEINTKSLPGRVTRACLLGRSR---LNATKGVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAVAGILIPEWL
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGAREYFADPTTLFVVQ+ LMGWAEGRRWAD++ PGCVD+EPT+PHK
Sbjct  118  ESLGFIENFSWYDAGAREYFADPTTLFVVQLVLMGWAEGRRWADMMNPGCVDIEPTLPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT +GP
Sbjct  178  KKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGEGP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            +ENLM H+ADPGH+NIFSAFTSH
Sbjct  238  VENLMAHIADPGHHNIFSAFTSH  260



>ref|XP_004251698.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Solanum 
lycopersicum]
Length=260

 Score =   451 bits (1161),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 217/263 (83%), Positives = 237/263 (90%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I STA  +IP+R++  + + SG+  TC++  SR  RL AGKEVSSVCEPLPPDRPL
Sbjct  1    MALAIHSTAFSSIPIRELPTKTF-SGKFTTCML--SRKSRLYAGKEVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAEL+H RWAMLAV+GILIPEWL
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKWFAQAELIHSRWAMLAVSGILIPEWL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFIDN+SWYDAG REYFAD TTLFVVQ+ALMGW EGRRWADI+ PGCVD+EP VPHK
Sbjct  118  ESLGFIDNFSWYDAGEREYFADSTTLFVVQLALMGWVEGRRWADIVNPGCVDIEPKVPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K+PK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP
Sbjct  178  KRPKTDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGHNNIF+AF SH
Sbjct  238  IENLMSHLADPGHNNIFAAFASH  260



>ref|XP_011093862.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum 
indicum]
Length=259

 Score =   433 bits (1113),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 210/263 (80%), Positives = 233/263 (89%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL++A++A   +P R++ +++ V G+  TC+    +   LNA K  SSVCEPLPPDRPL
Sbjct  1    MALAVAASAFSALPNRELPRKS-VPGKIATCL---PKRGCLNATKGPSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAVAGILIPEWL
Sbjct  57   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHARWAMLAVAGILIPEWL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGAREYFADPTTLFVVQ+ LMGW EGRRWAD+I PGCVD+EPT P++
Sbjct  117  ESLGFIENFSWYDAGAREYFADPTTLFVVQLGLMGWVEGRRWADMINPGCVDIEPTFPNR  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP
Sbjct  177  KKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFIGFCFQAVYTGQGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH NIFSAFTS 
Sbjct  237  IENLMAHIADPGHCNIFSAFTSQ  259



>ref|XP_006345258.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Solanum tuberosum]
Length=260

 Score =   432 bits (1112),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/263 (83%), Positives = 238/263 (90%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I STA  +IP+R++  + + SG+  TC++  S+  RL AGKEVSSVCEPLPPDRPL
Sbjct  1    MALAIHSTAFSSIPIRELPTKTF-SGKFTTCVL--SKKSRLYAGKEVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAEL+H RWAMLAVAGILIPEWL
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELIHSRWAMLAVAGILIPEWL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFIDN+SWYDAG REYFAD TTLFVVQ+ALMGW EGRRWADI+ PGCVD+EP VPHK
Sbjct  118  ESLGFIDNFSWYDAGEREYFADSTTLFVVQLALMGWVEGRRWADIVNPGCVDIEPKVPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP
Sbjct  178  KKPKTDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGHNNIF+AFTS 
Sbjct  238  IENLMSHLADPGHNNIFAAFTSQ  260



>gb|KDP33938.1| hypothetical protein JCGZ_07509 [Jatropha curcas]
Length=263

 Score =   431 bits (1108),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 208/264 (79%), Positives = 233/264 (88%), Gaps = 2/264 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIH-KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MALSIAST+L ++P    +  Q  + G+  TC +  ++  ++NA K VSSVCEPLPPDRP
Sbjct  1    MALSIASTSLTSLPTSTRNIPQKALLGKISTCHVGKAKV-KVNATKGVSSVCEPLPPDRP  59

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAVAGILIPEW
Sbjct  60   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEW  119

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFI+NY+W+DAGAREYFADPTTLF+VQ+ LMGW EGRRWAD+IKPGCVD+EP +PH
Sbjct  120  LESLGFIENYNWFDAGAREYFADPTTLFIVQLVLMGWVEGRRWADMIKPGCVDIEPKLPH  179

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
              +PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT +G
Sbjct  180  ITRPKPDVGYPGGLWFDPLMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGEG  239

Query  918  PIENLMFHLADPGHNNIFSAFTSH  989
            PIENLM H+ADPGH NIFSAFT++
Sbjct  240  PIENLMAHIADPGHCNIFSAFTAN  263



>ref|XP_009759850.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
Length=260

 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/263 (83%), Positives = 235/263 (89%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I STA  +IP+R++  +N + G+  TC++   R  RLNAGKEVSSVCEPLPPDRPL
Sbjct  1    MALAIHSTAFSSIPIRELPTKN-LPGKFTTCLL--PRRSRLNAGKEVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPEWL
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHSRWAMLAVAGILIPEWL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFIDN+SWYDAG REYFAD TTLFVVQ+ LMGWAEGRRWADII PGCVD+E  VPHK
Sbjct  118  ESLGFIDNFSWYDAGEREYFADSTTLFVVQLVLMGWAEGRRWADIINPGCVDIELKVPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP
Sbjct  178  KKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGHNNIF+AF S 
Sbjct  238  IENLMSHLADPGHNNIFAAFGSQ  260



>ref|XP_002277280.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Vitis 
vinifera]
 emb|CBI27778.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   425 bits (1093),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/263 (79%), Positives = 230/263 (87%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALSIASTA  ++P R++  +++     K    L  R  RLNA K VSSVCEPLPPDRPL
Sbjct  1    MALSIASTAFSSLPTREVSSKHF---PRKLTTWLPGRV-RLNATKGVSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL+WFAQAELMH RWAMLAVAGILIPE L
Sbjct  57   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRWFAQAELMHSRWAMLAVAGILIPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGA+E+FADPTTLFVVQ+ALMGW EGRRWAD+I PGCVD++ T P+K
Sbjct  117  ERLGFIENFSWYDAGAQEFFADPTTLFVVQLALMGWVEGRRWADLINPGCVDIQLTFPNK  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
             KPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT +GP
Sbjct  177  AKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGEGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH N+FSAFTS 
Sbjct  237  IENLMAHIADPGHCNVFSAFTSQ  259



>ref|XP_010687546.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=264

 Score =   422 bits (1086),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 230/265 (87%), Gaps = 3/265 (1%)
 Frame = +3

Query  201  MALSIASTALP-NIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKE-VSSVCEPLPPDR  374
            MAL++ASTAL  N+P+R+I  +     Q K C M+ + + ++NA K  VSSVCEPLPPDR
Sbjct  1    MALAVASTALSSNLPIREIPGKLLYPSQMKKCNMIGNSS-KVNAAKGGVSSVCEPLPPDR  59

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            PLWFPGS+PP+WLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPE
Sbjct  60   PLWFPGSTPPQWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHSRWAMLAVAGILIPE  119

Query  555  WLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVP  734
            WLE +G I+N+ WYDAG+REYFADPTTLFVVQ+ALMGW EGRRWAD + PGCVD+EP +P
Sbjct  120  WLESIGLIENFDWYDAGSREYFADPTTLFVVQLALMGWIEGRRWADYVNPGCVDIEPKLP  179

Query  735  HKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQ  914
            HKK PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+G CFQA+YT +
Sbjct  180  HKKNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGLCFQALYTGE  239

Query  915  GPIENLMFHLADPGHNNIFSAFTSH  989
            GP+ENL  H+ADPGH NIFSAF+SH
Sbjct  240  GPLENLTKHIADPGHYNIFSAFSSH  264



>ref|XP_007202451.1| hypothetical protein PRUPE_ppa010035mg [Prunus persica]
 gb|EMJ03650.1| hypothetical protein PRUPE_ppa010035mg [Prunus persica]
Length=267

 Score =   420 bits (1079),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 212/268 (79%), Positives = 228/268 (85%), Gaps = 7/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLR-----QIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I S AL  IP R     +   + +  G+ K C ML  RT  LNA K VSSVCEPLP
Sbjct  1    MALAITS-ALSTIPSRFRIEYREVPRKFCPGKLKPC-MLGRRTTSLNATKGVSSVCEPLP  58

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV+GIL
Sbjct  59   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVSGIL  118

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPEWLE LGFI+N+SW++AG REYFADPTTLFVVQ+ALMGW EGRRWADII PG VD+EP
Sbjct  119  IPEWLERLGFIENFSWFEAGEREYFADPTTLFVVQLALMGWVEGRRWADIINPGSVDIEP  178

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             +PHKK PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIY
Sbjct  179  KLPHKKNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQAIY  238

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTSH  989
            T + PIENLM H+ADPGH NIFSAFTS 
Sbjct  239  TGKDPIENLMAHIADPGHCNIFSAFTSQ  266



>ref|XP_008242266.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform 
X2 [Prunus mume]
Length=261

 Score =   417 bits (1073),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/263 (80%), Positives = 227/263 (86%), Gaps = 3/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I S AL  IP R++    +  G+ K CI L  RT  LNA K VSSVCEPLPPDRPL
Sbjct  1    MALAITS-ALSTIPRREV-PWKFCPGKVKPCI-LGRRTTSLNATKGVSSVCEPLPPDRPL  57

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV+GILIPE L
Sbjct  58   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVSGILIPECL  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SW++AG REYFADPTTLFVVQ+ALMGW EGRRWADII PG VD+EP +PHK
Sbjct  118  ERLGFIENFSWFEAGEREYFADPTTLFVVQLALMGWVEGRRWADIINPGSVDIEPKLPHK  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K P+ DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT + P
Sbjct  178  KNPEPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQAIYTGKDP  237

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH NIFSAFTS 
Sbjct  238  IENLMAHIADPGHCNIFSAFTSQ  260



>ref|XP_006474704.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=265

 Score =   417 bits (1072),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/267 (76%), Positives = 226/267 (85%), Gaps = 6/267 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPL----RQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPP  368
            MAL+IASTAL  +P     R I ++ +     K  +        +NA K VSSVCEPLPP
Sbjct  1    MALAIASTALSTLPFSSRCRDIPQKRFTEKITKCLVGRGGVI--VNATKGVSSVCEPLPP  58

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRPLWFPGS+PP WLDGSLPGD+GFDPLGLGSDPELLKWFAQAEL+HGRWAMLAVAGILI
Sbjct  59   DRPLWFPGSTPPSWLDGSLPGDYGFDPLGLGSDPELLKWFAQAELIHGRWAMLAVAGILI  118

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PEWLE +G I+N+SWYDAG+REYFADPTTLFVVQ+ALMGW EGRRWADII PGCVD++P 
Sbjct  119  PEWLESIGLIENFSWYDAGSREYFADPTTLFVVQLALMGWVEGRRWADIINPGCVDIQPD  178

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
            +P+K KPK DVGYPGG+WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT
Sbjct  179  LPNKTKPKPDVGYPGGIWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYT  238

Query  909  KQGPIENLMFHLADPGHNNIFSAFTSH  989
             QGP+ENL  H+ADPGH N+FSAFTS 
Sbjct  239  GQGPLENLACHVADPGHCNVFSAFTSQ  265



>ref|XP_002516245.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF46247.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=297

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 237/268 (88%), Gaps = 5/268 (2%)
 Frame = +3

Query  195  SSMALSIASTALPNIP--LRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKE-VSSVCEPLP  365
            S MAL+IAS++L ++    R+I ++ ++  +  TC +  ++  +LNA K  VS+VCEPLP
Sbjct  32   SFMALTIASSSLSSLLSSTREIPQKAFIR-KIGTCQVGKAKV-KLNATKGGVSTVCEPLP  89

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAVAGIL
Sbjct  90   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGIL  149

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPEWLE LGFI+NY+W+DAGAREYFADPTTLF+VQ+ LMGW EGRRWAD+IKPGCVD+EP
Sbjct  150  IPEWLESLGFIENYNWFDAGAREYFADPTTLFIVQLVLMGWVEGRRWADMIKPGCVDIEP  209

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
            T+P+K KPK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+Y
Sbjct  210  TLPNKTKPKPDVGYPGGLWFDPLMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVY  269

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTSH  989
            T +GPIENLM H+ADPGH NIFSAFTS 
Sbjct  270  TGEGPIENLMAHIADPGHCNIFSAFTSQ  297



>ref|XP_006381597.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|ERP59394.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=261

 Score =   415 bits (1067),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 228/264 (86%), Gaps = 4/264 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHK-QNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MAL+ AS++L ++P R   K Q  + G+ + C  +  R   +NA K VSSVCEPLPPDRP
Sbjct  1    MALNFASSSLSSLPTRTRDKPQKSLLGKIEKCQAVKVR---VNATKGVSSVCEPLPPDRP  57

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAEL+HGRWAMLA AGILIPEW
Sbjct  58   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKWFAQAELIHGRWAMLAAAGILIPEW  117

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFIDN++W+DAG REYFADPTTLFVVQ+ LMGW EGRRWAD+IKPGCVD++P +PH
Sbjct  118  LERLGFIDNFNWFDAGTREYFADPTTLFVVQLILMGWIEGRRWADMIKPGCVDIDPKLPH  177

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
            K KPK DVGYPGGLWFDP+ WGRGSPEPVM +RTKEIKNGRLAMLAF+GF FQAIYT +G
Sbjct  178  KTKPKPDVGYPGGLWFDPWNWGRGSPEPVMAIRTKEIKNGRLAMLAFVGFWFQAIYTGEG  237

Query  918  PIENLMFHLADPGHNNIFSAFTSH  989
            PI+NLM H+ADPGH NIFSAFTSH
Sbjct  238  PIDNLMAHIADPGHCNIFSAFTSH  261



>gb|EYU25834.1| hypothetical protein MIMGU_mgv1a012037mg [Erythranthe guttata]
Length=263

 Score =   415 bits (1067),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 227/262 (87%), Gaps = 2/262 (1%)
 Frame = +3

Query  204  ALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLW  383
            A +IA++   + P R +H     +G++ T I LS R  RL+AGK  SSVC+PLPPDRP+W
Sbjct  3    ASAIAASPFSSFPTR-LHSFPQAAGKSFTGICLSKRG-RLSAGKGPSSVCQPLPPDRPIW  60

Query  384  FPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLE  563
            FPGSSPP+WLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV+GIL+PEWL 
Sbjct  61   FPGSSPPQWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVSGILVPEWLG  120

Query  564  GLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKK  743
             LGFIDNYSW+DAG+REYFADP TL V Q+ALMGW EGRRWADI+ PG VD+EPT+PHK 
Sbjct  121  SLGFIDNYSWFDAGSREYFADPVTLLVAQLALMGWVEGRRWADIVNPGSVDIEPTLPHKT  180

Query  744  KPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPI  923
            KPK DVGYPGGLWFDP+MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP+
Sbjct  181  KPKPDVGYPGGLWFDPWMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGPL  240

Query  924  ENLMFHLADPGHNNIFSAFTSH  989
            +NL  H+ADPGH N+FSAF+SH
Sbjct  241  QNLAAHIADPGHCNVFSAFSSH  262



>gb|ABK96605.1| unknown [Populus trichocarpa x Populus deltoides]
Length=261

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 228/264 (86%), Gaps = 4/264 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHK-QNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MAL+ AS++L ++P R   K Q  + G+ + C  +  R   +NA K VSSVCEPLPPDRP
Sbjct  1    MALNFASSSLSSLPTRTRDKPQKSLLGKIEKCQAVKVR---VNATKGVSSVCEPLPPDRP  57

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAEL+HGRWAMLA AGILIPEW
Sbjct  58   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPESLKWFAQAELIHGRWAMLAAAGILIPEW  117

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFIDN++W+DAG REYFADPTTLFVVQ+ LMGW EGRRWAD+IKPGCVD++P +PH
Sbjct  118  LERLGFIDNFNWFDAGTREYFADPTTLFVVQLILMGWIEGRRWADMIKPGCVDIDPKLPH  177

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
            K KPK D+GYPGGLWFDP+ WGRGSPEPVM +RTKEIKNGRLAMLAF+GF FQAIYT +G
Sbjct  178  KTKPKPDIGYPGGLWFDPWNWGRGSPEPVMAIRTKEIKNGRLAMLAFVGFWFQAIYTGEG  237

Query  918  PIENLMFHLADPGHNNIFSAFTSH  989
            PI+NLM H+ADPGH NIFSAFTSH
Sbjct  238  PIDNLMAHIADPGHCNIFSAFTSH  261



>ref|XP_008242265.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform 
X1 [Prunus mume]
Length=267

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 227/268 (85%), Gaps = 7/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVS-----GQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I S AL  IP R + +   V      G+ K CI L  RT  LNA K VSSVCEPLP
Sbjct  1    MALAITS-ALSTIPRRFLIEYREVPWKFCPGKVKPCI-LGRRTTSLNATKGVSSVCEPLP  58

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV+GIL
Sbjct  59   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVSGIL  118

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE LE LGFI+N+SW++AG REYFADPTTLFVVQ+ALMGW EGRRWADII PG VD+EP
Sbjct  119  IPECLERLGFIENFSWFEAGEREYFADPTTLFVVQLALMGWVEGRRWADIINPGSVDIEP  178

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             +PHKK P+ DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIY
Sbjct  179  KLPHKKNPEPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQAIY  238

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTSH  989
            T + PIENLM H+ADPGH NIFSAFTS 
Sbjct  239  TGKDPIENLMAHIADPGHCNIFSAFTSQ  266



>gb|KHN12296.1| Chlorophyll a-b binding protein, chloroplastic [Glycine soja]
Length=260

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/261 (78%), Positives = 225/261 (86%), Gaps = 2/261 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+++STAL ++P R+I ++ +   +  TC+ L+ RT   NA K VS+VCEPLPPDRPL
Sbjct  1    MALALSSTALSSLPNREIRQKGFPE-RTPTCLSLTRRT-IANATKGVSAVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV GIL+PE L
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVFGILVPELL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+I+N+SWYDAG REYF DPTTLFVVQM LMGW EGRRWADI+ PG VD+EP VPH 
Sbjct  119  ERIGYIENFSWYDAGTREYFVDPTTLFVVQMGLMGWVEGRRWADIVNPGSVDIEPKVPHV  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +GP
Sbjct  179  TNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGEGP  238

Query  921  IENLMFHLADPGHNNIFSAFT  983
            IENLM HLADPGH NIFSAFT
Sbjct  239  IENLMAHLADPGHCNIFSAFT  259



>ref|XP_004288997.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=263

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 227/263 (86%), Gaps = 1/263 (0%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+IAS+AL + P R++  +     +  TC ML   + R+ AGK VSSVCEPLPPDRPL
Sbjct  1    MALAIASSALSSFPTREVPWKFSPGLRVTTC-MLGRGSTRVGAGKGVSSVCEPLPPDRPL  59

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW 
Sbjct  60   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWA  119

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGF++N+SW++AG REYFADPTTLFVVQ+ALMGW EGRRWAD++ PG V +EP +PHK
Sbjct  120  ERLGFLENFSWFEAGEREYFADPTTLFVVQLALMGWVEGRRWADMLNPGSVSIEPKLPHK  179

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K PK DVGYPGGL+FDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT + P
Sbjct  180  KIPKADVGYPGGLFFDPIMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQALYTGKDP  239

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH NIFSAFTS 
Sbjct  240  IENLMDHIADPGHVNIFSAFTSQ  262



>gb|KHG29329.1| Chlorophyll a-b binding, chloroplastic [Gossypium arboreum]
Length=261

 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 205/263 (78%), Positives = 227/263 (86%), Gaps = 2/263 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALS+AST+  +  + +IH +   S +  T +   +RT     G  VSSVCEPLPPDRPL
Sbjct  1    MALSMASTSFSSFSIIRIHPKKLFSRKVTTLLRGETRTKAAKGG--VSSVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPE L
Sbjct  59   WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILIPELL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFIDN+SWYDAG+++YFADPTTLFVVQMALMGW EGRRWADIIKPG VD+EP +P+K
Sbjct  119  ESLGFIDNFSWYDAGSKQYFADPTTLFVVQMALMGWVEGRRWADIIKPGSVDIEPNLPNK  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKP  DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT +GP
Sbjct  179  KKPTPDVGYPGGLWFDPLMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGEGP  238

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH N+FSAFT+H
Sbjct  239  IENLMAHIADPGHCNVFSAFTTH  261



>ref|XP_003546513.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Glycine max]
Length=260

 Score =   412 bits (1060),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 203/261 (78%), Positives = 224/261 (86%), Gaps = 2/261 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+++STAL ++P R+I +Q     +  TC+ L+ RT    A K VS+VCEPLPPDRPL
Sbjct  1    MALALSSTALSSLPNREI-RQKGFPDRTPTCLSLTRRT-VAYATKGVSAVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV GIL+PE L
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHARWAMLAVFGILVPELL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+I+N+SWYDAGAREYF DPTTLFVVQM LMGW EGRRWAD++ PG VD+EP VPH 
Sbjct  119  EKIGYIENFSWYDAGAREYFVDPTTLFVVQMGLMGWVEGRRWADMVNPGSVDIEPKVPHI  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +GP
Sbjct  179  TNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGEGP  238

Query  921  IENLMFHLADPGHNNIFSAFT  983
            IENLM HLADPGH NIFSAFT
Sbjct  239  IENLMAHLADPGHCNIFSAFT  259



>ref|XP_010099098.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB76746.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=294

 Score =   413 bits (1062),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 225/259 (87%), Gaps = 3/259 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALSIASTAL ++P R++  +   SG+   C +L     R+NA K VS+VCEPLPPDRPL
Sbjct  1    MALSIASTALSSVPNRELPLKLNSSGKISKCSLLGKT--RVNATKGVSTVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAEL+HGRWAMLAV+GILIPEWL
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELIHGRWAMLAVSGILIPEWL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFID+++WY+AGAREYFAD TTLFVVQ+ALMGW EGRRWAD+I PGCVD+EP +PHK
Sbjct  119  ERLGFIDDFNWYNAGAREYFADHTTLFVVQLALMGWVEGRRWADMINPGCVDIEPKLPHK  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT-KQG  917
              PK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT    
Sbjct  179  TNPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGNND  238

Query  918  PIENLMFHLADPGHNNIFS  974
            PI+NL  HLADPGH NIFS
Sbjct  239  PIDNLFAHLADPGHRNIFS  257



>ref|NP_001276216.1| chlorophyll a-b binding protein, chloroplastic-like [Glycine 
max]
 gb|ACU23891.1| unknown [Glycine max]
Length=260

 Score =   411 bits (1057),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/261 (77%), Positives = 224/261 (86%), Gaps = 2/261 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+++STAL ++P R+I ++ +   +  TC+ L+ RT   NA K VS+VCEPLPPDRPL
Sbjct  1    MALALSSTALSSLPNREIRQKGFPE-RTPTCLSLTRRT-IANATKGVSAVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV GIL+PE L
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVFGILVPELL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+I+N+SWYDAG REYF DPTTLFVVQM LMGW EGRRWADI+ PG VD+EP VPH 
Sbjct  119  ERIGYIENFSWYDAGTREYFVDPTTLFVVQMGLMGWVEGRRWADIVNPGSVDIEPKVPHV  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNG LAMLAF+GF FQAIYT +GP
Sbjct  179  TNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGGLAMLAFVGFWFQAIYTGEGP  238

Query  921  IENLMFHLADPGHNNIFSAFT  983
            IENLM HLADPGH NIFSAFT
Sbjct  239  IENLMAHLADPGHCNIFSAFT  259



>ref|XP_007012597.1| Photosystem I light harvesting complex gene 6 isoform 1 [Theobroma 
cacao]
 gb|EOY30216.1| Photosystem I light harvesting complex gene 6 isoform 1 [Theobroma 
cacao]
Length=259

 Score =   411 bits (1056),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 224/263 (85%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+IASTAL ++P+R    Q    G+  T +  S+    L A K VSSVCEPLPPDRPL
Sbjct  1    MALAIASTALSSLPIRD-RPQKPFPGKITTFLPGSTH---LRATKGVSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPE L
Sbjct  57   WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILIPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGAREYFADPTTLFVVQMALMGW EGRRW D+I PG VD++  +P+K
Sbjct  117  ERLGFIENFSWYDAGAREYFADPTTLFVVQMALMGWVEGRRWVDMINPGSVDIQLKIPNK  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K P  DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGR+AMLAF+GFCFQAIYT +GP
Sbjct  177  KNPTPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRIAMLAFVGFCFQAIYTGEGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM H+ADPGH N+FSAFT+ 
Sbjct  237  IENLMAHIADPGHCNVFSAFTTR  259



>gb|KHN42786.1| Chlorophyll a-b binding protein, chloroplastic [Glycine soja]
Length=256

 Score =   409 bits (1052),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/258 (78%), Positives = 222/258 (86%), Gaps = 2/258 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+++STAL ++P R+I +Q     +  TC+ L+ RT   NA K VS+VCEPLPPDRPL
Sbjct  1    MALALSSTALSSLPNREI-RQKGFPDRTPTCLSLTRRT-VANATKGVSAVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV GIL+PE L
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHARWAMLAVFGILVPELL  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+I+N+SWYDAGAREYF DPTTLFVVQM LMGW EGRRWAD++ PG VD+EP VPH 
Sbjct  119  EKIGYIENFSWYDAGAREYFVDPTTLFVVQMGLMGWVEGRRWADMVNPGSVDIEPKVPHI  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +GP
Sbjct  179  TNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGEGP  238

Query  921  IENLMFHLADPGHNNIFS  974
            IENLM HLADPGH NIFS
Sbjct  239  IENLMAHLADPGHCNIFS  256



>emb|CAN69989.1| hypothetical protein VITISV_024400 [Vitis vinifera]
Length=229

 Score =   408 bits (1048),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 209/224 (93%), Gaps = 0/224 (0%)
 Frame = +3

Query  318  RLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQA  497
            RLNA K VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL+WFAQA
Sbjct  6    RLNATKGVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRWFAQA  65

Query  498  ELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEG  677
            ELMH RWAMLAVAGILIPE LE LGFI+N+SWYDAGA+E+FADPTTLFVVQ+ALMGW EG
Sbjct  66   ELMHSRWAMLAVAGILIPECLERLGFIENFSWYDAGAQEFFADPTTLFVVQLALMGWVEG  125

Query  678  RRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG  857
            RRWAD+I PGCVD++ T P+K KPK DVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG
Sbjct  126  RRWADLINPGCVDIQLTFPNKAKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG  185

Query  858  RLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            RLAMLAF+GFCFQAIYT +GPIENLM H+ADPGH N+FSAFTS 
Sbjct  186  RLAMLAFVGFCFQAIYTGEGPIENLMAHIADPGHCNVFSAFTSQ  229



>ref|XP_006474703.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=271

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/272 (74%), Positives = 225/272 (83%), Gaps = 10/272 (4%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHK--QNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MAL+IASTAL  +P  +     Q   + +   C++       +NA K VSSVCEPLPPDR
Sbjct  1    MALAIASTALSTLPFSRCRDIPQKRFTEKITKCLVGRGGV-IVNATKGVSSVCEPLPPDR  59

Query  375  PLWFPGSSPPEWLDGS-------LPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV  533
            PLWFPGS+PP WLDG        LPGD+GFDPLGLGSDPELLKWFAQAEL+HGRWAMLAV
Sbjct  60   PLWFPGSTPPSWLDGRHSLFLIPLPGDYGFDPLGLGSDPELLKWFAQAELIHGRWAMLAV  119

Query  534  AGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCV  713
            AGILIPEWLE +G I+N+SWYDAG+REYFADPTTLFVVQ+ALMGW EGRRWADII PGCV
Sbjct  120  AGILIPEWLESIGLIENFSWYDAGSREYFADPTTLFVVQLALMGWVEGRRWADIINPGCV  179

Query  714  DVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCF  893
            D++P +P+K KPK DVGYPGG+WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCF
Sbjct  180  DIQPDLPNKTKPKPDVGYPGGIWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCF  239

Query  894  QAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            QAIYT QGP+ENL  H+ADPGH N+FSAFTS 
Sbjct  240  QAIYTGQGPLENLACHVADPGHCNVFSAFTSQ  271



>ref|XP_006474702.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=272

 Score =   408 bits (1049),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 201/274 (73%), Positives = 225/274 (82%), Gaps = 13/274 (5%)
 Frame = +3

Query  201  MALSIASTALPNIPL----RQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPP  368
            MAL+IASTAL  +P     R I ++ +     K  +        +NA K VSSVCEPLPP
Sbjct  1    MALAIASTALSTLPFSSRCRDIPQKRFTEKITKCLVGRGGVI--VNATKGVSSVCEPLPP  58

Query  369  DRPLWFPGSSPPEWLDGS-------LPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAML  527
            DRPLWFPGS+PP WLDG        LPGD+GFDPLGLGSDPELLKWFAQAEL+HGRWAML
Sbjct  59   DRPLWFPGSTPPSWLDGRHSLFLIPLPGDYGFDPLGLGSDPELLKWFAQAELIHGRWAML  118

Query  528  AVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPG  707
            AVAGILIPEWLE +G I+N+SWYDAG+REYFADPTTLFVVQ+ALMGW EGRRWADII PG
Sbjct  119  AVAGILIPEWLESIGLIENFSWYDAGSREYFADPTTLFVVQLALMGWVEGRRWADIINPG  178

Query  708  CVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGF  887
            CVD++P +P+K KPK DVGYPGG+WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF
Sbjct  179  CVDIQPDLPNKTKPKPDVGYPGGIWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGF  238

Query  888  CFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            CFQAIYT QGP+ENL  H+ADPGH N+FSAFTS 
Sbjct  239  CFQAIYTGQGPLENLACHVADPGHCNVFSAFTSQ  272



>ref|XP_011039957.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Populus 
euphratica]
Length=261

 Score =   407 bits (1047),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 202/264 (77%), Positives = 229/264 (87%), Gaps = 4/264 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHK-QNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MAL+ AS++L ++P R   K Q  + G+ + C  +  R   +NA K VSSVC+PLPPDRP
Sbjct  1    MALNFASSSLSSLPARTRDKPQKSLLGKIEKCQAVKIR---VNATKGVSSVCDPLPPDRP  57

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAEL+HGRWAMLA AGILIPEW
Sbjct  58   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELIHGRWAMLAAAGILIPEW  117

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFIDN++W+DAG REYFADPTTLFVVQ+ LMGW EGRRWAD+IKPGCVD++P +PH
Sbjct  118  LERLGFIDNFNWFDAGTREYFADPTTLFVVQLILMGWVEGRRWADMIKPGCVDIDPKLPH  177

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
            K KPK D+GYPGGLWFDP+ WGRGSPEPVM +RTKEIKNGRLAMLAF+GF FQAIYT +G
Sbjct  178  KTKPKPDIGYPGGLWFDPWNWGRGSPEPVMAIRTKEIKNGRLAMLAFVGFWFQAIYTGEG  237

Query  918  PIENLMFHLADPGHNNIFSAFTSH  989
            PI+NLM H+ADPGH NIFSAFTSH
Sbjct  238  PIDNLMAHIADPGHCNIFSAFTSH  261



>ref|XP_010272798.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nelumbo 
nucifera]
Length=261

 Score =   407 bits (1046),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/265 (77%), Positives = 226/265 (85%), Gaps = 6/265 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPL--RQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MAL++ S+AL  +P   R++  Q  + G   T + L SR   ++A K VSSVCEPLPPDR
Sbjct  1    MALAVTSSALSKLPPAPREV-AQKCLPGGIPTAVSLRSR---VSATKGVSSVCEPLPPDR  56

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL+WFAQAEL+H RWAMLAVAGILIPE
Sbjct  57   PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRWFAQAELIHSRWAMLAVAGILIPE  116

Query  555  WLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVP  734
             LE LGFI+N+SWYDAGA+EYFAD TTLFVVQM LMGW EGRRWAD++ PG VD+EP  P
Sbjct  117  CLERLGFIENFSWYDAGAKEYFADHTTLFVVQMVLMGWVEGRRWADLVNPGSVDIEPKFP  176

Query  735  HKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQ  914
            ++K PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +
Sbjct  177  NRKNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGE  236

Query  915  GPIENLMFHLADPGHNNIFSAFTSH  989
            GPIENLM H+ADPGH NIFSAFTSH
Sbjct  237  GPIENLMAHIADPGHCNIFSAFTSH  261



>ref|XP_009418009.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=259

 Score =   406 bits (1044),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/263 (77%), Positives = 224/263 (85%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+IAS+AL +  LR +     V G  + C   S    RL+A K VSSVC+PLPPDRPL
Sbjct  1    MALAIASSALCSPHLR-VQASKPVPGNTRAC---SRSPTRLHATKGVSSVCQPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL+WFAQAELMH RWAMLAVAGILIPE L
Sbjct  57   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLRWFAQAELMHSRWAMLAVAGILIPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGA++YFADP TLFVVQMALMGW EGRRWAD + PGCVD+EP  P++
Sbjct  117  EKLGFIENFSWYDAGAQQYFADPLTLFVVQMALMGWVEGRRWADYLNPGCVDIEPKFPNR  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K PK DVGYPGGLWFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYTK+GP
Sbjct  177  KNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFMGFWFQAIYTKEGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            ++NLM H+ADPGH NIFSAF S+
Sbjct  237  LDNLMAHIADPGHCNIFSAFVSN  259



>ref|XP_010531966.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Tarenaya 
hassleriana]
Length=267

 Score =   407 bits (1045),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 208/223 (93%), Gaps = 0/223 (0%)
 Frame = +3

Query  321  LNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAE  500
            + AGK VSSVCEPLPPDRPLWFPGS+PP+WLDGSLPGDFGFDPLGLGSDPELLKWFAQAE
Sbjct  45   VRAGKGVSSVCEPLPPDRPLWFPGSTPPQWLDGSLPGDFGFDPLGLGSDPELLKWFAQAE  104

Query  501  LMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGR  680
            LMH RWAMLAVAGILIPE LE LGFI+++SWYDAG+REYFADPTTL V Q+ALM WAEGR
Sbjct  105  LMHSRWAMLAVAGILIPECLERLGFIEDFSWYDAGSREYFADPTTLLVTQLALMAWAEGR  164

Query  681  RWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGR  860
            RWAD+IKPGCVD+EP +P+++ PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGR
Sbjct  165  RWADMIKPGCVDIEPKLPNRENPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGR  224

Query  861  LAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            LAMLAF+GFCFQAIYT +GPIENLM HLADPGH NIFSAFTSH
Sbjct  225  LAMLAFVGFCFQAIYTGEGPIENLMAHLADPGHCNIFSAFTSH  267



>gb|EYU25833.1| hypothetical protein MIMGU_mgv1a012037mg [Erythranthe guttata]
Length=263

 Score =   406 bits (1043),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +3

Query  204  ALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLW  383
            A +IA++   + P R +H     +G++ T I LS R  RL+AGK  SSVC+PLPPDRP+W
Sbjct  3    ASAIAASPFSSFPTR-LHSFPQAAGKSFTGICLSKRG-RLSAGKGPSSVCQPLPPDRPIW  60

Query  384  FPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLE  563
            FPGSSPP+WLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAMLAV+GIL+PEWL 
Sbjct  61   FPGSSPPQWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVSGILVPEWLG  120

Query  564  GLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKK  743
             LGFIDNYSW+DAG+REYFADP TL V Q+ALMGW EGRRWADI+ PG VD+EPT+PHK 
Sbjct  121  SLGFIDNYSWFDAGSREYFADPVTLLVAQLALMGWVEGRRWADIVNPGSVDIEPTLPHKT  180

Query  744  KPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPI  923
            KPK DVGYPGGLWFDP+MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA+YT QGP+
Sbjct  181  KPKPDVGYPGGLWFDPWMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAVYTGQGPL  240

Query  924  ENLMFHLADPGHNNIFS  974
            +NL  H+ADPGH N+FS
Sbjct  241  QNLAAHIADPGHCNVFS  257



>ref|XP_010932388.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Elaeis 
guineensis]
Length=259

 Score =   405 bits (1041),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/263 (77%), Positives = 222/263 (84%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I S A  N+  R +   N VS   KT   L SRT   NA K VSSVCEPLPPDRPL
Sbjct  1    MALAIGSFAFCNVQPR-VKAPNPVSRIIKTFARLPSRT---NATKGVSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGS+PPEWLDGSLPGD+GFDPLGLGSDPELL+WFAQAELMHGRWAMLAVAGIL+PE L
Sbjct  57   WFPGSTPPEWLDGSLPGDYGFDPLGLGSDPELLRWFAQAELMHGRWAMLAVAGILVPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E  GF++N+SWY+AGA++YFADP TLF+VQM LMGW EGRRWAD IKPGCVD+EP  P++
Sbjct  117  EKFGFLENFSWYEAGAQQYFADPVTLFIVQMILMGWVEGRRWADYIKPGCVDIEPKFPNR  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K PK DVGYPGGLWFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +GP
Sbjct  177  KNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFMGFWFQAIYTGEGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGH NIFSA +SH
Sbjct  237  IENLMAHLADPGHCNIFSALSSH  259



>ref|XP_006452840.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
 gb|ESR66080.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
Length=264

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 217/255 (85%), Gaps = 2/255 (1%)
 Frame = +3

Query  225  ALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPP  404
             LP    R I ++ +     K  +  S     +NA K VSSVCEPLPPDRPLWFPGS+PP
Sbjct  12   TLPFSRCRDIPQKCFTEKITKCLVGRSGVI--VNATKGVSSVCEPLPPDRPLWFPGSTPP  69

Query  405  EWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDN  584
             WLDGSLPGD+GFDPLGLGSDPELLKWFAQAEL+HGRWAMLAVAGILIPEWLE +G I+N
Sbjct  70   SWLDGSLPGDYGFDPLGLGSDPELLKWFAQAELIHGRWAMLAVAGILIPEWLESIGLIEN  129

Query  585  YSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVG  764
            +SWYDAG+REYFADPTTLFVVQ+ALMGW EGRRWADII PGCVD++P +P+K KPK DVG
Sbjct  130  FSWYDAGSREYFADPTTLFVVQLALMGWVEGRRWADIINPGCVDIQPDLPNKTKPKPDVG  189

Query  765  YPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHL  944
            YPGG+WFDP MWGRGSP+PVMVLRTKEIKNGRLAMLAF+GFCFQAIYT QGP+ENL  H+
Sbjct  190  YPGGIWFDPMMWGRGSPQPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGQGPLENLACHV  249

Query  945  ADPGHNNIFSAFTSH  989
            ADPGH N+FSAFTS 
Sbjct  250  ADPGHCNVFSAFTSQ  264



>ref|XP_006452839.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
 gb|ESR66079.1| hypothetical protein CICLE_v10009205mg [Citrus clementina]
Length=265

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = +3

Query  321  LNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAE  500
            +NA K VSSVCEPLPPDRPLWFPGS+PP WLDGSLPGD+GFDPLGLGSDPELLKWFAQAE
Sbjct  43   VNATKGVSSVCEPLPPDRPLWFPGSTPPSWLDGSLPGDYGFDPLGLGSDPELLKWFAQAE  102

Query  501  LMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGR  680
            L+HGRWAMLAVAGILIPEWLE +G I+N+SWYDAG+REYFADPTTLFVVQ+ALMGW EGR
Sbjct  103  LIHGRWAMLAVAGILIPEWLESIGLIENFSWYDAGSREYFADPTTLFVVQLALMGWVEGR  162

Query  681  RWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGR  860
            RWADII PGCVD++P +P+K KPK DVGYPGG+WFDP MWGRGSP+PVMVLRTKEIKNGR
Sbjct  163  RWADIINPGCVDIQPDLPNKTKPKPDVGYPGGIWFDPMMWGRGSPQPVMVLRTKEIKNGR  222

Query  861  LAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            LAMLAF+GFCFQAIYT QGP+ENL  H+ADPGH N+FSAFTS 
Sbjct  223  LAMLAFVGFCFQAIYTGQGPLENLACHVADPGHCNVFSAFTSQ  265



>ref|XP_010459573.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=270

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/263 (75%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = +3

Query  204  ALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLW  383
             L++++T+    P  +  +  W +       + S R   + AGKEVSSVCEPLPPDRPLW
Sbjct  8    TLTLSTTSRVEFPTERKRQVPWCATTLAGGRINSDRVVVVRAGKEVSSVCEPLPPDRPLW  67

Query  384  FPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLE  563
            FPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAEL+H RWAMLAV GILIPE LE
Sbjct  68   FPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELIHSRWAMLAVTGILIPECLE  127

Query  564  GLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKK  743
             LGFI+N+SWYDAG+REYFAD TTLFV Q+ LMGWAEGRRWAD+IKPG VD+EP  PHK 
Sbjct  128  RLGFIENFSWYDAGSREYFADSTTLFVAQLVLMGWAEGRRWADLIKPGSVDIEPKYPHKV  187

Query  744  KPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY-TKQGP  920
             PK DVGYPGGLWFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA Y T Q P
Sbjct  188  NPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQATYTTSQDP  247

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGH N+FSAFTSH
Sbjct  248  IENLMAHLADPGHCNVFSAFTSH  270



>ref|XP_007012598.1| Photosystem I light harvesting complex gene 6 isoform 2 [Theobroma 
cacao]
 gb|EOY30217.1| Photosystem I light harvesting complex gene 6 isoform 2 [Theobroma 
cacao]
Length=263

 Score =   404 bits (1037),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 220/260 (85%), Gaps = 4/260 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+IASTAL ++P+R    Q    G+  T +  S+    L A K VSSVCEPLPPDRPL
Sbjct  1    MALAIASTALSSLPIRD-RPQKPFPGKITTFLPGSTH---LRATKGVSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGILIPE L
Sbjct  57   WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILIPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWYDAGAREYFADPTTLFVVQMALMGW EGRRW D+I PG VD++  +P+K
Sbjct  117  ERLGFIENFSWYDAGAREYFADPTTLFVVQMALMGWVEGRRWVDMINPGSVDIQLKIPNK  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K P  DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGR+AMLAF+GFCFQAIYT +GP
Sbjct  177  KNPTPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRIAMLAFVGFCFQAIYTGEGP  236

Query  921  IENLMFHLADPGHNNIFSAF  980
            IENLM H+ADPGH N+FS  
Sbjct  237  IENLMAHIADPGHCNVFSVL  256



>ref|XP_007138637.1| hypothetical protein PHAVU_009G225500g [Phaseolus vulgaris]
 gb|ESW10631.1| hypothetical protein PHAVU_009G225500g [Phaseolus vulgaris]
Length=261

 Score =   403 bits (1036),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 221/261 (85%), Gaps = 1/261 (0%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+++STAL  +P R+I ++  +  +  T + LS RT   NA K VS+VCEPLPPDRPL
Sbjct  1    MALALSSTALSTLPNREIRQKVNLPERTGTWLGLSRRT-TANATKGVSAVCEPLPPDRPL  59

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV GILIPE L
Sbjct  60   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVFGILIPELL  119

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+++N++WYDAGAREYF D TTLFVVQM LMGW EGRRWAD++ PGCVD+E  VPH 
Sbjct  120  ERIGYVENFNWYDAGAREYFTDHTTLFVVQMGLMGWVEGRRWADMLNPGCVDIELKVPHI  179

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIY    P
Sbjct  180  TPPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYVGADP  239

Query  921  IENLMFHLADPGHNNIFSAFT  983
            +ENLM HLADPGH NIFSAFT
Sbjct  240  VENLMAHLADPGHCNIFSAFT  260



>ref|XP_004488100.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=264

 Score =   403 bits (1036),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/264 (73%), Positives = 222/264 (84%), Gaps = 1/264 (0%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRL-NAGKEVSSVCEPLPPDRP  377
            MAL+I+ST+L +   R+I ++ +  G A T  +   R+  + NA K VS VCEPLPPDRP
Sbjct  1    MALAISSTSLSSFANREICQKVFTQGTATTSWLSRRRSITIRNATKGVSDVCEPLPPDRP  60

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAML V+GIL+PE 
Sbjct  61   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLGVSGILVPEL  120

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            L+ +G+++N+SW++AG+ EYF DPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP +P+
Sbjct  121  LQNIGYVENFSWFNAGSVEYFTDPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEPKLPN  180

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
            +  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT   
Sbjct  181  RPNPKPDVGYPGGLWFDPMRWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGNS  240

Query  918  PIENLMFHLADPGHNNIFSAFTSH  989
            PIENLM HLADPGH NIFSAFTS 
Sbjct  241  PIENLMAHLADPGHCNIFSAFTSR  264



>ref|XP_010477121.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=269

 Score =   403 bits (1035),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 198/263 (75%), Positives = 219/263 (83%), Gaps = 2/263 (1%)
 Frame = +3

Query  204  ALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLW  383
            AL++++T+   IP  +  +  W +  A   I  S R   + AGKEVSSVCEPLPPDRPLW
Sbjct  8    ALTLSTTSRVEIPTERRRQVPWCATLAGGKIN-SDRVVVVRAGKEVSSVCEPLPPDRPLW  66

Query  384  FPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLE  563
            FPGSSPPEWLDGSLPGDFGFDPLGLGSDP+ LKWFAQAEL+H RWAMLAV GILIPE LE
Sbjct  67   FPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKWFAQAELIHSRWAMLAVTGILIPECLE  126

Query  564  GLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKK  743
             LGF++N+SWYDAG+REYFAD TTLFV Q+ LMGWAEGRRWAD+IKPG VD+EP  PHK 
Sbjct  127  RLGFLENFSWYDAGSREYFADSTTLFVAQLVLMGWAEGRRWADMIKPGSVDIEPKYPHKV  186

Query  744  KPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY-TKQGP  920
             PK DVGYPGG+WFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA Y T Q P
Sbjct  187  NPKPDVGYPGGIWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQATYTTSQDP  246

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGH N+FSAFTSH
Sbjct  247  IENLMAHLADPGHCNVFSAFTSH  269



>ref|NP_173349.1| PSI type II chlorophyll a/b-binding protein (Lhca2*1) [Arabidopsis 
thaliana]
 gb|AAM63464.1| PSI type II chlorophyll a/b-binding protein, putative [Arabidopsis 
thaliana]
 gb|AAV85677.1| At1g19150 [Arabidopsis thaliana]
 gb|AAW70400.1| At1g19150 [Arabidopsis thaliana]
 gb|AEE29811.1| PSI type II chlorophyll a/b-binding protein (Lhca2*1) [Arabidopsis 
thaliana]
Length=270

 Score =   402 bits (1034),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            ++  R   + AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+ 
Sbjct  40   LMRERLVVVRAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDT  99

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            LKWFAQAEL+H RWAMLAV GI+IPE LE LGFI+N+SWYDAG+REYFAD TTLFV QM 
Sbjct  100  LKWFAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQMV  159

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
            LMGWAEGRRWAD+IKPG VD+EP  PHK  PK DVGYPGGLWFD  MWGRGSPEPVMVLR
Sbjct  160  LMGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLR  219

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            TKEIKNGRLAMLAFLGFCFQA YT Q PIENLM HLADPGH N+FSAFTSH
Sbjct  220  TKEIKNGRLAMLAFLGFCFQATYTSQDPIENLMAHLADPGHCNVFSAFTSH  270



>gb|AAO22627.1| putative light-harvesting chlorophyll a/b binding protein [Arabidopsis 
thaliana]
Length=270

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            ++  R   + AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+ 
Sbjct  40   LMRERLVVVRAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDT  99

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            LKWFAQAEL+H RWAMLAV GI+IPE LE LGFI+N+SWYDAG+REYFAD TTLFV QM 
Sbjct  100  LKWFAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQMV  159

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
            LMGWAEGRRWAD+IKPG VD+EP  PHK  PK DVGYPGGLWFD  MWGRGSPEPVMVLR
Sbjct  160  LMGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLR  219

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            TKEIKNGRLAMLAFLGFCFQA YT Q PIENLM HLADPGH N+FSAFTSH
Sbjct  220  TKEIKNGRLAMLAFLGFCFQATYTSQDPIENLMAHLADPGHCNVFSAFTSH  270



>ref|XP_008784474.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Phoenix 
dactylifera]
Length=259

 Score =   402 bits (1032),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/263 (76%), Positives = 221/263 (84%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I S+A  N+  R +   N VS   +    L +RT   NA K VSSVCEPLPPDRPL
Sbjct  1    MALAIGSSAFFNLQPR-VKAPNTVSRLIRAFARLPTRT---NATKGVSSVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGD+GFDPLGLGSDPELL+WFAQAELMH RWAMLA AGIL+PE L
Sbjct  57   WFPGSSPPEWLDGSLPGDYGFDPLGLGSDPELLRWFAQAELMHSRWAMLAAAGILVPECL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LGFI+N+SWY+AGA++YF DP TLFVVQM LMGWAEGRRWAD IKPGCVD+EP  P++
Sbjct  117  EKLGFIENFSWYEAGAQQYFTDPVTLFVVQMILMGWAEGRRWADFIKPGCVDIEPKFPNR  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K PK DVGYPGGLWFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT +GP
Sbjct  177  KNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFMGFWFQAIYTGEGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            +ENLM HLADPGH NIF+A +SH
Sbjct  237  LENLMAHLADPGHCNIFAALSSH  259



>gb|KFK44053.1| hypothetical protein AALP_AA1G210000 [Arabis alpina]
Length=265

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 218/265 (82%), Gaps = 2/265 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVS-GQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MAL+IA +  P + L +   +        +    +S R   + AGKEVSSVCEPLPPDRP
Sbjct  1    MALAIAFSLTPTLVLSKSRVERGRGLCTVRAAGRMSERVVVVRAGKEVSSVCEPLPPDRP  60

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            +WFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+LLKWFAQAEL+H RWAMLAV GILIPE 
Sbjct  61   IWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDLLKWFAQAELVHSRWAMLAVTGILIPEC  120

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFI+N+SWYDAG+REYFAD TTLF+ Q+ LMGW EGRRWAD++KPG VD+EP  PH
Sbjct  121  LERLGFIENFSWYDAGSREYFADSTTLFLAQLVLMGWVEGRRWADLVKPGSVDIEPKYPH  180

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY-TKQ  914
            K  PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA Y + Q
Sbjct  181  KVNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQANYSSSQ  240

Query  915  GPIENLMFHLADPGHNNIFSAFTSH  989
             PIENLM HLADPGH NIFSAFTSH
Sbjct  241  DPIENLMAHLADPGHCNIFSAFTSH  265



>ref|XP_004488099.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=293

 Score =   402 bits (1034),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/267 (71%), Positives = 222/267 (83%), Gaps = 1/267 (0%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRL-NAGKEVSSVCEPLPPDRP  377
            MAL+I+ST+L +   R+I ++ +  G A T  +   R+  + NA K VS VCEPLPPDRP
Sbjct  1    MALAISSTSLSSFANREICQKVFTQGTATTSWLSRRRSITIRNATKGVSDVCEPLPPDRP  60

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAML V+GIL+PE 
Sbjct  61   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLGVSGILVPEL  120

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            L+ +G+++N+SW++AG+ EYF DPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP +P+
Sbjct  121  LQNIGYVENFSWFNAGSVEYFTDPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEPKLPN  180

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQG  917
            +  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQAIYT   
Sbjct  181  RPNPKPDVGYPGGLWFDPMRWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQAIYTGNS  240

Query  918  PIENLMFHLADPGHNNIFSAFTSH*CF  998
            PIENLM HLADPGH NIFS  + H C+
Sbjct  241  PIENLMAHLADPGHCNIFSVISFHFCY  267



>ref|XP_002890321.1| hypothetical protein ARALYDRAFT_472139 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66580.1| hypothetical protein ARALYDRAFT_472139 [Arabidopsis lyrata subsp. 
lyrata]
Length=269

 Score =   401 bits (1030),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 193/245 (79%), Positives = 209/245 (85%), Gaps = 0/245 (0%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGD  434
             ++  V+  + T   +S R     AGKEVSSVCEPLPPDRPLWFPGS+PPEWLDGSLPGD
Sbjct  25   QRRPLVASASPTGGRMSERLVVARAGKEVSSVCEPLPPDRPLWFPGSAPPEWLDGSLPGD  84

Query  435  FGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGARE  614
            FGFDPLGLGSDP+ LKWFAQAEL+H RWAMLAV GILIPE LE LGFI+N+SWY+AG+RE
Sbjct  85   FGFDPLGLGSDPDTLKWFAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYEAGSRE  144

Query  615  YFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPF  794
            YFAD TTLFV QM LMGWAEGRRWAD+IKPG VD+EP  PHK  PK DVGYPGGLWFD  
Sbjct  145  YFADSTTLFVAQMVLMGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFM  204

Query  795  MWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
            MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA YT Q PIENLM HLADPGH N+FS
Sbjct  205  MWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQATYTSQDPIENLMAHLADPGHCNVFS  264

Query  975  AFTSH  989
            AFTSH
Sbjct  265  AFTSH  269



>ref|XP_006416532.1| hypothetical protein EUTSA_v10008493mg [Eutrema salsugineum]
 gb|ESQ34885.1| hypothetical protein EUTSA_v10008493mg [Eutrema salsugineum]
Length=265

 Score =   399 bits (1026),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 219/265 (83%), Gaps = 2/265 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIH-KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRP  377
            MAL+IAS     + L     ++   S  ++     + R   + AGKEVSSVCEPLPPDRP
Sbjct  1    MALAIASALTSTLALSTSRVERGRASFWSRAGGRRTERVVVVRAGKEVSSVCEPLPPDRP  60

Query  378  LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEW  557
            LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+LLKWFAQAEL+H RWAMLAV GILIPE 
Sbjct  61   LWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDLLKWFAQAELVHSRWAMLAVTGILIPEC  120

Query  558  LEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPH  737
            LE LGFI+NYSWYDAG+REYFAD TTLF+ Q+ LMGWAEGRRWAD+IKPG VD+EP  PH
Sbjct  121  LERLGFIENYSWYDAGSREYFADSTTLFLAQLVLMGWAEGRRWADLIKPGSVDIEPKYPH  180

Query  738  KKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY-TKQ  914
            K  PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFCFQA Y T Q
Sbjct  181  KVNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQARYSTSQ  240

Query  915  GPIENLMFHLADPGHNNIFSAFTSH  989
             PIENLM HLADPGH N+FSAFTSH
Sbjct  241  DPIENLMAHLADPGHCNVFSAFTSH  265



>gb|AFK42470.1| unknown [Lotus japonicus]
Length=259

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/263 (75%), Positives = 220/263 (84%), Gaps = 4/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALSI+STAL   P     K++ V  + +T   L  R    NA K VS VCEPLPPDRPL
Sbjct  1    MALSISSTALSTFP--NTEKRHKVFPE-RTATWLPRRI-HTNAKKGVSDVCEPLPPDRPL  56

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDP+GLGSDPELLKW AQAELMH RWAML V+GILIPE L
Sbjct  57   WFPGSSPPEWLDGSLPGDFGFDPIGLGSDPELLKWLAQAELMHARWAMLGVSGILIPELL  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E +G+++NYSWY+AG +EYFADPTTLF+VQ+ALMGW EGRRWAD++ PG VD+EP +P++
Sbjct  117  EKMGYVENYSWYEAGTQEYFADPTTLFIVQLALMGWVEGRRWADLVNPGSVDIEPKLPNR  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK DVGYPGGLWFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT QGP
Sbjct  177  PNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGQGP  236

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
            IENLM HLADPGH NIFSAFTS 
Sbjct  237  IENLMAHLADPGHCNIFSAFTSR  259



>ref|XP_010498326.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=273

 Score =   399 bits (1024),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 201/274 (73%), Positives = 218/274 (80%), Gaps = 12/274 (4%)
 Frame = +3

Query  201  MALSIASTALP----------NIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSV  350
            MAL+IAS               IP  +  +  W +  A   I  S R   + AGKEVSSV
Sbjct  1    MALAIASALTSTLTLSTTSRVEIPTERRRQVPWCATLASGRIN-SDRVVVVRAGKEVSSV  59

Query  351  CEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLA  530
            CEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+ LKWFAQAEL+H RWAMLA
Sbjct  60   CEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDTLKWFAQAELIHSRWAMLA  119

Query  531  VAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGC  710
            V GILIPE LE LGFI+N+SWYDAG+REYFAD TTLFV Q+ LMGWAEGRRWAD+IKPG 
Sbjct  120  VTGILIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQLVLMGWAEGRRWADLIKPGS  179

Query  711  VDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFC  890
            VD+EP  PHK  PK D+GYPGGLWFD  MWGRGSPEP+MVLRTKEIKNGRLAMLAF+GFC
Sbjct  180  VDIEPKYPHKVNPKPDIGYPGGLWFDFMMWGRGSPEPIMVLRTKEIKNGRLAMLAFVGFC  239

Query  891  FQAIY-TKQGPIENLMFHLADPGHNNIFSAFTSH  989
            FQA Y T Q PIENLM HLADPGH N+FSAFTSH
Sbjct  240  FQATYTTSQDPIENLMAHLADPGHCNVFSAFTSH  273



>ref|XP_008450947.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Cucumis 
melo]
Length=265

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 213/262 (81%), Gaps = 0/262 (0%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MALSI+STAL + P+R+   +    G      +    +    A   VSSVCEPLPPDRPL
Sbjct  1    MALSISSTALSSFPIRESSHRANFPGNFPNHKLRRDYSDLKAAKSGVSSVCEPLPPDRPL  60

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGIL+PEW 
Sbjct  61   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILLPEWF  120

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
            E LG I N+SWYDAG+REYFADPTTL V Q+ALMGW EGRRWAD++ PG VDV+  +PHK
Sbjct  121  ESLGLIQNFSWYDAGSREYFADPTTLLVAQLALMGWVEGRRWADLVNPGSVDVDLKLPHK  180

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KK K DVGYPGG WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+G  FQAIYT QGP
Sbjct  181  KKVKADVGYPGGFWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGLWFQAIYTGQGP  240

Query  921  IENLMFHLADPGHNNIFSAFTS  986
            +ENL  H+ADPGH NIFSAFTS
Sbjct  241  LENLAAHVADPGHCNIFSAFTS  262



>emb|CDX96677.1| BnaA08g22200D [Brassica napus]
Length=266

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/268 (74%), Positives = 220/268 (82%), Gaps = 7/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWR----LNAGKEVSSVCEPLPP  368
            MAL+IAS AL +  L  +      +G+      +  RT +    + AGKEVSSVCEPLPP
Sbjct  1    MALAIAS-ALTSTTL-ALSTSRVENGRGAFSSRVDGRTSQRLVVVRAGKEVSSVCEPLPP  58

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRP+WFPG+SPP+WLDGSLPGDFGFDPLGLGSDPE L+WFAQAEL+H RWAMLAV GILI
Sbjct  59   DRPMWFPGTSPPKWLDGSLPGDFGFDPLGLGSDPETLRWFAQAELIHSRWAMLAVTGILI  118

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE LE LGFI+NYSWYDAG+REYFAD TTLFVVQ+ LMGWAEGRRWAD IKPG VD+EP 
Sbjct  119  PECLERLGFIENYSWYDAGSREYFADSTTLFVVQLVLMGWAEGRRWADFIKPGSVDIEPQ  178

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
             PHK  PK DVGYPGGLWFDP MWGRGSP+PVMV+RTKEIKNGRLAMLAF+GFCFQA Y+
Sbjct  179  YPHKTNPKPDVGYPGGLWFDPMMWGRGSPDPVMVMRTKEIKNGRLAMLAFVGFCFQANYS  238

Query  909  -KQGPIENLMFHLADPGHNNIFSAFTSH  989
              Q PIENLM HLADPGH N+FSAFTS 
Sbjct  239  ASQDPIENLMAHLADPGHCNVFSAFTSQ  266



>emb|CDX83783.1| BnaC08g18620D [Brassica napus]
Length=266

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/266 (74%), Positives = 215/266 (81%), Gaps = 3/266 (1%)
 Frame = +3

Query  201  MALSIAST-ALPNIPLRQIHKQNWVSG-QAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MAL+IAS      + L     QN      ++     S R   + AGKEVSSVCEPL PDR
Sbjct  1    MALAIASALTSTTLALSTSRVQNARGAFSSRVGGRTSERLVVVRAGKEVSSVCEPLTPDR  60

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            P+WFPG+SPPEWLDGSLPGDFGFDPLGLGSDPE L+WFAQAEL+H RWAMLAV GILIPE
Sbjct  61   PMWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPETLRWFAQAELIHSRWAMLAVTGILIPE  120

Query  555  WLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVP  734
             LE LGFI+NYSWYDAG+REYFAD TTLFVVQ+ LMGWAEGRRWAD IKPG VD+EP  P
Sbjct  121  CLERLGFIENYSWYDAGSREYFADSTTLFVVQLVLMGWAEGRRWADFIKPGSVDIEPQYP  180

Query  735  HKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT-K  911
            HK  PK DVGYPGGLWFDP MWGRGSP+PVMV+RTKEIKNGRLAMLAF+GFCFQA Y+  
Sbjct  181  HKVNPKPDVGYPGGLWFDPMMWGRGSPDPVMVMRTKEIKNGRLAMLAFVGFCFQANYSAS  240

Query  912  QGPIENLMFHLADPGHNNIFSAFTSH  989
            Q PIENLM HLADPGH N+FSAFTS 
Sbjct  241  QDPIENLMAHLADPGHCNVFSAFTSQ  266



>ref|NP_001289223.1| chlorophyll a-b binding protein, chloroplastic [Pyrus x bretschneideri]
 gb|AHM26634.1| a-b binding protein [Pyrus x bretschneideri]
Length=266

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 212/242 (88%), Gaps = 3/242 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRT--WRLNAGKE-VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF  443
            SG+  T  +L   T   RL+A K  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF
Sbjct  24   SGKVVTTCLLGRTTAATRLHATKGGVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF  83

Query  444  DPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFA  623
            DPLGLGSDPELLKW AQAELMHGRWAMLAVAGILIPEWLE LGFI+N+SW++AG REYFA
Sbjct  84   DPLGLGSDPELLKWNAQAELMHGRWAMLAVAGILIPEWLERLGFIENFSWFEAGEREYFA  143

Query  624  DPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWG  803
            DPTTLFVVQ+ALMGW EGRRWADII PG VD+EP  P+KK PK DVGYPGGLWFDP MWG
Sbjct  144  DPTTLFVVQLALMGWVEGRRWADIINPGSVDIEPKFPNKKNPKPDVGYPGGLWFDPMMWG  203

Query  804  RGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            RGSPEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT + PI+NLM H+ADPGH N+FSAFT
Sbjct  204  RGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQALYTGKDPIDNLMAHIADPGHCNVFSAFT  263

Query  984  SH  989
            S 
Sbjct  264  SQ  265



>ref|XP_008389009.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Malus 
domestica]
Length=267

 Score =   396 bits (1017),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 212/242 (88%), Gaps = 3/242 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRT--WRLNAGKE-VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF  443
            SG+  T  +L   T   RL+A K  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF
Sbjct  25   SGKVVTTCLLGRTTAATRLHATKGGVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF  84

Query  444  DPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFA  623
            DPLGLGSDPELLKW AQAELMHGRWAMLAVAGILIPEWLE LGFI+N+SW++AG REYFA
Sbjct  85   DPLGLGSDPELLKWNAQAELMHGRWAMLAVAGILIPEWLERLGFIENFSWFEAGEREYFA  144

Query  624  DPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWG  803
            DPTTLFVVQ+ALMGW EGRRWADII PG VD+EP  P+KK PK DVGYPGGLWFDP MWG
Sbjct  145  DPTTLFVVQLALMGWVEGRRWADIINPGSVDIEPKFPNKKNPKPDVGYPGGLWFDPMMWG  204

Query  804  RGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            RGSPEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT + PI+NLM H+ADPGH N+FSAFT
Sbjct  205  RGSPEPVMVLRTKEIKNGRLAMLAFVGFLFQALYTGKDPIDNLMAHIADPGHCNVFSAFT  264

Query  984  SH  989
            S 
Sbjct  265  SQ  266



>ref|XP_009110297.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brassica 
rapa]
Length=266

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/268 (74%), Positives = 219/268 (82%), Gaps = 7/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWR----LNAGKEVSSVCEPLPP  368
            MAL+IAS AL +  L  +      +G+      +  RT +    + AGKEVSSVCEPLPP
Sbjct  1    MALAIAS-ALTSTTL-ALSTSRVENGRGAFSSRVDGRTSQRLVVVRAGKEVSSVCEPLPP  58

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRP+WFPG+SPPEWLDGSLPGDFGFDPLGLGSDPE L+WFAQAEL+H RWAMLAV GILI
Sbjct  59   DRPMWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPETLRWFAQAELIHSRWAMLAVTGILI  118

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE LE LGFI+NYSWYDAG+REYFAD TTLFVVQ+ LMGWAEGRRWAD IKPG VD+EP 
Sbjct  119  PECLERLGFIENYSWYDAGSREYFADSTTLFVVQLVLMGWAEGRRWADFIKPGSVDIEPQ  178

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
             PHK  PK DVGYPGGLWFD  MWGRGSP+PVMV+RTKEIKNGRLAMLAF+GFCFQA Y+
Sbjct  179  YPHKVNPKPDVGYPGGLWFDAMMWGRGSPDPVMVMRTKEIKNGRLAMLAFVGFCFQANYS  238

Query  909  -KQGPIENLMFHLADPGHNNIFSAFTSH  989
              Q PIENLM HLADPGH N+FSAFTS 
Sbjct  239  ASQDPIENLMAHLADPGHCNVFSAFTSQ  266



>ref|XP_004144043.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66318.1| hypothetical protein Csa_1G597160 [Cucumis sativus]
Length=267

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/264 (73%), Positives = 214/264 (81%), Gaps = 2/264 (1%)
 Frame = +3

Query  201  MALSIASTA--LPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MALSI+STA  L + P+R  + ++   G      +    +    A   VSSVCEPLPPDR
Sbjct  1    MALSISSTATALSSFPIRDSYHRSNFPGNFPNHKLRRDYSDLKAAKSGVSSVCEPLPPDR  60

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGIL+PE
Sbjct  61   PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILLPE  120

Query  555  WLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVP  734
            W E LG I N+SWYDAG+REYFADPTTL V Q+ALMGW EGRRWAD++ PG VDV+  +P
Sbjct  121  WFESLGLIQNFSWYDAGSREYFADPTTLLVAQLALMGWVEGRRWADLVNPGSVDVDLKLP  180

Query  735  HKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQ  914
            HKKK K DVGYPGG WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+G  FQAIYT Q
Sbjct  181  HKKKAKADVGYPGGFWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGLWFQAIYTGQ  240

Query  915  GPIENLMFHLADPGHNNIFSAFTS  986
            GP+ENL  H+ADPGH NIFSAF+S
Sbjct  241  GPLENLAAHVADPGHCNIFSAFSS  264



>ref|XP_006306445.1| hypothetical protein CARUB_v10012387mg [Capsella rubella]
 gb|EOA39343.1| hypothetical protein CARUB_v10012387mg [Capsella rubella]
Length=273

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 199/274 (73%), Positives = 216/274 (79%), Gaps = 12/274 (4%)
 Frame = +3

Query  201  MALSIASTALP----------NIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSV  350
            MAL+IAS               IP  +  +  W + +    I  S R   + AGKEVSSV
Sbjct  1    MALAIASALTSTLTLSTTSRVEIPTERRRQAPWCASRDGGRIN-SDRAVVVRAGKEVSSV  59

Query  351  CEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLA  530
            CEPLPPDRPLWFPGS PPEWLDGSLPGDFGFDPLGLGSDP+ LKWFAQAEL+H RWAMLA
Sbjct  60   CEPLPPDRPLWFPGSYPPEWLDGSLPGDFGFDPLGLGSDPDTLKWFAQAELIHSRWAMLA  119

Query  531  VAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGC  710
            V GILIPE LE LGFI+N+SWYDAG+REYFAD TTLFV Q+ LMGW EGRRWAD+IKPG 
Sbjct  120  VTGILIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQLVLMGWVEGRRWADLIKPGS  179

Query  711  VDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFC  890
            VD+EP  PHK  PK DVGYPGGLWFD  MWGRGSPEPVMVLRTKEIKNGRLAMLAF+GFC
Sbjct  180  VDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFC  239

Query  891  FQAIYT-KQGPIENLMFHLADPGHNNIFSAFTSH  989
            FQA YT  Q PIENLM HLADPGH N+FSAFT+H
Sbjct  240  FQATYTSSQDPIENLMAHLADPGHCNVFSAFTTH  273



>gb|AAF82226.1|AC069143_2 Contains similarity to a chlorophyll a/b-binding protein type 
II from Arabidopsis thaliana gi|S46295 and contains a chlorophyll 
A-B binding proteins PF|00504 domain [Arabidopsis thaliana]
Length=267

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            ++  R   + AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDP+ 
Sbjct  40   LMRERLVVVRAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPDT  99

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            LKWFAQAEL+H RWAMLAV GI+IPE LE LGFI+N+SWYDAG+REYFAD TTLFV QM 
Sbjct  100  LKWFAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQMV  159

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
            LMGWAEGRRWAD+IKPG VD+EP  PHK  PK DVGYPGGLWFD  MWGRGSPEPVMVLR
Sbjct  160  LMGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLR  219

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            TKEIKNGRLAMLAFLGFCFQA YT Q PIENLM HLADPGH N+FS 
Sbjct  220  TKEIKNGRLAMLAFLGFCFQATYTSQDPIENLMAHLADPGHCNVFSV  266



>gb|AES65592.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=267

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/267 (72%), Positives = 217/267 (81%), Gaps = 6/267 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQI-----HKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I+ST+L + P R+I     H+    +    +       T R NA K VS VCEPLP
Sbjct  1    MALAISSTSLSSFPNREICQKVLHQGTTSTTSWLSSSRRRRLTIR-NAKKGVSDVCEPLP  59

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW AQAELMH RWAML V+GIL
Sbjct  60   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWLAQAELMHARWAMLGVSGIL  119

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE LE +G++ N+SWY+AG+ EYFADPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP
Sbjct  120  IPEILEKIGYVKNFSWYNAGSVEYFADPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEP  179

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             +P++  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA+Y
Sbjct  180  KLPNRPNPKPDVGYPGGLWFDPMQWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAVY  239

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTS  986
                PI+NLM HLADPGH NIFSAFTS
Sbjct  240  VGGSPIDNLMAHLADPGHVNIFSAFTS  266



>ref|XP_004161120.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
Length=267

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/264 (73%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = +3

Query  201  MALSIASTA--LPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MALSI+STA  L + P+R  + ++   G      +    +    A   VSSVCEPLPPDR
Sbjct  1    MALSISSTATALSSFPIRDSYHRSNFPGNFPNHKLRRDYSDLKAAKSGVSSVCEPLPPDR  60

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE LKWFAQAELMH RWAMLAVAGIL+PE
Sbjct  61   PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHARWAMLAVAGILLPE  120

Query  555  WLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVP  734
            W E LG I N+SWYDAG+REYFADPTTL V Q+ALMGW EGRRWAD++ PG VDV+  +P
Sbjct  121  WFESLGLIQNFSWYDAGSREYFADPTTLLVAQLALMGWVEGRRWADLVNPGSVDVDLKLP  180

Query  735  HKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQ  914
            HKKK   DVGYPGG WFDP MWGRGSPEPVMVLRTKEIKNGRLAMLAF+G  FQAIYT Q
Sbjct  181  HKKKAMADVGYPGGFWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGLWFQAIYTGQ  240

Query  915  GPIENLMFHLADPGHNNIFSAFTS  986
            GP+ENL  H+ADPGH NIFSAF+S
Sbjct  241  GPLENLAAHVADPGHCNIFSAFSS  264



>ref|XP_003595341.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=267

 Score =   390 bits (1002),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 192/267 (72%), Positives = 217/267 (81%), Gaps = 6/267 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQI-----HKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I+ST+L + P R+I     H+    +    +       T R NA K VS VCEPLP
Sbjct  1    MALAISSTSLSSFPNREICQKVLHQGTTSTTSWLSSSRRRRLTIR-NAKKGVSDVCEPLP  59

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPG+FGFDPLGLGSDPELLKW AQAELMH RWAML V+GIL
Sbjct  60   PDRPLWFPGSSPPEWLDGSLPGNFGFDPLGLGSDPELLKWLAQAELMHARWAMLGVSGIL  119

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE LE +G++ N+SWY+AG+ EYFADPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP
Sbjct  120  IPEILEKIGYVKNFSWYNAGSVEYFADPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEP  179

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             +P++  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA+Y
Sbjct  180  KLPNRPNPKPDVGYPGGLWFDPMQWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAVY  239

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTS  986
                PI+NLM HLADPGH NIFSAFTS
Sbjct  240  VGGSPIDNLMAHLADPGHVNIFSAFTS  266



>ref|XP_010049390.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Eucalyptus 
grandis]
 gb|KCW81941.1| hypothetical protein EUGRSUZ_C03307 [Eucalyptus grandis]
Length=261

 Score =   387 bits (995),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 200/262 (76%), Positives = 220/262 (84%), Gaps = 2/262 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            MAL+I S++L  +P R+   + W+ G+        +RT R  A K VSSVCEPLPPDRPL
Sbjct  1    MALAIVSSSLSTVPTRE-SPRKWLPGKVAASASSPART-RAKATKGVSSVCEPLPPDRPL  58

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH RWAML VAGILIPE L
Sbjct  59   WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLGVAGILIPEML  118

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              LGFI+NYSWY+AG REYFAD TTLFVVQ+ALMGW EGRRWAD+IKPG VD++  +P+K
Sbjct  119  GRLGFIENYSWYNAGTREYFADTTTLFVVQLALMGWVEGRRWADMIKPGSVDIDFKLPNK  178

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            KKPK DVGYPGG WFDP MWG GSPEPVMVLRTKEIKNGRLAMLAF+GF FQAIYT  GP
Sbjct  179  KKPKPDVGYPGGFWFDPMMWGMGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGDGP  238

Query  921  IENLMFHLADPGHNNIFSAFTS  986
            IENL+ H+ADPGH NIFSAFTS
Sbjct  239  IENLLNHIADPGHCNIFSAFTS  260



>gb|AFK45037.1| unknown [Medicago truncatula]
Length=267

 Score =   375 bits (962),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 186/265 (70%), Positives = 210/265 (79%), Gaps = 6/265 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQI-----HKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I+ST+L + P R+I     H+    +    +       T R NA K VS VCEPLP
Sbjct  1    MALAISSTSLSSFPNREICQKVLHQGTTSTTSWLSSSRRRRLTIR-NAKKGVSDVCEPLP  59

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW AQAELMH RWAML V+GIL
Sbjct  60   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWLAQAELMHARWAMLGVSGIL  119

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE LE +G++ N+SWY+AG+ EYFADPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP
Sbjct  120  IPEILEKIGYVKNFSWYNAGSVEYFADPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEP  179

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             +P++  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA+Y
Sbjct  180  KLPNRPNPKPDVGYPGGLWFDPMQWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAVY  239

Query  906  TKQGPIENLMFHLADPGHNNIFSAF  980
                PI+NLM HLADPG    F  F
Sbjct  240  VGGSPIDNLMAHLADPGSCQHFLGF  264



>gb|AAA57542.1| PSI type II chlorophyll a/b-binding protein [Arabidopsis thaliana]
Length=271

 Score =   373 bits (958),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            ++  R   + AGKEVSSVCEPLPPDRP     +    WLDGSLPGDFGFDP GLGSDP+ 
Sbjct  41   LMRERLVVVRAGKEVSSVCEPLPPDRPYGSLVALHLNWLDGSLPGDFGFDPFGLGSDPDT  100

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            LKWFAQAEL+H RWAMLAV GI+IPE LE LGFI+N+SWYDAG+REYFAD TTLFV QM 
Sbjct  101  LKWFAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQMV  160

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
            LMGWAEGRRWAD+IKPG VD+EP  PHK  PK D GYPGGLWFD  MWGRGSPEPVMVLR
Sbjct  161  LMGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDAGYPGGLWFDFMMWGRGSPEPVMVLR  220

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            TKEIKNGRLAMLAFLGFCFQA YT Q PIENLM HLADPGH N+FSAFTSH
Sbjct  221  TKEIKNGRLAMLAFLGFCFQATYTSQDPIENLMAHLADPGHCNVFSAFTSH  271



>ref|XP_004956926.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X3 [Setaria italica]
Length=272

 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 215/272 (79%), Gaps = 9/272 (3%)
 Frame = +3

Query  201  MALSIASTAL----PNIPLRQIHKQNWVSG---QAKTCIMLSSRTWR-LNAGKEVSSVCE  356
            MALS  S A     P   +R  H          Q  T +  + +T R +NA K VS+VCE
Sbjct  1    MALSAGSFAACSLQPRASVRACHAPRPAQPPPLQGPTAVSFTRKTGRRVNATKGVSAVCE  60

Query  357  PLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVA  536
            PL PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGS+PELL+WFAQAELMHGRWAMLA  
Sbjct  61   PLGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSEPELLRWFAQAELMHGRWAMLAAV  120

Query  537  GILIPEWLEGLGFID-NYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCV  713
            GILIP+ L   GFID  +SW+DAG+R+YFADP TLFV QMALMGWAEGRRWAD++ PGCV
Sbjct  121  GILIPDLLARWGFIDAGFSWFDAGSRDYFADPWTLFVSQMALMGWAEGRRWADLLNPGCV  180

Query  714  DVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCF  893
            D+EP  P++KKP  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGRLAMLAF+GF F
Sbjct  181  DIEPDFPNRKKPVPDVGYPGGLWFDWANWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWF  240

Query  894  QAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            QA+YT QGPI+NL+ HLADPGH N+FSAFTSH
Sbjct  241  QAVYTGQGPIDNLLAHLADPGHCNVFSAFTSH  272



>ref|XP_004956925.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Setaria italica]
Length=273

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 205/239 (86%), Gaps = 2/239 (1%)
 Frame = +3

Query  279  QAKTCIMLSSRTWR-LNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLG  455
            Q  T +  + +T R +NA K VS+VCEPL PDRPLWFPGS+PP WLDGSLPGDFGFDPLG
Sbjct  35   QGPTAVSFTRKTGRRVNATKGVSAVCEPLGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLG  94

Query  456  LGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPT  632
            LGS+PELL+WFAQAELMHGRWAMLA  GILIP+ L   GFID  +SW+DAG+R+YFADP 
Sbjct  95   LGSEPELLRWFAQAELMHGRWAMLAAVGILIPDLLARWGFIDAGFSWFDAGSRDYFADPW  154

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFV QMALMGWAEGRRWAD++ PGCVD+EP  P++KKP  DVGYPGGLWFD   WGRGS
Sbjct  155  TLFVSQMALMGWAEGRRWADLLNPGCVDIEPDFPNRKKPVPDVGYPGGLWFDWANWGRGS  214

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            PEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT QGPI+NL+ HLADPGH N+FSAFTSH
Sbjct  215  PEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNVFSAFTSH  273



>ref|XP_004956924.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Setaria italica]
Length=283

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 205/239 (86%), Gaps = 2/239 (1%)
 Frame = +3

Query  279  QAKTCIMLSSRT-WRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLG  455
            Q  T +  + +T  R+NA K VS+VCEPL PDRPLWFPGS+PP WLDGSLPGDFGFDPLG
Sbjct  45   QGPTAVSFTRKTGRRVNATKGVSAVCEPLGPDRPLWFPGSTPPPWLDGSLPGDFGFDPLG  104

Query  456  LGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPT  632
            LGS+PELL+WFAQAELMHGRWAMLA  GILIP+ L   GFID  +SW+DAG+R+YFADP 
Sbjct  105  LGSEPELLRWFAQAELMHGRWAMLAAVGILIPDLLARWGFIDAGFSWFDAGSRDYFADPW  164

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFV QMALMGWAEGRRWAD++ PGCVD+EP  P++KKP  DVGYPGGLWFD   WGRGS
Sbjct  165  TLFVSQMALMGWAEGRRWADLLNPGCVDIEPDFPNRKKPVPDVGYPGGLWFDWANWGRGS  224

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            PEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT QGPI+NL+ HLADPGH N+FSAFTSH
Sbjct  225  PEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNVFSAFTSH  283



>ref|NP_001063275.1| Os09g0439500 [Oryza sativa Japonica Group]
 dbj|BAD36085.1| putative chlorophyll a/b-binding protein type II [Oryza sativa 
Japonica Group]
 dbj|BAD36143.1| putative chlorophyll a/b-binding protein type II [Oryza sativa 
Japonica Group]
 dbj|BAF25189.1| Os09g0439500 [Oryza sativa Japonica Group]
 dbj|BAG90592.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score =   365 bits (938),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 199/239 (83%), Gaps = 2/239 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
            S  A    M   R      G  VS+VCEPL PDRPLWFPGSSPP WLDGSLPGDFGFDPL
Sbjct  28   SQNAAVARMAGHRAGATKGG--VSAVCEPLGPDRPLWFPGSSPPPWLDGSLPGDFGFDPL  85

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GLGSDPELL+WFAQAELMH RWAMLAVAGIL+PE LE  GF+++YSW DAGAR+YFADP 
Sbjct  86   GLGSDPELLRWFAQAELMHSRWAMLAVAGILVPEVLEKWGFMEDYSWIDAGARDYFADPW  145

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFV QMALMGWAEGRRWAD + PGCV VEP +P+++ P  DVGYPGGLWFD   WGRGS
Sbjct  146  TLFVSQMALMGWAEGRRWADYLNPGCVAVEPRLPNRRNPVPDVGYPGGLWFDWGNWGRGS  205

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            PEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT +GPI+NL+ HLADPGH N+FSAFTSH
Sbjct  206  PEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGEGPIDNLLHHLADPGHCNVFSAFTSH  264



>ref|XP_008667517.1| PREDICTED: uncharacterized protein LOC100273427 isoform X1 [Zea 
mays]
 tpg|DAA40154.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
 tpg|DAA40155.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
Length=271

 Score =   364 bits (935),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 198/226 (88%), Gaps = 2/226 (1%)
 Frame = +3

Query  318  RLNAGKE-VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQ  494
            R NA K  VS+VCEPL PDRP+WFPGSSPP WLDGSLPGDFGFDPLGLGS+PELL+WFAQ
Sbjct  46   RANATKGGVSTVCEPLGPDRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRWFAQ  105

Query  495  AELMHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPTTLFVVQMALMGWA  671
            AELMHGRWAMLA AGIL+P+ L   GFID  +SW+DAG+REYFADP TLFV QMALMGWA
Sbjct  106  AELMHGRWAMLAAAGILVPDLLARWGFIDAGFSWFDAGSREYFADPWTLFVSQMALMGWA  165

Query  672  EGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIK  851
            EGRRWAD ++PGCVD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIK
Sbjct  166  EGRRWADYLRPGCVDIEPRFPNRKNPVPDVGYPGGLWFDWANWGRGSPEPVMVLRTKEIK  225

Query  852  NGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            NGRLAMLAF+GF FQA+YT QGPI+NL+ HLADPGH NIFSAFTSH
Sbjct  226  NGRLAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNIFSAFTSH  271



>gb|EEC84641.1| hypothetical protein OsI_31519 [Oryza sativa Indica Group]
Length=264

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/239 (75%), Positives = 198/239 (83%), Gaps = 2/239 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
            S  A    M   R      G  VS+VCEPL PDRPLWFPGSSPP WLDGSLPGDFGFDPL
Sbjct  28   SQNAAVARMAGHRAGATKGG--VSAVCEPLGPDRPLWFPGSSPPPWLDGSLPGDFGFDPL  85

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GLGSDPELL+WFAQAELMH RWAMLA AGIL+PE LE  GF+++YSW DAGAR+YFADP 
Sbjct  86   GLGSDPELLRWFAQAELMHSRWAMLAAAGILVPEVLEKWGFMEDYSWIDAGARDYFADPW  145

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFV QMALMGWAEGRRWAD + PGCV VEP +P+++ P  DVGYPGGLWFD   WGRGS
Sbjct  146  TLFVSQMALMGWAEGRRWADYLNPGCVAVEPRLPNRRNPVPDVGYPGGLWFDWGNWGRGS  205

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            PEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT +GPI+NL+ HLADPGH N+FSAFTSH
Sbjct  206  PEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGEGPIDNLLHHLADPGHCNVFSAFTSH  264



>tpg|DAA40157.1| TPA: hypothetical protein ZEAMMB73_160322 [Zea mays]
Length=232

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 198/226 (88%), Gaps = 2/226 (1%)
 Frame = +3

Query  318  RLNAGKE-VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQ  494
            R NA K  VS+VCEPL PDRP+WFPGSSPP WLDGSLPGDFGFDPLGLGS+PELL+WFAQ
Sbjct  7    RANATKGGVSTVCEPLGPDRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRWFAQ  66

Query  495  AELMHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPTTLFVVQMALMGWA  671
            AELMHGRWAMLA AGIL+P+ L   GFID  +SW+DAG+REYFADP TLFV QMALMGWA
Sbjct  67   AELMHGRWAMLAAAGILVPDLLARWGFIDAGFSWFDAGSREYFADPWTLFVSQMALMGWA  126

Query  672  EGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIK  851
            EGRRWAD ++PGCVD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIK
Sbjct  127  EGRRWADYLRPGCVDIEPRFPNRKNPVPDVGYPGGLWFDWANWGRGSPEPVMVLRTKEIK  186

Query  852  NGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            NGRLAMLAF+GF FQA+YT QGPI+NL+ HLADPGH NIFSAFTSH
Sbjct  187  NGRLAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNIFSAFTSH  232



>ref|NP_001141336.1| hypothetical protein [Zea mays]
 gb|ACF86112.1| unknown [Zea mays]
Length=271

 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 198/226 (88%), Gaps = 2/226 (1%)
 Frame = +3

Query  318  RLNAGKE-VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQ  494
            R NA K  VS+VCEPL PDRP+WFPGSSPP WLDGSLPGDFGFDPLGLGS+PELL+WFAQ
Sbjct  46   RANATKGGVSTVCEPLGPDRPIWFPGSSPPPWLDGSLPGDFGFDPLGLGSEPELLRWFAQ  105

Query  495  AELMHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPTTLFVVQMALMGWA  671
            AELMHGRWAMLA AGIL+P+ L   GFID  +SW+DAG+REYFADP TLFV QMALMGWA
Sbjct  106  AELMHGRWAMLAAAGILVPDLLARWGFIDAGFSWFDAGSREYFADPWTLFVSQMALMGWA  165

Query  672  EGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIK  851
            EGRRWAD ++PGCVD+EP  P+++ P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIK
Sbjct  166  EGRRWADYLRPGCVDIEPRFPNRRNPVPDVGYPGGLWFDWANWGRGSPEPVMVLRTKEIK  225

Query  852  NGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            NGRLAMLAF+GF FQA+YT QGPI+NL+ HLADPGH NIFSAFTSH
Sbjct  226  NGRLAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNIFSAFTSH  271



>ref|XP_010238211.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X1 [Brachypodium distachyon]
Length=279

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/270 (67%), Positives = 207/270 (77%), Gaps = 2/270 (1%)
 Frame = +3

Query  180  TSIHPSSMALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEP  359
             S+ PS   + +   A P  P  +   QN  +  A   +       R  A K VS+VCEP
Sbjct  12   CSLQPSLFPIELRIPASPLAP--KARPQNAAAAAACGVVPTRGCLHRAGAAKGVSAVCEP  69

Query  360  LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAG  539
            L PDRP+WFPG+SPP WLDGSLPGDFGFDPLGLGS+PE L+WFAQAELMH RWAMLAVAG
Sbjct  70   LGPDRPVWFPGTSPPPWLDGSLPGDFGFDPLGLGSEPETLRWFAQAELMHSRWAMLAVAG  129

Query  540  ILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDV  719
            ILIPE L+  GF++ +SWY AG REYFADP TLF+ QMALMGWAEGRRW D + PG VD+
Sbjct  130  ILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFIAQMALMGWAEGRRWMDYLNPGSVDI  189

Query  720  EPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA  899
            EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQA
Sbjct  190  EPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQA  249

Query  900  IYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            +YT QGP++NL+ HLADPGH NIFSAFTSH
Sbjct  250  VYTGQGPVDNLLAHLADPGHCNIFSAFTSH  279



>ref|XP_003576571.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X2 [Brachypodium distachyon]
Length=272

 Score =   359 bits (922),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = +3

Query  318  RLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQA  497
            R  A K VS+VCEPL PDRP+WFPG+SPP WLDGSLPGDFGFDPLGLGS+PE L+WFAQA
Sbjct  49   RAGAAKGVSAVCEPLGPDRPVWFPGTSPPPWLDGSLPGDFGFDPLGLGSEPETLRWFAQA  108

Query  498  ELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEG  677
            ELMH RWAMLAVAGILIPE L+  GF++ +SWY AG REYFADP TLF+ QMALMGWAEG
Sbjct  109  ELMHSRWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFIAQMALMGWAEG  168

Query  678  RRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG  857
            RRW D + PG VD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNG
Sbjct  169  RRWMDYLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNG  228

Query  858  RLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            RLAMLAF+GF FQA+YT QGP++NL+ HLADPGH NIFSAFTSH
Sbjct  229  RLAMLAFVGFWFQAVYTGQGPVDNLLAHLADPGHCNIFSAFTSH  272



>dbj|BAJ86784.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=273

 Score =   350 bits (898),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
              +S+VCEPL PDRP+WFPG++PP WLDGSLPGDFGFDPLG GS+PE L+WFAQAELMHG
Sbjct  55   SSLSTVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQAELMHG  114

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAMLAVAGILIPE L+  GF++ +SWY AG REYFADP TLFV QMALMGW EGRRW D
Sbjct  115  RWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFVTQMALMGWVEGRRWMD  174

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
             + PG VD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGRLAML
Sbjct  175  YLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAML  234

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            AF+GF FQ +YT QGP++NL  HLADPGH NIFSAFTSH
Sbjct  235  AFVGFWFQVVYTGQGPLDNLFAHLADPGHCNIFSAFTSH  273



>dbj|BAJ88556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   350 bits (897),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
              +S+VCEPL PDRP+WFPG++PP WLDGSLPGDFGFDPLG GS+PE L+WFAQAELMHG
Sbjct  52   SSLSTVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQAELMHG  111

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAMLAVAGILIPE L+  GF++ +SWY AG REYFADP TLFV QMALMGW EGRRW D
Sbjct  112  RWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFVTQMALMGWVEGRRWMD  171

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
             + PG VD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGRLAML
Sbjct  172  YLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAML  231

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            AF+GF FQ +YT QGP++NL  HLADPGH NIFSAFTSH
Sbjct  232  AFVGFWFQVVYTGQGPLDNLFAHLADPGHCNIFSAFTSH  270



>dbj|BAJ94030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=273

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
              +S+VCEPL PDRP+WFPG++PP WLDGSLPGDFGFDPLG GS+PE L+WFAQAELMHG
Sbjct  55   SSLSTVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQAELMHG  114

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAMLAVAGILIPE L+  GF++ +SWY AG REYFADP TLFV QMALMGW EGRRW D
Sbjct  115  RWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFVTQMALMGWVEGRRWMD  174

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
             + PG VD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGRLAML
Sbjct  175  YLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAML  234

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            AF+GF FQ +YT QGP+ NL  HLADPGH NIFSAFTSH
Sbjct  235  AFVGFWFQVVYTGQGPLGNLFAHLADPGHCNIFSAFTSH  273



>gb|AFK40780.1| unknown [Medicago truncatula]
Length=230

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 181/231 (78%), Gaps = 6/231 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQI-----HKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLP  365
            MAL+I+ST+L + P R+I     H+    +    +       T R NA K VS VCEPLP
Sbjct  1    MALAISSTSLSSFPNREICQKVLHQGTTSTTSWLSSSRRRRLTIR-NAKKGVSDVCEPLP  59

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKW AQAELMH RWAML V+GIL
Sbjct  60   PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWLAQAELMHARWAMLGVSGIL  119

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE LE +G++ N+SWY+AG+ EYFADPTTLF+VQ+ALMGW EGRRWADI+ PG VD+EP
Sbjct  120  IPEILEKIGYVKNFSWYNAGSVEYFADPTTLFIVQLALMGWVEGRRWADIVNPGSVDIEP  179

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF  878
             +P++  PK DVGYPGGLWFDP  WGRGSPEPVMVLRTK ++ G L  L F
Sbjct  180  KLPNRPNPKPDVGYPGGLWFDPMQWGRGSPEPVMVLRTKRLRMGDLLCLLF  230



>ref|XP_002299309.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
 gb|EEE84114.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
Length=272

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 190/272 (70%), Gaps = 13/272 (5%)
 Frame = +3

Query  201  MALSIASTALPNIPL---RQI--HKQNWVSGQAKTCIMLSSRTWRL------NAGKEVSS  347
            MA   AS+A+  + +   RQ+   K  ++ G  K    LS +  RL       A + V+ 
Sbjct  1    MASVCASSAIAAVSISSSRQVLSQKTGFLVGSTKAS-FLSGKKLRLKKYTAPTAARSVT-  58

Query  348  VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAML  527
            VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML
Sbjct  59   VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAML  118

Query  528  AVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPG  707
              AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWADI+KPG
Sbjct  119  GAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELFFIGWAEGRRWADILKPG  178

Query  708  CVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGF  887
            CV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G 
Sbjct  179  CVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGA  238

Query  888  CFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             FQ IYT  GPI+NL  HLADPGH  +FSAFT
Sbjct  239  WFQHIYTGTGPIDNLFAHLADPGHATVFSAFT  270



>sp|P13869.1|CB12_PETHY RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCI type II CAB; Flags: Precursor [Petunia x 
hybrida]
 gb|AAA33711.1| chlorophyll binding protein precursor [Petunia x hybrida]
 prf||1503272A chlorophyll binding protein
Length=270

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 185/269 (69%), Gaps = 9/269 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQ--IHKQNWVSGQAKTCIMLSSRTWRLN------AGKEVSSVCE  356
            MA + AS+ +  +        K   + G  K   +   R  R++        + V+    
Sbjct  1    MASACASSTIAAVAFSSPSSQKNGSIVGATKASFLGGKRL-RVSKFIAPVGSRSVAVSAV  59

Query  357  PLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVA  536
               PDRPLWFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE LKW AQAEL+H RWAML  A
Sbjct  60   AADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAA  119

Query  537  GILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVD  716
            GI IPE+L  +G ++  SWY AG +EYF D TTLFV+++ L+GWAEGRRWADIIKPGCV+
Sbjct  120  GIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVN  179

Query  717  VEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQ  896
             +P  P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ
Sbjct  180  TDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ  239

Query  897  AIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             IYT  GPI+NL  HLADPGH  IF+AF+
Sbjct  240  HIYTGTGPIDNLFAHLADPGHATIFAAFS  268



>ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Solanum tuberosum]
Length=270

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 185/268 (69%), Gaps = 7/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQ-IHKQNWVSGQAKTCIMLSSRTWRLN------AGKEVSSVCEP  359
            MA + AS+ +  +       ++N     A     L  R  R++      A +  ++VC  
Sbjct  1    MASACASSTIAAVAFSSPSSRRNGSIVGATKASFLGGRRLRVSKYSTTPAARSATTVCVA  60

Query  360  LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAG  539
              PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAE++H RWAML  AG
Sbjct  61   AEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAEIVHCRWAMLGAAG  120

Query  540  ILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDV  719
            I IPE L  +G ++  SWY AG +EYF D TTLF+V++ L+GWAEGRRWADIIKPGCV+ 
Sbjct  121  IFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNT  180

Query  720  EPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA  899
            +P  P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ 
Sbjct  181  DPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQH  240

Query  900  IYTKQGPIENLMFHLADPGHNNIFSAFT  983
            IYT  GPI+NL  HLADPGH  IF+AF+
Sbjct  241  IYTGTGPIDNLFAHLADPGHATIFAAFS  268



>ref|XP_003528751.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN01491.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=270

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 178/249 (71%), Gaps = 7/249 (3%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRLNA------GKEVSSVCEPLPPDRPLWFPGSSPPEWLD  416
             K   + G  K    LS R  ++N+       +  ++VC    PDRPLWFPGS+PP WLD
Sbjct  21   QKNGSLLGSTKAS-FLSGRKLKVNSFTAPVGARSSTTVCAVAEPDRPLWFPGSTPPPWLD  79

Query  417  GSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWY  596
            GSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY
Sbjct  80   GSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY  139

Query  597  DAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGG  776
             AG  EYF D TTLFVV++  +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGG
Sbjct  140  TAGELEYFTDTTTLFVVELFFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGG  199

Query  777  LWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            LWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPG
Sbjct  200  LWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG  259

Query  957  HNNIFSAFT  983
            H  IF+AFT
Sbjct  260  HATIFAAFT  268



>ref|XP_006484100.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Citrus sinensis]
 gb|KDO81900.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
Length=268

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 183/266 (69%), Gaps = 5/266 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIM----LSSRTWRLNAG-KEVSSVCEPLP  365
            MA   AS A+  I      K   V+G  K   +    L  R     AG + VS       
Sbjct  1    MASVCASPAVAAISSPSSQKSRSVAGATKASFLGGKKLKLRKNGATAGTRSVSVSAAAAD  60

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE L+W  Q+E++H RWAML  AGI 
Sbjct  61   PNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIF  120

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE L  LG ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  121  IPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  180

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  181  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIY  240

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL+ HLADPGH  +F+AFT
Sbjct  241  TGTGPIDNLIAHLADPGHATVFAAFT  266



>ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum 
indicum]
Length=271

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 168/219 (77%), Gaps = 0/219 (0%)
 Frame = +3

Query  327  AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELM  506
            +G    +VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE LKW  QAEL+
Sbjct  51   SGTRSVTVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLKWNQQAELV  110

Query  507  HGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRW  686
            H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF++++ L+GWAEGRRW
Sbjct  111  HCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIIELILIGWAEGRRW  170

Query  687  ADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLA  866
            ADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLA
Sbjct  171  ADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLA  230

Query  867  MLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            MLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AF+
Sbjct  231  MLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS  269



>ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao]
 gb|EOX99848.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao]
Length=271

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 180/243 (74%), Gaps = 5/243 (2%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLN-AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGD  434
            K +++SG+     + S+R +    AG    +VC    P+RPLWFPGS+PP WLDGSLPGD
Sbjct  31   KASFLSGKK----LRSARKYSAAPAGARPVAVCAAADPNRPLWFPGSTPPPWLDGSLPGD  86

Query  435  FGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGARE  614
            FGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  E
Sbjct  87   FGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEE  146

Query  615  YFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPF  794
            YF DPTTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP 
Sbjct  147  YFTDPTTLFIVELLFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPL  206

Query  795  MWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
             WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+
Sbjct  207  GWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFA  266

Query  975  AFT  983
            AFT
Sbjct  267  AFT  269



>gb|KHG11922.1| Chlorophyll a-b binding 7, chloroplastic [Gossypium arboreum]
Length=270

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 176/242 (73%), Gaps = 4/242 (2%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K +++SG+     + S R +   A      VC    PDRPLWFPGS+PP WLDGSLPGDF
Sbjct  31   KASFLSGKK----LRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDF  86

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREY  617
            GFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EY
Sbjct  87   GFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEY  146

Query  618  FADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFM  797
            F D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  
Sbjct  147  FTDTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLG  206

Query  798  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+A
Sbjct  207  WGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAA  266

Query  978  FT  983
            FT
Sbjct  267  FT  268



>emb|CDP13340.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 177/242 (73%), Gaps = 7/242 (3%)
 Frame = +3

Query  282  AKTCIMLSSRTWRLN------AGKEVSSVCEPLPP-DRPLWFPGSSPPEWLDGSLPGDFG  440
            A     LS R  R++      AG    ++C      +RP+WFPGS+PP WLDGSLPGDFG
Sbjct  45   ATKASFLSGRKLRVSQYTSPPAGARSLTICAAAADLERPIWFPGSTPPPWLDGSLPGDFG  104

Query  441  FDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYF  620
            FDPLGLGSDPE L+W  Q+E++H RWAML  AGI IPE+L  +G ++  SWY AG  EYF
Sbjct  105  FDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGELEYF  164

Query  621  ADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMW  800
             D TTLFVV+M L+GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  W
Sbjct  165  TDTTTLFVVEMILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGW  224

Query  801  GRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            G GSPE V  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGHNN+F+AF
Sbjct  225  GTGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHNNVFAAF  284

Query  981  TS  986
            T+
Sbjct  285  TN  286



>ref|XP_006438030.1| hypothetical protein CICLE_v10031886mg [Citrus clementina]
 gb|ESR51270.1| hypothetical protein CICLE_v10031886mg [Citrus clementina]
Length=367

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 183/266 (69%), Gaps = 5/266 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIM----LSSRTWRLNAG-KEVSSVCEPLP  365
            MA   AS A+  I      K   V+G  K   +    L  R     AG + VS       
Sbjct  100  MASVCASPAVAAISSPSSQKSRSVAGATKASFLGGKKLKLRKNGATAGTRSVSVSAAAAD  159

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE L+W  Q+E++H RWAML  AGI 
Sbjct  160  PNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIF  219

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE L  LG ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  220  IPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  279

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  280  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIY  339

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL+ HLADPGH  +F+AFT
Sbjct  340  TGTGPIDNLIAHLADPGHATVFAAFT  365



>ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Populus euphratica]
Length=269

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 178/249 (71%), Gaps = 8/249 (3%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRL------NAGKEVSSVCEPLPPDRPLWFPGSSPPEWLD  416
             K  ++ G  K    LS +  RL       A + V+ VC    PDRPLWFPGS+PP WLD
Sbjct  21   QKTGFLVGSTKAS-FLSGKKLRLKRYTTPTAARSVT-VCVAADPDRPLWFPGSTPPPWLD  78

Query  417  GSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWY  596
            GSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY
Sbjct  79   GSLPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY  138

Query  597  DAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGG  776
             AG  EYF D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGG
Sbjct  139  TAGELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGG  198

Query  777  LWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            LWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPG
Sbjct  199  LWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG  258

Query  957  HNNIFSAFT  983
            H  IFSAFT
Sbjct  259  HATIFSAFT  267



>ref|XP_007139043.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
 gb|ESW11037.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
Length=270

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = +3

Query  297  MLSSRTWRLN------AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGL  458
             L  R  R+N       G+  ++VC    PDRPLWFPGS+PP WLDG+LPGDFGFDPLGL
Sbjct  34   FLGGRKLRVNKYTAAVGGRSSTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLGL  93

Query  459  GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTL  638
            GSDPE L+W  QAE++H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTL
Sbjct  94   GSDPESLRWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGEQEYFTDTTTL  153

Query  639  FVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPE  818
            F+V++  +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+
Sbjct  154  FIVELFFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPQ  213

Query  819  PVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HL+DPGH  IF+AFT
Sbjct  214  KIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLSDPGHATIFAAFT  268



>ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Populus 
euphratica]
Length=269

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 178/249 (71%), Gaps = 8/249 (3%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRL------NAGKEVSSVCEPLPPDRPLWFPGSSPPEWLD  416
             K  ++ G  K    LS +  RL       A + V+ VC    PDRPLWFPGS+PP WLD
Sbjct  21   QKTGFLVGSTKAS-FLSGKKLRLKRYTTPTAARSVT-VCVAADPDRPLWFPGSTPPPWLD  78

Query  417  GSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWY  596
            GSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY
Sbjct  79   GSLPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY  138

Query  597  DAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGG  776
             AG  EYF D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGG
Sbjct  139  TAGELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGG  198

Query  777  LWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            LWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPG
Sbjct  199  LWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG  258

Query  957  HNNIFSAFT  983
            H  IFSAFT
Sbjct  259  HATIFSAFT  267



>ref|XP_010044808.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Eucalyptus 
grandis]
 gb|KCW86917.1| hypothetical protein EUGRSUZ_B03494 [Eucalyptus grandis]
Length=264

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 182/248 (73%), Gaps = 3/248 (1%)
 Frame = +3

Query  240  PLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDG  419
            P  Q +  ++++G+    + +S  T    A   +++VC    PDRPLWFPGS+PP WLDG
Sbjct  18   PSGQKNGSSFLTGKR---LRVSKYTAPAAAAGRLATVCAVADPDRPLWFPGSTPPPWLDG  74

Query  420  SLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYD  599
            SLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY 
Sbjct  75   SLPGDFGFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  134

Query  600  AGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGL  779
            AG +EYF D TTLF++++  +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGL
Sbjct  135  AGEQEYFTDTTTLFIIELIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGL  194

Query  780  WFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGH  959
            WFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH
Sbjct  195  WFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGH  254

Query  960  NNIFSAFT  983
              +F+AFT
Sbjct  255  ATVFAAFT  262



>ref|XP_010100230.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB81985.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=283

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 180/242 (74%), Gaps = 2/242 (1%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K +++ G  K  + + + T  + + +  S+VC    P+RPLWFPGS+PP+WLDGSLPGDF
Sbjct  42   KGSFLGGSKK--LRVRNYTAPIRSSRSFSTVCAAADPNRPLWFPGSTPPDWLDGSLPGDF  99

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREY  617
            GFDPLGLGSDPE L+W  Q+E++H RWAML  AGI IPE+L  +G ++  SWY AG +EY
Sbjct  100  GFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEQEY  159

Query  618  FADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFM  797
            F D TTLF+V+M  +GWAEGRRWADI+KPG V+ +P  P+ K    DVGYPGGLWFDP  
Sbjct  160  FTDTTTLFIVEMIFIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLG  219

Query  798  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+A
Sbjct  220  WGSGSPEKIKELRTKEIKNGRLAMLAVIGAWFQHIYTGTGPIDNLFAHLADPGHATVFAA  279

Query  978  FT  983
            FT
Sbjct  280  FT  281



>ref|XP_004248339.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Solanum 
lycopersicum]
 sp|P10708.1|CB12_SOLLC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCI type II CAB-7; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA32197.1| chlorophyll a/b-binding protein [Solanum lycopersicum]
 gb|AAA34159.1| chlorophyll a/b-binding protein [Solanum lycopersicum]
 prf||1601518A chlorophyll a/b binding protein II
Length=270

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 183/269 (68%), Gaps = 9/269 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQ--IHKQNWVSGQAKTCIMLSSRTWRLN------AGKEVSSVCE  356
            MA + AS+ +  +        +   + G  K    L  R  R++        +  ++VC 
Sbjct  1    MASACASSTIAAVAFSSPSSRRNGSIVGTTKAS-FLGGRRLRVSKYSTTPTARSATTVCV  59

Query  357  PLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVA  536
               PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  A
Sbjct  60   AADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAA  119

Query  537  GILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVD  716
            GI IPE L  +G ++  SWY AG +EYF D TTLF+V++ L+GWAEGRRWADIIKPGCV+
Sbjct  120  GIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVN  179

Query  717  VEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQ  896
             +P  P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ
Sbjct  180  TDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ  239

Query  897  AIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             IYT  GPI+NL  HLADPGH  IF+AF+
Sbjct  240  HIYTGTGPIDNLFAHLADPGHATIFAAFS  268



>emb|CAA57492.1| Type II chlorophyll a/b binding protein from photosystem I [Pisum 
sativum]
Length=269

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 172/230 (75%), Gaps = 0/230 (0%)
 Frame = +3

Query  294  IMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE  473
            + ++S T   +  +  S+VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE
Sbjct  38   LKVNSSTASPSRVRSTSTVCTVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPE  97

Query  474  LLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQM  653
             L+W  QAEL+H RWAML  AGI IPE+L  LG ++  SWY AG +EYF D TTLF+V++
Sbjct  98   SLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVEL  157

Query  654  ALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVL  833
              +GWAEGRRWADI+ PGCV+ +P  P+ K    DVGYPGGLWFDP  WG  SP+ +  L
Sbjct  158  VFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKEL  217

Query  834  RTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            RTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  218  RTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  267



>ref|XP_003548018.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform 1 [Glycine max]
 gb|ACU23352.1| unknown [Glycine max]
Length=270

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 176/249 (71%), Gaps = 7/249 (3%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRLN------AGKEVSSVCEPLPPDRPLWFPGSSPPEWLD  416
             K   + G  K    LS R  ++N        +  ++VC    PDRPLWFPGS+PP WLD
Sbjct  21   QKNGSLLGSTKAS-FLSGRKLKVNNFTAPVGARSSTTVCAVAEPDRPLWFPGSTPPPWLD  79

Query  417  GSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWY  596
            GSLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY
Sbjct  80   GSLPGDFGFDPLGLASDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY  139

Query  597  DAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGG  776
             AG  EYF D TTLF+V++  +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGG
Sbjct  140  TAGELEYFTDTTTLFIVELFFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGG  199

Query  777  LWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            LWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPG
Sbjct  200  LWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG  259

Query  957  HNNIFSAFT  983
            H  IF+AFT
Sbjct  260  HATIFAAFT  268



>gb|ABK95601.1| unknown [Populus trichocarpa]
Length=269

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L  RT+         +VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L
Sbjct  40   LRLRTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETL  99

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            +W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  
Sbjct  100  RWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEVEYFTDTTTLFIVELFF  159

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRT  839
            +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRT
Sbjct  160  IGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRT  219

Query  840  KEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            KEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  220  KEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFT  267



>gb|ABK95596.1| unknown [Populus trichocarpa]
Length=269

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 178/249 (71%), Gaps = 8/249 (3%)
 Frame = +3

Query  255  HKQNWVSGQAKTCIMLSSRTWRL------NAGKEVSSVCEPLPPDRPLWFPGSSPPEWLD  416
             K  ++ G  K    LS +  RL       A + V+ VC    PDRPLWFPGS+PP WLD
Sbjct  21   QKTGFLVGSTKAS-FLSGKKLRLKKYTAPTAARSVT-VCVAADPDRPLWFPGSTPPPWLD  78

Query  417  GSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWY  596
            GSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY
Sbjct  79   GSLPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY  138

Query  597  DAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGG  776
             AG  EYF D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGG
Sbjct  139  TAGELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGG  198

Query  777  LWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            LWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPG
Sbjct  199  LWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG  258

Query  957  HNNIFSAFT  983
            H  +FSAFT
Sbjct  259  HATVFSAFT  267



>ref|XP_006848348.1| hypothetical protein AMTR_s00013p00180670 [Amborella trichopoda]
 gb|ERN09929.1| hypothetical protein AMTR_s00013p00180670 [Amborella trichopoda]
Length=264

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAM  524
            +V   +  +RPLWFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAM
Sbjct  50   TVSAAVASERPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLRWNQQAELVHCRWAM  109

Query  525  LAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKP  704
            L  AGI IPE+L  LG ++  SWY AG +EYF D TTLFVV++  +GWAEGRRWADIIKP
Sbjct  110  LGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFVVELIFIGWAEGRRWADIIKP  169

Query  705  GCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLG  884
            GCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G
Sbjct  170  GCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEQLKELRTKEIKNGRLAMLAVMG  229

Query  885  FCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
              FQA+YT  GPI+NL  HLADPGH  IFSAFT
Sbjct  230  AWFQAVYTGTGPIDNLFAHLADPGHATIFSAFT  262



>ref|XP_002303791.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
 gb|EEE78770.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
Length=269

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L  RT+         +VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L
Sbjct  40   LRLRTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETL  99

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            +W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  
Sbjct  100  RWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEVEYFTDTTTLFIVELFF  159

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRT  839
            +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRT
Sbjct  160  IGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRT  219

Query  840  KEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            KEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  220  KEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFT  267



>ref|XP_010917526.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Elaeis guineensis]
Length=266

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 170/230 (74%), Gaps = 0/230 (0%)
 Frame = +3

Query  294  IMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE  473
            I L  + W   A +   SV      +RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE
Sbjct  35   IKLRQKKWIAPAARRALSVSAEATTERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPE  94

Query  474  LLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQM  653
             L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  +YF D TTLFV+++
Sbjct  95   SLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELQYFTDTTTLFVIEL  154

Query  654  ALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVL  833
             L+GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGG WFDP  WG GSPE V  L
Sbjct  155  ILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGFWFDPLGWGSGSPEKVKEL  214

Query  834  RTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            RTKEIKNGRLAMLA +G  FQAIYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  215  RTKEIKNGRLAMLAVMGAWFQAIYTGTGPIDNLFAHLADPGHATIFAAFT  264



>ref|NP_001239987.1| uncharacterized protein LOC100794944 [Glycine max]
 gb|ACU18230.1| unknown [Glycine max]
Length=267

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/270 (58%), Positives = 185/270 (69%), Gaps = 14/270 (5%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTC--IMLSSRTWRLNAGKEV-------SSVC  353
            MA + AS+A+  + +         SGQ        LS R  R+   +         ++VC
Sbjct  1    MASACASSAITAVAISTPS-----SGQKNGSGGCFLSGRKLRVKKERAAIGGRSMGTTVC  55

Query  354  EPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAV  533
                PDRPLWFPGS+PP WLDG+LPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  
Sbjct  56   AVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGA  115

Query  534  AGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCV  713
            AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWADIIKPGCV
Sbjct  116  AGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTTLFIVELFFIGWAEGRRWADIIKPGCV  175

Query  714  DVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCF  893
            + +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA +G  F
Sbjct  176  NTDPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPQKIKDLRTKEIKNGRLAMLAVMGAWF  235

Query  894  QAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            Q IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  236  QHIYTATGPIDNLFAHLADPGHATIFAAFT  265



>ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Populus euphratica]
Length=269

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L  +T+         +VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L
Sbjct  40   LRLKTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETL  99

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            +W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  
Sbjct  100  RWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELIF  159

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRT  839
            +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRT
Sbjct  160  IGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRT  219

Query  840  KEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            KEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  220  KEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFT  267



>ref|XP_010669087.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=270

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 183/268 (68%), Gaps = 6/268 (2%)
 Frame = +3

Query  195  SSMALSIASTALPNIPLRQIHKQNWVSGQAKTCIM----LSSRTWRL-NAGKEVSSVCEP  359
            +S+  S ASTA+         K+  V G  K   +    L    ++   A K +S     
Sbjct  2    ASLCASSASTAV-CASSHSSQKKGSVLGATKASFLGGKKLRDTKYKAPTASKSLSVSAAA  60

Query  360  LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAG  539
              P+RP+WFPGS+PP WLDGSLPGDFGFDPLG GSDPE LKW  Q+EL+H RWAML  AG
Sbjct  61   AEPERPIWFPGSTPPPWLDGSLPGDFGFDPLGFGSDPETLKWMVQSELVHCRWAMLGAAG  120

Query  540  ILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDV  719
            I IPE+L  LG ++  SWY AG  EYF D TTLF+++M L+GWAEGRRWADI+KPGCV+ 
Sbjct  121  IFIPEFLTKLGILNTPSWYTAGELEYFTDTTTLFIIEMILIGWAEGRRWADILKPGCVNT  180

Query  720  EPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA  899
            +P  P+ K    DVGYPGGLWFDP  WG GSP+    LRTKEIKNGRLAMLA +G  FQ 
Sbjct  181  DPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPQKTKELRTKEIKNGRLAMLAVMGAWFQH  240

Query  900  IYTKQGPIENLMFHLADPGHNNIFSAFT  983
            IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  241  IYTGTGPIDNLFAHLADPGHATIFAAFT  268



>ref|XP_002514914.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47468.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=270

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 180/242 (74%), Gaps = 4/242 (2%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K +++SG+  T   +   T  + A + V+ VC    PDRPLWFPGS+PP WLDGSLPGDF
Sbjct  31   KASFLSGKRLT---VRKHTSPVVASRSVT-VCAVADPDRPLWFPGSTPPPWLDGSLPGDF  86

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREY  617
            GFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWYDAG  EY
Sbjct  87   GFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYDAGKLEY  146

Query  618  FADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFM  797
            F D TTLF++++  +GWAEGRRWADI+KPGCV+ +P  P+ +    DVGYPGGLWFDP  
Sbjct  147  FTDTTTLFIIELIFIGWAEGRRWADILKPGCVNTDPIFPNNRLTGTDVGYPGGLWFDPLG  206

Query  798  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+A
Sbjct  207  WGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAA  266

Query  978  FT  983
            F+
Sbjct  267  FS  268



>ref|XP_010655886.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Vitis 
vinifera]
 emb|CBI27656.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE LKW  Q+E++H RWAML  AGI 
Sbjct  64   PNRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLKWMVQSEIVHCRWAMLGAAGIF  123

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  124  IPEFLTKIGILNTPSWYTAGELEYFTDKTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  183

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA +G  FQAIY
Sbjct  184  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPDKIKELRTKEIKNGRLAMLAVMGAWFQAIY  243

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  244  TGTGPIDNLFAHLADPGHATIFAAFT  269



>ref|XP_010531194.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=269

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 185/268 (69%), Gaps = 8/268 (3%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRL--NAGKEVS-----SVCEP  359
            MA   AS+A+  +      K   + G  +    L  +  R+  NA  EV+     +V   
Sbjct  1    MASLCASSAITAVSSPSSQKSGSIVGTTRAG-FLGGKKLRVKKNAAAEVAAGRSATVAAA  59

Query  360  LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAG  539
            + PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AG
Sbjct  60   VDPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAG  119

Query  540  ILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDV  719
            I IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +GWAEGRRWADIIKPGCV+ 
Sbjct  120  IFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWADIIKPGCVNT  179

Query  720  EPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA  899
            +P  P+ K    DVGYPGGLWFDP  WG G P  +  LRTKEIKNGRLAMLA +G  FQ 
Sbjct  180  DPIFPNNKLTGTDVGYPGGLWFDPLGWGSGDPAKIKELRTKEIKNGRLAMLAVMGAWFQH  239

Query  900  IYTKQGPIENLMFHLADPGHNNIFSAFT  983
            IYT  GPI+NL  HLADPGH  IFSAFT
Sbjct  240  IYTGTGPIDNLFAHLADPGHATIFSAFT  267



>gb|KDP26804.1| hypothetical protein JCGZ_17962 [Jatropha curcas]
Length=270

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 179/242 (74%), Gaps = 4/242 (2%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K +++SG+    + L S T      + V+ VC    PDRPLWFPGS+PP WLDGSLPGDF
Sbjct  31   KASFLSGKK---LRLRSNTSSPVVSRSVT-VCAAADPDRPLWFPGSTPPPWLDGSLPGDF  86

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREY  617
            GFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWYDAG  EY
Sbjct  87   GFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYDAGKLEY  146

Query  618  FADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFM  797
            F D TTLF++++ L+GWAEGRRWADI+KPG V+ +P  P+ K    DVGYPGGLWFDP  
Sbjct  147  FTDTTTLFIIELILIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLG  206

Query  798  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+A
Sbjct  207  WGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAA  266

Query  978  FT  983
            F+
Sbjct  267  FS  268



>ref|XP_010531186.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=270

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 170/227 (75%), Gaps = 5/227 (2%)
 Frame = +3

Query  318  RLNAGKEVS-----SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLK  482
            + NA  EV+     +V   + PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+
Sbjct  42   KKNAAAEVAAGRSATVAAAVDPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLR  101

Query  483  WFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALM  662
            W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +
Sbjct  102  WNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFI  161

Query  663  GWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTK  842
            GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG G P  +  LRTK
Sbjct  162  GWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGDPAKIKELRTK  221

Query  843  EIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            EIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IFSAFT
Sbjct  222  EIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFSAFT  268



>ref|XP_009405484.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=311

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 167/223 (75%), Gaps = 0/223 (0%)
 Frame = +3

Query  315  WRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQ  494
            W     +   SV     P+RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  Q
Sbjct  87   WATKTARRAFSVSAAAVPERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQ  146

Query  495  AELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAE  674
            AE++H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLFV+++ L+GWAE
Sbjct  147  AEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGQLEYFTDTTTLFVIELILIGWAE  206

Query  675  GRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKN  854
            GRRWADIIKPGCV+ +P  P+ K    DVGYPGG WFDP  WG GSPE V  LRTKEIKN
Sbjct  207  GRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGFWFDPLGWGSGSPEKVKELRTKEIKN  266

Query  855  GRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            GRLAMLA +G  FQAIYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  267  GRLAMLAVMGAWFQAIYTGTGPIDNLFAHLADPGHATVFAAFT  309



>gb|ABY63668.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=262

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 172/242 (71%), Gaps = 0/242 (0%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            +    +  A+T  + + RT    A    S       PDRP+WFPGS PP WLDGSLPGDF
Sbjct  19   RNGLAAAGARTSFLGAGRTKLREAAARPSFAVSAAAPDRPIWFPGSVPPPWLDGSLPGDF  78

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREY  617
            GFDP GLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G +   SWY AG ++Y
Sbjct  79   GFDPFGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILSTPSWYTAGEQQY  138

Query  618  FADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFM  797
            F D TTLF++++ L+GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  
Sbjct  139  FTDTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLG  198

Query  798  WGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            WG GSPE +  LRTKEIKNGRLAMLA +G  FQA YT  GPI+NL  HLADPGH NIF A
Sbjct  199  WGSGSPEKLKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHANIFQA  258

Query  978  FT  983
            FT
Sbjct  259  FT  260



>ref|NP_001060090.1| Os07g0577600 [Oryza sativa Japonica Group]
 dbj|BAC83072.1| putative photosystem I antenna protein [Oryza sativa Japonica 
Group]
 dbj|BAF22004.1| Os07g0577600 [Oryza sativa Japonica Group]
 gb|EAZ04452.1| hypothetical protein OsI_26600 [Oryza sativa Indica Group]
 gb|EAZ40410.1| hypothetical protein OsJ_24861 [Oryza sativa Japonica Group]
 dbj|BAG96345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96438.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96478.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87660.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96569.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96828.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96864.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=263

 Score =   306 bits (783),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 185/261 (71%), Gaps = 3/261 (1%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPL  380
            ++ S ++TA+  +P       +++ G  ++  +L  +    +A    S       PDRP+
Sbjct  4    VSASSSTTAVAALP-GAARASSFLGGAGRSGRLLLRQAESSSA--RASFAVRAAAPDRPI  60

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            WFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L
Sbjct  61   WFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFL  120

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ++  SWY AG ++YF D TTLF++++ L+GWAEGRRWADIIKPGCV+ +P  P+ 
Sbjct  121  TKIGILNTPSWYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIFPNN  180

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQA YT  GP
Sbjct  181  KLTGTDVGYPGGLWFDPLGWGTGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGP  240

Query  921  IENLMFHLADPGHNNIFSAFT  983
            I+NL  HLADPGH  IF AFT
Sbjct  241  IDNLFAHLADPGHATIFQAFT  261



>gb|KDO81901.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
 gb|KDO81902.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
Length=265

 Score =   306 bits (783),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 180/263 (68%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIM----LSSRTWRLNAG-KEVSSVCEPLP  365
            MA   AS A+  I      K   V+G  K   +    L  R     AG + VS       
Sbjct  1    MASVCASPAVAAISSPSSQKSRSVAGATKASFLGGKKLKLRKNGATAGTRSVSVSAAAAD  60

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PPEWLDGSLPGDFGFDPLGLGSDPE L+W  Q+E++H RWAML  AGI 
Sbjct  61   PNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIF  120

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE L  LG ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  121  IPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  180

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  181  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIY  240

Query  906  TKQGPIENLMFHLADPGHNNIFS  974
            T  GPI+NL+ HLADPGH  +F+
Sbjct  241  TGTGPIDNLIAHLADPGHATVFA  263



>gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial [Erythranthe 
guttata]
Length=250

 Score =   305 bits (781),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAM  524
            +VC    PDRP+WFPGS+PPEWLDGSLPGDFGFDPLGLGSDP+ LKW AQAEL+H RWAM
Sbjct  36   AVCVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPDSLKWNAQAELVHCRWAM  95

Query  525  LAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKP  704
            L  AGI IPE+L  +G ++  SWY AG +EYF D TTLF+V++ L+GWAEGRRWADIIKP
Sbjct  96   LGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKP  155

Query  705  GCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLG  884
            G V+ +P  P+ K    DVGYPGGLWFDP  +G GSP  +  +RTKEIKNGRLAMLA +G
Sbjct  156  GSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGSGSPAKIKEIRTKEIKNGRLAMLAVMG  215

Query  885  FCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
              FQ IYT  GPI+NL  HLADPGH  IFSAF+
Sbjct  216  AWFQHIYTGTGPIDNLFAHLADPGHATIFSAFS  248



>gb|AGV54278.1| light-harvesting complex I protein Lhca2 [Phaseolus vulgaris]
Length=269

 Score =   306 bits (783),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 178/248 (72%), Gaps = 7/248 (3%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNA------GKEVSSVCEPLPPDRPLWFPGSSPPEWLDG  419
            K   + G AK    LS R  ++N+       +  ++VC    PDRPLWFPGS+PP WLDG
Sbjct  21   KNGSLLGTAKAS-FLSGRKLKVNSFTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDG  79

Query  420  SLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYD  599
            SLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY 
Sbjct  80   SLPGDFGFDPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYT  139

Query  600  AGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGL  779
            AG  EYF+D TTLFVV++  +GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGL
Sbjct  140  AGELEYFSDTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGL  199

Query  780  WFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGH  959
            WFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH
Sbjct  200  WFDPLGWGSGSPEKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGH  259

Query  960  NNIFSAFT  983
              IF+AFT
Sbjct  260  ATIFAAFT  267



>ref|XP_003637339.1| Chlorophyll a-b binding protein [Medicago truncatula]
 gb|KEH18534.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=268

 Score =   306 bits (783),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            +  ++VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE LKW  QAEL+H 
Sbjct  50   RSTTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPESLKWNVQAELVHC  109

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +GWAEGRRWAD
Sbjct  110  RWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWAD  169

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            I+ PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAML
Sbjct  170  ILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPQKLKELRTKEIKNGRLAML  229

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            A +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  230  AVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  266



>gb|AFK35880.1| unknown [Medicago truncatula]
Length=268

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            +  ++VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE LKW  QAEL+H 
Sbjct  50   RSTTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPESLKWNVQAELVHC  109

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +GWAEGRRWAD
Sbjct  110  RWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWAD  169

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            I+ PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAML
Sbjct  170  ILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPQKLKELRTKEIKNGRLAML  229

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            A +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  230  AVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  266



>ref|XP_010905185.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Elaeis guineensis]
Length=266

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 167/228 (73%), Gaps = 0/228 (0%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L  + W     +   SV      +RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L
Sbjct  37   LRQKKWTAPTARRALSVSAEAISERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESL  96

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            +W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLFV+++  
Sbjct  97   RWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFVIELIF  156

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRT  839
            +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGG WFDP  WG GSPE V  LRT
Sbjct  157  IGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGFWFDPLGWGSGSPEKVKELRT  216

Query  840  KEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            KEIKNGRLAMLA +G  FQAIYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  217  KEIKNGRLAMLAVMGAWFQAIYTGTGPIDNLFAHLADPGHATIFAAFT  264



>gb|AGV54335.1| chlorophyll A/B binding protein 7 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=269

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 177/248 (71%), Gaps = 7/248 (3%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNA------GKEVSSVCEPLPPDRPLWFPGSSPPEWLDG  419
            K   + G AK    LS R  ++N+       +  ++VC    PDRPLWFPGS+PP WLDG
Sbjct  21   KNGSLLGTAKAS-FLSGRKLKVNSFTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDG  79

Query  420  SLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYD  599
            SLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY 
Sbjct  80   SLPGDFGFDPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYT  139

Query  600  AGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGL  779
            AG  EYF D TTLFVV++  +GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGL
Sbjct  140  AGELEYFTDTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGL  199

Query  780  WFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGH  959
            WFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH
Sbjct  200  WFDPLGWGSGSPEKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGH  259

Query  960  NNIFSAFT  983
              IF+AFT
Sbjct  260  ATIFAAFT  267



>gb|AFK45885.1| unknown [Lotus japonicus]
Length=269

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 173/238 (73%), Gaps = 6/238 (3%)
 Frame = +3

Query  288  TCIMLSSRTWRLNA------GKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDP  449
            T   LS R  ++N        +  ++VC    PDRPLWFPGS+PP WLDGSLPGDFGFDP
Sbjct  30   TKAFLSGRKLKVNTFTAPVGARSTTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGDFGFDP  89

Query  450  LGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADP  629
            LGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D 
Sbjct  90   LGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDT  149

Query  630  TTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRG  809
            TTLF+V++  +GWAEGRRWADI+KPG V+ +P  P+ K    DVGYPGGLWFDP  WG G
Sbjct  150  TTLFIVELIFIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSG  209

Query  810  SPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            SP+ +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  210  SPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFT  267



>gb|KHN15861.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=249

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            +  ++VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE L+W  QAEL+H 
Sbjct  31   RSSTTVCAVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNVQAELVHC  90

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWAD
Sbjct  91   RWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELFFIGWAEGRRWAD  150

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            IIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAML
Sbjct  151  IIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAML  210

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            A +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  211  AVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  247



>ref|XP_008805305.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Phoenix dactylifera]
Length=267

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 168/229 (73%), Gaps = 0/229 (0%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            +   + W     +   SV      +RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE 
Sbjct  37   LRQKKCWIAPTARRALSVSAEATTERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPES  96

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLFV+++ 
Sbjct  97   LRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFVIELI  156

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
             +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE V  LR
Sbjct  157  FIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELR  216

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            TKEIKNGRLAMLA +G  FQAIYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  217  TKEIKNGRLAMLAVMGAWFQAIYTGTGPIDNLFAHLADPGHATIFAAFT  265



>ref|XP_009587026.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
tomentosiformis]
Length=269

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 166/218 (76%), Gaps = 0/218 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            + V+       PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE LKW  QAEL+H 
Sbjct  52   RSVAVSAVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLKWNQQAELVHC  111

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTLFV+++ L+GWAEGRRWAD
Sbjct  112  RWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWAD  171

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            IIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAML
Sbjct  172  IIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAML  231

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTS  986
            A +G  FQ IYT  GPI+NL  HLADPGH  IF+AF S
Sbjct  232  AVMGAWFQHIYTGIGPIDNLFAHLADPGHATIFAAFQS  269



>ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009773771.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
Length=270

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE LKW  QAEL+H RWAML  AGI 
Sbjct  63   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLKWNQQAELVHCRWAMLGAAGIF  122

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFV+++ L+GWAEGRRWADIIKPGCV+ +P
Sbjct  123  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDP  182

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  183  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  242

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AF+
Sbjct  243  TGTGPIDNLFAHLADPGHATIFAAFS  268



>emb|CAN72005.1| hypothetical protein VITISV_033663 [Vitis vinifera]
Length=272

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE LKW  Q+E++H RWAML  AGI 
Sbjct  65   PNRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLKWMVQSEIVHCRWAMLGAAGIF  124

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  125  IPEFLTKIGILNTPSWYTAGELEYFTDKTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  184

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA +G  FQAIY
Sbjct  185  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPDKIKELRTKEIKNGRLAMLAVMGAWFQAIY  244

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  245  TGTGPIDNLFAHLADPGHATIFAAFT  270



>ref|XP_002984998.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ13873.1| light-harvesting complex [Selaginella moellendorffii]
Length=268

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAM  524
            SV      +RPLWFPGS+PP WLDGSLP DFGFDPLGLGS+PELLKWF Q+E++H RWAM
Sbjct  54   SVTAAAATERPLWFPGSTPPAWLDGSLPADFGFDPLGLGSEPELLKWFVQSEIVHSRWAM  113

Query  525  LAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKP  704
            L  AGI IPE L  LG ++   WY AG +EYF D TTLF+V+M L+GWAEGRRWADI+KP
Sbjct  114  LGAAGIFIPEALTKLGILNTPFWYTAGEQEYFTDQTTLFIVEMILLGWAEGRRWADILKP  173

Query  705  GCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLG  884
            G V+ +P  P+ K    DVGYPGG WFDPF WG  SPE +  LRTKEIKNGRLAMLA +G
Sbjct  174  GSVNTDPVFPNNKLTGTDVGYPGGFWFDPFGWGTASPEKLKELRTKEIKNGRLAMLAVMG  233

Query  885  FCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
              FQA+YT   PI+NL+ HLADPGH  IFSAFTS 
Sbjct  234  AWFQAVYTGARPIDNLLAHLADPGHATIFSAFTSQ  268



>ref|XP_002986188.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ12719.1| light-harvesting complex [Selaginella moellendorffii]
Length=268

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAM  524
            SV      +RPLWFPGS+PP WLDGSLP DFGFDPLGLGS+PELLKWF Q+E++H RWAM
Sbjct  54   SVTAAAATERPLWFPGSTPPAWLDGSLPADFGFDPLGLGSEPELLKWFVQSEIVHSRWAM  113

Query  525  LAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKP  704
            L  AGI IPE L  LG ++   WY AG +EYF D TTLF+V+M L+GWAEGRRWADI+KP
Sbjct  114  LGAAGIFIPEALTKLGILNTPFWYTAGEQEYFTDQTTLFIVEMILLGWAEGRRWADILKP  173

Query  705  GCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLG  884
            G V+ +P  P+ K    DVGYPGG WFDPF WG  SPE +  LRTKEIKNGRLAMLA +G
Sbjct  174  GSVNTDPVFPNNKLTGTDVGYPGGFWFDPFGWGTASPEKLKELRTKEIKNGRLAMLAVMG  233

Query  885  FCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
              FQA+YT   PI+NL+ HLADPGH  IFSAFTS 
Sbjct  234  AWFQAVYTGARPIDNLLAHLADPGHATIFSAFTSQ  268



>ref|XP_007139044.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
 gb|ESW11038.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
Length=267

 Score =   304 bits (778),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 171/232 (74%), Gaps = 6/232 (3%)
 Frame = +3

Query  297  MLSSRTWRLN------AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGL  458
             L  R  R+N       G+  ++VC    PDRPLWFPGS+PP WLDG+LPGDFGFDPLGL
Sbjct  34   FLGGRKLRVNKYTAAVGGRSSTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLGL  93

Query  459  GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTL  638
            GSDPE L+W  QAE++H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D TTL
Sbjct  94   GSDPESLRWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGEQEYFTDTTTL  153

Query  639  FVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPE  818
            F+V++  +GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+
Sbjct  154  FIVELFFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPQ  213

Query  819  PVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
             +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HL+DPGH  IF+
Sbjct  214  KIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLSDPGHATIFA  265



>ref|XP_008446036.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X2 [Cucumis melo]
Length=269

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 169/229 (74%), Gaps = 4/229 (2%)
 Frame = +3

Query  309  RTWRLNAGKEVSS----VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            R   LNA   V+     VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE 
Sbjct  39   RLRNLNAAAVVAPRSAPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPES  98

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++ 
Sbjct  99   LRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGELEYFTDTTTLFIVELI  158

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
             +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LR
Sbjct  159  FIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELR  218

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            TKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AFT
Sbjct  219  TKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFT  267



>ref|XP_006657881.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Oryza brachyantha]
Length=266

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 167/220 (76%), Gaps = 0/220 (0%)
 Frame = +3

Query  324  NAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAEL  503
            ++ +  S       PDRP+WFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL
Sbjct  45   SSARSASFAVRAAAPDRPIWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAEL  104

Query  504  MHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRR  683
            +H RWAML  AGI IPE+L  +G ++  SWY AG ++YF D TTLF++++ L+GWAEGRR
Sbjct  105  VHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQQYFTDTTTLFIIELILIGWAEGRR  164

Query  684  WADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRL  863
            WADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRL
Sbjct  165  WADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPEKIKELRTKEIKNGRL  224

Query  864  AMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            AMLA +G  FQA YT  GPI+NL  HLADPGH  IF AFT
Sbjct  225  AMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFT  264



>ref|XP_004510609.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=268

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 165/215 (77%), Gaps = 0/215 (0%)
 Frame = +3

Query  339  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRW  518
             ++ C    PDRP+WFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RW
Sbjct  52   ATTKCAVAEPDRPIWFPGSTPPAWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRW  111

Query  519  AMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADII  698
            AML  AGI IPE+L  +G ++  SWY AG +EYF D TTLF++++  +GWAEGRRWADII
Sbjct  112  AMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIIELLFIGWAEGRRWADII  171

Query  699  KPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF  878
             PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA 
Sbjct  172  NPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPKKLKELRTKEIKNGRLAMLAV  231

Query  879  LGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  232  MGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  266



>ref|XP_004135326.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004171576.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Cucumis sativus]
 gb|KGN51671.1| hypothetical protein Csa_5G589390 [Cucumis sativus]
Length=271

 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 176/241 (73%), Gaps = 1/241 (0%)
 Frame = +3

Query  261  QNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFG  440
             N+++G+      L++    + A + V  VC    PDRPLWFPGS+PP WLDGSLPGDFG
Sbjct  30   SNFLTGKKLRLRNLNAAATAVVAPRTVP-VCAAADPDRPLWFPGSTPPPWLDGSLPGDFG  88

Query  441  FDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYF  620
            FDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF
Sbjct  89   FDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYF  148

Query  621  ADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMW  800
             D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  W
Sbjct  149  TDTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGW  208

Query  801  GRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            G GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+AF
Sbjct  209  GSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAF  268

Query  981  T  983
            T
Sbjct  269  T  269



>ref|XP_009415903.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=269

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 164/213 (77%), Gaps = 0/213 (0%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAM  524
            SV     P+RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAE++H RWAM
Sbjct  55   SVSAAAAPERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAEIVHCRWAM  114

Query  525  LAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKP  704
            L  AGI IPE L  +G ++  SWY AG  +YF D TTLFV+++ L+GWAEGRRWADIIKP
Sbjct  115  LGAAGIFIPELLTKIGILNTPSWYTAGQLQYFTDTTTLFVIELILIGWAEGRRWADIIKP  174

Query  705  GCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLG  884
            GCV+ +P  P+ K    DVGYPGG WFDP  WG GSPE V  LRTKEIKNGRLAMLA +G
Sbjct  175  GCVNTDPIFPNNKLTGTDVGYPGGFWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMG  234

Query  885  FCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
              FQAIYT  GPI+NL  HLADPGH  +FSAFT
Sbjct  235  AWFQAIYTGTGPIDNLFAHLADPGHATVFSAFT  267



>emb|CAA41406.1| Type II chlorophyll a /b-binding protein [Pinus sylvestris]
Length=278

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 165/219 (75%), Gaps = 0/219 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            +   +V + +  +RPLWFPG++PP WLDGSLPGDFGFDPLGLGSDPE LKW  QAEL+H 
Sbjct  60   RAAVTVSQAVQTERPLWFPGNTPPPWLDGSLPGDFGFDPLGLGSDPETLKWMVQAELVHC  119

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE    LG ++  SWY AG  EYF D TTLFVV+M  +GWAEGRRWAD
Sbjct  120  RWAMLGAAGIFIPELCTKLGILNTPSWYTAGELEYFTDKTTLFVVEMIFLGWAEGRRWAD  179

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            I++PG V+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAML
Sbjct  180  ILEPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAML  239

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            A +G  FQA YT  GPI+NL+ HLADPGH  IF+AF+S 
Sbjct  240  AVMGAWFQAEYTGTGPIDNLLAHLADPGHATIFAAFSSK  278



>ref|XP_009104311.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brassica 
rapa]
Length=256

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 171/237 (72%), Gaps = 8/237 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEP--------LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L  +  RLN    V +V             PDRP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLGGKKLRLNKKLNVPAVSRSGTSVRAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDP+ LKW AQAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            P  +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  198  PAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  254



>gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic, partial [Genlisea 
aurea]
Length=259

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = +3

Query  351  CEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLA  530
            C    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  Q+EL+HGRWAML 
Sbjct  47   CVAADPDRPLWFPGSTPPAWLDGSLPGDFGFDPLGLASDPDSLKWNQQSELVHGRWAMLG  106

Query  531  VAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGC  710
             AGI IPE+L  +G ++  SWY AG +EYF D TTLF++++ L+GWAEGRRWADIIKPG 
Sbjct  107  AAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIIELILIGWAEGRRWADIIKPGS  166

Query  711  VDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFC  890
            V+ +P  P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  
Sbjct  167  VNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVIGAW  226

Query  891  FQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            FQ IYT  GPI+NL  HLADPGH  IF+AF+
Sbjct  227  FQHIYTGTGPIDNLFAHLADPGHATIFAAFS  257



>gb|ABK21282.1| unknown [Picea sitchensis]
 gb|ABK22450.1| unknown [Picea sitchensis]
 gb|ABK23211.1| unknown [Picea sitchensis]
 gb|ABK24121.1| unknown [Picea sitchensis]
 gb|ABK26112.1| unknown [Picea sitchensis]
 gb|ABK26188.1| unknown [Picea sitchensis]
 gb|ABK26376.1| unknown [Picea sitchensis]
 gb|ABR17439.1| unknown [Picea sitchensis]
 gb|ACN39904.1| unknown [Picea sitchensis]
 gb|ACN39960.1| unknown [Picea sitchensis]
 gb|ACN40062.1| unknown [Picea sitchensis]
 gb|ACN40101.1| unknown [Picea sitchensis]
 gb|ACN40463.1| unknown [Picea sitchensis]
Length=278

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = +3

Query  348  VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAML  527
            V E +  +RPLWFPG++PP WLDGSLP DFGFDPLGLGSDPE LKW  Q+EL+H RWAML
Sbjct  65   VSEAVQTERPLWFPGTTPPPWLDGSLPADFGFDPLGLGSDPETLKWNVQSELVHCRWAML  124

Query  528  AVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPG  707
              AGI IPE L  LG ++  SWY AG +EYF D TTLFVV+M  +GWAEGRRWADIIKPG
Sbjct  125  GAAGIFIPELLTKLGILNTPSWYTAGEQEYFTDKTTLFVVEMIFLGWAEGRRWADIIKPG  184

Query  708  CVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGF  887
             V+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G 
Sbjct  185  SVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGA  244

Query  888  CFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
             FQA YT  GPI+NL+ HLADPGH  +F+AF+S 
Sbjct  245  WFQAEYTGTGPIDNLLAHLADPGHATVFAAFSSK  278



>gb|KHN16392.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=452

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = +3

Query  342  SSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWA  521
            ++VC    PDRPLWFPGS+PP WLDG+LPGDFGFDPLGLGSDPE L+W  QAEL+H RWA
Sbjct  237  TTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWA  296

Query  522  MLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIK  701
            ML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWADIIK
Sbjct  297  MLGAAGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTTLFIVELFFIGWAEGRRWADIIK  356

Query  702  PGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFL  881
            PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA +
Sbjct  357  PGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPQKIKDLRTKEIKNGRLAMLAVM  416

Query  882  GFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  417  GAWFQHIYTATGPIDNLFAHLADPGHATIFAAFT  450



>dbj|BAJ34383.1| unnamed protein product [Thellungiella halophila]
Length=256

 Score =   300 bits (769),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW AQAEL+H RWAML  AGI 
Sbjct  49   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNAQAELVHCRWAMLGAAGIF  108

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  109  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  168

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  169  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIY  228

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  229  TGTGPIDNLFAHLADPGHATIFAAFT  254



>ref|XP_007222715.1| hypothetical protein PRUPE_ppa009903mg [Prunus persica]
 gb|EMJ23914.1| hypothetical protein PRUPE_ppa009903mg [Prunus persica]
Length=272

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ L+W  QAEL+H RWAML  AGI 
Sbjct  65   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLRWNQQAELVHCRWAMLGAAGIF  124

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  125  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDP  184

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  185  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIY  244

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  245  TGTGPIDNLFAHLADPGHATIFAAFT  270



>ref|XP_008801837.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Phoenix dactylifera]
Length=262

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHG  512
            +   SV      +RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H 
Sbjct  45   RRALSVSAEATSERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAELVHC  104

Query  513  RWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD  692
            RWAML  AGI IPE L  +G ++  SWY AG  EYF D TTLFV+++ L+GWAEGRRWAD
Sbjct  105  RWAMLGAAGIFIPELLTKIGILNTPSWYTAGELEYFTDTTTLFVIELILIGWAEGRRWAD  164

Query  693  IIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAML  872
            IIKPGCV+ +P  P+ K    DVGYPGG WFDP  WG GSPE V  LRTKEIKNGRLAML
Sbjct  165  IIKPGCVNTDPVFPNNKLTGTDVGYPGGFWFDPLGWGSGSPEKVKELRTKEIKNGRLAML  224

Query  873  AFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            A +G  FQAIYT  GPI+NL  HLADPGH  IF AFT
Sbjct  225  AVMGAWFQAIYTGTGPIDNLFAHLADPGHATIF-AFT  260



>emb|CAC81065.1| putative chlorophyll A-B binding protein of LHCI type II precursor 
[Picea abies]
Length=278

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  348  VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAML  527
            V E +  +RPLWFPG++PP WLDGSLP DFGFDPLGLGSDPE LKW  Q+EL+H RWAML
Sbjct  65   VSEAVQTERPLWFPGTTPPPWLDGSLPADFGFDPLGLGSDPETLKWNVQSELVHCRWAML  124

Query  528  AVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPG  707
              AGI IPE L  LG ++  SWY AG  EYF D TTLFVV+M  +GWAEGRRWADIIKPG
Sbjct  125  GAAGIFIPELLTKLGILNTPSWYTAGELEYFTDKTTLFVVEMIFLGWAEGRRWADIIKPG  184

Query  708  CVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGF  887
             V+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G 
Sbjct  185  SVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGA  244

Query  888  CFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
             FQA YT  GPI+NL+ HLADPGH  +F+AF+S 
Sbjct  245  WFQAEYTGTGPIDNLLAHLADPGHATVFAAFSSK  278



>ref|XP_007135346.1| hypothetical protein PHAVU_010G121400g, partial [Phaseolus vulgaris]
 gb|ESW07340.1| hypothetical protein PHAVU_010G121400g, partial [Phaseolus vulgaris]
Length=264

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 174/245 (71%), Gaps = 7/245 (3%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNA------GKEVSSVCEPLPPDRPLWFPGSSPPEWLDG  419
            K   + G AK    LS R  ++N+       +  ++VC    PDRPLWFPGS+PP WLDG
Sbjct  21   KNGSLLGTAKAS-FLSGRKLKVNSLTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDG  79

Query  420  SLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYD  599
            SLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY 
Sbjct  80   SLPGDFGFDPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYT  139

Query  600  AGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGL  779
            AG  EYF D TTLFVV++  +GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGL
Sbjct  140  AGELEYFTDTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGL  199

Query  780  WFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGH  959
            WFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH
Sbjct  200  WFDPLGWGSGSPEKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGH  259

Query  960  NNIFS  974
              IF+
Sbjct  260  ATIFA  264



>ref|NP_001147224.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACG26188.1| chlorophyll a-b binding protein [Zea mays]
 emb|CDY43936.1| BnaC04g21740D [Brassica napus]
Length=256

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 172/237 (73%), Gaps = 8/237 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLP--------PDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L+ +  RLN    V +V +           P+RP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLAGKKLRLNKKLSVPAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDPE LKW  QAE++H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPESLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            P  +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  198  PAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  254



>ref|XP_002876615.1| Lhca2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52874.1| Lhca2 protein [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  50   PDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIF  109

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  110  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  169

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  170  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  229

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  230  TGTGPIDNLFAHLADPGHATIFAAFT  255



>ref|XP_009138769.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Brassica rapa]
 emb|CDX89120.1| BnaA04g00660D [Brassica napus]
Length=256

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 172/237 (73%), Gaps = 8/237 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPL--------PPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L  +  RLN    V++V +           P+RP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLCGKKLRLNKKLSVAAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDP+ LKW  QAE++H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPDSLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            P  +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  198  PAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  254



>ref|XP_009372280.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Pyrus 
x bretschneideri]
Length=271

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  64   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIF  123

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  124  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDP  183

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  184  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  243

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF++F+
Sbjct  244  TGTGPIDNLFAHLADPGHATIFASFS  269



>ref|XP_008340223.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Malus 
domestica]
Length=271

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  64   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIF  123

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  124  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDP  183

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  184  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  243

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF++F+
Sbjct  244  TGTGPIDNLFAHLADPGHATIFASFS  269



>gb|AHM26638.1| a-b binding protein [Pyrus x bretschneideri]
Length=271

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  64   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIF  123

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  124  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDP  183

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  184  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  243

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF++F+
Sbjct  244  TGTGPIDNLFAHLADPGHATIFASFS  269



>emb|CAB71077.1| Lhca2 protein [Arabidopsis thaliana]
Length=257

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAE++H RWAML  AGI 
Sbjct  50   PDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAEIVHCRWAMLGAAGIF  109

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  110  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  169

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  170  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  229

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  230  TGTGPIDNLFAHLADPGHATIFAAFT  255



>ref|NP_191706.2| photosystem I light harvesting complex protein [Arabidopsis thaliana]
 gb|AAD28767.1|AF134120_1 Lhca2 protein [Arabidopsis thaliana]
 gb|AAK96861.1| Lhca2 protein [Arabidopsis thaliana]
 gb|AAL38870.1| putative Lhca2 protein [Arabidopsis thaliana]
 gb|AAL66898.1| Lhca2 protein [Arabidopsis thaliana]
 gb|AAN72081.1| Lhca2 protein [Arabidopsis thaliana]
 gb|AEE80209.1| photosystem I light harvesting complex protein [Arabidopsis thaliana]
Length=257

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAE++H RWAML  AGI 
Sbjct  50   PDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAEIVHCRWAMLGAAGIF  109

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  110  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  169

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  170  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  229

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  230  TGTGPIDNLFAHLADPGHATIFAAFT  255



>ref|XP_008389866.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Malus domestica]
Length=336

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  129  PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIF  188

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  189  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDP  248

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  249  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  308

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF++F+
Sbjct  309  TGTGPIDNLFAHLADPGHATIFASFS  334



>emb|CCI55397.1| PSI antenna protein Lhca2 [Marchantia polymorpha]
Length=267

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 165/224 (74%), Gaps = 0/224 (0%)
 Frame = +3

Query  309  RTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWF  488
            R+ +++A  + S        +RPLWFPGS+ PEWLDGSLPGDFGFDPLGLGS+PELLKWF
Sbjct  40   RSAKVSAVSKASFSVRAQATERPLWFPGSTAPEWLDGSLPGDFGFDPLGLGSEPELLKWF  99

Query  489  AQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGW  668
             QAE++H RWAML  AGI IPE L  +G ++  SWY AG + YFAD TTLF+V++  MGW
Sbjct  100  VQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQTYFADQTTLFIVELLFMGW  159

Query  669  AEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEI  848
            AEGRRWADI+KPG V+ +P  P+ K    DVGYPGG WFDP  WG G    V  LRTKEI
Sbjct  160  AEGRRWADILKPGSVNTDPVFPNNKLTGTDVGYPGGFWFDPLGWGAGGAAKVKELRTKEI  219

Query  849  KNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            KNGRLAMLA +G  FQA+YT  GPI+NL  HLADPGH  +F+A 
Sbjct  220  KNGRLAMLAVMGAWFQAVYTGTGPIDNLFAHLADPGHATVFAAL  263



>ref|XP_010469082.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Camelina 
sativa]
Length=255

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  48   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIF  107

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  108  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  167

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  168  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  227

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  228  TGTGPIDNLFAHLADPGHATIFAAFT  253



>ref|XP_010512495.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=256

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  49   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIF  108

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  109  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  168

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  169  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  228

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  229  TGTGPIDNLFAHLADPGHATIFAAFT  254



>ref|XP_004510608.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=273

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 162/213 (76%), Gaps = 0/213 (0%)
 Frame = +3

Query  339  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRW  518
             ++ C    PDRP+WFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RW
Sbjct  52   ATTKCAVAEPDRPIWFPGSTPPAWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRW  111

Query  519  AMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADII  698
            AML  AGI IPE+L  +G ++  SWY AG +EYF D TTLF++++  +GWAEGRRWADII
Sbjct  112  AMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIIELLFIGWAEGRRWADII  171

Query  699  KPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF  878
             PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA 
Sbjct  172  NPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPKKLKELRTKEIKNGRLAMLAV  231

Query  879  LGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            +G  FQ IYT  GPI+NL  HLADPGH  IF+ 
Sbjct  232  MGAWFQHIYTGTGPIDNLFAHLADPGHATIFAV  264



>ref|XP_008446035.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X1 [Cucumis melo]
Length=281

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 166/226 (73%), Gaps = 4/226 (2%)
 Frame = +3

Query  309  RTWRLNAGKEVSS----VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPEL  476
            R   LNA   V+     VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDPE 
Sbjct  39   RLRNLNAAAVVAPRSAPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPES  98

Query  477  LKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMA  656
            L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++ 
Sbjct  99   LRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGELEYFTDTTTLFIVELI  158

Query  657  LMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
             +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LR
Sbjct  159  FIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELR  218

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
            TKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  +F+
Sbjct  219  TKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFA  264



>ref|XP_010413397.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=256

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  49   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIF  108

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  109  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  168

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  169  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  228

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  229  TGTGPIDNLFAHLADPGHATIFAAFT  254



>emb|CDY51572.1| BnaCnng21010D [Brassica napus]
Length=259

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 168/235 (71%), Gaps = 8/235 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEP--------LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L  +  RLN    V +V             PDRP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLGGKKLRLNKKLNVPTVSRSGTSVRAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDP+ LKW AQAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            P  +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+ 
Sbjct  198  PAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGNGPIDNLFAHLADPGHATIFAV  252



>ref|XP_006291716.1| hypothetical protein CARUB_v10017882mg [Capsella rubella]
 gb|EOA24614.1| hypothetical protein CARUB_v10017882mg [Capsella rubella]
Length=256

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW  QAEL+H RWAML  AGI 
Sbjct  49   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIF  108

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  109  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  168

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  169  VFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKLKELRTKEIKNGRLAMLAVMGAWFQHIY  228

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  229  TGTGPIDNLFAHLADPGHATIFAAFT  254



>pdb|2WSC|2 Chain 2, Improved Model Of Plant Photosystem I
 pdb|2WSE|2 Chain 2, Improved Model Of Plant Photosystem I
 pdb|2WSF|2 Chain 2, Improved Model Of Plant Photosystem I
Length=269

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 171/231 (74%), Gaps = 2/231 (1%)
 Frame = +3

Query  294  IMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPE  473
            + ++S T   +  +  S+VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE
Sbjct  38   LKVNSSTASPSRVRSTSTVCTVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPE  97

Query  474  LLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQM  653
             L+W  QAEL+H RWAML  AGI IPE+L  LG ++  SWY AG +EYF D TTLF+V++
Sbjct  98   SLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVEL  157

Query  654  ALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVL  833
              +GWAEGRRWADI+ PGCV+ +P  P+ K    DVGYPGGLWFDP  WG  SP+ +  L
Sbjct  158  VFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKEL  217

Query  834  RTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLM-FHLADPGHNNIFSAFT  983
            RTKEIKNGRLAMLA +G  FQ IYT  GPI+NL   HLADP H  IF+AFT
Sbjct  218  RTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAAHLADP-HATIFAAFT  267



>gb|EMT28434.1| hypothetical protein F775_43774 [Aegilops tauschii]
Length=255

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 163/218 (75%), Gaps = 0/218 (0%)
 Frame = +3

Query  327  AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELM  506
            AG   S       P+RP+WFPGS+PP WLDGSLPGDFGFDP GLGSDPE L+W  QAEL+
Sbjct  35   AGSRASFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELV  94

Query  507  HGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRW  686
            H RWAML  AGI IPE L  +G ++  SWY AG +EYF D TTLF+V++ L+GWAEGRRW
Sbjct  95   HCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIGWAEGRRW  154

Query  687  ADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLA  866
            ADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  +G GSPE +  LRTKEIKNGRLA
Sbjct  155  ADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSPEKLKDLRTKEIKNGRLA  214

Query  867  MLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            MLA +G  FQA YT  GPI+NL  HLADPGH  IF AF
Sbjct  215  MLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAF  252



>ref|XP_008222160.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Prunus 
mume]
Length=272

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 161/206 (78%), Gaps = 0/206 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ L+W  QAEL+H RWAML  AGI 
Sbjct  65   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLRWNQQAELVHCRWAMLGAAGIF  124

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG  EYF D TTLFVV++ L+GWAEGRRWADI+KPG V+ +P
Sbjct  125  IPEFLTKIGILNTPSWYTAGELEYFTDKTTLFVVELILIGWAEGRRWADILKPGSVNTDP  184

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  185  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  244

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL  HLADPGH  IF+AFT
Sbjct  245  TGTGPIDNLFAHLADPGHATIFAAFT  270



>ref|XP_010250717.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nelumbo 
nucifera]
Length=273

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = +3

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            +RPLWFPGS+PP WLDGSLPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI I
Sbjct  67   ERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFI  126

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE+L  +G ++  SWY AG  EYF D TTLF++++  +GWAEGRRWADIIKPG V+ +P 
Sbjct  127  PEFLTKIGILNTPSWYSAGELEYFTDTTTLFIIELIFIGWAEGRRWADIIKPGSVNTDPI  186

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
             P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IYT
Sbjct  187  FPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYT  246

Query  909  KQGPIENLMFHLADPGHNNIFSAFT  983
              GPI+NL  HLADPGH  IF+AFT
Sbjct  247  GTGPIDNLFAHLADPGHATIFAAFT  271



>ref|XP_004310079.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=269

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAE++H RWAML  AGI 
Sbjct  63   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNTQAEIVHCRWAMLGAAGIF  122

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +GWAEGRRWADI+KPG V+ +P
Sbjct  123  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWADILKPGSVNTDP  182

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  183  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  242

Query  906  TKQGPIENLMFHLADPGHNNIFSAF  980
            T  GPI+NL  HLADPGH  +FSAF
Sbjct  243  TGTGPIDNLFAHLADPGHATVFSAF  267



>emb|CAA59049.1| LHCI-680, photosystem I antenna protein [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ85253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   295 bits (755),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 162/218 (74%), Gaps = 0/218 (0%)
 Frame = +3

Query  327  AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELM  506
            A    S       P+RP+WFPGS+PP WLDGSLPGDFGFDP GLGSDPE L+W  QAEL+
Sbjct  35   AASRTSFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELV  94

Query  507  HGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRW  686
            H RWAML  AGI IPE L  +G ++  SWY AG +EYF D TTLF+V++ L+GWAEGRRW
Sbjct  95   HCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIGWAEGRRW  154

Query  687  ADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLA  866
            ADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  +G GSPE +  LRTKEIKNGRLA
Sbjct  155  ADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSPEKLKELRTKEIKNGRLA  214

Query  867  MLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            MLA +G  FQA YT  GPI+NL  HLADPGH  IF AF
Sbjct  215  MLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAF  252



>ref|XP_006836612.1| hypothetical protein AMTR_s00131p00114510 [Amborella trichopoda]
 gb|ERM99465.1| hypothetical protein AMTR_s00131p00114510 [Amborella trichopoda]
Length=190

 Score =   293 bits (749),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = +3

Query  459  GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTL  638
            GSDPE L+WFAQAELMH RWAML  AGILIPE LE LGFID+YSWY AG REYFAD TTL
Sbjct  3    GSDPESLRWFAQAELMHARWAMLGAAGILIPECLEKLGFIDDYSWYTAGEREYFADTTTL  62

Query  639  FVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPE  818
            FVVQM LMGW EGRRWAD IKPGCVD+EP  P KK PK DVGYPGGLWFDP+MWGRGSPE
Sbjct  63   FVVQMILMGWVEGRRWADFIKPGCVDIEPKYPTKKNPKPDVGYPGGLWFDPWMWGRGSPE  122

Query  819  PVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
            PVMVLRTKEIKNGRLAMLAFLGF FQA+YT  GP++NL  HLADPGH NIFS 
Sbjct  123  PVMVLRTKEIKNGRLAMLAFLGFWFQAVYTGAGPLDNLAAHLADPGHVNIFSG  175



>gb|ABO71660.2| LhCa2 protein [Brassica juncea]
Length=256

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 170/236 (72%), Gaps = 8/236 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEPLP--------PDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L  +  RLN    V++V +           P+RP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLCGKKLRLNKKLSVAAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDP+ LKW  QAE++H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPDSLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            P  +  LRTKEIKNGRL MLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AF
Sbjct  198  PAKIKELRTKEIKNGRLTMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAF  253



>gb|AGT16124.1| chlorophyll a-b binding protein [Saccharum hybrid cultivar R570]
Length=260

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRTW--RLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFD  446
            +GQ  +   L  +T   +  A +   +V     PDRP+WFPGS+PP WLDGSLPGDFGFD
Sbjct  20   NGQRASSSFLGGKTLLRQAEAARPSFAVRAAADPDRPIWFPGSTPPPWLDGSLPGDFGFD  79

Query  447  PLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFAD  626
            P GLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++   WY AG ++YF D
Sbjct  80   PWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPFWYTAGEQQYFTD  139

Query  627  PTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGR  806
             TTLF++++ L+GWAEGRRWADIIKPG V+ +P  P  K    DVGYPGGLWFDP  WG 
Sbjct  140  TTTLFIIELILIGWAEGRRWADIIKPGSVNTDPIFPSNKLTGTDVGYPGGLWFDPLGWGS  199

Query  807  GSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            GSPE +  LRTKEIKNGRLAMLA +G  FQA YT  GPI+NL  HLADPGH  IF AFT
Sbjct  200  GSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFT  258



>ref|XP_006402477.1| hypothetical protein EUTSA_v10006165mg [Eutrema salsugineum]
 gb|ESQ43930.1| hypothetical protein EUTSA_v10006165mg [Eutrema salsugineum]
Length=271

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW AQAEL+H RWAML  AGI 
Sbjct  49   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNAQAELVHCRWAMLGAAGIF  108

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  109  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  168

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSP  +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  169  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIY  228

Query  906  TKQGPIENLMFHLADPGHNNIFS  974
            T  GPI+NL  HLADPGH  IF+
Sbjct  229  TGTGPIDNLFAHLADPGHATIFA  251



>ref|XP_003562834.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Brachypodium 
distachyon]
Length=258

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 162/208 (78%), Gaps = 0/208 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PP WLDGSLPGDFGFDP GLGSDPE L+W  QAEL+H RWAML  AGI 
Sbjct  51   PERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIF  110

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE L  +G ++  SWY AG + YFAD TTLF+V++ L+GWAEGRRWADIIKPGCV+ +P
Sbjct  111  IPELLTKIGILNTPSWYTAGEQTYFADTTTLFIVELILIGWAEGRRWADIIKPGCVNTDP  170

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  +G GSPE +  LRTKEIKNGRLAMLA +G  FQA Y
Sbjct  171  IFPNNKLTGTDVGYPGGLWFDPLGYGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEY  230

Query  906  TKQGPIENLMFHLADPGHNNIFSAFTSH  989
            T  GPI+NL  HLADPGH  IF AFT +
Sbjct  231  TGTGPIDNLFAHLADPGHATIFRAFTPN  258



>ref|XP_004310078.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=286

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL SDP+ LKW  QAE++H RWAML  AGI 
Sbjct  63   PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNTQAEIVHCRWAMLGAAGIF  122

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLF+V++  +GWAEGRRWADI+KPG V+ +P
Sbjct  123  IPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWADILKPGSVNTDP  182

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  183  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIY  242

Query  906  TKQGPIENLMFHLADPGHNNIFS  974
            T  GPI+NL  HLADPGH  +FS
Sbjct  243  TGTGPIDNLFAHLADPGHATVFS  265



>emb|CAA55864.1| type II LHCI [Lolium temulentum]
Length=253

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 167/231 (72%), Gaps = 3/231 (1%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEV---SSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSD  467
            +  +RT  L  GK     S       P+RP+WFPGS+PP WLDGSLPGDFGFDP GLGSD
Sbjct  20   LAGARTSFLGTGKAATRSSFTVRTAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSD  79

Query  468  PELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVV  647
            PE L+W  QAEL+H RWAML  AGI IPE L  +G ++  SWY AG +EYF D TTLFVV
Sbjct  80   PESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFVV  139

Query  648  QMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVM  827
            ++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  +G GSPE + 
Sbjct  140  ELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGNGSPEKLK  199

Query  828  VLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
             LRTKEIKNGRLAMLA +G  FQA YT  GPI+NL  HLADPGH  IF AF
Sbjct  200  ELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAF  250



>ref|NP_001130616.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACG37652.1| chlorophyll a-b binding protein [Zea mays]
 tpg|DAA41203.1| TPA: chlorophyll a-b binding protein [Zea mays]
Length=260

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 171/239 (72%), Gaps = 2/239 (1%)
 Frame = +3

Query  273  SGQAKTCIMLSSRTW--RLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFD  446
            +GQ  +   L  +T   +  A +   +V     P+RP+WFPGS+PP WLDGSLPGDFGFD
Sbjct  20   NGQRASSSFLGGKTLLRQAEAARPSFAVRAAADPNRPIWFPGSTPPPWLDGSLPGDFGFD  79

Query  447  PLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFAD  626
            P GLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++   WY AG ++YF D
Sbjct  80   PWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPFWYTAGEQQYFTD  139

Query  627  PTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGR  806
             TTLF++++ L+GWAEGRRWADIIKPG V+ +P  P  K    DVGYPGGLWFDP  WG 
Sbjct  140  TTTLFIIELILIGWAEGRRWADIIKPGSVNTDPIFPSNKLTGTDVGYPGGLWFDPLGWGS  199

Query  807  GSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            GSPE +  LRTKEIKNGRLAMLA +G  FQA YT  GPI+NL  HLADPGH  IF AFT
Sbjct  200  GSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFT  258



>ref|XP_004958124.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Setaria italica]
Length=259

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 168/235 (71%), Gaps = 2/235 (1%)
 Frame = +3

Query  285  KTCIMLSSRTW--RLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGL  458
            +    L  RT   +  A +   +V     PDRP+WFPGS+PP WLDGSLPGDFGFDP GL
Sbjct  23   RASSFLGGRTLLRQAEAARPSFAVRAAADPDRPIWFPGSTPPPWLDGSLPGDFGFDPWGL  82

Query  459  GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTL  638
            GSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++   WY AG ++YF D TTL
Sbjct  83   GSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPFWYTAGEQQYFTDTTTL  142

Query  639  FVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPE  818
            F++++ L+GWAEGRRWADIIKPG V+ +P  P  K    DVGYPGGLWFDP  WG GSPE
Sbjct  143  FIIELILIGWAEGRRWADIIKPGSVNTDPIFPSNKLTGTDVGYPGGLWFDPLGWGSGSPE  202

Query  819  PVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             +  LRTKEIKNGRLAMLA +G  FQA YT  GPI+NL  HLADPGH  IF AFT
Sbjct  203  KIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFT  257



>ref|XP_001778557.1| predicted protein [Physcomitrella patens]
 gb|EDQ56587.1| predicted protein [Physcomitrella patens]
Length=273

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 170/242 (70%), Gaps = 9/242 (4%)
 Frame = +3

Query  273  SGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPP-------DRPLWFPGSSPPEWLDGSLPG  431
            +G A+T  +L+ R  R+           P+P        DRPLWFPGS PPEWLDGSLPG
Sbjct  26   AGPARTS-LLAGRVRRVTRIAASPQAEAPVPAQPSLPNNDRPLWFPGSQPPEWLDGSLPG  84

Query  432  DFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAR  611
            DFGFDPLGLGSDPELLKWF QAEL+H RWAML  AGI IPE L   G ++  SW  AG +
Sbjct  85   DFGFDPLGLGSDPELLKWFVQAELVHCRWAMLGAAGIFIPEALTKAGILNTPSWTVAGDQ  144

Query  612  EYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDP  791
            +YF D TTLFV+++ L  WAEGRRWADII PGCV+V+P  P+ K    DVGYPGGLWFDP
Sbjct  145  QYFTDATTLFVIEIILFAWAEGRRWADIINPGCVNVDPVFPNNKLTGTDVGYPGGLWFDP  204

Query  792  FMWGR-GSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNI  968
              WG+ G    +  LRT+EIKNGRLAMLA LG   QA YT  GPI+NL+ HLADPGHN I
Sbjct  205  LGWGQTGDAAKLKDLRTREIKNGRLAMLAVLGAVVQANYTHTGPIDNLLAHLADPGHNTI  264

Query  969  FS  974
            F+
Sbjct  265  FA  266



>ref|XP_003637475.1| Chlorophyll a-b binding protein [Medicago truncatula]
Length=294

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 166/243 (68%), Gaps = 26/243 (11%)
 Frame = +3

Query  333  KEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGL------------------  458
            +  ++VC    PDRPLWFPGS+PP WLDGSLPGDFGFDPLGL                  
Sbjct  50   RSTTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLYNGGLIILAGNTNDHNIN  109

Query  459  --------GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGARE  614
                     SDPE LKW  QAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +E
Sbjct  110  QSFGCDSTASDPESLKWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQE  169

Query  615  YFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPF  794
            YF D TTLF+V++  +GWAEGRRWADI+ PGCV+ +P  P+ K    DVGYPGGLWFDP 
Sbjct  170  YFTDTTTLFIVELIFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPL  229

Query  795  MWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
             WG GSP+ +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+
Sbjct  230  GWGSGSPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFA  289

Query  975  AFT  983
            AFT
Sbjct  290  AFT  292



>ref|NP_001148893.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACG33325.1| chlorophyll a-b binding protein [Zea mays]
 tpg|DAA63300.1| TPA: chlorophyll a-b binding protein isoform 1 [Zea mays]
 tpg|DAA63301.1| TPA: chlorophyll a-b binding protein isoform 2 [Zea mays]
 tpg|DAA63302.1| TPA: chlorophyll a-b binding protein isoform 3 [Zea mays]
Length=270

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = +3

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRP+WFPGS+PP WLDGSLPGDFGFDP GLGSDPE L+W  QAEL+H RWAML  AGI I
Sbjct  64   DRPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFI  123

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE+L  +G ++   WY AG ++YF D TTLF++++ L+GWAEGRRWADIIKPG V+ +P 
Sbjct  124  PEFLTKIGVLNTPFWYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGSVNTDPI  183

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
             P  K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQA YT
Sbjct  184  FPSNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYT  243

Query  909  KQGPIENLMFHLADPGHNNIFSAFT  983
              GPI+NL  HLADPGH  IF AFT
Sbjct  244  GTGPIDNLFAHLADPGHATIFQAFT  268



>ref|XP_001782439.1| predicted protein [Physcomitrella patens]
 gb|EDQ52774.1| predicted protein [Physcomitrella patens]
Length=210

 Score =   286 bits (733),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +3

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRPLWFPGS  PEWLDGSLPGDFGFDPLGLGSDPELLKWF QAEL+H RWAML  AGI I
Sbjct  1    DRPLWFPGSKAPEWLDGSLPGDFGFDPLGLGSDPELLKWFVQAELVHCRWAMLGAAGIFI  60

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE L   G ++  SW  AG ++YFADPTTLFV+++ L  WAEGRRWADI+ PGCV+V+P 
Sbjct  61   PEALTKAGILNTPSWNVAGDQQYFADPTTLFVIELILFAWAEGRRWADIVNPGCVNVDPV  120

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGR-GSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
             P+ K    DVGYPGGLWFDP  WG+    + +  LRTKEIKNGRLAMLA LG   QA Y
Sbjct  121  FPNNKLTGTDVGYPGGLWFDPLGWGQTKDAKKLKELRTKEIKNGRLAMLAVLGAVVQANY  180

Query  906  TKQGPIENLMFHLADPGHNNIFS  974
            T  GPI+NL+ HLADPGHN IF+
Sbjct  181  THTGPIDNLLAHLADPGHNTIFA  203



>gb|EMS51363.1| putative polygalacturonase [Triticum urartu]
Length=618

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  414  DGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSW  593
            + SLPGDFGFDPLG GS+PE L+WFAQAELMHGRWAMLA AGIL+PE L   GF++ +SW
Sbjct  391  NSSLPGDFGFDPLGFGSEPESLRWFAQAELMHGRWAMLAAAGILVPEVLHKWGFMEEFSW  450

Query  594  YDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPG  773
            Y AG REYFADP TLFV QMALMGW EGRRW D + PG VD+EP  P++K P  DVGYPG
Sbjct  451  YTAGEREYFADPWTLFVTQMALMGWVEGRRWMDYLNPGSVDIEPRFPNRKNPTPDVGYPG  510

Query  774  GLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADP  953
            GLWFD   WGRGSPEPVMVLRTKEIKNGRLAMLAF+GF FQA+YT QGP++NL+ HLADP
Sbjct  511  GLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGQGPLDNLLAHLADP  570

Query  954  GHNNIFS  974
            GH NIFS
Sbjct  571  GHCNIFS  577



>emb|CDY53917.1| BnaA07g38250D [Brassica napus]
Length=1029

 Score =   307 bits (786),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 171/237 (72%), Gaps = 8/237 (3%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEP--------LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPL  452
             L  +  RLN    V +V             PDRP+WFPGS+PPEWLDGSLPGDFGFDPL
Sbjct  18   FLGGKKLRLNKKLNVPAVSRSGTSVRAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  453  GLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPT  632
            GL SDP+ LKW AQAEL+H RWAML  AGI IPE+L  +G ++  SWY AG +EYF D T
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  633  TLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGS  812
            TLFVV++ L+GWAEGRRWADIIKPG V+ +P  P+ K    DVGYPGGLWFDP  WG GS
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGS  197

Query  813  PEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            P  +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  198  PAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  254



>ref|XP_009415902.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=300

 Score =   287 bits (734),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 164/244 (67%), Gaps = 31/244 (13%)
 Frame = +3

Query  345  SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGL----------------------  458
            SV     P+RPLWFPGS+PP WLDGSLPGDFGFDPLGL                      
Sbjct  55   SVSAAAAPERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGKSELVEPLQTTMSWCLRQQKM  114

Query  459  ---------GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAR  611
                     GSDPE L+W  QAE++H RWAML  AGI IPE L  +G ++  SWY AG  
Sbjct  115  NEWVFFTRAGSDPESLRWNQQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGQL  174

Query  612  EYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDP  791
            +YF D TTLFV+++ L+GWAEGRRWADIIKPGCV+ +P  P+ K    DVGYPGG WFDP
Sbjct  175  QYFTDTTTLFVIELILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGFWFDP  234

Query  792  FMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIF  971
              WG GSPE V  LRTKEIKNGRLAMLA +G  FQAIYT  GPI+NL  HLADPGH  +F
Sbjct  235  LGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQAIYTGTGPIDNLFAHLADPGHATVF  294

Query  972  SAFT  983
            SAFT
Sbjct  295  SAFT  298



>gb|KDO81899.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
Length=255

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 173/266 (65%), Gaps = 18/266 (7%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTCIM----LSSRTWRLNAG-KEVSSVCEPLP  365
            MA   AS A+  I      K   V+G  K   +    L  R     AG + VS       
Sbjct  1    MASVCASPAVAAISSPSSQKSRSVAGATKASFLGGKKLKLRKNGATAGTRSVSVSAAAAD  60

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RPLWFPGS+PPEWLDGSLPGDFGFDPLGL             E++H RWAML  AGI 
Sbjct  61   PNRPLWFPGSTPPEWLDGSLPGDFGFDPLGL-------------EIVHCRWAMLGAAGIF  107

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE L  LG ++  SWY AG  EYF D TTLF+V+M  +GWAEGRRWADIIKPGCV+ +P
Sbjct  108  IPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP  167

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              P+ K    DVGYPGGLWFDP  WG GSPE V  LRTKEIKNGRLAMLA +G  FQ IY
Sbjct  168  IFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIY  227

Query  906  TKQGPIENLMFHLADPGHNNIFSAFT  983
            T  GPI+NL+ HLADPGH  +F+AFT
Sbjct  228  TGTGPIDNLIAHLADPGHATVFAAFT  253



>ref|XP_001786080.1| predicted protein [Physcomitrella patens]
 gb|EDQ49108.1| predicted protein [Physcomitrella patens]
Length=278

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 170/246 (69%), Gaps = 11/246 (4%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K ++ SG+A     +++ T   N    +S+V  P   +RPLWFPGS  PEWLDGSLPGDF
Sbjct  30   KASFFSGRALRMTKVAAYT---NGDMTISAVAAP-QNERPLWFPGSQAPEWLDGSLPGDF  85

Query  438  GFDPLGL------GSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYD  599
            GFDPLGL      GSDPE LKWF QAEL+H RWAML  AGI IPE L  +G ++  SW  
Sbjct  86   GFDPLGLVLRTCAGSDPETLKWFVQAELVHCRWAMLGAAGIFIPEALTKMGILNTPSWTV  145

Query  600  AGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGL  779
            AG  +YF D TTLFV+++ L  WAEGRRWADI+ PGCV+V+P  P+ K    DVGYPGGL
Sbjct  146  AGDADYFTDKTTLFVIELILFAWAEGRRWADIVNPGCVNVDPVFPNNKLTGTDVGYPGGL  205

Query  780  WFDPFMWGRGSPEPVMV-LRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPG  956
            WFDP  WG+ S    +  LRT+EIKNGRLAMLA LG   QA YT  GPI+NL+ HL DPG
Sbjct  206  WFDPLGWGQTSDAAKLKDLRTREIKNGRLAMLAVLGAIVQANYTHTGPIDNLVAHLVDPG  265

Query  957  HNNIFS  974
            HN IF+
Sbjct  266  HNTIFA  271



>gb|AAB65793.1| photosystem I antenna protein [Oryza sativa Indica Group]
Length=265

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 171/257 (67%), Gaps = 7/257 (3%)
 Frame = +3

Query  216  ASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGS  395
            A  ALP  P       +++ G  ++  +L  +    +A    S       PDRP+WFPGS
Sbjct  13   AVAALPGAP----RASSFLGGAGRSGRLLLRQAESSSA--RASFAVRAAAPDRPIWFPGS  66

Query  396  SPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGF  575
            +PP WLDGSLPGDFGFDPLGLGSDPE L+W  QA+L+H RWAML  AGI IPE+L  +G 
Sbjct  67   TPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQADLVHCRWAMLGAAGIFIPEFLTKIGI  126

Query  576  IDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWAD-IIKPGCVDVEPTVPHKKKPK  752
            ++  SWY AG  +YF D TTLF++++ L+GWAEGRRWAD II PGCV+ +P  P ++   
Sbjct  127  LNTPSWYTAGEHQYFTDTTTLFIIELILIGWAEGRRWADIIINPGCVNTDPIFPQQQVHG  186

Query  753  RDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENL  932
               G P GLW DP  WG  SPE +  LRTKEIKNGR+AMLA +G  FQA +T  GPI+N 
Sbjct  187  HRRGEPCGLWLDPLGWGTVSPEKIKELRTKEIKNGRVAMLAVMGAWFQAEHTGTGPIDNF  246

Query  933  MFHLADPGHNNIFSAFT  983
              H+ADPGH  IF AFT
Sbjct  247  FAHVADPGHATIFQAFT  263



>ref|XP_006368879.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 gb|ERP65448.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
Length=208

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  423  LPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDA  602
            LPGDFGFDPLGLGSDPE L+W  QAEL+H RWAML  AGI IPE+L  +G ++  SWY A
Sbjct  20   LPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTA  79

Query  603  GAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLW  782
            G  EYF D TTLF+V++  +GWAEGRRWADI+KPGCV+ +P  P+ K    DVGYPGGLW
Sbjct  80   GELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLW  139

Query  783  FDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHN  962
            FDP  WG GSPE +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH 
Sbjct  140  FDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHA  199

Query  963  NIFSAFT  983
             +FSAFT
Sbjct  200  TVFSAFT  206



>pdb|2O01|2 Chain 2, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=186

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +3

Query  402  PEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFID  581
            PEWLDGSLPGDFGFDPLGL SDPE L+W  QAEL+H RWAML  AGI IPE+L  LG ++
Sbjct  1    PEWLDGSLPGDFGFDPLGLSSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILN  60

Query  582  NYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDV  761
              SWY AG +EYF D TTLF+V++  +GWAEGRRWADI+ PGCV+ +P  P+ K    DV
Sbjct  61   TPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDV  120

Query  762  GYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFH  941
            GYPGGLWFDP  WG  SP+ +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  H
Sbjct  121  GYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAH  180

Query  942  LADPGH  959
            LADPGH
Sbjct  181  LADPGH  186



>gb|EAZ44873.1| hypothetical protein OsJ_29513 [Oryza sativa Japonica Group]
Length=241

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  339  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRW  518
            VS+VCEPL PDRPLWFPGSSPP WLDGSLPGDFGFDPLGLGSDPELL+WFAQAELMH RW
Sbjct  13   VSAVCEPLGPDRPLWFPGSSPPPWLDGSLPGDFGFDPLGLGSDPELLRWFAQAELMHSRW  72

Query  519  AMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADII  698
            AMLAVAGIL+PE LE  GF+++YSW DAGAR+YFADP TLFV QMALMGWAEGRRWAD +
Sbjct  73   AMLAVAGILVPEVLEKWGFMEDYSWIDAGARDYFADPWTLFVSQMALMGWAEGRRWADYL  132

Query  699  KPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG  857
             PGCV VEP +P+++ P  DVGYPGGLWFD   WGRGS  P      +  + G
Sbjct  133  NPGCVAVEPRLPNRRNPVPDVGYPGGLWFDWGNWGRGSRSPSWCCAPRRSRTG  185



>gb|ACN28086.1| unknown [Zea mays]
Length=163

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = +3

Query  504  MHGRWAMLAVAGILIPEWLEGLGFID-NYSWYDAGAREYFADPTTLFVVQMALMGWAEGR  680
            MHGRWAMLA AGIL+P+ L   GFID  +SW+DAG+REYFADP TLFV QMALMGWAEGR
Sbjct  1    MHGRWAMLAAAGILVPDLLARWGFIDAGFSWFDAGSREYFADPWTLFVSQMALMGWAEGR  60

Query  681  RWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGR  860
            RWAD ++PGCVD+EP  P++K P  DVGYPGGLWFD   WGRGSPEPVMVLRTKEIKNGR
Sbjct  61   RWADYLRPGCVDIEPRFPNRKNPVPDVGYPGGLWFDWANWGRGSPEPVMVLRTKEIKNGR  120

Query  861  LAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
            LAMLAF+GF FQA+YT QGPI+NL+ HLADPGH NIFSAFTSH
Sbjct  121  LAMLAFVGFWFQAVYTGQGPIDNLLAHLADPGHCNIFSAFTSH  163



>ref|XP_001782441.1| predicted protein [Physcomitrella patens]
 gb|EDQ52776.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 147/216 (68%), Gaps = 0/216 (0%)
 Frame = +3

Query  339  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRW  518
            VS+       DRPLW PGS  P+WLDGSLPGD+GFDPL L ++P  L W  QAEL+H RW
Sbjct  3    VSATLTGNKTDRPLWLPGSEAPKWLDGSLPGDYGFDPLDLAAEPGRLNWMVQAELVHCRW  62

Query  519  AMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADII  698
            AML  AGI IPE L  +G ++  SWY AG   YFAD  TLF+V++ LM WAE RRWADI 
Sbjct  63   AMLGAAGIFIPELLTKIGILNTPSWYKAGDATYFADQGTLFIVELLLMAWAESRRWADIA  122

Query  699  KPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF  878
            +PG V+ +P  P+ K    DVGYPGGLWFDP  WG GS + +  +RTKE+KNGRLAMLA 
Sbjct  123  RPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSEDKLKEIRTKEVKNGRLAMLAV  182

Query  879  LGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTS  986
            LG   QA  T  GPI+NL  HLADP H  I  + +S
Sbjct  183  LGAFVQANVTHVGPIDNLFAHLADPYHTTILQSVSS  218



>ref|XP_001758295.1| predicted protein [Physcomitrella patens]
 gb|EDQ76697.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 145/214 (68%), Gaps = 0/214 (0%)
 Frame = +3

Query  339  VSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRW  518
            VS+       DRPLW PGS  P+WLDGSLPGD+GFDPL L ++P  L W  QAEL+H RW
Sbjct  54   VSATLTGNKTDRPLWLPGSEAPKWLDGSLPGDYGFDPLDLAAEPGRLNWMVQAELVHCRW  113

Query  519  AMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADII  698
            AML  AGI IPE L  +G ++  SWY AG   YFAD  TLF+V++ LM WAE RRWADI 
Sbjct  114  AMLGAAGIFIPELLTKIGILNTPSWYKAGDATYFADQGTLFIVELLLMAWAESRRWADIA  173

Query  699  KPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAF  878
            +PG V+ +P  P+ K    DVGYPGGLWFDP  WG GS + +  +RTKE+KNGRLAMLA 
Sbjct  174  RPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSEDKLKEIRTKEVKNGRLAMLAV  233

Query  879  LGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            LG   QA  T  GPI+NL  HLADP H  I  + 
Sbjct  234  LGAFVQANVTHVGPIDNLFAHLADPYHTTILQSL  267



>pdb|3LW5|2 Chain 2, Improved Model Of Plant Photosystem I
Length=176

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  462  SDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLF  641
            SDPE L+W  QAEL+H RWAML  AGI IPE+L  LG ++  SWY AG +EYF D TTLF
Sbjct  1    SDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLF  60

Query  642  VVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEP  821
            +V++  +GWAEGRRWADI+ PGCV+ +P  P+ K    DVGYPGGLWFDP  WG  SP+ 
Sbjct  61   IVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQK  120

Query  822  VMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            +  LRTKEIKNGRLAMLA +G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  121  LKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT  174



>gb|ACF23028.1| ST49-6 [Eutrema halophilum]
Length=215

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  366  PDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGIL  545
            P+RP+WFPGS+PPEWLDGSLPGDFGFDPLGL SDP+ LKW AQAEL+H RWAML  AGI 
Sbjct  55   PERPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNAQAELVHCRWAMLGAAGIF  114

Query  546  IPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
            IPE+L  +G ++  SWY AG +EYF D TTLFVV++ L+GWAEGRRWADIIKPG V+ +P
Sbjct  115  IPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDP  174

Query  726  TVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKE  845
              P+ K    DVGYPGGLWFDP +WG GSP  +  LRTK 
Sbjct  175  IFPNNKLTGTDVGYPGGLWFDPLVWGSGSPAKIKELRTKR  214



>gb|EMS53700.1| Chlorophyll a-b binding protein 7, chloroplastic [Triticum urartu]
Length=219

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  492  QAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWA  671
            +AEL+H RWAML  AGI IPE L  +G ++  SWY AG +EYF D TTLF+V++ L+GWA
Sbjct  54   RAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIGWA  113

Query  672  EGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIK  851
            EGRRWADIIKPGCV+ +P  P+ K    DVGYPGGLWFDP  +G GSPE +  LRTKEIK
Sbjct  114  EGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSPEKLKELRTKEIK  173

Query  852  NGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            NGRLAMLA +G  FQA YT  GPI+NL  HLADPGH  IF AF
Sbjct  174  NGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAF  216



>gb|ABK24236.1| unknown [Picea sitchensis]
 gb|ABK25778.1| unknown [Picea sitchensis]
 gb|ACN40523.1| unknown [Picea sitchensis]
Length=251

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 153/257 (60%), Gaps = 11/257 (4%)
 Frame = +3

Query  210  SIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFP  389
            S+ + A   +  R + +  +++G +     +S    R+  G   +         +  W P
Sbjct  3    SVTTQATLGVSCRSVCRSGFLTGSS-----VSRLARRVRPGSNPAPARSFKVEAKGEWLP  57

Query  390  GSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGL  569
            G S P +L+GSLPGD GFDPLGL  DPE LKW+ QAEL++GRWAML VAG+LIPE L   
Sbjct  58   GLSSPTYLNGSLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVLTSF  117

Query  570  GFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKP  749
            GFID   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   +   P
Sbjct  118  GFIDVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPVFKNYSLP  177

Query  750  KRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIEN  929
              +VGYPGG+ F+P  +      P M  + KE+ NGRLAMLAFLGF  Q   T +GP EN
Sbjct  178  PNEVGYPGGI-FNPLNF-----SPSMEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFEN  231

Query  930  LMFHLADPGHNNIFSAF  980
            L+ HL+DP HN I   F
Sbjct  232  LLQHLSDPWHNTIIQTF  248



>gb|ACN40598.1| unknown [Picea sitchensis]
Length=251

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 153/257 (60%), Gaps = 11/257 (4%)
 Frame = +3

Query  210  SIASTALPNIPLRQIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFP  389
            S+ + A   +  R + +  +++G +     +S    R+  G   +         +  W P
Sbjct  3    SVTTQATLGVSCRSVCRSGFLTGSS-----VSRLARRVRPGSNPAPARSFKVEAKGEWLP  57

Query  390  GSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGL  569
            G S P +L+GSLPGD GFDPLGL  DP+ LKW+ QAEL++GRWAML VAG+LIPE L   
Sbjct  58   GLSSPTYLNGSLPGDNGFDPLGLAEDPDSLKWYVQAELVNGRWAMLGVAGMLIPEVLTSF  117

Query  570  GFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKP  749
            GFID   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   +   P
Sbjct  118  GFIDVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPVFKNYSLP  177

Query  750  KRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIEN  929
              +VGYPGG+ F+P  +      P M  + KE+ NGRLAMLAFLGF  Q   T +GP EN
Sbjct  178  PNEVGYPGGI-FNPLNF-----SPSMEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFEN  231

Query  930  LMFHLADPGHNNIFSAF  980
            L+ HL+DP HN I   F
Sbjct  232  LLQHLSDPWHNTIIQTF  248



>gb|AEZ49173.1| chlorophyll a/b binding protein 4 [Wolffia australiana]
Length=250

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 134/202 (66%), Gaps = 6/202 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P++L+GSLPGD GFDPLGL  DPE LKWF QAEL +GRWAML VAG+L+PE  
Sbjct  55   WLPGLASPDYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELQNGRWAMLGVAGMLLPEVF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG +EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  115  TKIGIINAPQWYDAGKQEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            + P  +VGYPGG+ F+P  +      P +  + KEI NGRLAMLAFLGF  Q   T +GP
Sbjct  175  RLPPNEVGYPGGI-FNPLNFA-----PSLEAKEKEIANGRLAMLAFLGFLIQHNLTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAFTS  986
             +NL+ HL+DP HN I    +S
Sbjct  229  FDNLLQHLSDPWHNTIIQTLSS  250



>ref|XP_008783815.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Phoenix dactylifera]
Length=252

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 145/244 (59%), Gaps = 9/244 (4%)
 Frame = +3

Query  249  QIHKQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLP  428
            Q  K  +++G +       +R +     +  ++    +   +  W PG   P +L+GSLP
Sbjct  16   QASKARFLTGSSGKL----ARDFATKTARSKTTTSLKVEAKKGEWLPGLPSPAYLNGSLP  71

Query  429  GDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGA  608
            GD GFDPLGL  DPE LKW+ QAEL++ RWAML V G+L+PE    +G I+   WYDAG 
Sbjct  72   GDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPKWYDAGK  131

Query  609  REYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFD  788
             EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P   +   P  +VGYPGG+ F+
Sbjct  132  AEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKNYSLPPNEVGYPGGIIFN  191

Query  789  PFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNI  968
            P  +     +P +  + KE+ NGRLAMLAFLGF  Q   T QGP +NL+ HL+DP HN I
Sbjct  192  PLNF-----DPTVEAKEKELANGRLAMLAFLGFIIQHNVTGQGPFDNLLQHLSDPWHNTI  246

Query  969  FSAF  980
                
Sbjct  247  IQTL  250



>ref|XP_011047180.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Populus euphratica]
Length=251

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  55   WLPGLPSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  115  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNECGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVIQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             ENL+ H++DP HN I   F+ +
Sbjct  229  FENLLQHISDPWHNTIVQTFSGN  251



>ref|XP_004137413.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004168449.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64012.1| hypothetical protein Csa_1G033310 [Cucumis sativus]
Length=250

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 139/235 (59%), Gaps = 12/235 (5%)
 Frame = +3

Query  282  AKTCIMLSSRTWRLNAGKEVSSVCEPLP------PDRPLWFPGSSPPEWLDGSLPGDFGF  443
            A     LS  + + N    V      +P        +  W PG   P +LDGSLPGD GF
Sbjct  17   ASRSRFLSGSSGKFNRALSVKPTTSSIPNAFKVEAKKGEWLPGLPSPTYLDGSLPGDNGF  76

Query  444  DPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFA  623
            DPLGL  DPE L+W+ QAEL++GRWAML VAG+++PE L   G I+   WYDAG  EYFA
Sbjct  77   DPLGLAEDPENLRWYTQAELVNGRWAMLGVAGMVLPEVLTNYGIINVPKWYDAGKAEYFA  136

Query  624  DPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWG  803
              +TLFV++  L  + E RRW DI  PG V+ +P       P  DVGYPGG+ F+P  + 
Sbjct  137  SSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNDVGYPGGI-FNPLNF-  194

Query  804  RGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNI  968
                EP +  R KEI NGRLAMLAFLGF  Q   T +GP +N M H++DP HN I
Sbjct  195  ----EPTLEAREKEIANGRLAMLAFLGFIVQHNVTGKGPFDNFMQHISDPWHNTI  245



>emb|CEF99235.1| Chlorophyll A-B binding protein, plant [Ostreococcus tauri]
Length=239

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 137/227 (60%), Gaps = 3/227 (1%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L +R     A +    V      +RP+W+PG +P   LDGSLPGDFGFDPL L +DPE+ 
Sbjct  12   LKARATTTRASRRSVVVSAEAGAERPVWYPGKAPAPHLDGSLPGDFGFDPLSLSADPEMR  71

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            KW  QAEL H RWAML VAG + PE L  +G  D  +W DAG  +Y+A    LF +QMA+
Sbjct  72   KWMVQAELQHARWAMLGVAGAVAPELLTKIGVADLPNWVDAGTYQYWAPAGPLFFIQMAM  131

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKK-PKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
              WAE RRW D+  PG ++ +P   +       DVGYPGGL FD   + +  P     L+
Sbjct  132  FNWAEVRRWQDMKNPGSMNTDPLFGYNSNDTNTDVGYPGGL-FDKLGYAK-DPAKAKELK  189

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
             KEIKNGRLAM+AFLG C Q + T QGP+ENL  H+A PG    F +
Sbjct  190  LKEIKNGRLAMVAFLGICAQYVQTGQGPVENLFSHIASPGSVGYFGS  236



>ref|XP_006368875.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 ref|XP_006368876.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 ref|XP_006368877.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 ref|XP_006368878.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 gb|ERP65444.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 gb|ERP65445.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 gb|ERP65446.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
 gb|ERP65447.1| hypothetical protein POPTR_0001s13800g [Populus trichocarpa]
Length=156

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = +3

Query  522  MLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIK  701
            ML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWADI+K
Sbjct  1    MLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELFFIGWAEGRRWADILK  60

Query  702  PGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFL  881
            PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAMLA +
Sbjct  61   PGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVM  120

Query  882  GFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            G  FQ IYT  GPI+NL  HLADPGH  +FSAFT
Sbjct  121  GAWFQHIYTGTGPIDNLFAHLADPGHATVFSAFT  154



>emb|CAA78932.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=251

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 131/200 (66%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG S P +L+GSLPGD GFDPLGL  DPE LKW+ QAEL++GRWAML VAG+LIPE L
Sbjct  55   WLPGLSSPSYLNGSLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVL  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  115  TSIGLINVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLFKQY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P M  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNEVGYPGGI-FNPLNF-----SPSMEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAF  980
             +NL+ HL+DP HN I    
Sbjct  229  FDNLLQHLSDPWHNTIIQTL  248



>ref|NP_001061884.1| Os08g0435900 [Oryza sativa Japonica Group]
 dbj|BAD10636.1| putative chlorophyll a/b-binding protein precursor [Oryza sativa 
Japonica Group]
 dbj|BAF23798.1| Os08g0435900 [Oryza sativa Japonica Group]
 gb|EAZ42851.1| hypothetical protein OsJ_27444 [Oryza sativa Japonica Group]
 dbj|BAG90554.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96663.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96733.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87372.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE L
Sbjct  49   WLPGLPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVL  108

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ID   WYDAG   YFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  109  TKIGLIDAPQWYDAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKSY  168

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPG + F+P  +     EP +  + KE+ NGRLAMLAFLGF  Q   T++GP
Sbjct  169  SLPPHECGYPGSV-FNPLNF-----EPTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGP  222

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ HL+DP HN I    +
Sbjct  223  FDNLLQHLSDPWHNTIIQTLS  243



>ref|XP_002514741.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=251

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  55   WLPGLPSPAYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  115  TKIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVIQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             +NL+ HL+DP HN I   F+ +
Sbjct  229  FDNLLQHLSDPWHNTIIQTFSGN  251



>ref|XP_009388762.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=251

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 132/200 (66%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDGSLPGD GFDPLGL  DPE L+W+ QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLASPTYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   + 
Sbjct  116  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKYPGSVNQDPIFKNY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFIIQHNVTGKGP  229

Query  921  IENLMFHLADPGHNNIFSAF  980
             ENL+ HL+DP HN I   F
Sbjct  230  FENLLQHLSDPWHNTIIQTF  249



>gb|EAZ07102.1| hypothetical protein OsI_29351 [Oryza sativa Indica Group]
Length=244

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE L
Sbjct  49   WLPGLPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVL  108

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ID   WYDAG   YFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  109  TKIGLIDAPQWYDAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKSY  168

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPG + F+P  +     EP +  + KE+ NGRLAMLAFLGF  Q   T++GP
Sbjct  169  SLPPHECGYPGSV-FNPLNF-----EPTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGP  222

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ HL+DP HN I    +
Sbjct  223  FDNLLQHLSDPWHNTIIQTLS  243



>ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
 gb|ABK96327.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP52260.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
Length=251

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  55   WLPGLPSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  115  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNECGYPGGI-FNPLNFA-----PTIEAKEKELANGRLAMLAFLGFVIQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             +NL+ H++DP HN I   F+ +
Sbjct  229  FDNLLQHISDPWHNTIVQTFSGN  251



>gb|ACU19413.1| unknown [Glycine max]
Length=156

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = +3

Query  522  MLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIK  701
            ML  AGI IPE+L  +G ++  SWY AG  EYF D TTLF+V++  +GWAEGRRWADIIK
Sbjct  1    MLGAAGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTTLFIVELFFIGWAEGRRWADIIK  60

Query  702  PGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFL  881
            PGCV+ +P  P+ K    DVGYPGGLWFDP  WG GSP+ +  LRTKEIKNGRLAMLA +
Sbjct  61   PGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPQKIKDLRTKEIKNGRLAMLAVM  120

Query  882  GFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
            G  FQ IYT  GPI+NL  HLADPGH  IF+AFT
Sbjct  121  GAWFQHIYTATGPIDNLFAHLADPGHATIFAAFT  154



>gb|ACJ85068.1| unknown [Medicago truncatula]
 gb|AFK42004.1| unknown [Medicago truncatula]
 gb|KEH33313.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=253

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 148/253 (58%), Gaps = 21/253 (8%)
 Frame = +3

Query  270  VSGQAKTCIM----LSSRTWRLNAGKEVSSV------CEP-----LPPDRPLWFPGSSPP  404
            V+ QA   I     L SR    ++GK    V      C P     +   +  W PG + P
Sbjct  4    VTTQASAAIFRPCGLKSRFLTGSSGKLNREVAIRPMGCSPSASFKVEAKKGEWLPGLASP  63

Query  405  EWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDN  584
             +L GSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE    +G I+ 
Sbjct  64   GYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGIINV  123

Query  585  YSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVG  764
              WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P       PK +VG
Sbjct  124  PKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVG  183

Query  765  YPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHL  944
            YPGG+ F+P  +      P +  + KEI NGRLAMLAFLGF  Q   T +GP +NL+ HL
Sbjct  184  YPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHL  237

Query  945  ADPGHNNIFSAFT  983
            +DP HN I    +
Sbjct  238  SDPWHNTIVQTLS  250



>ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52261.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=252

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  55   WLPGLPSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  115  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNECGYPGGI-FNPLNFA-----PTIEAKEKELANGRLAMLAFLGFVIQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ H++DP HN I   F+
Sbjct  229  FDNLLQHISDPWHNTIVQTFS  249



>ref|XP_006659431.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 139/236 (59%), Gaps = 16/236 (7%)
 Frame = +3

Query  276  GQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLG  455
            GQ  T +  +S T R N   E              W PG   P +LDGSLPGD GFDPLG
Sbjct  26   GQPSTRLGRASTTARRNVRVEAKGE----------WLPGLPSPVYLDGSLPGDNGFDPLG  75

Query  456  LGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTT  635
            L  DPE L+WF QAEL++GRWAML VAG+L+PE L   G ID   WYDAG   YFA  +T
Sbjct  76   LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKAGIIDAPQWYDAGKATYFASSST  135

Query  636  LFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSP  815
            LFVV+  L  + E RRW DI  PGCV+ +P       P  + GYPG + F+P  +     
Sbjct  136  LFVVEFILFHYVEIRRWQDIKNPGCVNQDPIFKSYSLPPHECGYPGSV-FNPLNFA----  190

Query  816  EPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             P +  + KE+ NGRLAMLAFLGF  Q   T++GP +NL+ HL+DP HN I    +
Sbjct  191  -PTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQTLS  245



>ref|XP_010258312.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Nelumbo 
nucifera]
Length=251

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 132/196 (67%), Gaps = 6/196 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+GSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  55   WLPGLASPGYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEIF  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+  +WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   + 
Sbjct  115  TKIGIINVPAWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKNY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P M  + KEI NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNEVGYPGGI-FNPLNFA-----PTMEAKEKEIANGRLAMLAFLGFVVQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNI  968
             +NL+ HL+DP HN I
Sbjct  229  FDNLLQHLSDPWHNTI  244



>emb|CAA78901.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=244

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 131/200 (66%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG S P +L+GSLPGD GFDPLGL  DPE LKW+ QAEL++GRWAML VAG+LIPE L
Sbjct  48   WLPGLSSPSYLNGSLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVL  107

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  108  TSIGLINVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLFKQY  167

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P M  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  168  SLPPNEVGYPGGI-FNPLNF-----SPSMEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  221

Query  921  IENLMFHLADPGHNNIFSAF  980
             +NL+ HL+DP HN I    
Sbjct  222  FDNLLQHLSDPWHNTIIQTL  241



>ref|XP_007509312.1| unknown [Bathycoccus prasinos]
 emb|CCO19769.1| unknown [Bathycoccus prasinos]
Length=241

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 145/241 (60%), Gaps = 11/241 (5%)
 Frame = +3

Query  258  KQNWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDF  437
            K  + + +  T I  + RT R       SSV       RPLW PG++ P  L G LPGD+
Sbjct  6    KTQFGTQRISTHISATKRTVR-------SSVIAS-AESRPLWMPGTAAPSHLKGMLPGDY  57

Query  438  GFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDA-GARE  614
            GFDPL LG D + L W+ QAEL H RWAML VAG+  PE L   G  D  +W+DA     
Sbjct  58   GFDPLNLGEDSKDLDWYVQAELQHARWAMLGVAGMAAPELLTMFGVSDLPNWHDAPFYNG  117

Query  615  YFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPF  794
            YFA  TTLF VQM +M WAE RRW DI  PG V  +P  P  K P  DVGYPGG+ F+P 
Sbjct  118  YFASSTTLFTVQMFMMNWAEIRRWQDIKNPGSVSEDPAFPGNKLPAGDVGYPGGI-FNPM  176

Query  795  MWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFS  974
             +G+ + E +  L+ KEI NGRLAM+A LG   Q  +T  GP+ENL  HL++PG NN+F 
Sbjct  177  NYGKSTDE-LKALKAKEIANGRLAMVAALGCFIQYDHTGVGPVENLTSHLSNPGVNNVFK  235

Query  975  A  977
            A
Sbjct  236  A  236



>ref|XP_002947520.1| light harvesting complex A [Volvox carteri f. nagariensis]
 gb|EFJ51568.1| light harvesting complex A [Volvox carteri f. nagariensis]
Length=264

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 163/257 (63%), Gaps = 12/257 (5%)
 Frame = +3

Query  201  MALSIASTALPNIPLRQIHKQNWVSGQAKTC--IMLSSRTWRLNAGKEVSSVCEPLPPDR  374
            MA  ++ ++   +  + + +++ V+ +A      +  +R W ++A K      +   P  
Sbjct  1    MAFVLSKSSAFGVAAKPVSRRSSVAVKASAVPENVKEARAW-IDAWKSKQGGAK-RDPSL  58

Query  375  PLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPE  554
            P W PG++ P +LDG+LPGDFGFDPL LG++P  LKW+AQAEL+H R+AMLAVAGIL+PE
Sbjct  59   PSWMPGATLPGYLDGTLPGDFGFDPLYLGAEPSKLKWYAQAELVHARFAMLAVAGILVPE  118

Query  555  WLEGLGFI---DNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEP  725
             L  +GF       +WYDAG  +YFA  ++LF VQM L  WAE RR+ D +KPG  + +P
Sbjct  119  LLTNIGFSWPGAGVAWYDAGKFQYFAPASSLFGVQMLLFAWAELRRYQDFVKPGSANQDP  178

Query  726  TVPHKKKPK-RDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAI  902
               + K P   + GYPGG+ FDPF W +G    +  L+TKEIKNGRLAMLAF GF  QA 
Sbjct  179  IFSNNKLPDGNEPGYPGGI-FDPFGWSKGD---MKSLKTKEIKNGRLAMLAFAGFAAQAY  234

Query  903  YTKQGPIENLMFHLADP  953
             T   P++NL  HLADP
Sbjct  235  TTGTTPLKNLATHLADP  251



>gb|AAC67557.1| chlorophyll a/b-binding protein presursor [Oryza sativa Japonica 
Group]
Length=244

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE L
Sbjct  49   WLPGLPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVL  108

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ID   WYDAG   YFA   TLFV++  L  + E R+W DI  PGCV+ +P     
Sbjct  109  TKIGLIDAPQWYDAGKATYFASSNTLFVIEFILFHYVEIRQWQDIKNPGCVNQDPIFKSY  168

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
            + P  + GYPG + F+P  +     EP +  + KE+ NGRLAMLAFLGF  Q   T++GP
Sbjct  169  RLPSDECGYPGSV-FNPLNF-----EPTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGP  222

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ HL+DP HN I    +
Sbjct  223  FDNLLQHLSDPWHNTIIQTLS  243



>ref|XP_003081427.1| PSI-associated light-harvesting chlorophyll a/b binding protein, 
(IC) [Ostreococcus tauri]
 gb|AAY27545.1| chloroplast light-harvesting complex I protein precursor Lhca2 
[Ostreococcus tauri]
Length=242

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 137/227 (60%), Gaps = 3/227 (1%)
 Frame = +3

Query  300  LSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELL  479
            L +R     A +    V      +RP+W+PG +P   LDGSLPGDFGFDPL L +DPE+ 
Sbjct  15   LKARATTTRASRRSVVVSAEAGAERPVWYPGKAPAPHLDGSLPGDFGFDPLSLSADPEMR  74

Query  480  KWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMAL  659
            KW  QAEL H RWAML VAG + PE L  +G  D  +W DAG  +Y+A    LF +QMA+
Sbjct  75   KWMVQAELQHARWAMLGVAGAVAPELLTKIGVADLPNWVDAGTYQYWAPAGPLFFIQMAM  134

Query  660  MGWAEGRRWADIIKPGCVDVEPTVPHKKK-PKRDVGYPGGLWFDPFMWGRGSPEPVMVLR  836
              WAE RRW D+  PG ++ +P   +       DVGYPGGL FD   + +  P     L+
Sbjct  135  FNWAEVRRWQDMKNPGSMNTDPLFGYNSNDTNTDVGYPGGL-FDKLGYAK-DPAKAKELK  192

Query  837  TKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSA  977
             KEIKNGRLAM+AFLG C Q + T QGP+ENL  H+A PG    F +
Sbjct  193  LKEIKNGRLAMVAFLGICAQYVQTGQGPVENLFSHIASPGSVGYFGS  239



>ref|XP_002877563.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53822.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P++L GSL GD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  58   WLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              LG I+   WYDAG  +YFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  118  TKLGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK +VGYPGG+ F+P  +      P +  + KEI NGRLAMLAFLGF  Q   T +GP
Sbjct  178  SLPKGEVGYPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFVVQHNVTGKGP  231

Query  921  IENLMFHLADPGHNNIFSAFT  983
             ENL+ HL+DP HN I    +
Sbjct  232  FENLLQHLSDPWHNTIVQTLS  252



>gb|ABK22868.1| unknown [Picea sitchensis]
Length=233

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 128/214 (60%), Gaps = 45/214 (21%)
 Frame = +3

Query  348  VCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAML  527
            V E +  +RPLWFPG++PP WLDGSLP DFGFDPLGLGSDPE LKW  Q+EL+H RWAML
Sbjct  65   VSEAVQTERPLWFPGTTPPPWLDGSLPADFGFDPLGLGSDPETLKWNVQSELVHCRWAML  124

Query  528  AVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPG  707
              AGI IPE L  LG                                             
Sbjct  125  GAAGIFIPELLTKLGI--------------------------------------------  140

Query  708  CVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGF  887
             ++ +P  P+ K    DVGYPGGLWFDP  WG GSPE +  LRTKEIKNGRLAML+ +G 
Sbjct  141  -LNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLSVMGA  199

Query  888  CFQAIYTKQGPIENLMFHLADPGHNNIFSAFTSH  989
             FQA YT  GPI+NL+ HLADPGH  +F+AF+S 
Sbjct  200  WFQAEYTGTGPIDNLLAHLADPGHATVFAAFSSK  233



>gb|EPS72553.1| chlorophyll a /b binding protein, partial [Genlisea aurea]
Length=208

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 130/202 (64%), Gaps = 6/202 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+G LPGD GFDPLGLG DPE LKWF QAEL +GRWAML VAG+L+PE L
Sbjct  12   WLPGLASPGYLNGRLPGDNGFDPLGLGEDPENLKWFVQAELQNGRWAMLGVAGMLLPEVL  71

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
               G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  72   TSAGLINVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  131

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  132  SLPPNEVGYPGGI-FNPLNFA-----PTEEAKEKELANGRLAMLAFLGFLVQHNVTGKGP  185

Query  921  IENLMFHLADPGHNNIFSAFTS  986
             +NL+ HLADP HN I   FT 
Sbjct  186  FDNLVQHLADPWHNTIIQTFTK  207



>ref|XP_003075175.1| PSI-associated light-harvesting chlorophyll a/b binding protein 
(IC) [Ostreococcus tauri]
 gb|AAY27540.1| chloroplast light-harvesting complex I protein precursor Lhca4 
[Ostreococcus tauri]
 emb|CAL52447.1| Chlorophyll A-B binding protein, plant [Ostreococcus tauri]
Length=236

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 134/203 (66%), Gaps = 5/203 (2%)
 Frame = +3

Query  372  RPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIP  551
            +P+WFPG   P+ L G LPGD+GFDPL LG +P+ L+W+ QAEL HGRWAML VAG   P
Sbjct  33   QPMWFPGMDAPQHLKGELPGDYGFDPLNLGKEPKDLEWYVQAELQHGRWAMLGVAGAAAP  92

Query  552  EWLEGLGFIDNYSWYDA-GAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            E L  +G  D  +W+DA   + YF D TTLF VQM +M WAE RRW D+ KPG V+ +P 
Sbjct  93   EILTKMGISDLPNWHDAPNYQGYFTDATTLFWVQMLMMNWAEVRRWQDMRKPGSVNEDPA  152

Query  729  VPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYT  908
                K P   VGYPGG+ FDP  + +G    +  L+ KEI NGRLAM+AF G   Q  +T
Sbjct  153  FSGNKLPSGIVGYPGGI-FDPLGYAKGD---LNKLKAKEIANGRLAMVAFAGIMVQYDHT  208

Query  909  KQGPIENLMFHLADPGHNNIFSA  977
              GP+ NL+ H++DP HNN+F A
Sbjct  209  GVGPVANLVAHMSDPAHNNVFQA  231



>ref|XP_011087238.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Sesamum 
indicum]
Length=249

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 130/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDGSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  54   WLPGLASPTYLDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  113

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   + 
Sbjct  114  TSIGIINVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKNY  173

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  174  SLPPNEVGYPGGI-FNPLNFA-----PTTEAKEKELANGRLAMLAFLGFIVQHNVTGKGP  227

Query  921  IENLMFHLADPGHNNIFSAF  980
             +NL+ HL+DP HN I    
Sbjct  228  FDNLLQHLSDPWHNTIIQTL  247



>gb|EYU24360.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata]
Length=251

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 130/202 (64%), Gaps = 6/202 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L GSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE L
Sbjct  56   WLPGLASPNYLAGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVL  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  116  TSIGLINVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KEI NGRLAMLAFLGF  Q   T +G 
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTQEAKEKEIANGRLAMLAFLGFVVQHNVTGKGA  229

Query  921  IENLMFHLADPGHNNIFSAFTS  986
             +NL+ HL+DP HN I   F +
Sbjct  230  FDNLLQHLSDPWHNTIIQTFKN  251



>ref|NP_190331.3| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
 sp|P27521.1|CA4_ARATH RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCI type III CAB-4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA32760.1| light-harvesting chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 emb|CAB61973.1| CHLOROPHYLL A-B BINDING PROTEIN 4 PRECURSOR homolog [Arabidopsis 
thaliana]
 gb|AAM13079.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAM63472.1| chlorophyll a-b binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAN15412.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AEE78285.1| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
Length=251

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 130/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P++L GSL GD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  57   WLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  +YFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  117  TKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK +VGYPGG+ F+P  +      P    + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  177  SLPKGEVGYPGGI-FNPLNFA-----PTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  230

Query  921  IENLMFHLADPGHNNIFSAFT  983
             ENL+ HL+DP HN I   F 
Sbjct  231  FENLLQHLSDPWHNTIVQTFN  251



>ref|XP_009587071.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=251

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 130/202 (64%), Gaps = 6/202 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDG L GD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE L
Sbjct  56   WLPGLTSPTYLDGRLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVL  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
               G ++   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  116  TSAGLLNVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KEI NGRLAMLAFLGF  Q   T +GP
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGP  229

Query  921  IENLMFHLADPGHNNIFSAFTS  986
             +NL+ HL+DP HN I   F +
Sbjct  230  FDNLLQHLSDPWHNTIIQTFAN  251



>ref|XP_001419664.1| chlorophyll a/b binding, possibly photosystem I light harvesting 
complex [Ostreococcus lucimarinus CCE9901]
 gb|ABO97957.1| chlorophyll a/b binding, possibly photosystem I light harvesting 
complex [Ostreococcus lucimarinus CCE9901]
Length=235

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 130/202 (64%), Gaps = 3/202 (1%)
 Frame = +3

Query  369  DRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILI  548
            DRP+W+PG +P   LDGSLPGD+GFDPL L +DPE+ +W  QAEL H RWAML VAG + 
Sbjct  35   DRPVWYPGKAPAAHLDGSLPGDYGFDPLSLSADPEMRQWMVQAELQHARWAMLGVAGCVA  94

Query  549  PEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPT  728
            PE L  +G  D  +W DA   +Y+A   TLF +QMA+  WAE RRW D+  PG V+ +P 
Sbjct  95   PELLTKIGVADLPNWVDAATYQYWAPGGTLFFIQMAMFNWAEIRRWQDMKNPGSVNTDPL  154

Query  729  VPHKKK-PKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIY  905
              +       DVGYP GL FD F W +   +    L+ KEIKNGRLAMLAFLG C Q + 
Sbjct  155  FGYNSNDTNTDVGYPKGL-FDKFGWAK-DEKTTAELKLKEIKNGRLAMLAFLGICAQYVQ  212

Query  906  TKQGPIENLMFHLADPGHNNIF  971
            T  GP+ENL  H+ +PG   +F
Sbjct  213  TGVGPVENLFSHMGNPGQVGVF  234



>ref|XP_009618704.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana tomentosiformis]
Length=251

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 130/202 (64%), Gaps = 6/202 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDGSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLASPTYLDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ++   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  116  TNIGILNVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KEI NGRLAMLAFLGF  Q     +GP
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTAEAKEKEIANGRLAMLAFLGFIVQHNVVGKGP  229

Query  921  IENLMFHLADPGHNNIFSAFTS  986
             +NL+ HL+DP HN I    ++
Sbjct  230  FDNLLQHLSDPWHNTIVQTLSN  251



>gb|KDP31267.1| hypothetical protein JCGZ_11643 [Jatropha curcas]
Length=249

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  53   WLPGLPSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  112

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  113  TKIGIINAPQWYDAGKVEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  172

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  173  SLPPHECGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  226

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             ENL+ HL+DP HN I      +
Sbjct  227  FENLLQHLSDPWHNTIVQTLRGY  249



>gb|EAZ07099.1| hypothetical protein OsI_29348 [Oryza sativa Indica Group]
Length=244

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 130/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE L
Sbjct  49   WLPGLPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVL  108

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ID   WYDAG   YFA  +TLFV++  L    E RRW DI  PGCV+ +P     
Sbjct  109  TKIGLIDAPQWYDAGKATYFASSSTLFVIEFILFHSVEIRRWQDIKNPGCVNQDPIFKSY  168

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPG + F+P  +     EP +  + KE+ NGRLAMLAFLGF  Q   T++GP
Sbjct  169  SLPPHECGYPGSV-FNPLNF-----EPTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGP  222

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ HL+DP HN I    +
Sbjct  223  FDNLLQHLSDPWHNTIIQTLS  243



>ref|XP_010547822.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Tarenaya 
hassleriana]
Length=252

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 129/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+GSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  57   WLPGLASPAYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  116

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  117  TKIGIINVPEWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  176

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  177  SLPPNEVGYPGGI-FNPLNFA-----PTAEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  230

Query  921  IENLMFHLADPGHNNIFSAF  980
             ENL+ HL+DP HN I    
Sbjct  231  FENLLQHLSDPWHNTIIQTL  250



>ref|XP_010546068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Tarenaya hassleriana]
Length=252

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 135/217 (62%), Gaps = 6/217 (3%)
 Frame = +3

Query  330  GKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMH  509
            G    +    +   +  W PG + P +L+GSL GD GFDPLGL  DPE LKWF QAEL++
Sbjct  40   GSSTRTASYKVEAKKGEWLPGLASPAYLNGSLAGDNGFDPLGLAEDPENLKWFVQAELVN  99

Query  510  GRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWA  689
            GRWAML VAG+L+PE    +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW 
Sbjct  100  GRWAMLGVAGMLLPEVFTKIGIINAPEWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQ  159

Query  690  DIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAM  869
            DI  PG V+ +P     + P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAM
Sbjct  160  DIKNPGSVNQDPIFKQYRLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAM  213

Query  870  LAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            LAFLGF  Q   T +GP ENL+ HL+DP H+ I   F
Sbjct  214  LAFLGFVVQHNVTGKGPFENLLQHLSDPWHSTIIQTF  250



>ref|XP_009804068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nicotiana sylvestris]
Length=249

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 143/240 (60%), Gaps = 11/240 (5%)
 Frame = +3

Query  282  AKTCIMLSSRTWRLNAG---KEVSSVCEPLPPD--RPLWFPGSSPPEWLDGSLPGDFGFD  446
            A     LS  + +LN     K  +S C     +  +  W PG + P +LDG L GD GFD
Sbjct  16   ASKTRFLSGASGKLNREVFFKPSTSSCNSFKVEAKKGEWLPGLTSPTYLDGRLAGDNGFD  75

Query  447  PLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFAD  626
            PLGL  DPE LKWF QAEL++GRWAML VAG+L+PE L   G ++   WYDAG  EYFA 
Sbjct  76   PLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSAGLLNVPKWYDAGKSEYFAS  135

Query  627  PTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGR  806
             +TLFV++  L  + E RRW DI  PG V+ +P       P  +VGYPGG+ F+P  +  
Sbjct  136  SSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPNEVGYPGGI-FNPLNFA-  193

Query  807  GSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTS  986
                P +  + KEI NGRLAMLAFLGF  Q   T +GP +NL+ HL+DP HN I   F +
Sbjct  194  ----PSLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFAN  249



>ref|XP_010426187.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 142/236 (60%), Gaps = 13/236 (6%)
 Frame = +3

Query  297  MLSSRTWRLNAGKEVSSVCEP-------LPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLG  455
             L+  + +LN      S+  P       +   +  W PG + P++L GSL GD GFDPLG
Sbjct  23   FLTGSSGKLNRDLSFKSIGSPSKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLG  82

Query  456  LGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTT  635
            L  DPE LKWF QAEL++GRWAML VAG+L+PE    +G I+   WYDAG  +YFA  +T
Sbjct  83   LAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSST  142

Query  636  LFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSP  815
            LFV++  L  + E RRW DI  PG V+ +P       PK +VGYPGG+ F+P  +     
Sbjct  143  LFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGI-FNPLNFA----  197

Query  816  EPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
             P +  + KE+ NGRLAMLAFLGF  Q   T +GP ENL+ HL+DP HN I    +
Sbjct  198  -PTLEAKEKELANGRLAMLAFLGFVIQHNVTGKGPFENLLQHLSDPWHNTIVQTLS  252



>ref|XP_010257811.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nelumbo nucifera]
Length=250

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 132/196 (67%), Gaps = 6/196 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+GSLPGD GFDPLGL  DP+ LKWF QAEL +GRWAML VAG+L+PE L
Sbjct  55   WLPGLASPSYLNGSLPGDNGFDPLGLAEDPDNLKWFVQAELQNGRWAMLGVAGMLLPEIL  114

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+  +WYDAG  EYFA  +TLFVV+  L  + E RRW DI  PG V+ +P   + 
Sbjct  115  TKIGIINVPAWYDAGKVEYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIFKNY  174

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  175  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  228

Query  921  IENLMFHLADPGHNNI  968
             +NL+ HL+DP HN I
Sbjct  229  FDNLLQHLSDPWHNTI  244



>ref|XP_009773617.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana sylvestris]
Length=251

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 129/196 (66%), Gaps = 6/196 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDGSLPGD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLASPTYLDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ++   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P   + 
Sbjct  116  TNIGILNVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKNY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P    + KEI NGRLAMLAFLGF  Q     +GP
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTAEAKEKEIANGRLAMLAFLGFIVQHNVVGKGP  229

Query  921  IENLMFHLADPGHNNI  968
             +NL+ HL+DP HN I
Sbjct  230  FDNLLQHLSDPWHNTI  245



>ref|XP_010515052.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P++L GSL GD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  58   WLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVF  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  +YFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  118  TKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              PK +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  178  SLPKGEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  231

Query  921  IENLMFHLADPGHNNIFSAFT  983
             ENL+ HL+DP HN I    +
Sbjct  232  FENLLQHLSDPWHNTIVQTLS  252



>ref|XP_008453211.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Cucumis melo]
Length=252

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 130/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLPSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  116  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  176  SLPPNECGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFIVQHNVTGKGP  229

Query  921  IENLMFHLADPGHNNIFSAF  980
             +NL+ H++DP HN I   F
Sbjct  230  FDNLLQHISDPWHNTIVQTF  249



>ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Setaria italica]
Length=245

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 129/201 (64%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +LDGSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+LIPE L
Sbjct  50   WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVL  109

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
               G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  110  TKAGLINAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY  169

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPG + F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  170  SLPPHECGYPGSV-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFLIQHNVTGKGP  223

Query  921  IENLMFHLADPGHNNIFSAFT  983
             +NL+ HL+DP HN I   F+
Sbjct  224  FDNLLQHLSDPWHNTIIQTFS  244



>ref|XP_010235157.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Brachypodium distachyon]
Length=244

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 129/201 (64%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +LDG LPGD GFDPLGL  DPE L+W+ QAEL++GRWAML VAG+L PE L
Sbjct  49   WLPGLPSPAYLDGKLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLTPELL  108

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG   YFA  +TLFVV+  L  + E RRW DI +PGCV+ +P     
Sbjct  109  TKIGLINAPEWYDAGKSTYFASSSTLFVVEFILFHYVEIRRWQDIKEPGCVNQDPIFKSY  168

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPG + F+P  +      P +  + KEI NGRLAMLA+LGF  Q   T +GP
Sbjct  169  SLPPHECGYPGSV-FNPLNFA-----PTLEAKEKEIANGRLAMLAYLGFSVQHAVTGKGP  222

Query  921  IENLMFHLADPGHNNIFSAFT  983
            ++NL  HL+DP HN I   F+
Sbjct  223  LDNLFQHLSDPWHNTIIQTFS  243



>ref|XP_010550595.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=252

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 133/218 (61%), Gaps = 6/218 (3%)
 Frame = +3

Query  327  AGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELM  506
            AG    S    +   +  W PG + P +L+GSLPGD GFDPL L  DPE  +WF QAEL+
Sbjct  39   AGSSTKSASFKVEAKKGEWLPGLATPAYLNGSLPGDNGFDPLALAEDPENFRWFVQAELV  98

Query  507  HGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRW  686
            +GRWAML VAG+L+PE    +G I    WYDAG  EYFA  +TLFV++  L  + E RRW
Sbjct  99   NGRWAMLGVAGMLLPEVFTKIGIISVPEWYDAGKGEYFASSSTLFVIEFILFHYVEIRRW  158

Query  687  ADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLA  866
             DI  PG V+ +P       P  +VGYPGG+ F+P  +      P +  + KE+ NGRLA
Sbjct  159  QDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLA  212

Query  867  MLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAF  980
            MLAFLGF  Q   T +GP ENL+ HL+DP HN I   F
Sbjct  213  MLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIIQTF  250



>ref|XP_010030046.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW83631.1| hypothetical protein EUGRSUZ_B00523 [Eucalyptus grandis]
Length=294

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE  
Sbjct  98   WLPGLASPGYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVF  157

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+  +WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  158  TKIGIINVPAWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  217

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  218  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGP  271

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             ENL+ HL+DP HN I      +
Sbjct  272  FENLVQHLSDPWHNTIVQTLRGY  294



>gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Capsicum annuum]
Length=250

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 132/203 (65%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +LDGSLPGD GFDPLGL  DPE LKW+ QAEL++GRWAML VAG+L+PE  
Sbjct  54   WLPGLASPAYLDGSLPGDNGFDPLGLAEDPENLKWYIQAELVNGRWAMLGVAGMLLPEVF  113

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G ++   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P   + 
Sbjct  114  TSIGILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKNY  173

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +           + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  174  SLPPNECGYPGGI-FNPLNFAATEEA-----KEKELANGRLAMLAFLGFIVQHNVTGKGP  227

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             +NL+ HL+DP HN I    +S+
Sbjct  228  FDNLLQHLSDPWHNTIIQTLSSN  250



>ref|XP_010322569.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum lycopersicum]
Length=250

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 143/241 (59%), Gaps = 14/241 (6%)
 Frame = +3

Query  264  NWVSGQAKTCIMLSSRTWRLNAGKEVSSVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGF  443
            N  SG+        S T   N+ K  +   E        W PG + P +L+GSL GD GF
Sbjct  24   NGSSGKLNRDFSFKSSTLSYNSFKVEAKKGE--------WLPGLTSPTYLNGSLAGDNGF  75

Query  444  DPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFA  623
            DPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE    +G ++   WYDAG  +YFA
Sbjct  76   DPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGLLNVPKWYDAGKSDYFA  135

Query  624  DPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWG  803
              +TLFV++  L  + E RRW DI  PG V+ +P       P  +VGYPGG+ F+P  + 
Sbjct  136  SSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPNEVGYPGGI-FNPLNFA  194

Query  804  RGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFT  983
                 P +  + KEI NGRLAMLAFLGF  Q   T +GP +NL+ H++DP HN I   F+
Sbjct  195  -----PTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTFS  249

Query  984  S  986
            +
Sbjct  250  N  250



>ref|XP_004236014.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Solanum 
lycopersicum]
Length=287

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 161/283 (57%), Gaps = 27/283 (10%)
 Frame = +3

Query  198  SMALSIASTALPNIP-----LRQIHKQNWVSGQAKTCIM--LSSRTWRLNA-----GKEV  341
            S  LS+ +T LP +P     L ++ K   V+ QA   I    +SRT  L        +EV
Sbjct  12   SFQLSLKTT-LPFLPIITNKLFKLEKMATVTTQASAAIFRPCASRTRFLTGSSGKLNREV  70

Query  342  S--------SVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQA  497
            S             +   +  W PG + P++LDGSLPGD GFDPLGL  DPE LKWF QA
Sbjct  71   SFRPSTFSSYNSFKVEAKKGQWLPGLASPDYLDGSLPGDNGFDPLGLAEDPENLKWFIQA  130

Query  498  ELMHGRWAMLAVAGILIPEWLEGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEG  677
            EL++GRWAML VAG+L+PE    +G ++   WYDAG  EYFA  +TLFV++  L  + E 
Sbjct  131  ELVNGRWAMLGVAGMLLPEVFTSIGILNVPKWYDAGKSEYFASSSTLFVIEFILFHYVEI  190

Query  678  RRWADIIKPGCVDVEPTVPHKKKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNG  857
            RRW DI  PG V+ +P   +   P    GYPGG+ F+P  +      P    + KE+ NG
Sbjct  191  RRWQDIKNPGSVNQDPIFKNYSLPPNKCGYPGGI-FNPLNFA-----PTEEAKEKELANG  244

Query  858  RLAMLAFLGFCFQAIYTKQGPIENLMFHLADPGHNNIFSAFTS  986
            RLAMLAFLGF  Q   T +GP +NL+ HL+DP HN I    ++
Sbjct  245  RLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSN  287



>ref|XP_009149912.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Brassica 
rapa]
 emb|CDY47410.1| BnaCnng15190D [Brassica napus]
 emb|CDX99044.1| BnaA06g17350D [Brassica napus]
Length=252

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG + P +L+GSL GD GFDPLGL  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  58   WLPGLASPGYLNGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVF  117

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  +YFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  118  TKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  177

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  178  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFVIQHNVTGKGP  231

Query  921  IENLMFHLADPGHNNIFSAFT  983
             ENL+ HL+DP HN I   F+
Sbjct  232  FENLLQHLSDPWHNTIVQTFS  252



>ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004154963.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 gb|KGN63677.1| hypothetical protein Csa_1G009810 [Cucumis sativus]
Length=252

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 130/200 (65%), Gaps = 6/200 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG   P +L+GSLPGD GFDPLGL  DPE L+W+ QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLPSPMYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P     
Sbjct  116  TKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  + GYPGG+ F+P  +      P +  + KEI NGRLAMLAFLGF  Q   T +GP
Sbjct  176  SLPPNECGYPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGP  229

Query  921  IENLMFHLADPGHNNIFSAF  980
             +NL+ H++DP HN I   F
Sbjct  230  FDNLLQHISDPWHNTIVQTF  249



>ref|XP_004513901.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cicer arietinum]
Length=252

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 6/203 (3%)
 Frame = +3

Query  381  WFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWL  560
            W PG S P +L GSLPGD GFDPL L  DPE LKWF QAEL++GRWAML VAG+L+PE  
Sbjct  56   WLPGLSSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVF  115

Query  561  EGLGFIDNYSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHK  740
              +G I+   WYDAG  EYFA  +TLFV++  L  + E RRW DI  PG V+ +P     
Sbjct  116  TNIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQY  175

Query  741  KKPKRDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGP  920
              P  +VGYPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP
Sbjct  176  SLPPNEVGYPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFIVQHNVTGKGP  229

Query  921  IENLMFHLADPGHNNIFSAFTSH  989
             +NL+ HL+DP HN I    + +
Sbjct  230  FDNLLQHLSDPWHNTIIQTLSGN  252



>gb|KHG01496.1| Chlorophyll a-b binding P4, chloroplastic [Gossypium arboreum]
Length=252

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 150/255 (59%), Gaps = 21/255 (8%)
 Frame = +3

Query  270  VSGQAKTCIM--LSSRTWRL--NAGKEVSSVC-EPL----------PPDRPLWFPGSSPP  404
            V+ QA   +    +S+T  L  N+GK    VC +P+             +  W PG   P
Sbjct  4    VTTQASAAVFRPCTSKTRFLTGNSGKLNRQVCFKPMSSSSISSFKVEAKKGEWLPGLPSP  63

Query  405  EWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHGRWAMLAVAGILIPEWLEGLGFIDN  584
             +L GSLPGD GFDPLGL  DPE L+WF QAEL++GRWAML VAG+L+PE    +G I+ 
Sbjct  64   AYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGLINA  123

Query  585  YSWYDAGAREYFADPTTLFVVQMALMGWAEGRRWADIIKPGCVDVEPTVPHKKKPKRDVG  764
              WYDAG  EYFA  +TLFV++  L  + E RRW DI  PGCV+ +P       P  + G
Sbjct  124  PQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPHECG  183

Query  765  YPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQAIYTKQGPIENLMFHL  944
            YPGG+ F+P  +      P +  + KE+ NGRLAMLAFLGF  Q   T +GP +NL+ HL
Sbjct  184  YPGGI-FNPLNFA-----PTLEAKEKELANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHL  237

Query  945  ADPGHNNIFSAFTSH  989
            +DP HN I +    +
Sbjct  238  SDPWHNTIINTIRGY  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2605467596544