BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21592_g1_i1 len=1295 path=[41:0-162 @204@!:163-605 40:606-670
710:671-1075 1115:1076-1294]

Length=1295
                                                                      Score     E

ref|XP_009591832.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     560   0.0      
ref|XP_009769587.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     559   0.0      
ref|XP_006340478.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     554   0.0      
ref|XP_004237506.1|  PREDICTED: GDSL esterase/lipase At5g33370          551   0.0      
ref|XP_011077072.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     535   0.0      
gb|EPS65950.1|  hypothetical protein M569_08823                         532   0.0      
ref|XP_007206865.1|  hypothetical protein PRUPE_ppb006257mg             531   0.0      
ref|XP_008218370.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     531   0.0      
ref|XP_003521784.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     531   0.0      
gb|EYU39770.1|  hypothetical protein MIMGU_mgv1a009318mg                530   0.0      
ref|XP_009611210.1|  PREDICTED: GDSL esterase/lipase LTL1-like          531   0.0      
ref|XP_011084724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     530   0.0      
gb|KHN43144.1|  GDSL esterase/lipase                                    530   0.0      
ref|XP_003626495.1|  GDSL esterase/lipase                               530   0.0      
ref|XP_004494760.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     530   0.0      
gb|ACU23610.1|  unknown                                                 528   0.0      Glycine max [soybeans]
ref|XP_008370769.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     528   0.0      
emb|CBI28654.3|  unnamed protein product                                526   0.0      
ref|XP_009777584.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    526   0.0      
ref|XP_002268826.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     525   0.0      Vitis vinifera
ref|XP_003555561.1|  PREDICTED: GDSL esterase/lipase At5g33370          525   0.0      
gb|EYU39534.1|  hypothetical protein MIMGU_mgv1a008648mg                525   0.0      
ref|XP_011077073.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    525   0.0      
gb|EYU39533.1|  hypothetical protein MIMGU_mgv1a008571mg                524   0.0      
emb|CAN66351.1|  hypothetical protein VITISV_039098                     523   0.0      Vitis vinifera
gb|KHN04961.1|  GDSL esterase/lipase                                    523   0.0      
ref|XP_008388755.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     523   0.0      
ref|XP_010102187.1|  GDSL esterase/lipase                               523   0.0      
gb|KHG28666.1|  GDSL esterase/lipase LTL1 -like protein                 522   0.0      
ref|XP_010918935.1|  PREDICTED: GDSL esterase/lipase LTL1               521   0.0      
ref|XP_010648948.1|  PREDICTED: GDSL esterase/lipase At5g33370          521   0.0      
emb|CBI28652.3|  unnamed protein product                                521   0.0      
ref|NP_001237641.2|  uncharacterized LOC100500155 precursor             521   0.0      
ref|XP_009348739.1|  PREDICTED: GDSL esterase/lipase LTL1-like          521   0.0      
ref|XP_007143993.1|  hypothetical protein PHAVU_007G120000g             521   1e-180   
ref|XP_009764127.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    521   1e-180   
ref|XP_003535381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     521   2e-180   
ref|XP_004302114.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     520   3e-180   
ref|XP_003554731.1|  PREDICTED: GDSL esterase/lipase LTL1-like          520   3e-180   
ref|XP_006340481.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     520   3e-180   
ref|XP_004237503.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     519   6e-180   
ref|XP_010243647.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     518   1e-179   
ref|XP_008796408.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     518   1e-179   
ref|XP_006403052.1|  hypothetical protein EUTSA_v10003456mg             518   2e-179   
ref|XP_006283972.1|  hypothetical protein CARUB_v10005096mg             518   2e-179   
ref|XP_010435380.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     517   2e-179   
ref|XP_007030304.1|  Li-tolerant lipase 1 isoform 1                     517   3e-179   
gb|KHN14896.1|  GDSL esterase/lipase                                    517   3e-179   
ref|XP_010440676.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    517   3e-179   
ref|XP_010674245.1|  PREDICTED: GDSL esterase/lipase At5g33370          517   4e-179   
ref|XP_003521782.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    517   6e-179   
ref|XP_006854343.1|  hypothetical protein AMTR_s00039p00143210          516   7e-179   
ref|XP_002522020.1|  zinc finger protein, putative                      516   9e-179   Ricinus communis
gb|KHN35332.1|  GDSL esterase/lipase LTL1                               516   1e-178   
ref|XP_003541357.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     516   1e-178   
ref|XP_011002018.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     515   2e-178   
ref|XP_009631850.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     516   2e-178   
ref|NP_198322.1|  GDSL esterase/lipase                                  515   2e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868396.1|  GDSL-motif lipase/hydrolase family protein         515   2e-178   
gb|KHN14884.1|  GDSL esterase/lipase                                    514   4e-178   
ref|XP_007147233.1|  hypothetical protein PHAVU_006G107100g             514   4e-178   
gb|AAS75127.1|  GDSL-motif lipase                                       514   5e-178   Agave americana [century plant]
ref|XP_004495557.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     514   6e-178   
ref|XP_003553269.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     514   7e-178   
ref|XP_008789479.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   8e-178   
ref|XP_011076887.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   9e-178   
ref|XP_011038448.1|  PREDICTED: GDSL esterase/lipase At5g33370          513   9e-178   
ref|XP_003589465.1|  GDSL esterase/lipase                               513   1e-177   
ref|XP_003524731.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   1e-177   
ref|XP_003520948.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    513   1e-177   
ref|XP_003554997.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   1e-177   
ref|XP_010043320.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     513   1e-177   
ref|XP_009379726.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     513   2e-177   
ref|XP_006371114.1|  hypothetical protein POPTR_0019s04150g             513   5e-177   
ref|XP_003553249.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     512   5e-177   
emb|CDO99962.1|  unnamed protein product                                511   5e-177   
ref|XP_004152806.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     511   5e-177   
ref|XP_007205392.1|  hypothetical protein PRUPE_ppa007427mg             511   7e-177   
ref|XP_006443291.1|  hypothetical protein CICLE_v10020640mg             511   8e-177   
ref|XP_006443287.1|  hypothetical protein CICLE_v10020709mg             511   8e-177   
gb|KHN14886.1|  GDSL esterase/lipase                                    511   8e-177   
ref|XP_002325360.1|  hypothetical protein POPTR_0019s04130g             511   8e-177   Populus trichocarpa [western balsam poplar]
ref|XP_004513280.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     511   9e-177   
ref|XP_011002016.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     511   9e-177   
ref|XP_008810810.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     511   9e-177   
ref|XP_010940685.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     510   1e-176   
ref|XP_006350943.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     510   1e-176   
gb|KCW61461.1|  hypothetical protein EUGRSUZ_H04197                     511   1e-176   
ref|XP_003590909.1|  GDSL esterase/lipase                               510   2e-176   
ref|XP_002319125.1|  hypothetical protein POPTR_0013s04790g             510   2e-176   Populus trichocarpa [western balsam poplar]
ref|XP_002522021.1|  zinc finger protein, putative                      510   2e-176   Ricinus communis
ref|XP_008218371.1|  PREDICTED: GDSL esterase/lipase LTL1-like          511   2e-176   
ref|XP_010024922.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     509   2e-176   
ref|XP_003554996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     510   2e-176   
ref|XP_003553275.1|  PREDICTED: GDSL esterase/lipase At5g33370          510   3e-176   
gb|ACU23725.1|  unknown                                                 510   3e-176   Glycine max [soybeans]
ref|XP_006577328.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...    510   3e-176   
ref|XP_006375868.1|  hypothetical protein POPTR_0013s04790g             510   3e-176   
ref|XP_004155142.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     512   3e-176   
gb|ABK95911.1|  unknown                                                 509   4e-176   Populus trichocarpa [western balsam poplar]
gb|KHN35333.1|  GDSL esterase/lipase                                    509   5e-176   
ref|XP_003521783.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     509   5e-176   
ref|XP_004292262.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     508   5e-176   
gb|ACR33100.1|  putative tea geometrid larvae-inducible protein         508   8e-176   Camellia sinensis [black tea]
ref|XP_002325361.2|  hypothetical protein POPTR_0019s04140g             508   8e-176   Populus trichocarpa [western balsam poplar]
ref|XP_004494761.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     508   1e-175   
ref|XP_010485798.1|  PREDICTED: GDSL esterase/lipase LTL1-like          509   1e-175   
ref|XP_008441804.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     508   1e-175   
ref|XP_010413520.1|  PREDICTED: GDSL esterase/lipase LTL1               508   1e-175   
ref|XP_003554732.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     508   1e-175   
ref|XP_010463906.1|  PREDICTED: GDSL esterase/lipase LTL1               508   1e-175   
emb|CDX92063.1|  BnaC03g33650D                                          507   3e-175   
ref|XP_007151673.1|  hypothetical protein PHAVU_004G066300g             507   3e-175   
ref|XP_008350788.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     505   3e-175   
gb|KHN43145.1|  GDSL esterase/lipase                                    506   4e-175   
ref|XP_009108075.1|  PREDICTED: GDSL esterase/lipase At5g33370          507   4e-175   
ref|XP_007151675.1|  hypothetical protein PHAVU_004G066500g             507   4e-175   
emb|CAN67727.1|  hypothetical protein VITISV_038832                     506   5e-175   Vitis vinifera
gb|ACU23289.1|  unknown                                                 506   5e-175   Glycine max [soybeans]
ref|XP_004489545.1|  PREDICTED: GDSL esterase/lipase LTL1-like          506   7e-175   
ref|XP_002268296.2|  PREDICTED: GDSL esterase/lipase At5g33370          506   7e-175   Vitis vinifera
ref|XP_010263996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     506   8e-175   
ref|XP_010558733.1|  PREDICTED: GDSL esterase/lipase LTL1               506   8e-175   
gb|AES82718.2|  GDSL-like lipase/acylhydrolase                          506   9e-175   
ref|XP_003543915.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     506   1e-174   
ref|XP_004302115.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     506   1e-174   
ref|XP_007151676.1|  hypothetical protein PHAVU_004G066600g             506   1e-174   
ref|XP_008443761.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    505   1e-174   
ref|XP_003626492.1|  GDSL esterase/lipase                               506   1e-174   
emb|CDY12384.1|  BnaC08g08210D                                          505   1e-174   
ref|XP_007147234.1|  hypothetical protein PHAVU_006G107200g             506   2e-174   
emb|CDY47551.1|  BnaA08g07360D                                          505   2e-174   
ref|XP_009134760.1|  PREDICTED: GDSL esterase/lipase LTL1               505   2e-174   
ref|XP_006437267.1|  hypothetical protein CICLE_v10033835mg             505   2e-174   
ref|XP_006484791.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     504   3e-174   
ref|XP_004494758.1|  PREDICTED: GDSL esterase/lipase LTL1-like          504   4e-174   
ref|XP_003554733.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     504   4e-174   
ref|XP_007133949.1|  hypothetical protein PHAVU_010G005800g             504   5e-174   
ref|XP_009386573.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     504   5e-174   
ref|XP_011002017.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     504   5e-174   
ref|XP_011084387.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     503   6e-174   
gb|KDO46628.1|  hypothetical protein CISIN_1g041652mg                   504   7e-174   
ref|XP_002884438.1|  Li-tolerant lipase 1                               503   8e-174   
gb|KFK24279.1|  hypothetical protein AALP_AAs47157U000200               503   9e-174   
gb|KDO52498.1|  hypothetical protein CISIN_1g017684mg                   503   1e-173   
gb|KHN41491.1|  GDSL esterase/lipase                                    503   1e-173   
ref|XP_004953113.1|  PREDICTED: GDSL esterase/lipase LTL1-like          503   1e-173   
emb|CDP04255.1|  unnamed protein product                                503   1e-173   
ref|XP_004142546.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     502   2e-173   
ref|XP_003521785.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     502   2e-173   
ref|XP_007030303.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    502   2e-173   
ref|XP_006297961.1|  hypothetical protein CARUB_v10014002mg             501   4e-173   
ref|XP_006478980.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     501   4e-173   
ref|XP_006443290.1|  hypothetical protein CICLE_v10020515mg             502   6e-173   
gb|KHN35335.1|  GDSL esterase/lipase                                    500   9e-173   
ref|XP_008810066.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     500   1e-172   
gb|KFK37853.1|  hypothetical protein AALP_AA3G037800                    499   3e-172   
ref|XP_009405750.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     499   4e-172   
ref|XP_004249922.1|  PREDICTED: GDSL esterase/lipase At5g33370          499   5e-172   
ref|XP_008370770.1|  PREDICTED: GDSL esterase/lipase LTL1-like          498   7e-172   
gb|ACU23502.1|  unknown                                                 499   7e-172   Glycine max [soybeans]
gb|KHG28665.1|  hypothetical protein F383_15485                         498   8e-172   
gb|KDP23751.1|  hypothetical protein JCGZ_23584                         498   1e-171   
ref|NP_187079.1|  Li-tolerant lipase 1                                  497   2e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043319.1|  PREDICTED: GDSL esterase/lipase LTL1-like          497   3e-171   
ref|XP_008677149.1|  PREDICTED: uncharacterized protein LOC100280...    496   5e-171   
ref|XP_006350316.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     496   6e-171   
ref|XP_009385316.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     496   8e-171   
ref|XP_002522022.1|  zinc finger protein, putative                      496   1e-170   Ricinus communis
gb|ABX75139.1|  lipase                                                  495   1e-170   Gossypium hirsutum [American cotton]
ref|XP_008345728.1|  PREDICTED: GDSL esterase/lipase LTL1-like          495   1e-170   
ref|XP_008370782.1|  PREDICTED: GDSL esterase/lipase LTL1-like          495   2e-170   
ref|NP_001146251.1|  hypothetical protein precursor                     495   3e-170   Zea mays [maize]
ref|XP_003618755.1|  GDSL esterase/lipase                               494   3e-170   
ref|XP_010936081.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     494   4e-170   
ref|XP_002265999.1|  PREDICTED: GDSL esterase/lipase At4g28780          494   5e-170   Vitis vinifera
ref|XP_009348738.1|  PREDICTED: GDSL esterase/lipase LTL1-like          493   8e-170   
ref|NP_001047441.1|  Os02g0617400                                       493   1e-169   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86703.1|  hypothetical protein OsI_08086                          493   1e-169   Oryza sativa Indica Group [Indian rice]
ref|XP_004976167.1|  PREDICTED: GDSL esterase/lipase LTL1-like          493   1e-169   
gb|KCW85323.1|  hypothetical protein EUGRSUZ_B02163                     493   1e-169   
ref|XP_009587010.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     492   2e-169   
ref|XP_004494759.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     492   2e-169   
ref|XP_009379724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     492   2e-169   
ref|XP_007147237.1|  hypothetical protein PHAVU_006G107400g             492   2e-169   
gb|ACG37655.1|  anther-specific proline-rich protein APG                492   3e-169   Zea mays [maize]
gb|ACR37591.1|  unknown                                                 491   4e-169   Zea mays [maize]
ref|XP_006660400.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     491   5e-169   
ref|XP_010530492.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    491   7e-169   
gb|EMT19317.1|  GDSL esterase/lipase                                    491   9e-169   
gb|ACG46653.1|  anther-specific proline-rich protein APG precursor      491   9e-169   Zea mays [maize]
ref|XP_003626493.1|  GDSL esterase/lipase                               490   1e-168   
ref|XP_007030301.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    490   1e-168   
ref|XP_009124003.1|  PREDICTED: GDSL esterase/lipase LTL1-like          489   3e-168   
ref|NP_001141295.1|  uncharacterized protein LOC100273386 precursor     489   3e-168   Zea mays [maize]
ref|XP_009348740.1|  PREDICTED: GDSL esterase/lipase LTL1-like          489   3e-168   
ref|XP_004247304.1|  PREDICTED: GDSL esterase/lipase At4g28780          489   3e-168   
emb|CDY49349.1|  BnaA05g33110D                                          489   3e-168   
ref|NP_001136990.1|  uncharacterized protein LOC100217152               490   4e-168   Zea mays [maize]
ref|XP_009766488.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     489   4e-168   
emb|CDY42916.1|  BnaC05g47350D                                          489   4e-168   
dbj|BAK06471.1|  predicted protein                                      489   5e-168   
ref|XP_002467122.1|  hypothetical protein SORBIDRAFT_01g020000          488   6e-168   Sorghum bicolor [broomcorn]
ref|XP_006408203.1|  hypothetical protein EUTSA_v10020986mg             488   7e-168   
ref|XP_002446760.1|  hypothetical protein SORBIDRAFT_06g021990          489   8e-168   Sorghum bicolor [broomcorn]
gb|KEH28987.1|  GDSL-like lipase/acylhydrolase                          488   8e-168   
gb|EYU19868.1|  hypothetical protein MIMGU_mgv1a008447mg                488   9e-168   
ref|XP_011083094.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    488   1e-167   
ref|XP_011002019.1|  PREDICTED: GDSL esterase/lipase LTL1-like          488   1e-167   
ref|XP_008235540.1|  PREDICTED: GDSL esterase/lipase At4g28780          488   1e-167   
ref|NP_001241754.1|  anther-specific proline-rich protein APG pre...    487   3e-167   
ref|XP_002303095.1|  GDSL-motif lipase/hydrolase family protein         486   3e-167   Populus trichocarpa [western balsam poplar]
dbj|BAK07334.1|  predicted protein                                      486   4e-167   
gb|KGN66731.1|  hypothetical protein Csa_1G665920                       486   4e-167   
ref|XP_008388753.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     486   4e-167   
ref|NP_001132075.1|  uncharacterized protein LOC100193489 precursor     485   1e-166   Zea mays [maize]
ref|XP_003580102.1|  PREDICTED: GDSL esterase/lipase LTL1               485   2e-166   
ref|XP_004489173.1|  PREDICTED: GDSL esterase/lipase LTL1-like          484   2e-166   
ref|XP_008382662.1|  PREDICTED: GDSL esterase/lipase At4g28780          484   3e-166   
ref|XP_002454777.1|  hypothetical protein SORBIDRAFT_04g037130          484   3e-166   Sorghum bicolor [broomcorn]
emb|CDP03830.1|  unnamed protein product                                484   3e-166   
ref|NP_001053264.1|  Os04g0507700                                       484   4e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002319124.2|  hypothetical protein POPTR_0013s04780g             485   7e-166   Populus trichocarpa [western balsam poplar]
ref|XP_010069682.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     482   2e-165   
gb|EPS69813.1|  hypothetical protein M569_04951                         480   3e-165   
emb|CDP04257.1|  unnamed protein product                                481   4e-165   
ref|XP_010524958.1|  PREDICTED: GDSL esterase/lipase At5g18430          481   4e-165   
ref|XP_006652494.1|  PREDICTED: GDSL esterase/lipase LTL1-like          481   5e-165   
ref|XP_003573228.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     481   5e-165   
ref|XP_008364335.1|  PREDICTED: GDSL esterase/lipase LTL1-like          480   8e-165   
ref|XP_011038450.1|  PREDICTED: GDSL esterase/lipase LTL1-like          480   8e-165   
gb|EMT08293.1|  GDSL esterase/lipase LTL1                               480   1e-164   
gb|EMS62626.1|  GDSL esterase/lipase LTL1                               480   1e-164   
dbj|BAJ85303.1|  predicted protein                                      479   2e-164   
ref|XP_009398857.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     479   2e-164   
ref|XP_009389128.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     481   3e-164   
ref|XP_003533553.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     479   4e-164   
ref|XP_002325359.2|  hypothetical protein POPTR_0019s04110g             480   4e-164   Populus trichocarpa [western balsam poplar]
ref|XP_010447915.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     478   6e-164   
ref|XP_003570388.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     478   7e-164   
ref|XP_010438383.1|  PREDICTED: GDSL esterase/lipase At4g28780          478   9e-164   
ref|XP_004955275.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     479   1e-163   
gb|AAN05519.1|  putative early nodulin gene (Enod) related protein      478   1e-163   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064786.1|  Os10g0463200                                       478   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009129278.1|  PREDICTED: GDSL esterase/lipase At4g28780          476   3e-163   
emb|CDY35219.1|  BnaA01g08120D                                          476   3e-163   
gb|EAY88013.1|  hypothetical protein OsI_09436                          477   3e-163   Oryza sativa Indica Group [Indian rice]
ref|XP_003574015.1|  PREDICTED: GDSL esterase/lipase LTL1               476   3e-163   
gb|AFW64010.1|  hypothetical protein ZEAMMB73_688590                    476   4e-163   
emb|CDY06871.1|  BnaC01g09700D                                          476   5e-163   
ref|XP_004242381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     475   6e-163   
ref|NP_001048510.1|  Os02g0816200                                       476   6e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003552505.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     475   1e-162   
gb|KHN13664.1|  GDSL esterase/lipase                                    475   1e-162   
ref|XP_006352714.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     475   1e-162   
ref|NP_194607.1|  GDSL esterase/lipase                                  474   1e-162   Arabidopsis thaliana [mouse-ear cress]
gb|AFW63005.1|  hypothetical protein ZEAMMB73_059549                    476   2e-162   
ref|XP_008643799.1|  PREDICTED: anther-specific proline-rich prot...    475   2e-162   
ref|XP_006661836.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     475   2e-162   
ref|NP_001151440.1|  anther-specific proline-rich protein APG pre...    475   2e-162   Zea mays [maize]
ref|XP_006412910.1|  hypothetical protein EUTSA_v10025523mg             474   2e-162   
gb|EYU33157.1|  hypothetical protein MIMGU_mgv1a008646mg                474   2e-162   
ref|XP_010433162.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     474   3e-162   
ref|XP_004982954.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     474   3e-162   
gb|KFK29417.1|  hypothetical protein AALP_AA7G132000                    473   7e-162   
ref|XP_002869473.1|  GDSL-motif lipase/hydrolase family protein         472   1e-161   
ref|XP_009589092.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     472   1e-161   
ref|XP_009801786.1|  PREDICTED: GDSL esterase/lipase LTL1-like          472   2e-161   
ref|XP_004495029.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    472   2e-161   
ref|NP_001062538.1|  Os08g0565900                                       473   2e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162645.1|  hypothetical protein PHAVU_001G168200g             472   5e-161   
ref|XP_003542450.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     471   5e-161   
ref|XP_003536954.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     471   6e-161   
ref|XP_006283981.1|  hypothetical protein CARUB_v10005104mg             470   6e-161   
gb|KHN48972.1|  GDSL esterase/lipase                                    471   7e-161   
ref|XP_006400391.1|  hypothetical protein EUTSA_v10013876mg             470   9e-161   
gb|KHN05905.1|  GDSL esterase/lipase                                    470   1e-160   
ref|XP_007139614.1|  hypothetical protein PHAVU_008G044500g             468   5e-160   
ref|XP_002873894.1|  predicted protein                                  467   9e-160   
gb|KEH21597.1|  GDSL-like lipase/acylhydrolase                          467   1e-159   
gb|ACU23670.1|  unknown                                                 468   1e-159   
gb|KEH42418.1|  GDSL-like lipase/acylhydrolase                          467   2e-159   
ref|XP_004495028.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...    467   2e-159   
ref|NP_197344.2|  GDSL esterase/lipase                                  466   2e-159   
gb|EPS67986.1|  hypothetical protein M569_06783                         466   3e-159   
ref|XP_009126251.1|  PREDICTED: GDSL esterase/lipase At5g18430          466   4e-159   
gb|ACG31868.1|  anther-specific proline-rich protein APG precursor      465   4e-159   
gb|AFW58803.1|  hypothetical protein ZEAMMB73_832786                    464   5e-159   
gb|AEY85024.1|  zinc finger protein                                     466   6e-159   
gb|EMT16609.1|  GDSL esterase/lipase                                    466   6e-159   
ref|XP_007144437.1|  hypothetical protein PHAVU_007G156000g             464   2e-158   
emb|CDY02631.1|  BnaC02g08040D                                          464   2e-158   
ref|XP_006287983.1|  hypothetical protein CARUB_v10001218mg             463   6e-158   
ref|XP_010492845.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     462   8e-158   
dbj|BAJ90848.1|  predicted protein                                      461   5e-157   
ref|XP_010038336.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     459   2e-156   
ref|XP_010528706.1|  PREDICTED: GDSL esterase/lipase LTL1-like          459   2e-156   
ref|XP_010420599.1|  PREDICTED: GDSL esterase/lipase At5g18430          458   3e-156   
ref|XP_010454082.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     458   4e-156   
gb|KFK26081.1|  hypothetical protein AALP_AA8G200400                    458   5e-156   
ref|XP_004304788.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     458   5e-156   
ref|XP_002521156.1|  zinc finger protein, putative                      458   6e-156   
dbj|BAJ91997.1|  predicted protein                                      458   6e-156   
ref|XP_011024535.1|  PREDICTED: GDSL esterase/lipase At4g28780          457   8e-156   
gb|EYU46367.1|  hypothetical protein MIMGU_mgv1a008634mg                454   1e-154   
ref|XP_008345732.1|  PREDICTED: GDSL esterase/lipase At5g18430-like     454   2e-154   
gb|KDO52499.1|  hypothetical protein CISIN_1g017684mg                   452   4e-154   
ref|XP_007201335.1|  hypothetical protein PRUPE_ppa007652mg             450   6e-153   
ref|XP_003590908.1|  GDSL esterase/lipase                               449   9e-153   
ref|XP_006443680.1|  hypothetical protein CICLE_v10020728mg             446   2e-151   
ref|XP_010684826.1|  PREDICTED: GDSL esterase/lipase At4g28780-like     446   3e-151   
ref|XP_010530493.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    441   4e-150   
gb|EMT14508.1|  GDSL esterase/lipase                                    441   2e-149   
gb|EMT04884.1|  GDSL esterase/lipase                                    436   1e-147   
gb|EMS53263.1|  GDSL esterase/lipase LTL1                               434   9e-147   
ref|XP_009371058.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    429   6e-145   
gb|EPS60817.1|  hypothetical protein M569_13984                         426   8e-145   
ref|XP_003626500.1|  GDSL esterase/lipase                               423   2e-143   
ref|XP_006443292.1|  hypothetical protein CICLE_v10020640mg             423   3e-143   
emb|CDX74196.1|  BnaA03g28510D                                          419   4e-141   
gb|KDO52501.1|  hypothetical protein CISIN_1g017684mg                   413   1e-139   
gb|EMT05671.1|  GDSL esterase/lipase                                    407   2e-136   
ref|XP_007147235.1|  hypothetical protein PHAVU_006G1073001g            398   9e-134   
ref|XP_009777585.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    396   2e-132   
ref|XP_002522023.1|  zinc finger protein, putative                      398   2e-132   
gb|KCW61468.1|  hypothetical protein EUGRSUZ_H04205                     392   7e-131   
ref|XP_010440677.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...    392   1e-130   
ref|XP_006443286.1|  hypothetical protein CICLE_v10020709mg             389   5e-130   
ref|NP_001078631.1|  GDSL esterase/lipase                               388   4e-129   
gb|KDO52500.1|  hypothetical protein CISIN_1g017684mg                   385   5e-128   
ref|XP_006576592.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    385   7e-128   
ref|XP_008443762.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    383   3e-127   
ref|XP_003520622.2|  PREDICTED: GDSL esterase/lipase At4g28780-like     378   2e-125   
gb|ABK25359.1|  unknown                                                 376   5e-124   
gb|AFW63007.1|  hypothetical protein ZEAMMB73_059549                    374   1e-123   
gb|ABR17593.1|  unknown                                                 374   2e-123   
gb|ABK22816.1|  unknown                                                 374   2e-123   
ref|XP_011083095.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...    367   4e-121   
gb|KHN47677.1|  GDSL esterase/lipase                                    354   2e-116   
ref|XP_004173982.1|  PREDICTED: GDSL esterase/lipase At5g33370-like     348   5e-115   
gb|KCW50155.1|  hypothetical protein EUGRSUZ_K03589                     351   6e-115   
gb|ACU18148.1|  unknown                                                 334   8e-109   
ref|XP_002975076.1|  hypothetical protein SELMODRAFT_174517             312   8e-99    
ref|XP_002975075.1|  hypothetical protein SELMODRAFT_232422             310   9e-99    
ref|XP_002988966.1|  hypothetical protein SELMODRAFT_128884             307   5e-97    
ref|XP_003589453.1|  GDSL esterase/lipase                               305   7e-96    
ref|XP_002988967.1|  hypothetical protein SELMODRAFT_129056             303   2e-95    
ref|XP_002988963.1|  hypothetical protein SELMODRAFT_128933             297   3e-93    
gb|AFK40233.1|  unknown                                                 287   1e-91    
gb|ACU17474.1|  unknown                                                 279   4e-88    
gb|EPS72894.1|  hypothetical protein M569_01863                         278   5e-88    
ref|XP_002522024.1|  carboxylic ester hydrolase, putative               278   2e-87    
gb|ACU15087.1|  unknown                                                 269   1e-84    
gb|KHN14798.1|  GDSL esterase/lipase                                    268   2e-84    
ref|XP_002983359.1|  hypothetical protein SELMODRAFT_118141             271   3e-83    
ref|XP_001764401.1|  predicted protein                                  270   9e-83    
ref|XP_001758743.1|  predicted protein                                  270   1e-82    
gb|EAY78821.1|  hypothetical protein OsI_33925                          268   2e-82    
ref|XP_003626494.1|  GDSL esterase/lipase                               264   3e-82    
gb|KHN14888.1|  GDSL esterase/lipase                                    263   3e-82    
ref|XP_002960678.1|  hypothetical protein SELMODRAFT_403122             268   5e-82    
tpg|DAA37013.1|  TPA: hypothetical protein ZEAMMB73_160387              262   2e-81    
gb|AES61163.2|  GDSL-like lipase/acylhydrolase                          258   2e-80    
ref|XP_004145849.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     262   2e-79    
ref|XP_008457023.1|  PREDICTED: GDSL esterase/lipase At5g37690          261   4e-79    
ref|XP_010271296.1|  PREDICTED: GDSL esterase/lipase At5g37690          257   2e-77    
ref|XP_004305842.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     255   5e-77    
gb|AAP35038.1|  putative GDSL-motif lipase                              248   7e-77    
ref|XP_009101821.1|  PREDICTED: GDSL esterase/lipase At3g50400          255   7e-77    
emb|CDY54699.1|  BnaC01g42330D                                          255   8e-77    
gb|ACU15164.1|  unknown                                                 248   1e-76    
ref|XP_007032977.1|  SGNH hydrolase-type esterase superfamily pro...    254   2e-76    
ref|XP_008381376.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     252   5e-76    
ref|XP_009367135.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     251   2e-75    
ref|XP_006372567.1|  hypothetical protein POPTR_0017s02870g             250   4e-75    
ref|XP_002531921.1|  zinc finger protein, putative                      250   6e-75    
ref|XP_002967217.1|  hypothetical protein SELMODRAFT_87116              249   9e-75    
ref|NP_190609.1|  GDSL esterase/lipase                                  249   2e-74    
ref|XP_002960505.1|  hypothetical protein SELMODRAFT_73430              248   2e-74    
ref|XP_007216510.1|  hypothetical protein PRUPE_ppa025674mg             248   3e-74    
ref|XP_002876029.1|  GDSL-motif lipase/hydrolase family protein         248   4e-74    
ref|XP_006384153.1|  hypothetical protein POPTR_0004s08520g             247   6e-74    
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     247   7e-74    
gb|KHG07651.1|  hypothetical protein F383_34423                         247   1e-73    
ref|XP_009370610.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     246   2e-73    
ref|XP_010062263.1|  PREDICTED: GDSL esterase/lipase At5g37690          245   4e-73    
ref|XP_004232990.1|  PREDICTED: GDSL esterase/lipase At5g45670          245   5e-73    
ref|XP_002984381.1|  hypothetical protein SELMODRAFT_120432             244   6e-73    
ref|XP_008228044.1|  PREDICTED: GDSL esterase/lipase At5g37690          244   7e-73    
ref|XP_004289592.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     244   8e-73    
gb|KDO51878.1|  hypothetical protein CISIN_1g018844mg                   244   1e-72    
ref|XP_008380187.1|  PREDICTED: GDSL esterase/lipase At2g42990          243   1e-72    
ref|XP_006437131.1|  hypothetical protein CICLE_v10031968mg             243   1e-72    
ref|XP_006291327.1|  hypothetical protein CARUB_v10017460mg             244   2e-72    
gb|AFK33443.1|  unknown                                                 238   2e-72    
ref|XP_010426585.1|  PREDICTED: GDSL esterase/lipase At3g50400-like     244   2e-72    
ref|XP_009117276.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     244   2e-72    
ref|XP_006355561.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     243   2e-72    
gb|KDO50801.1|  hypothetical protein CISIN_1g041889mg                   243   2e-72    
ref|XP_002972805.1|  hypothetical protein SELMODRAFT_232013             243   2e-72    
ref|XP_007215624.1|  hypothetical protein PRUPE_ppa007979mg             243   2e-72    
ref|XP_006482381.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     243   2e-72    
ref|NP_001239864.1|  uncharacterized protein LOC100809260 precursor     243   2e-72    
emb|CBI33516.3|  unnamed protein product                                243   3e-72    
ref|XP_010515402.1|  PREDICTED: GDSL esterase/lipase At3g50400-like     243   3e-72    
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     242   3e-72    
ref|XP_002274836.2|  PREDICTED: GDSL esterase/lipase At5g37690          243   3e-72    
ref|XP_010272684.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     242   4e-72    
ref|XP_009789284.1|  PREDICTED: GDSL esterase/lipase At5g37690          242   4e-72    
ref|XP_006484904.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     242   5e-72    
ref|XP_011085659.1|  PREDICTED: GDSL esterase/lipase At2g23540          243   5e-72    
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         242   5e-72    
ref|XP_010503713.1|  PREDICTED: GDSL esterase/lipase At3g50400          242   6e-72    
ref|XP_011007241.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     242   7e-72    
gb|EYU39392.1|  hypothetical protein MIMGU_mgv1a018005mg                242   7e-72    
ref|XP_010680502.1|  PREDICTED: GDSL esterase/lipase At2g23540          242   7e-72    
ref|XP_006828510.1|  hypothetical protein AMTR_s00060p00187780          242   7e-72    
ref|XP_009612511.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     242   8e-72    
ref|XP_006285681.1|  hypothetical protein CARUB_v10007145mg             241   8e-72    
ref|XP_006430582.1|  hypothetical protein CICLE_v10013564mg             241   9e-72    
ref|XP_011001569.1|  PREDICTED: GDSL esterase/lipase At5g37690          241   1e-71    
ref|XP_004499972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     241   1e-71    
ref|XP_009769556.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     241   2e-71    
emb|CDX76857.1|  BnaC08g34430D                                          241   2e-71    
dbj|BAB56037.1|  putative proline-rich protein                          241   2e-71    
gb|ABR18010.1|  unknown                                                 241   2e-71    
emb|CDX89578.1|  BnaC04g35970D                                          241   2e-71    
ref|XP_008343129.1|  PREDICTED: GDSL esterase/lipase At5g37690          240   2e-71    
ref|XP_004300561.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     241   3e-71    
ref|XP_010528545.1|  PREDICTED: GDSL esterase/lipase At5g37690          240   3e-71    
emb|CDY55498.1|  BnaA05g34360D                                          240   3e-71    
dbj|BAK00337.1|  predicted protein                                      241   4e-71    
ref|XP_002870554.1|  hypothetical protein ARALYDRAFT_493746             239   5e-71    
gb|KFK36130.1|  hypothetical protein AALP_AA4G081500                    239   5e-71    
ref|XP_003632456.1|  PREDICTED: GDSL esterase/lipase At2g23540          240   5e-71    
ref|XP_001759235.1|  predicted protein                                  239   6e-71    
ref|XP_010267929.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     239   7e-71    
emb|CDY53653.1|  BnaC04g52870D                                          239   8e-71    
gb|AAX20033.1|  GDSL-lipase protein                                     239   9e-71    
sp|O23470.2|GDL64_ARATH  RecName: Full=GDSL esterase/lipase At4g1...    239   9e-71    
ref|NP_179935.1|  GDSL esterase/lipase                                  240   9e-71    
emb|CDY38949.1|  BnaA04g13700D                                          239   1e-70    
ref|XP_006414376.1|  hypothetical protein EUTSA_v10027022mg             239   1e-70    
gb|KHG08353.1|  hypothetical protein F383_35589                         239   1e-70    
ref|XP_009140469.1|  PREDICTED: GDSL esterase/lipase At2g23540          239   1e-70    
ref|XP_006364625.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     239   1e-70    
ref|XP_006404033.1|  hypothetical protein EUTSA_v10010459mg             239   1e-70    
ref|XP_001757546.1|  predicted protein                                  239   1e-70    
ref|XP_002878691.1|  GDSL-motif lipase/hydrolase family protein         239   1e-70    
ref|XP_010938710.1|  PREDICTED: GDSL esterase/lipase At2g23540          239   1e-70    
ref|XP_010670128.1|  PREDICTED: GDSL esterase/lipase At5g37690          239   1e-70    
ref|XP_008229570.1|  PREDICTED: GDSL esterase/lipase At2g42990          238   2e-70    
ref|XP_004250176.1|  PREDICTED: GDSL esterase/lipase At5g37690          238   2e-70    
ref|NP_181827.2|  GDSL esterase/lipase                                  238   2e-70    
ref|XP_010028324.1|  PREDICTED: GDSL esterase/lipase At2g23540          238   2e-70    
ref|XP_010524116.1|  PREDICTED: GDSL esterase/lipase At2g42990          238   2e-70    
gb|KDP39193.1|  hypothetical protein JCGZ_00950                         238   2e-70    
ref|XP_009409252.1|  PREDICTED: GDSL esterase/lipase At5g37690          239   3e-70    
ref|XP_009142896.1|  PREDICTED: GDSL esterase/lipase At2g42990          238   3e-70    
ref|XP_009411706.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     238   3e-70    
ref|XP_011100466.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     237   3e-70    
ref|XP_006404839.1|  hypothetical protein EUTSA_v10000195mg             238   3e-70    
ref|XP_010440879.1|  PREDICTED: GDSL esterase/lipase At5g37690          238   4e-70    
emb|CCI55370.1|  PH01B035L11.15                                         242   4e-70    
ref|XP_002870171.1|  hypothetical protein ARALYDRAFT_355138             238   4e-70    
ref|XP_009589693.1|  PREDICTED: GDSL esterase/lipase At5g37690          237   5e-70    
ref|XP_001753090.1|  predicted protein                                  237   5e-70    
ref|XP_009376483.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     238   5e-70    
ref|XP_002306752.2|  GDSL-motif lipase/hydrolase family protein         236   5e-70    
ref|XP_001772825.1|  predicted protein                                  237   5e-70    
gb|KHG15434.1|  hypothetical protein F383_19515                         236   5e-70    
gb|EAZ05071.1|  hypothetical protein OsI_27261                          237   6e-70    
ref|XP_002880015.1|  GDSL-motif lipase/hydrolase family protein         236   6e-70    
ref|XP_004509186.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     237   6e-70    
ref|XP_002528958.1|  zinc finger protein, putative                      236   7e-70    
ref|XP_010449833.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     237   7e-70    
gb|KFK34289.1|  hypothetical protein AALP_AA5G125900                    243   7e-70    
ref|XP_010508487.1|  PREDICTED: GDSL esterase/lipase At2g42990          236   8e-70    
ref|XP_007047124.1|  Ankyrin repeat-containing protein isoform 1        238   8e-70    
ref|XP_010450525.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     236   9e-70    
ref|XP_006285255.1|  hypothetical protein CARUB_v10006620mg             237   9e-70    
gb|EPS68861.1|  hypothetical protein M569_05905                         236   1e-69    
ref|XP_002528959.1|  zinc finger protein, putative                      236   1e-69    
ref|XP_010108989.1|  GDSL esterase/lipase                               236   1e-69    
ref|XP_008241574.1|  PREDICTED: GDSL esterase/lipase At2g23540          236   1e-69    
ref|XP_006852691.1|  hypothetical protein AMTR_s00021p00254410          238   1e-69    
ref|XP_008796209.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     236   1e-69    
ref|XP_007204479.1|  hypothetical protein PRUPE_ppa021185mg             235   1e-69    
ref|XP_010434862.1|  PREDICTED: GDSL esterase/lipase At4g16230          236   1e-69    
ref|XP_002276681.1|  PREDICTED: GDSL esterase/lipase At2g04570          235   2e-69    
ref|XP_006411572.1|  hypothetical protein EUTSA_v10016869mg             235   2e-69    
ref|XP_007154385.1|  hypothetical protein PHAVU_003G114800g             236   2e-69    
ref|XP_010558438.1|  PREDICTED: GDSL esterase/lipase At3g50400          236   2e-69    
ref|XP_006658083.1|  PREDICTED: GDSL esterase/lipase At2g23540-like     236   2e-69    
gb|KDO51877.1|  hypothetical protein CISIN_1g018844mg                   235   2e-69    
ref|XP_010252590.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    235   2e-69    
ref|XP_006387004.1|  hypothetical protein POPTR_2251s00200g             228   2e-69    
ref|XP_010549002.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     235   2e-69    
ref|XP_011003477.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     235   3e-69    
ref|XP_008809415.1|  PREDICTED: GDSL esterase/lipase At5g37690          235   3e-69    



>ref|XP_009591832.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=370

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/330 (78%), Positives = 296/330 (90%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYG+DYPTHRPTGRFSNGLNIPDIISEKLG EPT+PYL+P
Sbjct  41    SLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSNGLNIPDIISEKLGMEPTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTGIQFVNII+I QQ++YFAEYQ+R+AAL+G EKAK+L
Sbjct  101   ELQGQKLLVGANFASAGVGILNDTGIQFVNIIRIGQQVEYFAEYQKRVAALVGTEKAKQL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+PFS RS Q+ LP+YV FVI+EYKKVL +LY LGARRV+
Sbjct  161   VKQALVLITLGGNDFVNNYYLVPFSLRSTQYALPDYVTFVISEYKKVLAKLYSLGARRVI  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S DG CA ELQ AA +FNP+LV ++  LN EI  + F+A NT+
Sbjct  221   VTGTGPLGCVPAELAQRSQDGNCAAELQEAASLFNPQLVEMLNGLNSEIGSHVFIAANTN  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DF+TNP+AFGFVTS+VACCGQGPYNG+GLCTPLS+LC NRDEYAFWD FHPSEKAN
Sbjct  281   QMHLDFVTNPQAFGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDEYAFWDPFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ G+  YMHPMNLST++ MDS A
Sbjct  341   RIIVQQILTGTTAYMHPMNLSTIMVMDSKA  370



>ref|XP_009769587.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana sylvestris]
Length=369

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/330 (78%), Positives = 296/330 (90%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYG+DYPTHRPTGRFSNGLNIPDIISEKLG EPT+PYL+P
Sbjct  40    SLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSNGLNIPDIISEKLGMEPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTGIQFVNII+I QQL+YFAEYQ+R+AAL+G EKAK+L
Sbjct  100   ELQGQKLLVGANFASAGVGILNDTGIQFVNIIRIGQQLEYFAEYQKRVAALVGTEKAKQL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V +ALVLITLGGNDFVNNYYL+PFS RS Q+ LP+YV FVI+EYK VL +LY LGARRV+
Sbjct  160   VKEALVLITLGGNDFVNNYYLVPFSLRSTQYALPDYVTFVISEYKHVLAKLYSLGARRVI  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S DG CA ELQ AA +FNP+LV ++  LN EI  + F+A NT+
Sbjct  220   VTGTGPLGCVPAELAQRSQDGNCAAELQEAASLFNPQLVEMLNGLNSEIGSHVFIAANTN  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DF+TNP+AFGFVTS+VACCGQGPYNG+GLCTPLS+LC NRDEYAFWD FHPSEKAN
Sbjct  280   QMHLDFVTNPQAFGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDEYAFWDPFHPSEKAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ G+  YMHPMNLST++ MDS A
Sbjct  340   RIIVQQILTGTTAYMHPMNLSTIMVMDSKA  369



>ref|XP_006340478.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=360

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/330 (77%), Positives = 297/330 (90%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD GNNN+LATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG EPT+PYL+P
Sbjct  31    SLVDTGNNNYLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGIEPTLPYLSP  90

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVG+LNDTGIQFVNII+I QQL+YFAEYQ+R+ ALIG EKAK+L
Sbjct  91    ELQGEKLLVGANFASAGVGVLNDTGIQFVNIIRIGQQLEYFAEYQKRVGALIGSEKAKQL  150

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V + LVLITLGGNDFVNNYYL+PFS RSRQ+ LP+YV +VI+EYK VL++LY LGARRV+
Sbjct  151   VKEGLVLITLGGNDFVNNYYLVPFSVRSRQYMLPDYVSYVISEYKNVLQKLYSLGARRVI  210

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S DG CA +LQ AA +FNP+LV ++  LN EI  + F+A NT+
Sbjct  211   VTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLFNPQLVEMLNGLNSEIGNHVFVAANTN  270

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DFIT+P+AFGFVTS+VACCGQGPYNGMGLCTPLS+LC+NRDEYAFWD FHP+EKAN
Sbjct  271   QMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLCTPLSNLCSNRDEYAFWDPFHPTEKAN  330

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV+Q++ G+  YMHPMNLST++ MDS A
Sbjct  331   RIIVEQILTGTTDYMHPMNLSTIMVMDSKA  360



>ref|XP_004237506.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
Length=363

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/330 (77%), Positives = 296/330 (90%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG E T+PYL+P
Sbjct  34    SLVDNGNNNYLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGLERTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVG+LNDTG+QFVNII+I QQL+YFAEYQ+R+ ALIG EKAKKL
Sbjct  94    ELQGGKLLVGANFASAGVGVLNDTGVQFVNIIRIGQQLEYFAEYQKRVGALIGSEKAKKL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V + LVLITLGGNDFVNNYYL+PFS RSRQ+ LP+YV +VI+EYK VL++LY+LGARRV+
Sbjct  154   VKEGLVLITLGGNDFVNNYYLVPFSVRSRQYMLPDYVSYVISEYKNVLQKLYNLGARRVI  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S DG CA +LQ AA +FNP+LV ++  LN EI  + F+A NT+
Sbjct  214   VTGTGPLGCVPAELAQRSRDGSCADDLQQAAVLFNPQLVEMLNGLNSEIGTHVFVAANTN  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DFIT+P+AFGFVTS+VACCGQGPYNGMGLCTPLS+LC NRDEYAFWD FHP+EKAN
Sbjct  274   QMHLDFITDPQAFGFVTSKVACCGQGPYNGMGLCTPLSNLCPNRDEYAFWDPFHPTEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV+Q+M G+  YMHPMNLST++ MDS A
Sbjct  334   RIIVEQIMTGTTDYMHPMNLSTIMVMDSKA  363



>ref|XP_011077072.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/330 (73%), Positives = 294/330 (89%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPTHRPTGRFSNGLNIPD+ISE++G E TMPYLNP
Sbjct  38    SLVDNGNNNYLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISEQMGWEATMPYLNP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVG+LNDTG QFVNII+IY+QL++F +YQQR++ALIG E+ KKL
Sbjct  98    ELTGQKLLVGANFASAGVGVLNDTGFQFVNIIRIYEQLNFFQQYQQRVSALIGEEETKKL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V ++LVL+TLGGNDFVNNYYL+P+S RSRQFTL  YV +V++EYKKVL RL+DLG RRV+
Sbjct  158   VKESLVLMTLGGNDFVNNYYLVPYSARSRQFTLQKYVPYVVSEYKKVLMRLHDLGPRRVI  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ AA +FNP+LV+++  LN+++  N F+A NT+
Sbjct  218   VTGTGPLGCVPAELALHSTNGECAEELQKAAALFNPQLVQMLNELNQQLGSNVFIAANTN  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+NP+AFGF TS++ACCGQGPYNG+GLCTP S+LC NRD Y FWD FHPSE+AN
Sbjct  278   QMHMDFISNPQAFGFTTSKIACCGQGPYNGLGLCTPFSNLCPNRDLYVFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             ++IV Q++ GS  YMHPMNLST++A+DS A
Sbjct  338   KLIVQQILAGSTAYMHPMNLSTIMALDSRA  367



>gb|EPS65950.1| hypothetical protein M569_08823, partial [Genlisea aurea]
Length=340

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/329 (72%), Positives = 296/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID+P+HRPTGRFSNGLNIPDIIS+  G EPT+PYL+P
Sbjct  12    SLVDNGNNNYLATTARADSPPYGIDHPSHRPTGRFSNGLNIPDIISQHFGWEPTLPYLSP  71

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVG+LNDTGIQFVNII+++QQL++F +YQQRLA LIG + AKKL
Sbjct  72    ELSGSKLLVGANFASAGVGVLNDTGIQFVNIIRVFQQLNFFEQYQQRLAVLIGKDAAKKL  131

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V ++LV ITLGGNDFVNNYYL+PFS RS+Q+++ +YV  VI+EYKKVLKRLY+LG RR++
Sbjct  132   VRNSLVFITLGGNDFVNNYYLVPFSIRSQQYSIDDYVPLVISEYKKVLKRLYELGPRRII  191

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS +G+C PELQ AA +FNP+LV+++  LNRE+  +AFLA NT+
Sbjct  192   VTGTGPLGCVPAELAQHSQNGECVPELQKAAALFNPQLVQMLDELNREVGSHAFLAANTN  251

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDF++NP+AFGFV+SQVACCGQGPYNG+GLCT  S+LC+NRD+Y FWD FHPSEKAN
Sbjct  252   QMHMDFMSNPQAFGFVSSQVACCGQGPYNGLGLCTGFSNLCSNRDQYVFWDPFHPSEKAN  311

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV Q++ G+NTYMHP+NL+T++A+D  
Sbjct  312   KLIVQQILTGTNTYMHPLNLTTLMALDKQ  340



>ref|XP_007206865.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
 gb|EMJ08064.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
Length=363

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 296/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++LAT+ARADS PYGIDYPTHRPTGRFSNGLNIPDIISE+LGSEPT+PYL+P
Sbjct  34    SLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDIISEQLGSEPTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQ LL+GANFASAG+GILNDTGIQF+NII+I++QL+YF +YQ R+AAL+G E+ ++L
Sbjct  94    HLTGQNLLVGANFASAGIGILNDTGIQFLNIIRIFKQLEYFEQYQTRVAALVGPEQTERL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGARRV+
Sbjct  154   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS  G+C+ EL+ AA +FNP+LV++I  LN ++  + F+A N +
Sbjct  214   VTGTGPLGCVPAELAQHSRAGECSVELERAASLFNPQLVQMINGLNSQLGSDVFVAANAY  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP+A+GFVTS++ACCGQGPYNG+GLCT +S+LC NRD YAFWDAFHPSEKAN
Sbjct  274   EMHMDFISNPRAYGFVTSKIACCGQGPYNGIGLCTMVSNLCPNRDLYAFWDAFHPSEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RII  Q++ GSN YM+PMNLST+LA+DS 
Sbjct  334   RIIAQQILTGSNKYMNPMNLSTILALDSR  362



>ref|XP_008218370.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Prunus mume]
Length=363

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/329 (74%), Positives = 295/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++LAT+ARADS PYGIDYPTHRPTGRFSNGLNIPDIISE+LGSEPT+PYL+P
Sbjct  34    SLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDIISEQLGSEPTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQ LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQ R+AAL+G E+ ++L
Sbjct  94    QLTGQNLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFEQYQTRVAALVGPEQTQRL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGARRV+
Sbjct  154   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS  G+C+ EL+ AA +FNP+LV++I  LN +I  + F+A N +
Sbjct  214   VTGTGPLGCVPAELAQHSRAGECSVELERAASLFNPQLVQMINGLNSQIGSDVFVAANAY  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI +P+A+GFVTS++ACCGQGPYNG+GLCT +S+LC NRD YAFWD FHPSEKAN
Sbjct  274   EMHMDFIADPQAYGFVTSKIACCGQGPYNGIGLCTVVSNLCPNRDLYAFWDPFHPSEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RII  Q++ GSN YM+PMNLST+LA+DS 
Sbjct  334   RIIAQQILTGSNKYMNPMNLSTILALDSR  362



>ref|XP_003521784.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN35334.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 296/328 (90%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARAD+PPYGID+PT RPTGRFSNG NIPD IS+ LG+E T+PYL+P
Sbjct  35    SLVDNGNNNFLATTARADAPPYGIDFPTGRPTGRFSNGYNIPDFISQSLGAESTLPYLDP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQFVNII+IY+QL+Y+ EYQQR++ALIG E+ ++L
Sbjct  95    ELDGERLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYWQEYQQRVSALIGPEQTERL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             +N ALVLITLGGNDFVNNYYL+P+S RSRQ+ LP+YV ++I+EYKKVL+RLY++GARRV+
Sbjct  155   INGALVLITLGGNDFVNNYYLVPYSARSRQYNLPDYVKYIISEYKKVLRRLYEIGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G C+ ELQ AA +FNP+LV+II+ LN EI  N F+ VNT 
Sbjct  215   VTGTGPLGCVPAELAQRSTNGDCSAELQQAAALFNPQLVQIIRQLNSEIGSNVFVGVNTQ  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DFI+NP+ +GFVTS+VACCGQGPYNG+GLCTP S+LC NRD YAFWD FHP+E+AN
Sbjct  275   QMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNLCPNRDSYAFWDPFHPTERAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q+++G++ YM+PMNLST++A+DS
Sbjct  335   RIIVQQILSGTSEYMYPMNLSTIMALDS  362



>gb|EYU39770.1| hypothetical protein MIMGU_mgv1a009318mg [Erythranthe guttata]
Length=345

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 290/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+ PYGIDYP+H+ TGRFSNGLNIPDIISE +G EPT+PYL+P
Sbjct  16    SLVDNGNNNYLVTTARADAYPYGIDYPSHQATGRFSNGLNIPDIISESMGWEPTLPYLSP  75

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL  QKLLIGANFASAGVG+LNDTGIQFVNII+IYQQL+YF EY+QR++ LIG ++ +KL
Sbjct  76    QLVEQKLLIGANFASAGVGVLNDTGIQFVNIIRIYQQLNYFEEYKQRVSELIGEDETQKL  135

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V ++LVLITLGGNDFVNNY+L+P+S RSRQ++LP YV FVI+EYKKVLKRLY LG RRV+
Sbjct  136   VKESLVLITLGGNDFVNNYFLVPYSARSRQYSLPKYVPFVISEYKKVLKRLYKLGFRRVI  195

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS DG+CA ELQ AA +FNP+L +++K LN  +  + F+A NT+
Sbjct  196   VTGTGPLGCVPAELAQHSTDGECAKELQKAASLFNPQLDKMLKQLNHGLGKDVFIAANTN  255

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI NP  FGFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  256   LMHMDFIANPTRFGFVTSKIACCGQGPYNGLGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  315

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV QM+ GSN YMHPMNLST++AMDS A
Sbjct  316   RMIVQQMLTGSNLYMHPMNLSTIMAMDSRA  345



>ref|XP_009611210.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana tomentosiformis]
Length=369

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/329 (72%), Positives = 295/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYP+HRPTGRFSNGLNIPDIISE+LG EPT+PYL+P
Sbjct  40    SLVDNGNNNYLITSARADSPPYGIDYPSHRPTGRFSNGLNIPDIISEQLGMEPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLLIGANFASAGVGILNDTGIQF+NII+I +QL+YF +YQ+R+ A+IG E+ ++L
Sbjct  100   ELTGDKLLIGANFASAGVGILNDTGIQFLNIIRIGKQLEYFEQYQRRVTAVIGAEQTQQL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L++LY+LGARRV+
Sbjct  160   VNSALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVRYLISEYRKILQKLYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+CA ELQ AA +FNP+L +++  LN ++  + F+A NT+
Sbjct  220   VTGTGPMGCVPAELAQRSPTGECAVELQRAASLFNPQLTQLLSDLNSQLAADVFVAANTY  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  280   AMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ GS+TYM+PMNLS+++A+DS 
Sbjct  340   RIIVQQILTGSSTYMNPMNLSSIMALDSR  368



>ref|XP_011084724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/330 (74%), Positives = 290/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE++G EPT+PYL+P
Sbjct  38    SLVDNGNNNYLVTTARADAPPYGIDYPTHRPTGRFSNGLNIPDIISEEMGWEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVG+LNDTGIQFVNII+IYQQL+YF EYQQRL A IG ++A+K+
Sbjct  98    ELRGSKLLVGANFASAGVGVLNDTGIQFVNIIRIYQQLNYFEEYQQRLRAEIGVDEARKV  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN++LVLITLGGNDFVNNYYL+P+S RSRQ++LP+YV FVI+EYKKVL+RLY LG  RV+
Sbjct  158   VNESLVLITLGGNDFVNNYYLVPYSARSRQYSLPDYVPFVISEYKKVLRRLYTLGVLRVI  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA EL  AA ++NP+L  ++K LN EI    F+A NT+
Sbjct  218   VTGTGPLGCVPAELALHSRNGECAEELMEAAQLYNPQLQDMLKDLNDEIGRKVFIAANTN  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+ P+ FGF+TS++ACCGQGPYNG+GLCTP S+LC NRD Y FWD FHPSEKAN
Sbjct  278   QMHMDFISEPQRFGFITSKIACCGQGPYNGIGLCTPFSNLCPNRDLYVFWDPFHPSEKAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++NG N YMHPMNL T+LAMDS A
Sbjct  338   RIIVQQILNGDNKYMHPMNLRTMLAMDSKA  367



>gb|KHN43144.1| GDSL esterase/lipase [Glycine soja]
Length=363

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 295/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARAD+PPYGIDYPT RPTGRFSNG NIPD IS+ LG+E T+PYL+P
Sbjct  34    SLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSNGYNIPDFISQSLGAESTLPYLDP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQFVNII+IY+QL+Y+ EYQQR++ LIG E+ ++L
Sbjct  94    ELDGERLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYWEEYQQRVSGLIGPEQTERL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             +N ALVLITLGGNDFVNNYYL+P+S RSRQ+ LP+YV ++I+EYKKVL+RLY++GARRV+
Sbjct  154   INGALVLITLGGNDFVNNYYLVPYSARSRQYNLPDYVKYIISEYKKVLRRLYEIGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G C+ ELQ AA +FNP+LV+II+ LN EI  N F+ VNT 
Sbjct  214   VTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQIIQQLNSEIGSNVFVGVNTQ  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DFI+NP+ +GFVTS+VACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  274   QMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNLCPNRDIYAFWDPFHPSERAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+++G++ YM+PMNLST++A+DS 
Sbjct  334   RLIVQQILSGTSEYMYPMNLSTIMALDSK  362



>ref|XP_003626495.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82713.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 292/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNG NIPD IS+ LG+EPT+PYL+P
Sbjct  41    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGYNIPDFISQALGAEPTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+ LL+GANFASAG+GILNDTGIQF+NII+I++QL+YF +YQQR++ LIG E+ + L
Sbjct  101   ELNGEALLVGANFASAGIGILNDTGIQFINIIRIFRQLEYFQQYQQRVSGLIGPEQTQSL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQ+ LP+YV ++I+EYKK+L+RLYDLGARRV+
Sbjct  161   VNGALVLITLGGNDFVNNYYLVPFSARSRQYNLPDYVRYIISEYKKILRRLYDLGARRVI  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ   +G C+ ELQ AA +FNP+L++II+ LN EI  N F+  NT 
Sbjct  221   VTGTGPIGCVPAELAQRGTNGGCSVELQRAAALFNPQLIQIIQQLNNEIGSNVFMGANTR  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+ +DF+ NP+A+GFVTSQ+ACCGQGPYNG+GLCTPLS+LC NRDEYAFWDAFHPSEKAN
Sbjct  281   QMALDFVNNPQAYGFVTSQIACCGQGPYNGLGLCTPLSNLCPNRDEYAFWDAFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              +IV Q+++G+  YM+PMNLSTVLA+DS 
Sbjct  341   SLIVQQILSGTTDYMYPMNLSTVLALDSK  369



>ref|XP_004494760.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=371

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/329 (73%), Positives = 293/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNGLNIPD IS +LG+E T+PYL+P
Sbjct  42    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDFISRELGAESTLPYLSP  101

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+GQ+LL+GANFASAG+GILNDTGIQFVNII+IY+QL+YF EYQQR++ LIG E  ++L
Sbjct  102   ELNGQRLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYFEEYQQRVSGLIGAEGTRRL  161

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQ+ LPNYV ++I+EYKK+L+RLYDLGARRV+
Sbjct  162   VNGALVLITLGGNDFVNNYYLVPFSARSRQYPLPNYVKYLISEYKKILRRLYDLGARRVL  221

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S++G+C+PEL  AA +FNP+LV++I+ LN EI  N F+  NT 
Sbjct  222   VTGTGPLGCVPAELAQRSVNGECSPELMRAASLFNPQLVQMIQQLNGEIGSNIFVGANTR  281

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+ ++F+ NP+A+GFVTS+VACCGQGPYNG+GLCT  S+LC NRD+YAFWD FHPSE+AN
Sbjct  282   QMSINFVNNPQAYGFVTSKVACCGQGPYNGLGLCTVASNLCPNRDQYAFWDPFHPSERAN  341

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              IIV Q+M+G+  YM+PMNLST+LA+DS 
Sbjct  342   SIIVQQIMSGNTEYMYPMNLSTILALDSK  370



>gb|ACU23610.1| unknown [Glycine max]
Length=363

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 294/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARAD+PPYGIDYPT RPTGRFSNG NIPD IS+ LG+E T+PYL+P
Sbjct  34    SLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSNGYNIPDFISQSLGAESTLPYLDP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQFVNII+IY+QL+Y+ EYQQR++ LIG E+ ++L
Sbjct  94    ELDGERLLVGANFASAGIGILNDTGIQFVNIIRIYRQLEYWEEYQQRVSGLIGPEQTERL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             +N ALVLITLGGNDFVNNYYL+P+S RSRQ+ LP+YV ++I+EYKKVL+RLY++GARRV+
Sbjct  154   INGALVLITLGGNDFVNNYYLVPYSARSRQYNLPDYVKYIISEYKKVLRRLYEIGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G C+ ELQ AA +FNP+LV+II+ LN EI  N F+ VNT 
Sbjct  214   VTGTGPLGCVPAELAQRSTNGDCSAELQRAAALFNPQLVQIIQQLNSEIGSNVFVGVNTQ  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DFI+NP+ +GFVTS+VACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  274   QMHIDFISNPQRYGFVTSKVACCGQGPYNGLGLCTPASNLCPNRDIYAFWDPFHPSERAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+++G++ YM+PMN ST++A+DS 
Sbjct  334   RLIVQQILSGTSEYMYPMNFSTIMALDSK  362



>ref|XP_008370769.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008345729.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/328 (73%), Positives = 298/328 (91%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++LAT+ARADS PYGIDYPTHRPTGRFSNGLNIPD+ISE++GSEPT+PYL+P
Sbjct  33    SLVDSGNNDYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDLISEQIGSEPTLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQ LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQ R++AL+G E+A++L
Sbjct  93    QLTGQXLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQTRVSALVGPEQAQRL  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL LITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+RLY+LGAR+V+
Sbjct  153   VNEALYLITLGGNDFVNNYYLLPFSARSRQFSLPDYVVYLISEYRKVLERLYELGARKVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS +G+CA ELQ AA +FNP+LV +I  LN +   +AF+A N +
Sbjct  213   VTGTGPLGCVPAELAQHSTNGECAVELQRAASLFNPQLVDMINSLNSQFGSDAFVAANAY  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF+++P+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKAN
Sbjct  273   EMHMDFVSDPQAYGFVTSKIACCGQGPYNGIGLCTFASNLCPNRDLYAFWDPFHPSEKAN  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ GSN YM+PMNLST+LA+D+
Sbjct  333   RIIVQQILTGSNKYMNPMNLSTILALDT  360



>emb|CBI28654.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 290/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L TSARADSPPYGIDYPTHR TGRFSNGLNIPDIIS+ + SE T+PYL+P
Sbjct  33    SLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISQTIKSESTLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+KLL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQ+L AL+G +KA+ +
Sbjct  93    QLTGKKLLVGANFASAGIGILNDTGIQFLNIIRIYRQLEYFQQYQQKLTALVGAQKARGI  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQF LPNYV ++I+EY+K+L RLY LGARRV+
Sbjct  153   VNQALVLITLGGNDFVNNYYLVPNSARSRQFALPNYVRYLISEYQKILMRLYKLGARRVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAE A  S +G+CA ELQ A+ +FNP+LV++++ LN++   + F+A NTH
Sbjct  213   VTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQMLQGLNKKFHADVFIAANTH  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFIT+P+AFGF TS++ACCGQGPYNG+GLCT LS+LC NR +YAFWDAFHPSEKAN
Sbjct  273   EMHMDFITDPQAFGFTTSKIACCGQGPYNGLGLCTVLSNLCPNRGQYAFWDAFHPSEKAN  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  333   RLIVQQIMTGSTMYMNPMNLSTIMALDSR  361



>ref|XP_009777584.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
Length=370

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 293/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYP+HRPTGRFSNGLNIPDIISE+LG EPT+PYL+P
Sbjct  41    SLVDNGNNNYLITSARADSPPYGIDYPSHRPTGRFSNGLNIPDIISEQLGMEPTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTGIQF+NII+I +QL+YF +YQ+R++ +IG E+ ++L
Sbjct  101   ELTGDKLLVGANFASAGVGILNDTGIQFLNIIRIGKQLEYFEQYQRRVSGVIGAEQTQQL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LP+YV ++I EY+K+L++LY+LGARRV+
Sbjct  161   VNSALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVRYLIYEYRKILQKLYELGARRVL  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+CA ELQ AA +FNP+L +++  LN ++  + F+A NT+
Sbjct  221   VTGTGPMGCVPAELAQRSRTGECAVELQRAASLFNPQLTQLLSDLNAQLAADVFVAANTY  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  281   TMHMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ GS+ YM+PMNLS+++A+DS 
Sbjct  341   RIIVQQILTGSSEYMNPMNLSSIMALDSR  369



>ref|XP_002268826.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Vitis vinifera]
Length=368

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 290/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L TSARADSPPYGIDYPTHR TGRFSNGLNIPDIIS+ + SE T+PYL+P
Sbjct  39    SLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISQTIKSESTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+KLL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQ+L AL+G +KA+ +
Sbjct  99    QLTGKKLLVGANFASAGIGILNDTGIQFLNIIRIYRQLEYFQQYQQKLTALVGAQKARGI  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQF LPNYV ++I+EY+K+L RLY LGARRV+
Sbjct  159   VNQALVLITLGGNDFVNNYYLVPNSARSRQFALPNYVRYLISEYQKILMRLYKLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAE A  S +G+CA ELQ A+ +FNP+LV++++ LN++   + F+A NTH
Sbjct  219   VTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQMLQGLNKKFHADVFIAANTH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFIT+P+AFGF TS++ACCGQGPYNG+GLCT LS+LC NR +YAFWDAFHPSEKAN
Sbjct  279   EMHMDFITDPQAFGFTTSKIACCGQGPYNGLGLCTVLSNLCPNRGQYAFWDAFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  339   RLIVQQIMTGSTMYMNPMNLSTIMALDSR  367



>ref|XP_003555561.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
Length=371

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 293/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNGLNIPD IS++LGSE T+PYL+P
Sbjct  41    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDFISQELGSESTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++LL+GANFASAG+GILNDTG+QFVNII+I +QL+YF EYQQR++AL+G EK K+L
Sbjct  101   ELNGERLLVGANFASAGIGILNDTGVQFVNIIRITRQLEYFQEYQQRVSALVGDEKTKEL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT GGNDFVNNYYL+P S RSRQF LP+YV +VI+EYKKVL+RLYDLGARRV+
Sbjct  161   VNGALVLITCGGNDFVNNYYLVPNSARSRQFALPDYVTYVISEYKKVLRRLYDLGARRVL  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ A+ ++NP+LV +IK LN+E+  + F+A NT 
Sbjct  221   VTGTGPLGCVPAELALRGRNGECSEELQRASALYNPQLVEMIKQLNKEVGSDVFVAANTQ  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF+TNP+A+GF+TS+VACCGQGP+NG+GLCT +S+LC NR E+AFWD FHPSEKAN
Sbjct  281   LMHDDFVTNPQAYGFITSKVACCGQGPFNGLGLCTVVSNLCPNRHEFAFWDPFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M+G++ YMHPMNLST+LA+DS 
Sbjct  341   RLIVQQIMSGTSKYMHPMNLSTILALDSK  369



>gb|EYU39534.1| hypothetical protein MIMGU_mgv1a008648mg [Erythranthe guttata]
Length=367

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 286/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISE+LG EPTMPYL+P
Sbjct  38    SLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQLGMEPTMPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G KLL+GANFASAGVGILNDTGIQF+NII+I +Q++YF +YQ R+A  IG ++ + L
Sbjct  98    FLKGDKLLVGANFASAGVGILNDTGIQFLNIIRIGKQIEYFQQYQTRVAGQIGPDQTRVL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV F+I+EY+KVL +LYDLGARRV+
Sbjct  158   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRFLISEYRKVLTKLYDLGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S  G+CA EL  AA +FNP+L  +I  +N EI  + F+A NT+
Sbjct  218   VTGTGPLGCVPAELAQRSRGGECAVELMRAAALFNPQLTEMISSVNSEIGADVFVAANTY  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GF+TS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSE+AN
Sbjct  278   TMHMDFVSNPQAYGFITSKIACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ G N YM PMNLST+LA+DS 
Sbjct  338   RIIVQQILTGDNKYMKPMNLSTILAVDSR  366



>ref|XP_011077073.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g33370-like 
[Sesamum indicum]
Length=368

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 289/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPTHRPTGRFSNGLNIPDIIS KLG EPTMPYL+P
Sbjct  39    SLVDNGNNNYLVTSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISNKLGMEPTMPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQKLL+GANFASAGVGILNDTGIQF+NII+I +QL+YF +YQ R+ +LIG E+ K L
Sbjct  99    LLKGQKLLVGANFASAGVGILNDTGIQFLNIIRINKQLEYFQQYQTRVTSLIGAERTKTL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RS+QF+LP++V +VI+EY+K+L RLY+LGARRV+
Sbjct  159   VNQALVLITLGGNDFVNNYYLVPYSARSQQFSLPDFVRYVISEYRKILARLYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+CA EL  AA +FNP+L  +++ LN E+  + F+A NT+
Sbjct  219   VTGTGPMGCVPAELAQRSRAGECAAELTRAAGLFNPQLTEMLRSLNSELGADVFVAANTY  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI+NP+A GF+TS++ACCGQGPYNG+GLCTP+S+LC NRD YAFWD+FHPSE+AN
Sbjct  279   AMHMDFISNPQAHGFITSKIACCGQGPYNGVGLCTPVSNLCPNRDVYAFWDSFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ G N YM+P+NL+T++AMDS
Sbjct  339   RIIVQQILTGDNKYMNPINLTTIMAMDS  366



>gb|EYU39533.1| hypothetical protein MIMGU_mgv1a008571mg [Erythranthe guttata]
Length=369

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 295/330 (89%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGID+PTHRPTGRFSNGLNIPDIISEK+G EPT+PYL+ 
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDFPTHRPTGRFSNGLNIPDIISEKMGWEPTIPYLSR  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVG+LNDTGIQFVNII+IY+QL++F +YQQRL   IG  +AKKL
Sbjct  100   ELSGQKLLVGANFASAGVGVLNDTGIQFVNIIRIYEQLNFFRQYQQRLMREIGATEAKKL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN++LVL+TLGGNDFVNNY+L+P+S RS+Q+++ +YV FVI+EYKKVL+RLY+LG RRV+
Sbjct  160   VNESLVLMTLGGNDFVNNYFLVPYSIRSQQYSIQDYVPFVISEYKKVLQRLYELGPRRVI  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA +LQ AA +FNP+LV++I  LN++I  + F+A NT+
Sbjct  220   VTGTGPLGCVPAELALHSNNGECAEQLQLAASLFNPQLVQMIDELNQDIGTDVFVAANTN  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+NP+ FGF TS++ACCGQGPYNG+GLCTP S+LC NRD Y FWDAFHPSE+AN
Sbjct  280   QMHMDFISNPEQFGFQTSKIACCGQGPYNGLGLCTPFSNLCPNRDLYVFWDAFHPSERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IVDQ+  GS TYMHPMNLST++ +DS A
Sbjct  340   RMIVDQIFGGSTTYMHPMNLSTIVTLDSRA  369



>emb|CAN66351.1| hypothetical protein VITISV_039098 [Vitis vinifera]
Length=354

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 290/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L TSARADSPPYGIDYPTHR TGRFSNGLNIPDIIS+ + SE T+PYL+P
Sbjct  25    SLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISQTIKSESTLPYLSP  84

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+KLL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQ+L AL+G +KA+ +
Sbjct  85    QLTGKKLLVGANFASAGIGILNDTGIQFLNIIRIYRQLEYFQQYQQKLTALVGAQKARGI  144

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQF LPNYV ++I+EY+K+L RLY LGARRV+
Sbjct  145   VNQALVLITLGGNDFVNNYYLVPNSARSRQFALPNYVRYLISEYQKILMRLYKLGARRVL  204

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAE A  S +G+CA ELQ A+ +FNP+LV++++ LN++   + F+A NTH
Sbjct  205   VTGTGPMGCVPAERAMRSRNGECAAELQQASALFNPQLVQMLQGLNKKFHADVFIAANTH  264

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFIT+P+A+GF TS++ACCGQGPYNG+GLCT LS+LC NR +YAFWDAFHPSEKAN
Sbjct  265   EMHMDFITDPQAYGFTTSKIACCGQGPYNGLGLCTVLSNLCPNRGQYAFWDAFHPSEKAN  324

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  325   RLIVQQIMTGSTMYMNPMNLSTIMALDSR  353



>gb|KHN04961.1| GDSL esterase/lipase [Glycine soja]
Length=355

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 293/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNGLNIPD IS++LGSE T+PYL+P
Sbjct  25    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDFISQELGSESTLPYLSP  84

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++LL+GANFASAG+GILNDTG+QFVNII+I +QL+YF EYQQR++AL+G EK K+L
Sbjct  85    ELNGERLLVGANFASAGIGILNDTGVQFVNIIRITRQLEYFQEYQQRVSALVGDEKTKEL  144

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT GGNDFVNNYYL+P S RSRQF LP+YV +VI+EYKKVL+RLYDLGARRV+
Sbjct  145   VNGALVLITCGGNDFVNNYYLVPNSARSRQFALPDYVTYVISEYKKVLRRLYDLGARRVV  204

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ A+ ++NP+LV +IK LN+E+  + F+A NT 
Sbjct  205   VTGTGPLGCVPAELALRGRNGECSEELQRASALYNPQLVEMIKQLNKEVGSDVFVAANTQ  264

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF+TNP+A+GF+TS+VACCGQGP+NG+GLCT +S+LC NR E+AFWD FHPSEKAN
Sbjct  265   LMHDDFVTNPQAYGFITSKVACCGQGPFNGLGLCTVVSNLCPNRHEFAFWDPFHPSEKAN  324

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M+G++ YMHPMNLST+LA+DS 
Sbjct  325   RLIVQQIMSGTSKYMHPMNLSTILALDSK  353



>ref|XP_008388755.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/328 (73%), Positives = 292/328 (89%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++LAT+ARAD+ PYGIDYPTHRPTGRFSNGLNIPD+ISE++GSEPT+PYL+P
Sbjct  33    SLVDSGNNDYLATTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEQIGSEPTLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQKLL+GANFASAG+GILNDTGIQF+NII+IY+QL YF +YQ R+ AL+G E+A++L
Sbjct  93    HLTGQKLLVGANFASAGIGILNDTGIQFLNIIRIYKQLKYFQQYQTRVNALVGPEQAQRL  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGAR+V+
Sbjct  153   VNEALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARKVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELAQ S  G+CA ELQ AA +FNP+LV +I  LN +I  + F+A N  
Sbjct  213   VTGTGPLGCAPAELAQRSRRGECAVELQRAASLFNPQLVDMINSLNGQIGSDVFVAANAF  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+NP+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKA+
Sbjct  273   QMHMDFISNPQAYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYAFWDAFHPSEKAS  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++ GSN YM+PMNLST+LA+DS
Sbjct  333   RIIAQQILTGSNKYMNPMNLSTILALDS  360



>ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB93130.1| GDSL esterase/lipase [Morus notabilis]
Length=367

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 293/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+ PYGIDYPTHRPTGRFSNGLNIPD+ISE +GSEPT+PYL+P
Sbjct  38    SLVDNGNNNYLATTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEAIGSEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+ LL+GANFASAG+G+LNDTGIQF+NII+IY+QL+YF +YQ R++ALIG E+ ++L
Sbjct  98    ELTGEGLLVGANFASAGIGVLNDTGIQFLNIIRIYKQLEYFQQYQTRVSALIGAEQTERL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL+LITLGGNDFVNNYYL+PFS RSRQ++LP+YV +VI+EY+KVL RLY+LGARRV+
Sbjct  158   VNEALILITLGGNDFVNNYYLVPFSARSRQYSLPDYVVYVISEYQKVLARLYELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ AA +FNP+LV++I  LN +I  + F+A N  
Sbjct  218   VTGTGPLGCVPAELAMRSPNGQCAVELQRAAGLFNPQLVQMINRLNSDIGSDVFVAANAF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP+A+GFVTS+VACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSE+AN
Sbjct  278   EMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTIASNLCPNRDIYAFWDAFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV  ++ G + YMHPMNLST++A+DS 
Sbjct  338   RIIVRNILEGDSKYMHPMNLSTIMALDSR  366



>gb|KHG28666.1| GDSL esterase/lipase LTL1 -like protein [Gossypium arboreum]
Length=365

 Score =   522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 292/329 (89%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+ PYGIDYPTHR TGRFSNGLNIPD+ISE++GSEPT+PYL+P
Sbjct  36    SLVDNGNNNYLATTARADAYPYGIDYPTHRATGRFSNGLNIPDLISEQIGSEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+GQ+LLIGANFASAG+GILNDTG+QFVNII+I +QL YF +YQQR++ALIG E+ ++L
Sbjct  96    ELNGQRLLIGANFASAGIGILNDTGVQFVNIIRIGEQLQYFRQYQQRVSALIGPEQTQRL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVL+TLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L RLY+LGARRV+
Sbjct  156   VNEALVLMTLGGNDFVNNYYLVPFSARSRQFALPDYVVYIISEYRKILLRLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS  G+CA ELQ A+ +FNP+L  ++  LN E+  + F+AVNT+
Sbjct  216   VTGTGPLGCVPAELAQHSRAGECAIELQRASALFNPQLAEMLSGLNNELGADIFVAVNTN  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMD+I NP+ FGFVTS+VACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSE+AN
Sbjct  276   EMHMDWINNPQQFGFVTSKVACCGQGPYNGIGLCTIASNLCLNRDIYAFWDPFHPSERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q++ GS  YMHPMNLST++ +DS 
Sbjct  336   RLIVQQIITGSTKYMHPMNLSTIMELDSR  364



>ref|XP_010918935.1| PREDICTED: GDSL esterase/lipase LTL1 [Elaeis guineensis]
Length=364

 Score =   521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 294/328 (90%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPTH+PTGRFSNGLNIPDIISE++G+EPT+PYL+P
Sbjct  35    SLVDNGNNNYLATTARADSPPYGIDYPTHQPTGRFSNGLNIPDIISEQIGAEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF+NIIKI +QL YF +YQQRL+ALIG  +AKKL
Sbjct  95    ELRGEKLLVGANFASAGIGILNDTGIQFINIIKISRQLQYFEQYQQRLSALIGVAQAKKL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSR+F LP+YV ++I EYKK+L+ L++LGARR+M
Sbjct  155   VNKALVLITLGGNDFVNNYYLVPFSARSREFALPDYVRYIIFEYKKILRTLHELGARRIM  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA+ S DG C PELQ AA +FNP+L++I+  LN ++  + +++ N  
Sbjct  215   VTGTGPLGCVPAELAERSRDGSCDPELQRAAALFNPQLIQILNELNTDLGSDIYISANAF  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMD++++P A+GFVTS++ACCGQGPYNG+GLCT  S+LC+NR+ Y+FWDA+HP+EKAN
Sbjct  275   KMHMDYVSDPAAYGFVTSKIACCGQGPYNGLGLCTVASNLCSNRNLYSFWDAYHPTEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q M GS+ YM+PMNLST+LA+D+
Sbjct  335   RIIVNQFMIGSSEYMNPMNLSTILALDA  362



>ref|XP_010648948.1| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
 emb|CAN67726.1| hypothetical protein VITISV_038831 [Vitis vinifera]
Length=369

 Score =   521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 291/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++L T+ARADSPPYGIDYPTHRPTGRFSNGLNIPDIISE++G +PT+PYL+P
Sbjct  40    SLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGEQPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQR+  LIG  + ++L
Sbjct  100   ELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRVTTLIGAAQTERL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+RLY+LGARRV+
Sbjct  160   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLRRLYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+CA ELQ AA +FNP+LV++I  LN EI  + F+A N  
Sbjct  220   VTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQMINGLNNEIGGDVFIAANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSE+AN
Sbjct  280   RMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNLCANRDIYAFWDAFHPSERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R IV Q+++GS  YMHPMNLS ++A+DS 
Sbjct  340   RYIVRQILSGSTDYMHPMNLSNIMALDSR  368



>emb|CBI28652.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 291/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++L T+ARADSPPYGIDYPTHRPTGRFSNGLNIPDIISE++G +PT+PYL+P
Sbjct  38    SLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGEQPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQR+  LIG  + ++L
Sbjct  98    ELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRVTTLIGAAQTERL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+RLY+LGARRV+
Sbjct  158   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLRRLYELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+CA ELQ AA +FNP+LV++I  LN EI  + F+A N  
Sbjct  218   VTGTGPMGCVPAELAMRSRNGECAVELQRAADLFNPQLVQMINGLNNEIGGDVFIAANAF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSE+AN
Sbjct  278   RMHMDFISNPGAYGFVTSKIACCGQGPYNGLGLCTIASNLCANRDIYAFWDAFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R IV Q+++GS  YMHPMNLS ++A+DS 
Sbjct  338   RYIVRQILSGSTDYMHPMNLSNIMALDSR  366



>ref|NP_001237641.2| uncharacterized LOC100500155 precursor [Glycine max]
Length=364

 Score =   521 bits (1342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+PPYGID+PTHRPTGRFSNGLNIPDIISE LG EPT+PYL+P
Sbjct  35    SLVDSGNNDFLATTARADAPPYGIDFPTHRPTGRFSNGLNIPDIISENLGLEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G++LL+GANFASAG+GILNDTG QF+NII IY+QL  FA YQQRL+A IG E A + 
Sbjct  95    LLVGERLLVGANFASAGIGILNDTGFQFLNIIHIYKQLKLFAHYQQRLSAHIGKEGAWRH  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+ +L+RLYDLG RRV+
Sbjct  155   VNQALILITLGGNDFVNNYYLVPYSVRSRQFSLPDYVTYIISEYRLILRRLYDLGGRRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+C  ELQ AA +FNP+LV ++K LN+EI  + F+AVN +
Sbjct  215   VTGTGPMGCVPAELALRSRNGECDVELQRAASLFNPQLVEMVKGLNQEIGAHVFIAVNAY  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF+TNP+ FGFVTS++ACCGQGP+NG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  275   EMHMDFVTNPQDFGFVTSKIACCGQGPFNGVGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV QMM GS+ YMHPMNLST++A+DS  
Sbjct  335   RIIVQQMMTGSDQYMHPMNLSTIMALDSRV  364



>ref|XP_009348739.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=362

 Score =   521 bits (1341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 296/328 (90%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++LAT+ARADS PYGIDYPTH PTGRFSNGLNIPD+ISE++GSEPT+PYL+P
Sbjct  33    SLVDNGNNDYLATTARADSYPYGIDYPTHLPTGRFSNGLNIPDLISEQIGSEPTLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQ LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQ R++AL+G E+A++L
Sbjct  93    QLTGQNLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQTRVSALVGPEQAQRL  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL+LITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+RLY+LGAR+V+
Sbjct  153   VNEALILITLGGNDFVNNYYLLPFSARSRQFSLPDYVVYLISEYRKVLERLYELGARKVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ AA +FNP+LV +I  LN +   +AF+A N +
Sbjct  213   VTGTGPLGCVPAELALHSRNGECAVELQRAASLFNPQLVDMINSLNSQFGSDAFVAANAY  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++MDF+++P+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKAN
Sbjct  273   EMNMDFVSDPQAYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYAFWDAFHPSEKAN  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV  +  GSN YM+PMNLST+LA+D+
Sbjct  333   RIIVQNIFTGSNKYMNPMNLSTILALDT  360



>ref|XP_007143993.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
 gb|ESW15987.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
Length=366

 Score =   521 bits (1341),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 239/328 (73%), Positives = 289/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+PPYGID+PTHRPTGRFSNGLNIPDIISE+LG EPT+PYLNP
Sbjct  37    SLVDSGNNDFLATTARADAPPYGIDFPTHRPTGRFSNGLNIPDIISEQLGLEPTLPYLNP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLL+GANFASAG+GILNDTG QF++II IY+QL  F  YQQRL+A IG E A+K 
Sbjct  97    LLIGEKLLVGANFASAGIGILNDTGFQFLHIIHIYKQLKLFQHYQQRLSAHIGAEGARKH  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV+++I+EY+ +LKRLYDLG RRV+
Sbjct  157   VNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVNYIISEYRLILKRLYDLGGRRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+C  ELQ AA +FNP+LV +++ LN+EI  + F+AVN +
Sbjct  217   VTGTGPMGCVPAELALRSGNGECDLELQRAASLFNPQLVEMVRGLNQEIGAHVFIAVNAY  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF+ NP+AFGFVTS++ACCGQGPYNG+GLCT +S+LC NRD YAFWD FHPSEKAN
Sbjct  277   EMHMDFVNNPRAFGFVTSKIACCGQGPYNGVGLCTAISNLCPNRDLYAFWDPFHPSEKAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV QMM GS  YMHPMNLST++A+DS
Sbjct  337   RIIVQQMMTGSVQYMHPMNLSTIMAIDS  364



>ref|XP_009764127.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764128.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score =   521 bits (1341),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 238/331 (72%), Positives = 293/331 (89%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+LAT+ARADSPPYGIDYPT R TGRFSNG NIPDIIS+++G SE  +PYL+
Sbjct  48    SLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGFNIPDIISQQIGASESPLPYLS  107

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L+GQ+LL+GANFASAG+GILNDTGIQF+NII+I QQL+YF +YQ R++ALIG E  K+
Sbjct  108   PELNGQRLLVGANFASAGIGILNDTGIQFINIIRIPQQLEYFRQYQSRVSALIGEESTKQ  167

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVL+TLGGNDFVNNYYL+P S RSRQ+ LP+YV F+I+EY+K+L R+YDLGARRV
Sbjct  168   LVNQALVLMTLGGNDFVNNYYLVPNSARSRQYALPDYVPFLISEYRKILMRVYDLGARRV  227

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELAQ S +G+CA ELQ AA +FNP+L ++++ LN E+  N F+A NT
Sbjct  228   LVTGTGPLGCVPAELAQRSRNGECAVELQQAAALFNPQLTQMLQDLNSELGSNIFIAANT  287

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H+DFITNP+A+GF+TS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSE+A
Sbjct  288   QQMHIDFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPNRDVFAFWDPFHPSERA  347

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N+IIV Q+M GS+ YM+PMNLST+LAMDS A
Sbjct  348   NKIIVQQIMTGSSEYMNPMNLSTILAMDSMA  378



>ref|XP_003535381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   521 bits (1341),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 291/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNGLNIPD IS++LGSE T+PYL+P
Sbjct  41    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDFISQELGSESTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++L +GANFASAG+G+LNDTG+QFVNII+I +QL+YF EYQQR++ALIG +K K+L
Sbjct  101   ELNGERLFVGANFASAGIGVLNDTGVQFVNIIRISRQLEYFQEYQQRVSALIGDDKTKEL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT GGNDFVNNYYL+P S RSRQF LP+YV FVI+EYKKVL+RLYDLGARRV+
Sbjct  161   VNGALVLITCGGNDFVNNYYLVPNSARSRQFALPDYVTFVISEYKKVLRRLYDLGARRVV  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ AA ++NP+LV +IK LN+E+  + F+A NT 
Sbjct  221   VTGTGPLGCVPAELALRGRNGECSEELQQAASLYNPQLVEMIKQLNKEVGSDVFVAANTQ  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF+TNP+ +GF+TS+VACCGQGP+NG+GLCT  S+LC  RDE+AFWDAFHPSEKA+
Sbjct  281   LMHNDFVTNPQTYGFITSKVACCGQGPFNGIGLCTVASNLCPYRDEFAFWDAFHPSEKAS  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV Q+M+G++ YMHPMNLST+LA+DS 
Sbjct  341   KLIVQQIMSGTSKYMHPMNLSTILALDSK  369



>ref|XP_004302114.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   520 bits (1338),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 293/327 (90%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARADS PYGIDYPTHRPTGRFSNGLNIPD+ISE LGSEPT+PYL+P
Sbjct  35    SLVDNGNNDYLITTARADSYPYGIDYPTHRPTGRFSNGLNIPDLISESLGSEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL+G+KLL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +YQ R++ALIG ++ K L
Sbjct  95    QLNGEKLLVGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYQTRVSALIGPDQTKSL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQ++LP+YV ++I+EY+K+L RLY+LGAR+V+
Sbjct  155   VNGALVLITLGGNDFVNNYYLVPYSARSRQYSLPDYVVYLISEYRKILNRLYELGARQVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG LGCVPAELA  S +G+C+ ELQ AA +FNP+LV++I  LN EI  N F+A N++
Sbjct  215   VTGTGSLGCVPAELAMRSRNGECSVELQRAASLFNPQLVQMIGSLNSEIGANVFIASNSN  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI++P A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  275   EMHMDFISDPGAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             R+IV Q++ GS+ YMHPMNLST+L++D
Sbjct  335   RLIVQQILTGSDKYMHPMNLSTMLSLD  361



>ref|XP_003554731.1| PREDICTED: GDSL esterase/lipase LTL1-like [Glycine max]
 gb|KHN43146.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   520 bits (1339),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 290/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADS PYG+DYPTHR TGRFSNGLNIPDIISEK+GSEPT+PYL+ 
Sbjct  45    SLVDNGNNNYLFTTARADSYPYGVDYPTHRATGRFSNGLNIPDIISEKIGSEPTLPYLSR  104

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+ ++L
Sbjct  105   ELDGERLLVGANFASAGIGILNDTGIQFINIIRITRQLQYFEQYQQRVSALIGPEQTQRL  164

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LPNYV ++I+EY+K+L RLY+LGARRV+
Sbjct  165   VNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVVYLISEYRKILVRLYELGARRVL  224

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G+CA ELQ A+ +FNP+LV+++  LN EI  + F++ N  
Sbjct  225   VTGTGPLGCVPAELAQRSRNGECAAELQQASALFNPQLVQLVNQLNSEIGSDVFISANAF  284

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q +MDFI+NP+A+GF+TS+VACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  285   QSNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPNRDVYAFWDPFHPSERAN  344

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IVD  M G + YMHPMNLST+L +DS +
Sbjct  345   RLIVDTFMIGDSKYMHPMNLSTMLLLDSTS  374



>ref|XP_006340481.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=367

 Score =   520 bits (1338),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 290/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPTHR TGRFSNGLNIPDIISE+LG EPT+PYL P
Sbjct  38    SLVDNGNNNYLLTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISEQLGMEPTLPYLAP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G +LL+GANFASAGVGILNDTGIQF NII+I +QL+YF +YQ+R++ LIG E+ ++L
Sbjct  98    QLTGDRLLVGANFASAGVGILNDTGIQFFNIIRIGKQLEYFEQYQRRVSGLIGAEQTEQL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LITLGGNDFVNNYYLIPFS RSRQF+LP+YV ++I+EY+K+L++LYDLG RRV+
Sbjct  158   VNSALILITLGGNDFVNNYYLIPFSARSRQFSLPDYVVYLISEYRKILQKLYDLGGRRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA +FNP+L +++  LN +I  N F+A NT 
Sbjct  218   VTGTGPIGCVPAELAQRSTSGECSIELQRAAALFNPQLTQMLADLNSQIGANVFIAANTF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              ++M+F++NP+A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSE+AN
Sbjct  278   TMNMNFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDIYAFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ GS+ YM+PMNLSTV+A+DS  
Sbjct  338   RIIVQQILTGSSEYMNPMNLSTVMALDSRT  367



>ref|XP_004237503.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=367

 Score =   519 bits (1336),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 289/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPTHR TGRFSNGLNIPDIISE+LG EPT+PYL P
Sbjct  38    SLVDNGNNNYLVTSARADSPPYGIDYPTHRATGRFSNGLNIPDIISEQLGMEPTLPYLAP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G +LL+GANFASAGVGILNDTGIQF NII+I +QL+YF +YQ+R++ LIG  + ++L
Sbjct  98    QLTGDRLLVGANFASAGVGILNDTGIQFFNIIRIGKQLEYFEQYQRRVSGLIGAAQTEQL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+K+L++LYDLG RRV+
Sbjct  158   VNSALILITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKILQKLYDLGGRRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA +FNP+L +++  LN +I  N F+A NT+
Sbjct  218   VTGTGPIGCVPAELAQRSRSGECSVELQRAAALFNPQLTQMLADLNSQIGANVFIAANTY  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              ++MDF++NP+A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSE+AN
Sbjct  278   TMNMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDIYAFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ GS+ YM PMNLST++A+DS 
Sbjct  338   RIIVQQILTGSSQYMSPMNLSTIMALDSR  366



>ref|XP_010243647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   518 bits (1335),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 291/328 (89%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADS PYGIDYP+HR TGRFSNG NIPD+IS+ +G E T+PYL+P
Sbjct  37    SLVDNGNNNYLATSARADSYPYGIDYPSHRATGRFSNGFNIPDLISQAIGEESTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL GANFASAGVG+LNDTGIQF+NII+I++QL+YF +YQQR++ALIG E+ ++L
Sbjct  97    ELTGQRLLNGANFASAGVGVLNDTGIQFLNIIRIFKQLEYFQQYQQRVSALIGEEQTQQL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF+LP+YV +VI+EYKK+L R+Y+LGARRV+
Sbjct  157   VNRALVLITLGGNDFVNNYYLIPFSARSRQFSLPDYVRYVISEYKKILMRVYELGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS++G+CA ELQ AA +FNP+L + I  LN EI  + F+A NT+
Sbjct  217   VTGTGPLGCVPAELALHSVNGECAIELQRAAALFNPQLAQTINELNSEIGSDVFVAANTN  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++ MDF++NP+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSE+AN
Sbjct  277   RMTMDFVSNPQAYGFVTSKIACCGQGPYNGIGLCTSASNLCPNRDVYAFWDPFHPSERAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ GSN YMHPMNLST++A+D+
Sbjct  337   RIIVQQILAGSNDYMHPMNLSTIMAVDA  364



>ref|XP_008796408.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=371

 Score =   518 bits (1335),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD PPYGIDYPT RPTGRFSNGLN+PDIISE LG+EPT+PYL+P
Sbjct  42    SLVDNGNNNYLATTARADRPPYGIDYPTGRPTGRFSNGLNVPDIISENLGAEPTLPYLSP  101

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF NII+I +QL YF +YQQRL++LIG  + ++L
Sbjct  102   ELRGEKLLVGANFASAGIGILNDTGIQFANIIRIRRQLSYFEQYQQRLSSLIGSARTQRL  161

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+SPRSR+F+LP+YV ++I+EYKK+L  LY+LGARRV+
Sbjct  162   VNQALVLITLGGNDFVNNYYLVPYSPRSREFSLPDYVTYLISEYKKILASLYELGARRVL  221

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+C  EL  A+ +FNP+L++++  LNR+   + F+AVN+ 
Sbjct  222   VTGTGPLGCVPAELALRSRNGQCDSELNRASDLFNPQLIQLLNQLNRQFGSDVFVAVNSR  281

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP+A+GFVTS+VACCGQGPYNG+GLCT LS LC NR+ Y+FWD +HP+EKAN
Sbjct  282   KMHMDFISNPQAYGFVTSKVACCGQGPYNGIGLCTSLSSLCPNRNVYSFWDQYHPTEKAN  341

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M GS  YM+PMNLST+LAMD+ +
Sbjct  342   RIIVSQFMTGSTEYMNPMNLSTILAMDARS  371



>ref|XP_006403052.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
 gb|ESQ44505.1| hypothetical protein EUTSA_v10003456mg [Eutrema salsugineum]
Length=366

 Score =   518 bits (1333),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 235/330 (71%), Positives = 291/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FL T+ARAD+ PYGIDYPTHRPTGRFSNGLNIPD+ISE LG   ++PYL+P
Sbjct  37    SLVDNGNNDFLVTTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEHLGQASSLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLLIGANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ RL+ LIG E+ ++L
Sbjct  97    MLKKDKLLIGANFASAGIGILNDTGIQFLNIIRITKQLEYFQQYKVRLSGLIGEEEMERL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYIISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+C+ ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRNGECSTELQRAASLFNPQLVQMINDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+NP+A+GFV+S+VACCGQGPYNG+GLCTP+S+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISNPQAYGFVSSKVACCGQGPYNGIGLCTPISNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RII  Q++NGS  YMHPMNLST+L++DS A
Sbjct  337   RIIAQQILNGSPQYMHPMNLSTILSLDSMA  366



>ref|XP_006283972.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
 gb|EOA16870.1| hypothetical protein CARUB_v10005096mg [Capsella rubella]
Length=366

 Score =   518 bits (1333),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTHRPTGRFSNGLNIPD+ISE LG E  MPYL+P
Sbjct  37    SLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNGLNIPDLISEHLGQESPMPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   +LL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+  +L
Sbjct  97    MLKKDRLLVGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKLRVSGLVGEEEMNRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQ++LP+YV F+I+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQYSLPDYVVFIISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S DG+CA ELQ AA +FNP+L ++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRDGECATELQRAASLFNPQLTQMISDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+ +GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQRYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RII +Q++NGS  YMHPMNLSTVL +DS A
Sbjct  337   RIIAEQILNGSPEYMHPMNLSTVLTVDSMA  366



>ref|XP_010435380.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Camelina sativa]
Length=366

 Score =   517 bits (1332),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 289/327 (88%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTHRPTGRFSNGLNIPD+ISE LG E  MPYL+P
Sbjct  37    SLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNGLNIPDLISEHLGQESPMPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L  +KLL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+  +L
Sbjct  97    MLKKEKLLVGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKLRVSGLVGEEEMNRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV F+I+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFIISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+CA ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQMITELNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             RII  Q++NGS  YMHPMNLSTVL +D
Sbjct  337   RIIAQQILNGSPEYMHPMNLSTVLTVD  363



>ref|XP_007030304.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030305.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10806.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10807.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
Length=367

 Score =   517 bits (1332),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 291/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+ PYGIDYPTHR TGRFSNGLNIPD+ISE++GSEPT+PYL+P
Sbjct  38    SLVDNGNNNYLATTARADAYPYGIDYPTHRATGRFSNGLNIPDLISEQIGSEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTG QFVNII+I +QL+YF +YQQR++ALIG E+ ++L
Sbjct  98    ELTGQKLLVGANFASAGIGILNDTGFQFVNIIRISKQLEYFQQYQQRVSALIGPEQTQRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+L+TLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+K+L RL+ LGARRV+
Sbjct  158   VNQALILMTLGGNDFVNNYYLVPFSARSRQFSLPDYVVYIISEYRKILVRLHGLGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS  G+CA ELQ AA +FNP+LV+++  LNRE+  + F+A N +
Sbjct  218   VTGTGPLGCVPAELAQHSRAGECAVELQRAAALFNPQLVQMLNGLNRELGSDIFIAANAY  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMD+I+NP+A+GFVTS+VACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSE+AN
Sbjct  278   DMHMDWISNPQAYGFVTSKVACCGQGPYNGIGLCTMASNLCPNRDIYAFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+  GS  YM+PMNLST++ +DS 
Sbjct  338   RLIVRQIATGSTKYMNPMNLSTIMELDSR  366



>gb|KHN14896.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   517 bits (1332),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 233/330 (71%), Positives = 294/330 (89%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP THRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPTHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  +AK 
Sbjct  100   PELRGDKLLVGANFASAGIGILNDTGVQFVNVIRMYRQLEYFKEYQNRVSAIIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIATDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NRD+YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNLCSNRDQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+DS+
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDSN  369



>ref|XP_010440676.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
 ref|XP_010450323.1| PREDICTED: GDSL esterase/lipase At5g33370 isoform X1 [Camelina 
sativa]
Length=366

 Score =   517 bits (1331),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 289/327 (88%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTHRPTGRFSNGLNIPD+ISE LG E  MPYL+P
Sbjct  37    SLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNGLNIPDLISEHLGQESPMPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L  +KLL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+  +L
Sbjct  97    MLKKEKLLVGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKLRVSGLVGEEEMNRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV F+I+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFIISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+CA ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQMITDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             RII  Q++NGS  YMHPMNLSTVL +D
Sbjct  337   RIIAQQILNGSPEYMHPMNLSTVLTVD  363



>ref|XP_010674245.1| PREDICTED: GDSL esterase/lipase At5g33370 [Beta vulgaris subsp. 
vulgaris]
Length=365

 Score =   517 bits (1331),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 235/330 (71%), Positives = 288/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNNFLAT+ARADSPPYGIDYPTH  TGRFSNGLNIPDIISE +GSEPT+PYL+P
Sbjct  36    SLVDSGNNNFLATTARADSPPYGIDYPTHIATGRFSNGLNIPDIISETIGSEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTG QF+NII+IY QL+YF +YQQR++ALIG E+ ++L
Sbjct  96    ELTGQKLLVGANFASAGIGILNDTGAQFLNIIRIYGQLEYFQQYQQRVSALIGEERTRQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RS QFTLP+YVD++I++Y  +L+RLY+LG RRV+
Sbjct  156   VNKALVLITLGGNDFVNNYYLVPFSIRSTQFTLPDYVDYLISQYTMILQRLYELGPRRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+E+AQ   +G CA ELQ AA +FNPRLV++I  LN +I  + F+A N  
Sbjct  216   VTGTGPLGCVPSEIAQRGRNGNCADELQKAASLFNPRLVQMINQLNNKIGSHVFVAANAF  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI NP+++GFVTS+VACCGQGPYNG+GLCT LS+LC NR+ YAFWDAFHP+E+AN
Sbjct  276   QMHMDFINNPRSYGFVTSKVACCGQGPYNGVGLCTVLSNLCPNRNLYAFWDAFHPTERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV Q++ G+  YMHPMNLST++ +DS  
Sbjct  336   RLIVQQILRGNTNYMHPMNLSTIIELDSRV  365



>ref|XP_003521782.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X1 [Glycine 
max]
Length=376

 Score =   517 bits (1331),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADS PYGIDYPTHR TGRFSNGLNIPDIISEK+GSEPT+PYL+ 
Sbjct  45    SLVDNGNNNYLFTTARADSYPYGIDYPTHRATGRFSNGLNIPDIISEKIGSEPTLPYLSR  104

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+ ++L
Sbjct  105   ELDGERLLVGANFASAGIGILNDTGIQFINIIRISRQLQYFEQYQQRVSALIGPEQTQRL  164

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LPNYV ++I+EY+K+L RLY+LGARRV+
Sbjct  165   VNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVVYLISEYRKILVRLYELGARRVL  224

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G+CA ELQ A+ +FNP+LV+++  LN EI    F++ N  
Sbjct  225   VTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQLVNQLNSEIGSVVFISANAF  284

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + +MDFI+NP+A+GF+TS+VACCGQGPYNG+GLCTP S+LC NRD +AFWD FHPSE+AN
Sbjct  285   ESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPNRDVFAFWDPFHPSERAN  344

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IVD  M G + YMHPMNLSTVL +D+ +
Sbjct  345   RLIVDTFMIGDSKYMHPMNLSTVLLLDATS  374



>ref|XP_006854343.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
 gb|ERN15810.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
Length=362

 Score =   516 bits (1329),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 284/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++LAT+ARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE +G+EPT+PYL P
Sbjct  34    SLVDNGNNDYLATTARADNPPYGIDYPTHRPTGRFSNGLNIPDIISENMGTEPTLPYLAP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +YQQR+  LIG  + ++L
Sbjct  94    ELTGQKLLVGANFASAGIGILNDTGIQFLNIIRISKQLEYFQQYQQRVTTLIGAAQTQRL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I EY K+L RLY+LGARRV+
Sbjct  154   VNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLIPEYSKILARLYELGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+C PELQ A+ +FNP+LV+++  LN +   N F++ N  
Sbjct  214   VTGTGPMGCVPAELAMRSRNGQCDPELQRASALFNPQLVQMLGQLNNQFGSNVFISANAF  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI+NP AFGFVTS+VACCGQGPYNG+GLCT LS+LC +R +YAFWD FHPSE A+
Sbjct  274   NMHMDFISNPGAFGFVTSKVACCGQGPYNGLGLCTALSNLCADRSKYAFWDPFHPSESAS  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M G+  YMHPMNLST+L MD++
Sbjct  334   RIIVRQFMTGTTEYMHPMNLSTILQMDNY  362



>ref|XP_002522020.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40424.1| zinc finger protein, putative [Ricinus communis]
Length=364

 Score =   516 bits (1328),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 295/329 (90%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNGLNIPD+ISE +GSEPT+PYL+P
Sbjct  35    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDLISEAIGSEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF+NII+IY+QL+YF +YQQR++ALIG E+ ++L
Sbjct  95    ELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRVSALIGPEQTQRL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL R+Y+LGARRV+
Sbjct  155   VNQALVLMTLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLLRVYELGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+C+ ELQ AA +FNP+LV++I  +N +I  + F+A N +
Sbjct  215   VTGTGPLGCVPAELAMRSRNGECSVELQRAAGLFNPQLVQMINEVNNQIGSDVFVAANAY  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MDFI++P+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSE+AN
Sbjct  275   QMNMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDIYAFWDPFHPSERAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ GS+ YM+PMNLST++ +DS 
Sbjct  335   RIIVRQILIGSSKYMNPMNLSTIMELDSR  363



>gb|KHN35332.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score =   516 bits (1329),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 235/330 (71%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADS PYG+DYPTHR TGRFSNGLNIPDIISEK+GSEPT+PYL+ 
Sbjct  45    SLVDNGNNNYLFTTARADSYPYGVDYPTHRATGRFSNGLNIPDIISEKIGSEPTLPYLSR  104

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+ ++L
Sbjct  105   ELDGERLLVGANFASAGIGILNDTGIQFINIIRISRQLQYFEQYQQRVSALIGPEQTQRL  164

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LPNYV ++I+EY+K+L RLY+LGARRV+
Sbjct  165   VNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVLYLISEYRKILVRLYELGARRVL  224

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G+CA ELQ A+ +FNP+LV+++  LN EI    F++ N  
Sbjct  225   VTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQLVNQLNSEIGSVVFISANAF  284

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + +MDFI+NP+A+GF+TS+VACCGQGPYNG+GLCTP S+LC NRD +AFWD FHPSE+AN
Sbjct  285   ESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPNRDVFAFWDPFHPSERAN  344

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IVD  M G + YMHPMNLSTVL +D+ +
Sbjct  345   RLIVDTFMIGDSKYMHPMNLSTVLLLDATS  374



>ref|XP_003541357.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   516 bits (1328),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 294/330 (89%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL+YF EYQ R++ALIG  +AK 
Sbjct  100   PELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFKEYQNRVSALIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV ++I+EY+K+L++LYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQKLLQKLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIGSDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR++YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_011002018.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   515 bits (1327),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 230/330 (70%), Positives = 289/330 (88%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT + TGRFSNGLNIPDIISE++GSE  +PYL+P
Sbjct  39    SLVDSGNNNYLATTARADSPPYGIDYPTRQATGRFSNGLNIPDIISEQMGSESPLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL+GANFASAG+GILNDTG+QF+NII++++QL+YF +YQQR+ ALIG E+AK+L
Sbjct  99    ELRGQRLLVGANFASAGIGILNDTGVQFINIIRMHRQLEYFQQYQQRVGALIGAEQAKRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P S RSRQ+ LP+YV ++I+EY+++L +LY+LGARRV+
Sbjct  159   VNQALVLITVGGNDFVNNYYLVPSSARSRQYDLPDYVKYLISEYRELLMKLYNLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +IK +NR+I  N F+A NTH
Sbjct  219   VTGTGPLGCVPAELATRSTNGGCSEELQRAAALYNPQLESMIKDVNRKIGSNVFIAANTH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF++NP+A+GF TS+ ACCGQGPYNG+GLCT LS+LC NRD YAFWD FHPSEKA+
Sbjct  279   QMHTDFVSNPQAYGFTTSKTACCGQGPYNGIGLCTTLSNLCPNRDLYAFWDPFHPSEKAS  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q+M GS  YM PMNLST++A+DS +
Sbjct  339   RIIVQQIMTGSTQYMKPMNLSTIMALDSRS  368



>ref|XP_009631850.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=380

 Score =   516 bits (1328),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 291/331 (88%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD+GNNN+LAT+ARADSPPYGIDYPT R TGRFSNG NIPDIIS+++GS E  +PYL+
Sbjct  50    SLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGFNIPDIISQQIGSSESPLPYLS  109

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L+GQ+LL+GANFASAG+GILNDTGIQF+NI++I QQL+YF +YQ R++ALIG    K+
Sbjct  110   PELNGQRLLVGANFASAGIGILNDTGIQFINIVRIPQQLEYFRQYQSRVSALIGEASTKQ  169

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLITLGGNDFVNNYYL+P S RSRQ+ LP+YV F+I+EY+K+L RLY+LGARRV
Sbjct  170   LVNQALVLITLGGNDFVNNYYLVPNSARSRQYALPDYVPFLISEYRKILMRLYNLGARRV  229

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELAQ S +G+CA ELQ AA +FNP+L ++++ LN ++  N F+A NT
Sbjct  230   LVTGTGPLGCVPAELAQRSRNGECAIELQRAAALFNPQLTQMLQNLNSQLGSNIFIAANT  289

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H DFITNP+A+GF+TS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSE+A
Sbjct  290   QQMHTDFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPNRDLFAFWDPFHPSERA  349

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N+IIV Q+M GS+ YM+PMNLST+LAMDS A
Sbjct  350   NKIIVQQIMTGSSEYMNPMNLSTILAMDSMA  380



>ref|NP_198322.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8LB81.1|GDL79_ARATH RecName: Full=GDSL esterase/lipase At5g33370; AltName: Full=Extracellular 
lipase At5g33370; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM64916.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAO42146.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50514.1| unknown protein [Arabidopsis thaliana]
 gb|AED93898.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=366

 Score =   515 bits (1326),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 288/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTHRPTGRFSNGLNIPD+ISE LG E  MPYL+P
Sbjct  37    SLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNGLNIPDLISEHLGQESPMPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLL GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+  +L
Sbjct  97    MLKKDKLLRGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKVRVSGLVGEEEMNRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV FVI+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFVISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+CA ELQ AA +FNP+L+++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLIQMITDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++NGS  YMHPMNLST+L +DS
Sbjct  337   RIIAQQILNGSPEYMHPMNLSTILTVDS  364



>ref|XP_002868396.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44655.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=366

 Score =   515 bits (1326),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 288/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTHRPTGRFSNGLNIPD+ISE LG E  MPYL+P
Sbjct  37    SLVDNGNNDFLATTARADNYPYGIDFPTHRPTGRFSNGLNIPDLISEHLGQESPMPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLL GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+  +L
Sbjct  97    MLKKDKLLRGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKVRVSGLVGEEEMNRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV F+I+EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFIISEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+CA ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRNGECATELQRAASLFNPQLVQMITDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++NGS  YMHPMNLST+L +DS
Sbjct  337   RIIAQQILNGSPEYMHPMNLSTILTVDS  364



>gb|KHN14884.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   514 bits (1325),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 292/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL+YF EYQ R++ALIG  +AK 
Sbjct  100   PELSGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFKEYQNRVSALIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP Y  ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYAKYLISEYQKLLQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIATDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NRD+YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNLCSNRDQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+I+D++M+G   YM+PMNLST+LA+D++
Sbjct  340   NRLILDEIMSGYKGYMNPMNLSTILALDAN  369



>ref|XP_007147233.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
 gb|ESW19227.1| hypothetical protein PHAVU_006G107100g [Phaseolus vulgaris]
Length=369

 Score =   514 bits (1325),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 290/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+ PYGIDYPTHR TGRFSNGLNIPDIISEK+GSEPT+PYL+P
Sbjct  40    SLVDNGNNNYLLTTARADAYPYGIDYPTHRATGRFSNGLNIPDIISEKIGSEPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L+G++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+A++L
Sbjct  100   ALNGERLLVGANFASAGIGILNDTGIQFINIIRIGRQLQYFEQYQQRVSALIGAEQAQRL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNY+L+PFS RSRQF LP+YV ++I+EY+K+L RLY+LGARRV+
Sbjct  160   VNQALVLITLGGNDFVNNYFLVPFSARSRQFALPDYVVYIISEYRKILLRLYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS +G+CA ELQ A+ +FNP+LV+++  LN EI    F++ N  
Sbjct  220   VTGTGPLGCVPAELAQHSRNGECAAELQQASALFNPQLVQLVNQLNSEIGSVIFVSANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + +MDFI+NP+A+GF+TS+VACCGQG +NG+GLCTP+S+LC NRD +AFWD FHPSE+AN
Sbjct  280   ESNMDFISNPQAYGFITSKVACCGQGRFNGIGLCTPISNLCPNRDVFAFWDPFHPSERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIVD  M G N YM+PMNLST++ +DS 
Sbjct  340   RIIVDTFMIGDNKYMNPMNLSTIMHLDSR  368



>gb|AAS75127.1| GDSL-motif lipase [Agave americana]
Length=367

 Score =   514 bits (1324),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 283/327 (87%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPTHRPTGRFSNGLNIPDIISE LG+E T+PYL+P
Sbjct  38    SLVDNGNNNYLATTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEHLGAEATLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQ+LL+GANFASAG+GILNDTGIQF+NII+I +Q+ YF +YQQR++ALIG  + ++L
Sbjct  98    DLRGQRLLVGANFASAGIGILNDTGIQFINIIRISRQMQYFEQYQQRVSALIGQAQMRRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP++V +VI+EYKK+L RLY+LGAR+V+
Sbjct  158   VNRALVLITLGGNDFVNNYYLVPFSARSRQFSLPDFVRYVISEYKKILARLYELGARQVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+ELAQ S DG C PELQ A  +FNP+LV+I+  LN +     FL  NT 
Sbjct  218   VTGTGPLGCVPSELAQRSRDGNCDPELQRAGDLFNPQLVQILNQLNSQFGSTVFLGANTR  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + HMDFI+ P+ +GF+TS+VACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHP++KAN
Sbjct  278   RAHMDFISYPQRYGFITSKVACCGQGPYNGIGLCTVASNLCPNRDLYAFWDAFHPTQKAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             RIIV Q M GSN YM PMN++++LAM+
Sbjct  338   RIIVSQFMTGSNEYMTPMNVTSLLAMN  364



>ref|XP_004495557.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   514 bits (1323),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 288/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             S+ DNGNN+FLAT+ARAD+PPYGID+PTH+P+GRFSNGLNIPD+ISE+LG EPT+PYL+P
Sbjct  39    SIADNGNNHFLATTARADTPPYGIDFPTHKPSGRFSNGLNIPDLISEQLGLEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLL+GANFASAG+GILNDTGIQF++I+ I +QL  F  YQQRL+A IG  +A+KL
Sbjct  99    CLVGEKLLVGANFASAGIGILNDTGIQFLDILHIDKQLKLFHHYQQRLSAHIGANEAQKL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLI LGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+K+LK+LYDLG R+V+
Sbjct  159   VNKALVLIVLGGNDFVNNYYLVPFSARSRQFSLPDYVSYLISEYRKILKKLYDLGGRKVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G C  EL+ A  ++NP+LV++IK LN+EI  + F+A N H
Sbjct  219   VTGTGPMGCVPAELAMRSRNGDCDVELERAGSLYNPQLVQMIKGLNQEIGADIFIAANAH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI+NP+AFGFVTS+ ACCGQGPYNG+GLCTPLS+LC NRD YAFWD+FHPSEKA+
Sbjct  279   QMHMDFISNPQAFGFVTSKEACCGQGPYNGIGLCTPLSNLCQNRDLYAFWDSFHPSEKAS  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ GS  YMHPMNLST+LAMDS
Sbjct  339   RIIVQQILTGSYEYMHPMNLSTLLAMDS  366



>ref|XP_003553269.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   514 bits (1323),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 293/329 (89%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  +AK 
Sbjct  100   PELRGDKLLVGANFASAGIGILNDTGVQFVNVIRMYRQLEYFKEYQNRVSAIIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIATDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR++YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPQQFGFVTSQVACCGQGPYNGIGLCTALSNLCSNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+++M+GS  YM+PMNLST+LA+D+
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDA  368



>ref|XP_008789479.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=364

 Score =   513 bits (1322),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 288/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGID PT RPTGRFSNG+N+PDIISE LG+EPT+PYL+P
Sbjct  35    SLVDNGNNNYLATTARADAPPYGIDSPTRRPTGRFSNGMNVPDIISENLGAEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVGILNDTGIQFVNII+I+ QL YF +YQQRL++LIG E+A++L
Sbjct  95    ELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIWTQLHYFEQYQQRLSSLIGPEQAQRL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQFTLPNYV ++++EY+K+L  LY+LGARRV+
Sbjct  155   VNQALVLITLGGNDFVNNYYLVPFSVRSRQFTLPNYVTYLMSEYRKILAGLYELGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S  G C PEL  A+ +FNP+L++++  LN +I  + F +VN +
Sbjct  215   VTGTGPLGCVPAELALRSRTGHCDPELNGASNLFNPQLIQVVNELNSQIGSDVFFSVNVY  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI++P+A+GFVTS++ACCGQGPYNG+GLCT LS++C NRD +AFWDAFHP+E+AN
Sbjct  275   SMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTVLSNVCPNRDIFAFWDAFHPTERAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RI+V Q M G+  YM P+NLST+LAMD+  
Sbjct  335   RILVRQFMAGTTKYMSPLNLSTILAMDART  364



>ref|XP_011076887.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=369

 Score =   513 bits (1322),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 287/330 (87%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+LAT+ARADSPPYGIDYPTHRPTGRFSNGLNIPDIISE +G SE  +PYL+
Sbjct  39    SLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISESIGQSESPLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAGVGIL+DTG QFVNII+I QQL YF +YQ+R++ALIG E+A++
Sbjct  99    PELTGPKLLVGANFASAGVGILSDTGAQFVNIIRISQQLSYFQQYQRRVSALIGAEEAQR  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN+ALVLITLGGNDFVNNYYL+PFS RSRQFTLP+YV ++I+EY+K+L RLY+LGARRV
Sbjct  159   LVNEALVLITLGGNDFVNNYYLVPFSARSRQFTLPDYVRYLISEYRKILSRLYELGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA  S +G+CAPELQ AA +FNP+L  ++  LN ++  + F+A NT
Sbjct  219   LVTGTGPLGCVPAELAMRSRNGECAPELQQAAALFNPQLTEMLLSLNSQLGSDVFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI +P+AFGF+TS+VACCGQG YNG+GLCT LS+LC NRD YAFWD FHPSE+A
Sbjct  279   QLMNSDFIRDPQAFGFITSKVACCGQGLYNGLGLCTQLSNLCPNRDVYAFWDPFHPSERA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR IV Q+M GS+ YM PMNLST++A+DS 
Sbjct  339   NRFIVRQIMTGSSAYMTPMNLSTIIALDSR  368



>ref|XP_011038448.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
 ref|XP_011038449.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
Length=368

 Score =   513 bits (1322),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 288/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYGIDYPTHR TGRFSNGLNIPD+ISE++GSE  +PYL+P
Sbjct  39    SLVDSGNNNYLATTARADSYPYGIDYPTHRATGRFSNGLNIPDLISEQIGSESPLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++++QL+YF +YQQR+ ALIG EKAK+L
Sbjct  99    ELRGQKLLVGANFASAGIGILNDTGIQFINIIRMHRQLEYFQQYQQRVGALIGAEKAKQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+L+T+GGNDFVNNYYL+P+S RSRQ+ LP+YV ++I+EYKK+L RLY+LGARRV+
Sbjct  159   VNQALILLTVGGNDFVNNYYLVPYSARSRQYDLPDYVKYLISEYKKLLMRLYNLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +I  +NR+I  + F+A NTH
Sbjct  219   VTGTGPLGCVPAELAMRSANGGCSAELQRAAALYNPQLESMIIDVNRKIGSDVFIAANTH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H+DF +NP+A+GF TS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKAN
Sbjct  279   QMHVDFFSNPQAYGFTTSKIACCGQGPYNGLGLCTLFSNLCPNRDLYAFWDPFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             +IIV Q+M GS  YM PMNLST++A+DS 
Sbjct  339   KIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>ref|XP_003589465.1| GDSL esterase/lipase [Medicago truncatula]
 ref|XP_003590913.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59716.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=368

 Score =   513 bits (1322),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 284/327 (87%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             S+ DNGNN+FL T+ARAD+PPYGID+PTH+PTGRFSNGLNIPDIISE+LG EPT+PYL+P
Sbjct  39    SIADNGNNHFLLTTARADTPPYGIDFPTHKPTGRFSNGLNIPDIISERLGLEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLL+GANFASAG+GILNDTG QF++II I +QL  F  YQQRL+A IG E+AKKL
Sbjct  99    LLIGEKLLVGANFASAGIGILNDTGFQFLDIIHIDKQLKLFDHYQQRLSAHIGAEEAKKL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ A+VLI LGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EYKKVLK+LYDLG R+V+
Sbjct  159   VHKAIVLIVLGGNDFVNNYYLVPFSARSRQFSLPDYVTYLISEYKKVLKKLYDLGGRKVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G C  EL  AA ++NP+LV +IK LN EI  + F+A N  
Sbjct  219   VTGTGPMGCVPAELALRSRNGDCDVELVRAASLYNPQLVEMIKELNTEIGSDVFIAANAR  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFITNP+AFGFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKA+
Sbjct  279   QMHMDFITNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNLCQNRDLYAFWDPFHPSEKAS  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             RIIV Q++ GSN YM+PMNLSTVLAMD
Sbjct  339   RIIVQQILTGSNEYMYPMNLSTVLAMD  365



>ref|XP_003524731.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN42753.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   513 bits (1322),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 292/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL+YF EYQ R++ALIG  +A  
Sbjct  100   PELRGDKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFKEYQNRVSALIGASEATN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQKILQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIGSDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR+ YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPRQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNRETYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_003520948.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Glycine 
max]
 gb|KHN27241.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score =   513 bits (1322),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 287/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADS PYGID  +HR +GRFSNGLN+PD+ISEK+GSEPT+PYL+P
Sbjct  43    SLVDNGNNNFLATTARADSYPYGIDSASHRASGRFSNGLNMPDLISEKIGSEPTLPYLSP  102

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL+G++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+ + L
Sbjct  103   QLNGERLLVGANFASAGIGILNDTGIQFINIIRITEQLAYFKQYQQRVSALIGEEQTRNL  162

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSR++ LP+YV F+I+EY+K+L  LY+LGARRV+
Sbjct  163   VNKALVLITLGGNDFVNNYYLVPFSARSREYALPDYVVFLISEYRKILANLYELGARRVL  222

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ A  +FNP+LV+++  LN +I  + F++ N  
Sbjct  223   VTGTGPLGCVPAELAMHSQNGECATELQRAVNLFNPQLVQLLHELNTQIGSDVFISANAF  282

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H+DF++NP+A+GFVTS+VACCGQG YNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  283   TMHLDFVSNPQAYGFVTSKVACCGQGAYNGIGLCTPASNLCPNRDLYAFWDPFHPSERAN  342

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IVD+ M GS  YMHPMNLST++A+DS
Sbjct  343   RLIVDKFMTGSTEYMHPMNLSTIIALDS  370



>ref|XP_003554997.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   513 bits (1321),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 230/330 (70%), Positives = 293/330 (89%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP THRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPTHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  +AK 
Sbjct  100   PELRGDKLLVGANFASAGIGILNDTGVQFVNVIRMYRQLEYFKEYQNRVSAIIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+C PELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCVPELQQAAALFNPQLEQMLLQLNRKIGSDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TNP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR++YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_010043320.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Eucalyptus grandis]
 gb|KCW85325.1| hypothetical protein EUGRSUZ_B02164 [Eucalyptus grandis]
Length=369

 Score =   513 bits (1321),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 288/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPTHRPTGRFSNG NIPD IS+++GS+PT+PYL+P
Sbjct  40    SLVDNGNNNYLATTARADSPPYGIDYPTHRPTGRFSNGFNIPDFISQEIGSQPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL+GANFASAG+GILNDTG+QF+N+I++YQQL+YF +YQQR++ALIG  + +KL
Sbjct  100   ELRGQRLLVGANFASAGIGILNDTGVQFINVIRMYQQLEYFRQYQQRVSALIGPGRTRKL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNY+L+P+S RSRQ++LPNYV FVI+E+KK L RL+DLGARRV+
Sbjct  160   VNQALVLITVGGNDFVNNYFLVPYSARSRQYSLPNYVRFVISEFKKQLMRLHDLGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C  ELQ AA ++NP+L++++K LN + K   F+A NT 
Sbjct  220   VTGTGPLGCVPAELAMRGRNGQCVAELQQAASLYNPQLLQMLKDLNNKYKSQVFIAANTQ  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H +FI NP+A+GF+T++VACCGQGPYNG+GLCT  S LC NRD+YAFWD FHPS+KAN
Sbjct  280   LMHNNFIANPRAYGFITAKVACCGQGPYNGIGLCTVASTLCPNRDQYAFWDPFHPSQKAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M+GS  YM PMN+ST++A+DS 
Sbjct  340   RLIVQQIMSGSTKYMDPMNVSTIMALDSR  368



>ref|XP_009379726.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=362

 Score =   513 bits (1320),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 290/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++LAT+ARADS PYGIDYPT RPTGRFSNGLNIPD+ISE +GSEPT+PYL+P
Sbjct  33    SLVDSGNNDYLATTARADSYPYGIDYPTRRPTGRFSNGLNIPDLISEHIGSEPTLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQ LL+GANFASAG+GILNDTG QF+NII+IY+QL+YF +YQ R++AL+G E+ ++L
Sbjct  93    QLTGQNLLVGANFASAGIGILNDTGFQFLNIIRIYKQLEYFQQYQTRVSALVGPEQTQRL  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGARRV+
Sbjct  153   VNEALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARRVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S  G+CA ELQ AA +FNP+L  ++  LN +I  + F+  +  
Sbjct  213   VTGTGPLGCVPAELAQRSRRGECAVELQRAASLFNPQLADMVNSLNNQIGSDVFIYADAF  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HM+FI+NP+A+GFVTS++ACCGQGPYNG+GLCT +S+LC NRD YAFWD+FHPSEKAN
Sbjct  273   RMHMNFISNPQAYGFVTSKIACCGQGPYNGVGLCTIVSNLCPNRDLYAFWDSFHPSEKAN  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV  ++ GSN YM+PMNLST+LA+DS
Sbjct  333   RIIVQIILTGSNEYMNPMNLSTILALDS  360



>ref|XP_006371114.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
 gb|ERP48911.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
Length=395

 Score =   513 bits (1320),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 287/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT + TGRFSNGLNIPDIISE++GSE  +P+L+P
Sbjct  66    SLVDSGNNNYLATTARADSPPYGIDYPTRQATGRFSNGLNIPDIISEQMGSESPLPFLSP  125

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL+GANFASAG+GILNDTG+QF+NII++Y QL+YF +YQQR+ ALIG E+AK+L
Sbjct  126   ELRGQRLLVGANFASAGIGILNDTGVQFINIIRMYAQLEYFQQYQQRVGALIGAEQAKRL  185

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P S RSRQ+ LP+YV ++I+EY+++L +LY+LGARRV+
Sbjct  186   VNQALVLITVGGNDFVNNYYLVPSSARSRQYDLPDYVKYLISEYRELLMKLYNLGARRVL  245

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +I  +NR+I  N F++ NTH
Sbjct  246   VTGTGPLGCVPAELATRSTNGGCSEELQRAAALYNPQLESMINDVNRKIGSNVFISANTH  305

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF++NP+A+GF TS++ACCGQG YNG+GLCT LS+LC NRD YAFWD FHPSEKAN
Sbjct  306   QMHTDFVSNPQAYGFTTSKIACCGQGSYNGLGLCTILSNLCPNRDVYAFWDPFHPSEKAN  365

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q+M GS  YM PMNLST++A+DS +
Sbjct  366   RIIVQQIMTGSTQYMKPMNLSTIMALDSRS  395



>ref|XP_003553249.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   512 bits (1318),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 230/330 (70%), Positives = 292/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  +AK 
Sbjct  100   PELRGDKLLVGANFASAGIGILNDTGVQFVNVIRMYRQLEYFKEYQNRVSAIIGASEAKN  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV  ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+L+RLYDLGARRV
Sbjct  160   LVKQALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLQRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPL CVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLACVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLQLNRKIATDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF+TN + FGFVTSQVACCGQGPYNG+GLCT LS+LC+NRD+YAFWDAFHPSEKA
Sbjct  280   GKAHNDFVTNAQQFGFVTSQVACCGQGPYNGIGLCTALSNLCSNRDQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+DS+
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDSN  369



>emb|CDO99962.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   511 bits (1317),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 289/329 (88%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+L TSARADSPPYG+DYPTHRPTGRFSNG NIPDIIS+ +G SE  +PYL+
Sbjct  40    SLVDSGNNNYLVTSARADSPPYGLDYPTHRPTGRFSNGFNIPDIISQNIGASESPLPYLD  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L+G++LL+GANFASAGVGILNDTGIQFVNII+I  QL+YF EYQQR++AL+G ++AK+
Sbjct  100   PELNGRRLLVGANFASAGVGILNDTGIQFVNIIRISLQLEYFREYQQRVSALVGAQQAKQ  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVL+TLGGNDFVNNYYL+P S RSRQ+ LP+YV F+I+EY+KVL RLYDLGARRV
Sbjct  160   LVNQALVLMTLGGNDFVNNYYLVPNSARSRQYALPDYVRFLISEYQKVLSRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA  S +G+C+ ELQ AA +FNP+L+++++ LN +I  + F+  NT
Sbjct  220   IVTGTGPLGCVPAELAMRSRNGECSAELQRAAGLFNPQLIQMLRGLNSKIGKDVFIGANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H DFITNP AFGFV+S+VACCGQGPYNG+GLCT LS+LC NRD+YAFWD FHPSEKA
Sbjct  280   QQMHNDFITNPGAFGFVSSKVACCGQGPYNGLGLCTGLSNLCPNRDQYAFWDPFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             N+IIV Q++ GS  YM PMNLST+LA+DS
Sbjct  340   NKIIVQQILTGSTDYMTPMNLSTILAVDS  368



>ref|XP_004152806.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
 gb|KGN61316.1| Zinc finger protein [Cucumis sativus]
Length=368

 Score =   511 bits (1317),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 284/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPD+ISE +GS  T+PYL+P
Sbjct  39    SLVDNGNNNYLLTTARADNYPYGIDYPTRRPTGRFSNGLNIPDLISEAMGSPSTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I QQL+YF +YQ R++ALIG E+  +L
Sbjct  99    QLRGENLLVGANFASAGIGILNDTGIQFLNIIRIRQQLEYFRQYQARVSALIGEEETVRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+P S RSRQFTLP+YV ++I+EY+KVL  LY+ GARRV+
Sbjct  159   VNEALVLITLGGNDFVNNYYLVPVSARSRQFTLPDYVVYIISEYRKVLASLYEFGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ AA +FNP+L +II  LN EI  + F+AVNT 
Sbjct  219   VTGTGPLGCVPAELAMRGRNGECSAELQRAAALFNPQLAQIINSLNEEIGSHVFIAVNTQ  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GF+TS+VACCGQGP+NG+GLCTP S+LC NR+ YAFWD FHPSE+AN
Sbjct  279   MMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNLCRNRNVYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ G+  YMHPMNLST+LAMDS 
Sbjct  339   RIIVQQILTGTQEYMHPMNLSTILAMDSR  367



>ref|XP_007205392.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
 gb|EMJ06591.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
Length=368

 Score =   511 bits (1316),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 284/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNG NIPD IS++LG+E T+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSNGFNIPDFISQQLGAESTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQFVNII++ +QL+YF +YQQR++ALIG ++ K+L
Sbjct  99    ELTGQKLLVGANFASAGIGILNDTGIQFVNIIRMSRQLEYFQQYQQRVSALIGTQRTKQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQ+ LP+YV  +I+E KK+L R+YDLG RRV+
Sbjct  159   VNQALVLLTVGGNDFVNNYYLVPFSARSRQYDLPDYVKLLISELKKLLLRMYDLGTRRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G+C+ ELQ AA ++NP+LV+++K LN ++  + F+A NT 
Sbjct  219   VTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQMLKSLNSQLGSDVFIAANTQ  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DFI+NP+AFGF TS++ACCGQGPYNG+GLCT  S+LC NR  YAFWDAFHPSEKAN
Sbjct  279   QTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNLCPNRGRYAFWDAFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  ++ GS  YM PMNLST+LA+DS 
Sbjct  339   KLIVQNILTGSTKYMDPMNLSTILALDSR  367



>ref|XP_006443291.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 ref|XP_006478981.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Citrus sinensis]
 gb|ESR56531.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|KDO52502.1| hypothetical protein CISIN_1g017181mg [Citrus sinensis]
Length=376

 Score =   511 bits (1317),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 291/329 (88%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGID+PTHRPTGRFSNG NIPDIIS+++G SE  +PYL+
Sbjct  45    SLVDSGNNNYLATTARADAPPYGIDFPTHRPTGRFSNGFNIPDIISQRIGQSEAPLPYLS  104

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L+GQ+LLIGANFASAG+GILNDTGIQFVNII++++QLDYFAEYQ+R++A+IG ++A++
Sbjct  105   PELNGQRLLIGANFASAGIGILNDTGIQFVNIIRMFRQLDYFAEYQRRVSAVIGAQQARQ  164

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNYYL+P+S RSRQFTLPNYV ++I+EY+K+L RLY+LGARRV
Sbjct  165   LVNRALVLITVGGNDFVNNYYLVPYSARSRQFTLPNYVKYIISEYRKLLMRLYELGARRV  224

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA    +G C+ ELQ A  ++NP+L ++++ +NR+I    F+A NT
Sbjct  225   LVTGTGPLGCVPAELALRGSNGGCSAELQRATSLYNPQLEQMLQGINRKIGQTVFIAANT  284

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q HMDF++NP+A+GF T++VACCGQGP NG+GLCT LS+LC NR  YAFWD FHPSEKA
Sbjct  285   QQTHMDFVSNPQAYGFTTAKVACCGQGPNNGLGLCTALSNLCPNRQLYAFWDPFHPSEKA  344

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+Q+ +GS  YM PMNLSTV+A+DS
Sbjct  345   NRLIVEQIFSGSTNYMTPMNLSTVMALDS  373



>ref|XP_006443287.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 ref|XP_006478978.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
 gb|ESR56527.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 gb|KDO52496.1| hypothetical protein CISIN_1g017552mg [Citrus sinensis]
Length=369

 Score =   511 bits (1316),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 291/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++LAT+ARADS PYGIDYPTHRPTGRFSNGLNIPD+ISE++G E T+PYL+P
Sbjct  40    SLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDLISEQIGMESTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL+GANFASAG+GILNDTG QF+NII+I +Q++YF +YQQR++ALIG E+ ++L
Sbjct  100   ELTGQRLLVGANFASAGIGILNDTGFQFINIIRISKQIEYFQQYQQRVSALIGAEQTERL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+K+L R+Y+LGARRV+
Sbjct  160   VNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKILARIYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ  ++G+C+ ELQ AA +FNP+LV+++  LN +I  + F+A N  
Sbjct  220   VTGTGPLGCVPAELAQRGVNGECSVELQRAADLFNPQLVQMLNELNSQIGSDVFVAANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI +P+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKAN
Sbjct  280   AMHMDFIHDPQAYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYAFWDPFHPSEKAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV ++ +GS+ YM+PMNLST++A+DS 
Sbjct  340   RIIVQRIASGSSKYMNPMNLSTIMALDSR  368



>gb|KHN14886.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   511 bits (1316),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 292/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP THRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPPTHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL YF EYQ R+ ALIG  +AK 
Sbjct  100   PELSGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLHYFKEYQNRVRALIGASQAKS  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+LK+LYDLGARRV
Sbjct  160   LVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLKKLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEKMLLRLNRKIGKDIFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGF TSQVACCGQGPYNG+GLCT LS+LCTNR++YAFWDAFHPSEKA
Sbjct  280   GKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNLCTNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_002325360.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
 gb|EEE99741.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
Length=367

 Score =   511 bits (1316),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGL+IPD IS+ LGSE T+PYL+P
Sbjct  38    SLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLSIPDFISQHLGSELTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL+GANFASAG+GILNDTGIQF+NII++Y+QL+YF +YQ+R+ AL+G ++ ++L
Sbjct  98    ELTGQRLLVGANFASAGIGILNDTGIQFLNIIRMYKQLEYFEQYQRRVTALVGAQQTQQL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LIT+GGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L RLYDLGARRV+
Sbjct  158   VNGALTLITVGGNDFVNNYYLVPFSARSRQFRLPDYVRYLISEYRKILMRLYDLGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+C+ ELQ AA ++NP+L +++  LN +   + F+A NT 
Sbjct  218   VTGTGPMGCVPAELAQRSPNGQCSAELQRAASLYNPQLTQMLGQLNDQYGADIFIAANTR  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+  DF+ NP+A+GFVTS++ACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  278   QMTADFVYNPQAYGFVTSKIACCGQGPYNGLGLCTPASNLCPNRDLYAFWDPFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              I+V Q++NG  TYMHPMNLST+LA+DS 
Sbjct  338   GIVVQQILNGDATYMHPMNLSTILALDSR  366



>ref|XP_004513280.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=368

 Score =   511 bits (1316),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 284/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGID P HR +GRFSNGLN+ D+ISEK+G EPT+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADSYPYGIDSPAHRASGRFSNGLNMADLISEKIGEEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG+KLL GANFASAG+GILNDTGIQF+NII+I  QL YF +YQQR++ALIG  +AKKL
Sbjct  99    ELDGEKLLAGANFASAGIGILNDTGIQFINIIRITAQLAYFKQYQQRVSALIGENEAKKL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSR+F LP+YV F+I+EY+K+L+ +Y+LGARRV+
Sbjct  159   VNEALVLITLGGNDFVNNYYLVPFSARSREFALPDYVVFLISEYRKILENMYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ A  +FNP+LV++I  LN +   + F++ N  
Sbjct  219   VTGTGPLGCVPAELAMHSRNGECATELQRAVNLFNPQLVQLINQLNSQFGSDVFISANAF  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H+DF+ +P+A+GFVTS+VACCGQG YNG+GLCTP S+LC NRD YAFWD FHPSEKAN
Sbjct  279   TMHLDFVNDPQAYGFVTSKVACCGQGAYNGIGLCTPASNLCPNRDLYAFWDPFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IVD+ M GS  YMHPMNLST++A+DS 
Sbjct  339   RLIVDKFMTGSTEYMHPMNLSTIIALDSR  367



>ref|XP_011002016.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score =   511 bits (1315),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 285/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPT RPTGRFSNGLNIPD IS++LGSEPT+PYL+P
Sbjct  39    SLVDNGNNNYLVTSARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQQLGSEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQ+LL+GANFASAG+GILNDTGIQF+NII++Y+QLDYF +YQ+R+AAL+G ++ ++L
Sbjct  99    QLTGQRLLVGANFASAGIGILNDTGIQFLNIIRMYRQLDYFEQYQRRVAALLGAQQTQQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LIT+GGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L RLYDLG RRV+
Sbjct  159   VNGALSLITVGGNDFVNNYYLVPFSARSRQFRLPDYVRYLISEYRKILMRLYDLGVRRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+CA ELQ AA ++NP+L +++  LN +   + F+A NT 
Sbjct  219   VTGTGPMGCVPAELAQRSTNGQCAVELQRAASLYNPQLTQMLGQLNNQYGADIFIAANTG  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+  +F+ NP+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHP+E+AN
Sbjct  279   QMTANFVDNPQAYGFVTSKIACCGQGPYNGLGLCTLASNLCPNRDLYAFWDPFHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              II  Q++ G  TYMHPMNLST+LA+DS 
Sbjct  339   SIIAQQILTGDATYMHPMNLSTILALDSR  367



>ref|XP_008810810.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=365

 Score =   511 bits (1315),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 287/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFL T+ARAD PPYGIDYPTHRPTGRFSNGLN+PDIISE LG+EPT+PYL+P
Sbjct  36    SLVDNGNNNFLLTTARADLPPYGIDYPTHRPTGRFSNGLNMPDIISEHLGAEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF+NII+I +QL YF +Y+QRL++++G  + KKL
Sbjct  96    ELRGEKLLVGANFASAGIGILNDTGIQFLNIIRIDRQLVYFEQYKQRLSSVVGEAQMKKL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSR+F LP+YV ++I+EYKK+L RLY+LGARRVM
Sbjct  156   VNQALVLITLGGNDFVNNYYLVPFSARSREFALPDYVRYLISEYKKILGRLYELGARRVM  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+ELAQ   +G+CA ELQ AA +FNP+L R +  LNR+   + F++ N  
Sbjct  216   VTGTGPLGCVPSELAQRGRNGECAAELQRAASLFNPQLDRTLIELNRKFGSDVFISANAF  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMD+I++P ++GFVTS++ACCGQGPYNG+GLCT  S+LC NR+ Y+FWDAFHP+EKAN
Sbjct  276   KMHMDYISDPGSYGFVTSKIACCGQGPYNGLGLCTAASNLCPNRNLYSFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q M GS+ YM+PMNLST+LAMD+
Sbjct  336   RIIVSQFMIGSSEYMNPMNLSTILAMDA  363



>ref|XP_010940685.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=364

 Score =   510 bits (1314),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 286/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGID PT RPTGRFSNGLN+PDIISE LGSEP MPYL+P
Sbjct  35    SLVDNGNNNYLATTARADAPPYGIDSPTRRPTGRFSNGLNVPDIISENLGSEPLMPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVGILNDTGIQFVNII+I+ QL YF +YQQRL++LIG E+ + L
Sbjct  95    ELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIWNQLHYFQQYQQRLSSLIGPEQTQSL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN  LVLITLGGNDFVNNYYL+P+S RSRQFTLP+YV ++++EYKK+L  LY+LGARRV+
Sbjct  155   VNQGLVLITLGGNDFVNNYYLVPYSLRSRQFTLPDYVTYLMSEYKKILAGLYELGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S  G+C PEL  A+ +FNP+L++++  LN +I  + F++VN +
Sbjct  215   VTGTGPLGCVPAELALRSRTGQCDPELNRASNLFNPQLIQVLNELNGQIGSDVFVSVNVY  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCT LS++C NR+ YAFWDAFHP+E+AN
Sbjct  275   TMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTVLSNVCPNRNIYAFWDAFHPTERAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R++V Q M G+  YM PMNLST+LAMDS  
Sbjct  335   RMLVSQFMAGTTKYMSPMNLSTILAMDSRT  364



>ref|XP_006350943.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score =   510 bits (1314),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 231/331 (70%), Positives = 290/331 (88%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD+GNNN+LAT+ARADSPPYGIDYPT R TGRFSNG NIPDIIS+++GS E  +PYL+
Sbjct  34    SLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGYNIPDIISQQIGSSESPLPYLS  93

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P L GQ+LL+GANFASAG+GILNDTG+QF+NII++ QQLDYF +YQ+R++ LIG    ++
Sbjct  94    PALTGQRLLVGANFASAGIGILNDTGVQFINIIRMPQQLDYFRQYQRRVSGLIGEASTQR  153

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVL+TLGGNDFVNNY+L+P S RSRQF++P+YV F+I EY+K+L  +Y+LG RRV
Sbjct  154   LVNQALVLMTLGGNDFVNNYFLVPNSARSRQFSIPDYVPFLIREYRKILMTVYNLGGRRV  213

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELAQ S +G+C+PELQ AA +FNP+L+++++ LNRE+  N F+A NT
Sbjct  214   IVTGTGPLGCVPAELAQRSRNGECSPELQQAAALFNPQLMQMLQGLNRELGSNVFIAANT  273

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H +FITNP+A+GF+TS+VACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKA
Sbjct  274   QQMHTNFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPNRDVYAFWDPFHPSEKA  333

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N+IIV Q+M+G+  YM+PMNLST+LAMDS A
Sbjct  334   NKIIVQQIMSGTTEYMNPMNLSTILAMDSEA  364



>gb|KCW61461.1| hypothetical protein EUGRSUZ_H04197 [Eucalyptus grandis]
Length=373

 Score =   511 bits (1315),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 285/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPT +PTGRFSNG N+PD IS++LGSE T+PYL+P
Sbjct  43    SLVDNGNNNYLVTTARADSPPYGIDYPTGQPTGRFSNGFNVPDFISQELGSESTLPYLSP  102

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTG QF+NII +Y QL YF EYQ+R++AL+G E+ ++L
Sbjct  103   ELTGQKLLVGANFASAGIGILNDTGTQFINIIGMYTQLQYFEEYQKRVSALVGAERTQQL  162

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNY+L+P+S RSRQFT+P Y  ++I+EY+K+L+RLY+LGARRV+
Sbjct  163   VNQALVLITVGGNDFVNNYFLVPYSARSRQFTIPEYAKYLISEYRKLLERLYELGARRVL  222

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+CAPELQ AA +FNP+L ++++ LN+E     F+A NT 
Sbjct  223   VTGTGPLGCVPAELALRGRNGQCAPELQQAASLFNPQLTQMLQGLNQEYGSPVFIAANTD  282

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DFI++P+A+GFVTS+VACCGQGPYNG+GLCT  S LCTNRD+YAFWD FHPS+KAN
Sbjct  283   LMHGDFISDPQAYGFVTSKVACCGQGPYNGIGLCTTASDLCTNRDQYAFWDPFHPSQKAN  342

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  +M GS  YM+PMNLST+LA+DSH
Sbjct  343   KLIVQSIMKGSAEYMYPMNLSTILALDSH  371



>ref|XP_003590909.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES61160.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=367

 Score =   510 bits (1314),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 238/328 (73%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             S+ DNGNNNFL T+ARAD+PPYGID+PTH PTGRFSNGLNIPD+ SE+LG EP++PYL+P
Sbjct  38    SVADNGNNNFLTTTARADAPPYGIDFPTHEPTGRFSNGLNIPDLTSERLGLEPSLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLL+GANFASAGVGILNDTG QF+ II I +QLD F +YQQ+L+A IG E AK+L
Sbjct  98    LLVGEKLLVGANFASAGVGILNDTGFQFLQIIHIGKQLDLFNQYQQKLSAQIGAEGAKQL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN A+VLI LGGNDFVNNYYL+PFS RSRQF+LPNYV ++I+EYKK+L+RLYDLGARRV+
Sbjct  158   VNKAIVLIMLGGNDFVNNYYLVPFSARSRQFSLPNYVTYLISEYKKILQRLYDLGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GC PAELA  S +G C  EL  AA ++NP+LV++I  LNREI  + F+AVN H
Sbjct  218   VTGTGPMGCAPAELALKSRNGDCDAELMRAASLYNPQLVQMITQLNREIGDDVFIAVNAH  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFITNPKAFGFVT++ ACCGQG +NG+GLCTP+S LC NR+ YAFWDAFHPSEKA+
Sbjct  278   KMHMDFITNPKAFGFVTAKDACCGQGRFNGIGLCTPISKLCPNRNLYAFWDAFHPSEKAS  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV QM  GSN YM+PMNLSTVLAMDS
Sbjct  338   RIIVQQMFIGSNLYMNPMNLSTVLAMDS  365



>ref|XP_002319125.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|EEE95048.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=368

 Score =   510 bits (1313),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 288/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYGIDYPTH+ TGRFSNGLNIPD+ISE++GSE  +PYL+P
Sbjct  39    SLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSNGLNIPDLISEQIGSESPLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++++QL+YF +YQQR+ ALIG EKAK+L
Sbjct  99    ELRGQKLLVGANFASAGIGILNDTGIQFLNIIRMHRQLEYFQQYQQRVGALIGAEKAKRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN +L+L+T+GGNDFVNNYYL+P+S RSRQ+ LP+YV  +I+EYKK+L RLY+LGARRV+
Sbjct  159   VNQSLILLTVGGNDFVNNYYLVPYSARSRQYDLPDYVKHLISEYKKILMRLYNLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +I  +NR+I  + F+A NTH
Sbjct  219   VTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLESMIIDVNRKIGSDVFIAANTH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF++NP+A+GF TS++ACCGQGPYNG+GLCT LS+LC NR+ YAFWD FHPSEKAN
Sbjct  279   QMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNLCPNRELYAFWDPFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             +IIV Q+M GS  YM PMNLST++A+DS 
Sbjct  339   KIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>ref|XP_002522021.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40425.1| zinc finger protein, putative [Ricinus communis]
Length=368

 Score =   510 bits (1313),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 285/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID+PTHRPTGRFSNGLNIPD IS+ +G++  +PYL+P
Sbjct  39    SLVDNGNNNYLATTARADSPPYGIDFPTHRPTGRFSNGLNIPDFISQAIGTDFLLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTG+QF NII+++QQ +YF EYQ+R+AALIG E+ ++L
Sbjct  99    QLTGENLLVGANFASAGIGILNDTGVQFANIIRMFQQYEYFEEYQRRVAALIGAERTQQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VNDALVLIT+GGNDFVNNYYL+PFS RSRQ++LP+YV F+I+EYKK+L RLYDLGARRV+
Sbjct  159   VNDALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVRFLISEYKKLLMRLYDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ AA +FNP+L ++++ LN +   + F+A NT 
Sbjct  219   VTGTGPLGCVPAELAMRSSNGECAAELQRAAALFNPQLTQMLRQLNSQYGSDIFIAANTG  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+  DFI+NP AFGFVTS+VACCGQGPYNG+GLCT LS+LC NRD YAFWD FHPSE+AN
Sbjct  279   QMSADFISNPGAFGFVTSKVACCGQGPYNGLGLCTGLSNLCPNRDVYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
               I  Q++ G+  YM+PMNLST++A+DS 
Sbjct  339   SYIARQILTGTTDYMNPMNLSTIMALDSR  367



>ref|XP_008218371.1| PREDICTED: GDSL esterase/lipase LTL1-like [Prunus mume]
Length=405

 Score =   511 bits (1317),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 286/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGIDYPT RPTGRFSNG NIPD IS+++G+E T+PYL+P
Sbjct  76    SLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSNGFNIPDFISQQIGAESTLPYLSP  135

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQFVNII++ +QL+YF +YQQR++ALIG ++ K+L
Sbjct  136   ELTGQKLLVGANFASAGIGILNDTGIQFVNIIRMSRQLEYFQQYQQRVSALIGAQRTKQL  195

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQ+ LP+YV  +++E KK+L R+YDLG RRV+
Sbjct  196   VNGALVLLTVGGNDFVNNYYLVPFSARSRQYDLPDYVKLLMSELKKLLLRMYDLGTRRVL  255

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S +G+C+ ELQ AA ++NP+LV+++K LN ++  + F+A NT 
Sbjct  256   VTGTGPLGCVPAELAQRSRNGECSAELQRAASLYNPQLVQLLKSLNSQLGSDVFIAANTQ  315

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DFI+NP+AFGF TS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKAN
Sbjct  316   QTRNDFISNPQAFGFSTSKIACCGQGPYNGLGLCTVASNLCPNRDRYAFWDAFHPSEKAN  375

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  ++ GS  YM+PMNLST+LA+DS 
Sbjct  376   KLIVQNILTGSTKYMNPMNLSTILALDSR  404



>ref|XP_010024922.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Eucalyptus grandis]
Length=352

 Score =   509 bits (1311),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 285/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPT +PTGRFSNG N+PD IS++LGSE T+PYL+P
Sbjct  22    SLVDNGNNNYLVTTARADSPPYGIDYPTGQPTGRFSNGFNVPDFISQELGSESTLPYLSP  81

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTG QF+NII +Y QL YF EYQ+R++AL+G E+ ++L
Sbjct  82    ELTGQKLLVGANFASAGIGILNDTGTQFINIIGMYTQLQYFEEYQKRVSALVGAERTQQL  141

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNY+L+P+S RSRQFT+P Y  ++I+EY+K+L+RLY+LGARRV+
Sbjct  142   VNQALVLITVGGNDFVNNYFLVPYSARSRQFTIPEYAKYLISEYRKLLERLYELGARRVL  201

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+CAPELQ AA +FNP+L ++++ LN+E     F+A NT 
Sbjct  202   VTGTGPLGCVPAELALRGRNGQCAPELQQAASLFNPQLTQMLQGLNQEYGSPVFIAANTD  261

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DFI++P+A+GFVTS+VACCGQGPYNG+GLCT  S LCTNRD+YAFWD FHPS+KAN
Sbjct  262   LMHGDFISDPQAYGFVTSKVACCGQGPYNGIGLCTTASDLCTNRDQYAFWDPFHPSQKAN  321

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  +M GS  YM+PMNLST+LA+DSH
Sbjct  322   KLIVQSIMKGSAEYMYPMNLSTILALDSH  350



>ref|XP_003554996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   510 bits (1313),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 292/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL YF EYQ R+ ALIG  +AK 
Sbjct  100   PELSGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLHYFKEYQNRVRALIGASQAKS  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+LK+LYDLGARRV
Sbjct  160   LVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLKKLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAATLFNPQLEKMLLRLNRKIGKDIFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGF TSQVACCGQGPYNG+GLCT LS+LCTNR++YAFWDAFHPSEKA
Sbjct  280   GKTHNDFVSNPQQFGFFTSQVACCGQGPYNGLGLCTALSNLCTNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_003553275.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
 gb|KHN14883.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   510 bits (1313),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 291/329 (88%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  39    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAEATLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQF+N+I++Y+QL YF EYQ R+ A+IG  + K 
Sbjct  99    PELRGNKLLVGANFASAGIGILNDTGIQFINVIRMYRQLQYFKEYQNRVRAIIGASQTKS  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV ++I+EY+K+L++LYDLGARRV
Sbjct  159   LVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQKLLQKLYDLGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CA ELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  219   LVTGTGPLGCVPSELAQRGRNGQCAAELQQAAELFNPQLEQMLLQLNRKIGKDTFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H +F+TNP+ FGF+TSQ+ACCGQGPYNG+GLCTPLS+LC NRD+YAFWDAFHPSEKA
Sbjct  279   GKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCTPLSNLCPNRDQYAFWDAFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+++M+GS  YM+PMNLST+LA+D+
Sbjct  339   NRLIVEEIMSGSKIYMNPMNLSTILALDA  367



>gb|ACU23725.1| unknown [Glycine max]
Length=372

 Score =   510 bits (1313),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 229/328 (70%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADS PYGID  +HR +GRFSNGLN+PD+ISEK+GSEPT+PYL+P
Sbjct  43    SLVDNGNNNFLATTARADSYPYGIDSASHRASGRFSNGLNMPDLISEKIGSEPTLPYLSP  102

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL+G++LL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+ + L
Sbjct  103   QLNGERLLVGANFASAGIGILNDTGIQFINIIRITEQLAYFKQYQQRVSALIGEEQTRNL  162

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSR++ LP+YV F+I+EY+K+L  LY+LGARRV+
Sbjct  163   VNKALVLITLGGNDFVNNYYLVPFSARSREYALPDYVVFLISEYRKILANLYELGARRVL  222

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ A  +FNP+LV+++  LN +I  + F++ N  
Sbjct  223   VTGTGPLGCVPAELAMHSQNGECATELQRAVSLFNPQLVQLLHELNTQIGSDVFISANAF  282

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H+DF++NP+A+GFVTS+VAC GQG YNG+GLCTP S+LC NRD YAFWD FHPSE+AN
Sbjct  283   TMHLDFVSNPQAYGFVTSKVACGGQGAYNGIGLCTPASNLCPNRDLYAFWDPFHPSERAN  342

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IVD+ M GS  YMHPMNLST++A+DS
Sbjct  343   RLIVDKFMTGSTEYMHPMNLSTIIALDS  370



>ref|XP_006577328.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X2 [Glycine 
max]
Length=382

 Score =   510 bits (1314),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 289/336 (86%), Gaps = 6/336 (2%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADS PYGIDYPTHR TGRFSNGLNIPDIISEK+GSEPT+PYL+ 
Sbjct  45    SLVDNGNNNYLFTTARADSYPYGIDYPTHRATGRFSNGLNIPDIISEKIGSEPTLPYLSR  104

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQF------VNIIKIYQQLDYFAEYQQRLAALIGG  763
             +LDG++LL+GANFASAG+GILNDTGIQF      +NII+I +QL YF +YQQR++ALIG 
Sbjct  105   ELDGERLLVGANFASAGIGILNDTGIQFYNLHLQINIIRISRQLQYFEQYQQRVSALIGP  164

Query  762   EKAKKLVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDL  583
             E+ ++LVN ALVLITLGGNDFVNNYYL+PFS RSRQF LPNYV ++I+EY+K+L RLY+L
Sbjct  165   EQTQRLVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPNYVVYLISEYRKILVRLYEL  224

Query  582   GARRVMVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAF  403
             GARRV+VTGTGPLGCVPAELAQ S +G+CA ELQ A+ +FNP+LV+++  LN EI    F
Sbjct  225   GARRVLVTGTGPLGCVPAELAQRSRNGECAAELQEASALFNPQLVQLVNQLNSEIGSVVF  284

Query  402   LAVNTHQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFH  223
             ++ N  + +MDFI+NP+A+GF+TS+VACCGQGPYNG+GLCTP S+LC NRD +AFWD FH
Sbjct  285   ISANAFESNMDFISNPQAYGFITSKVACCGQGPYNGIGLCTPASNLCPNRDVFAFWDPFH  344

Query  222   PSEKANRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             PSE+ANR+IVD  M G + YMHPMNLSTVL +D+ +
Sbjct  345   PSERANRLIVDTFMIGDSKYMHPMNLSTVLLLDATS  380



>ref|XP_006375868.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 ref|XP_006375869.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53665.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53666.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=372

 Score =   510 bits (1313),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 288/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYGIDYPTH+ TGRFSNGLNIPD+ISE++GSE  +PYL+P
Sbjct  43    SLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSNGLNIPDLISEQIGSESPLPYLSP  102

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++++QL+YF +YQQR+ ALIG EKAK+L
Sbjct  103   ELRGQKLLVGANFASAGIGILNDTGIQFLNIIRMHRQLEYFQQYQQRVGALIGAEKAKRL  162

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN +L+L+T+GGNDFVNNYYL+P+S RSRQ+ LP+YV  +I+EYKK+L RLY+LGARRV+
Sbjct  163   VNQSLILLTVGGNDFVNNYYLVPYSARSRQYDLPDYVKHLISEYKKILMRLYNLGARRVL  222

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +I  +NR+I  + F+A NTH
Sbjct  223   VTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLESMIIDVNRKIGSDVFIAANTH  282

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF++NP+A+GF TS++ACCGQGPYNG+GLCT LS+LC NR+ YAFWD FHPSEKAN
Sbjct  283   QMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNLCPNRELYAFWDPFHPSEKAN  342

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             +IIV Q+M GS  YM PMNLST++A+DS 
Sbjct  343   KIIVQQIMTGSTRYMKPMNLSTIMALDSR  371



>ref|XP_004155142.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=440

 Score =   512 bits (1319),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 233/330 (71%), Positives = 284/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPD+ISE +GS  T+PYL+P
Sbjct  111   SLVDNGNNNYLLTTARADNYPYGIDYPTRRPTGRFSNGLNIPDLISEAMGSPSTLPYLSP  170

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I QQL+YF +YQ R++ALIG E+  +L
Sbjct  171   QLRGENLLVGANFASAGIGILNDTGIQFLNIIRIRQQLEYFRQYQARVSALIGEEETVRL  230

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+P S RSRQFTLP+YV ++I+EY+KVL  LY+ GARRV+
Sbjct  231   VNEALVLITLGGNDFVNNYYLVPVSARSRQFTLPDYVVYIISEYRKVLASLYEFGARRVL  290

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ AA +FNP+L +II  LN EI  + F+AVNT 
Sbjct  291   VTGTGPLGCVPAELAMRGRNGECSAELQRAAALFNPQLAQIINSLNEEIGSHVFIAVNTQ  350

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GF+TS+VACCGQGP+NG+GLCTP S+LC NR+ YAFWD FHPSE+AN
Sbjct  351   MMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNLCRNRNVYAFWDPFHPSERAN  410

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ G+  YMHPMNLST+LAMDS  
Sbjct  411   RIIVQQILTGTQEYMHPMNLSTILAMDSRT  440



>gb|ABK95911.1| unknown [Populus trichocarpa]
Length=368

 Score =   509 bits (1311),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 288/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYGIDYPTH+ TGRFSNGLNIPD+ISE++GSE  +PYL+P
Sbjct  39    SLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSNGLNIPDLISEQIGSESPLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++++QL+YF +YQQR+ ALIG EKAK+L
Sbjct  99    ELRGQKLLVGANFASAGIGILNDTGIQFLNIIRMHRQLEYFQQYQQRVGALIGAEKAKRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN +L+L+T+GGNDFVNNYYL+P+S RSRQ+ LP+YV  +I+EYKK+L RLY+LGARRV+
Sbjct  159   VNQSLILLTVGGNDFVNNYYLVPYSARSRQYDLPDYVKHLISEYKKLLMRLYNLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G C+ ELQ AA ++NP+L  +I  +NR+I  + F+A NTH
Sbjct  219   VTGTGPLGCVPAELATRSTNGGCSAELQRAAALYNPQLESMIIDVNRKIGSDVFIAANTH  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF++NP+A+GF TS++ACCGQGPYNG+GLCT LS+LC NR+ YAFWD FHPSEKAN
Sbjct  279   QMHADFVSNPQAYGFTTSKIACCGQGPYNGLGLCTLLSNLCPNRELYAFWDPFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             +IIV Q+M GS  YM PMNLST++A+DS 
Sbjct  339   KIIVQQIMTGSTRYMKPMNLSTIMALDSR  367



>gb|KHN35333.1| GDSL esterase/lipase, partial [Glycine soja]
Length=368

 Score =   509 bits (1311),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 284/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FL T+ARAD+PPYGIDYPTHRPTGRFSNGLNIPD+IS +LG EPT+PYL+P
Sbjct  39    SLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTGIQF+NII I +QL  F EYQ+RL+  IG E  + L
Sbjct  99    LLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHIGAEGTRNL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL+RLYDLGARRV+
Sbjct  159   VNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLYDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S  G C  ELQ AA +FNP+LV+++  LN+E+  + F+A N  
Sbjct  219   VTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQMLNGLNQELGADVFIAANAQ  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSEKA+
Sbjct  279   RMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPASNLCPNRDLYAFWDPFHPSEKAS  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ G+  YMHPMNLST++A+DS
Sbjct  339   RIIVQQILRGTTEYMHPMNLSTIMAIDS  366



>ref|XP_003521783.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   509 bits (1310),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 284/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FL T+ARAD+PPYGIDYPTHRPTGRFSNGLNIPD+IS +LG EPT+PYL+P
Sbjct  36    SLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTGIQF+NII I +QL  F EYQ+RL+  IG E  + L
Sbjct  96    LLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHIGAEGTRNL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL+RLYDLGARRV+
Sbjct  156   VNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLYDLGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S  G C  ELQ AA +FNP+LV+++  LN+E+  + F+A N  
Sbjct  216   VTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVQMLNGLNQELGADVFIAANAQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSEKA+
Sbjct  276   RMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTPTSNLCPNRDLYAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q++ G+  YMHPMNLST++A+DS
Sbjct  336   RIIVQQILRGTTEYMHPMNLSTIMAIDS  363



>ref|XP_004292262.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   508 bits (1309),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID+PTHRPTG FSNGLN+PD++SE++GSE  +PYL+ 
Sbjct  29    SLVDNGNNNYLATTARADSPPYGIDFPTHRPTGHFSNGLNLPDLVSEQMGSELLLPYLSS  88

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL GANFASAG+GILNDTG+QFVNII+I++Q + F +YQQR++ALIGG +AK+L
Sbjct  89    ELTGQKLLTGANFASAGIGILNDTGVQFVNIIRIFKQFELFQQYQQRVSALIGGAQAKRL  148

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VNDALVL+TLGGNDFVNNY+L+PFS RSRQ+++  Y  ++I+EY+K+L RLY+LG RRV+
Sbjct  149   VNDALVLVTLGGNDFVNNYFLVPFSARSRQYSISQYSQYLISEYRKILLRLYELGGRRVL  208

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPA +AQ S +G+CAPELQ AA +FNP LV++++ LN ++   AF+A N H
Sbjct  209   VTGTGPLGCVPAAMAQRSRNGECAPELQRAAAIFNPLLVQMVQGLNAQLGTEAFVAANAH  268

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
                MDF++NP+ +GFVTS+V CCGQGPYNG+GLCTPLS+LC+NRD YAFWD FHPSE+AN
Sbjct  269   A-SMDFLSNPRKYGFVTSRVVCCGQGPYNGVGLCTPLSNLCSNRDVYAFWDPFHPSERAN  327

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV  MM GS+ YM+PMNLST++AMDS 
Sbjct  328   RLIVQTMMTGSSKYMNPMNLSTIMAMDSR  356



>gb|ACR33100.1| putative tea geometrid larvae-inducible protein [Camellia sinensis]
Length=367

 Score =   508 bits (1309),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++LAT+ARAD+PPYGIDYPTHRPTGRFSNGLNIPDI+SE++GSEPT+PYL+P
Sbjct  38    SLVDSGNNDYLATTARADNPPYGIDYPTHRPTGRFSNGLNIPDILSEQIGSEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G +LLIGANFASAGVGILNDTG QF+NII+IY+QL+YF +YQ R++ LIG  + + L
Sbjct  98    ELTGDRLLIGANFASAGVGILNDTGFQFLNIIRIYKQLEYFQQYQTRVSRLIGPAETQTL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN  LVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGARRV+
Sbjct  158   VNQGLVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLVRLYELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQ S  G+C  ELQ AA +FNP+L++++  LN +I    F+A N  
Sbjct  218   VTGTGPLGCVPAELAQRSRTGECVVELQRAAGLFNPQLIQMVNGLNSQIGSTVFIAANAQ  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI++P+A+GFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHP E+AN
Sbjct  278   RMHMDFISDPQAYGFVTSKIACCGQGPYNGLGLCTPLSNLCPNRDIYAFWDPFHPFERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R +V Q++ GS  YM PMNLS +LA+DS
Sbjct  338   RFVVQQILTGSPNYMSPMNLSPILALDS  365



>ref|XP_002325361.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
 gb|EEE99742.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
Length=364

 Score =   508 bits (1309),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 288/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYP+HRPTGRFSNGLNIPD+IS+++GSE  +PYL+P
Sbjct  35    SLVDSGNNNYLATTARADSPPYGIDYPSHRPTGRFSNGLNIPDLISKRIGSESVLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQ+LL GANFASAG+GILNDTG+QF+NII++Y+QL+YF EYQ+R  AL+G ++ ++L
Sbjct  95    ELRGQRLLNGANFASAGIGILNDTGVQFINIIRMYRQLEYFQEYQRRARALVGVDQTERL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLIT+GGNDFVNNYYLIP+S RSRQF++PNYV ++I+EY+K+L +LY LGARRV+
Sbjct  155   VKGALVLITVGGNDFVNNYYLIPYSARSRQFSVPNYVKYLISEYEKILMKLYKLGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G C+ ELQ AA +FNP+LV+++K LN++I    F+A NT 
Sbjct  215   VTGTGPMGCVPAELAMRSTNGGCSAELQRAASLFNPQLVQMLKGLNKKIGNTVFIAANTQ  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q H+DFI+NP+A+GF T++ ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKAN
Sbjct  275   QSHLDFISNPQAYGFTTAKTACCGQGPYNGLGLCTAASNLCPNRDLYAFWDAFHPSEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV+Q+ +G+  YM PMNLST++ +D+ A
Sbjct  335   RLIVEQIYSGTTKYMDPMNLSTIMTLDARA  364



>ref|XP_004494761.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=373

 Score =   508 bits (1309),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD+IS+KLG+E  +PYL+P
Sbjct  44    SLVDSGNNNYLATTARADSPPYGIDYPTGRPTGRFSNGLNIPDLISQKLGTESVLPYLSP  103

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+KLL GANFASAG+GILNDTG+QF+NII++Y+QLDYF EYQ R+ +LIG  + KKL
Sbjct  104   QLRGEKLLNGANFASAGIGILNDTGVQFLNIIRMYRQLDYFEEYQHRVTSLIGAARTKKL  163

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQ++L +YV F+I EY+K+L+RLYDLGARRV+
Sbjct  164   VNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLIVEYRKLLQRLYDLGARRVI  223

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA     G C+ ELQ AA ++NP+L  +I+ LN +I  + F+A NT 
Sbjct  224   VTGTGPLGCVPAELAMRGSSGGCSAELQRAAELYNPQLQHMIQGLNNKIGKDVFIAANTA  283

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF+TNPKAFGF TS++ACCGQGPYNG+GLCTPLS+LC +R+ YAFWD FHPSEKA 
Sbjct  284   LMHSDFVTNPKAFGFATSRIACCGQGPYNGIGLCTPLSNLCQDRNLYAFWDPFHPSEKAG  343

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             ++IV+Q+M+GS  YMHPMNLSTVLA+D+
Sbjct  344   KLIVEQIMSGSKRYMHPMNLSTVLALDA  371



>ref|XP_010485798.1| PREDICTED: GDSL esterase/lipase LTL1-like [Camelina sativa]
Length=392

 Score =   509 bits (1311),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  62    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  121

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I++Q +YF +YQQR++ALIG E  ++L
Sbjct  122   QLTGENLLVGANFASAGIGILNDTGIQFINIIRIFKQFEYFEQYQQRVSALIGPEATQQL  181

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L+RLY+LGARRV+
Sbjct  182   VNQALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYAKILRRLYELGARRVL  241

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N++
Sbjct  242   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANSY  301

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  302   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNLCPNRDIYAFWDAFHPTEKAN  361

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS  YMHPMNLST + +DS
Sbjct  362   RIIVNQILTGSAKYMHPMNLSTAMLLDS  389



>ref|XP_008441804.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis melo]
Length=368

 Score =   508 bits (1308),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 284/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFL T+ARAD+ PYGIDYPT RPTGRFSNGLNIPD+ISE +GS  T+PYL+P
Sbjct  39    SLVDNGNNNFLLTTARADNYPYGIDYPTRRPTGRFSNGLNIPDLISEAMGSPSTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I QQL+YF +YQ R++ALIG  +  +L
Sbjct  99    QLRGENLLVGANFASAGIGILNDTGIQFLNIIRIRQQLEYFRQYQARVSALIGEAETVRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+P S RSRQF+LP+YV ++I+EY+K+L  LY+ GARRV+
Sbjct  159   VNEALVLITLGGNDFVNNYYLVPVSARSRQFSLPDYVVYIISEYRKILASLYEFGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C+ ELQ AA +FNP+LV+II  LN EI  + F+AVNT 
Sbjct  219   VTGTGPLGCVPAELAMRGRNGECSVELQRAAALFNPQLVQIINSLNDEIGSHVFIAVNTQ  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+A+GF+TS+VACCGQGP+NG+GLCTP S+LC NR+ YAFWD FHPSE+AN
Sbjct  279   MMHMDFVSNPQAYGFITSKVACCGQGPFNGIGLCTPASNLCPNRNVYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ G+  YMHPMNLST+LAMDS  
Sbjct  339   RIIVQQILTGTQEYMHPMNLSTILAMDSRT  368



>ref|XP_010413520.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   508 bits (1308),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I++Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFINIIRIFKQFEYFEQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L+RLY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYAKILRRLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N++
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANSY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS  YMHPMNLST + +DS
Sbjct  336   RIIVNQILTGSAKYMHPMNLSTAMLLDS  363



>ref|XP_003554732.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   508 bits (1307),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 283/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+PPYGIDYPTHRPTGRFSNGLNIPD+IS +LG EPT+PYL+P
Sbjct  36    SLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTGIQF+NII I +QL  F EYQ+RL+  IG E A+ L
Sbjct  96    LLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHIGAEGARNL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL+RLYDLG RRV+
Sbjct  156   VNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLYDLGTRRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S  G C  ELQ AA +FNP+LV ++  LN+E+  + F+A N  
Sbjct  216   VTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVEMLNGLNQELGADVFIAANAQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKA+
Sbjct  276   RMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNLCPNRDLYAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ G+  YMHPMNLST++A+DS 
Sbjct  336   RIIVQQILRGTTEYMHPMNLSTIMAIDSR  364



>ref|XP_010463906.1| PREDICTED: GDSL esterase/lipase LTL1 [Camelina sativa]
Length=366

 Score =   508 bits (1307),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQF+NII+I++Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFINIIRIFKQFEYFEQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L+RLY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYAKILRRLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N++
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANSY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNLCPNRDIYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS  YMHPMNLST + +DS
Sbjct  336   RIIVNQILTGSAKYMHPMNLSTAMLLDS  363



>emb|CDX92063.1| BnaC03g33650D [Brassica napus]
Length=366

 Score =   507 bits (1305),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 287/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I++Q ++F +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRIFKQFEFFEQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF+LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFSLPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_007151673.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
 gb|ESW23667.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
Length=370

 Score =   507 bits (1305),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 292/329 (89%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDY-PTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDY PTHRPTGRFSNG NIPD+IS+K+G+E T+PYL+
Sbjct  39    SLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSNGYNIPDLISQKIGAESTLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  + K 
Sbjct  99    PELRGNKLLVGANFASAGIGILNDTGLQFVNVIRMYRQLEYFKEYQNRVSAIIGSSQTKS  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV+++I+EY+K+L++LYDLGARRV
Sbjct  159   LVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVNYLISEYQKLLQKLYDLGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CA ELQ AA +FNP+L +++  LNR++  + F+A NT
Sbjct  219   LVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQMLLQLNRKLGKDVFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGFVT++VACCGQGPYNG+GLCTPLS+LC NR +YAFWDAFHPSEKA
Sbjct  279   GKTHNDFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNLCPNRGQYAFWDAFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+++M+GS  YM+PMNLST+LA+D+
Sbjct  339   NRLIVEEIMSGSKAYMNPMNLSTILALDA  367



>ref|XP_008350788.1| PREDICTED: GDSL esterase/lipase At5g33370-like, partial [Malus 
domestica]
Length=319

 Score =   505 bits (1300),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 231/317 (73%), Positives = 281/317 (89%), Gaps = 0/317 (0%)
 Frame = -3

Query  1071  ATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNPQLDGQKLLIGA  892
             AT+ARAD+ PYGIDYPTHRPTGRFSNGLNIPD+ISE++GSEPT+PYL+P L GQKLL+GA
Sbjct  1     ATTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEQIGSEPTLPYLSPHLTGQKLLVGA  60

Query  891   NFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKLVNDALVLITLG  712
             NFASAG+GILNDTGIQF+NII+IY+QL YF +YQ R+ AL+G E+A++LVN+ALVLITLG
Sbjct  61    NFASAGIGILNDTGIQFLNIIRIYKQLKYFQQYQTRVNALVGPEQAQRLVNEALVLITLG  120

Query  711   GNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVMVTGTGPLGCVP  532
             GNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL RLY+LGAR+V+VTGTGPLGC P
Sbjct  121   GNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRKVLARLYELGARKVLVTGTGPLGCAP  180

Query  531   AELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTHQIHMDFITNPK  352
             AELAQ S  G+CA ELQ AA +FNP+LV +I  LN +I  + F+A N  Q+HMDFI+NP+
Sbjct  181   AELAQRSRRGECAVELQRAASLFNPQLVDMINSLNGQIGSDVFVAANAFQMHMDFISNPQ  240

Query  351   AFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKANRIIVDQMMNGS  172
             A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKA+RII  Q++ GS
Sbjct  241   AYGFVTSKIACCGQGPYNGIGLCTIASNLCPNRDLYAFWDAFHPSEKASRIIAQQILTGS  300

Query  171   NTYMHPMNLSTVLAMDS  121
             N YM+PMNLST+LA+DS
Sbjct  301   NKYMNPMNLSTILALDS  317



>gb|KHN43145.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score =   506 bits (1304),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 282/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+PPYGIDYPTHRPTGRFSNGLNIPD+IS  LG EPT+PYL+P
Sbjct  36    SLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLGLGLEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTGIQF+NII I +QL  F EYQ+RL+  IG E A+ L
Sbjct  96    LLVGEKLLIGANFASAGIGILNDTGIQFLNIIHIQKQLKLFHEYQERLSLHIGAEGARNL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL+RLYDLG RRV+
Sbjct  156   VNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLYDLGTRRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S  G C  ELQ AA +FNP+LV ++  LN+E+  + F+A N  
Sbjct  216   VTGTGPMGCVPAELATRSRTGDCDVELQRAASLFNPQLVEMLNGLNQELGADVFIAANAQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKA+
Sbjct  276   RMHMDFVSNPRAYGFVTSKIACCGQGPYNGVGLCTAASNLCPNRDLYAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ G+  YMHPMNLST++A+DS 
Sbjct  336   RIIVQQILRGTTEYMHPMNLSTIMAIDSR  364



>ref|XP_009108075.1| PREDICTED: GDSL esterase/lipase At5g33370 [Brassica rapa]
Length=366

 Score =   507 bits (1305),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FL T+ARAD+ PYGID+PTH PTGRFSNGLNIPD+ISE LG    +PYL+P
Sbjct  37    SLVDNGNNDFLVTTARADNYPYGIDFPTHLPTGRFSNGLNIPDLISEHLGQASPLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLLIGANFASAG+GILNDTGIQF+NII+I +QL+Y  +Y+ R++ L+G E+ ++L
Sbjct  97    MLKKDKLLIGANFASAGIGILNDTGIQFLNIIRITKQLEYLEQYKVRVSGLVGEEEMERL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV +V++EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYVVSEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRTGECSTELQRAASLFNPQLVQMINDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++NGS  YMHPMNLST+L +DS
Sbjct  337   RIIAQQILNGSPEYMHPMNLSTILTLDS  364



>ref|XP_007151675.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
 gb|ESW23669.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
Length=370

 Score =   507 bits (1305),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 292/329 (89%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDY-PTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDY PTHRPTGRFSNG NIPD+IS+K+G+E T+PYL+
Sbjct  39    SLVDSGNNNYLATTARADAPPYGIDYAPTHRPTGRFSNGYNIPDLISQKIGAESTLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL+YF EYQ R++ALIG  +AK 
Sbjct  99    PELTGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLEYFQEYQNRVSALIGASQAKS  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN++LVLIT GGNDFVNNY+L+P S RSRQ+ LP YV ++I+EY+K+L+RLYDLG RR+
Sbjct  159   LVNESLVLITAGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQKLLQRLYDLGPRRI  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR++  + F+A NT
Sbjct  219   LVTGTGPLGCVPSELAQRGRNGQCAPELQRAAELFNPQLEQMLLQLNRKLGKDVFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H +F++NP+ FGFVT++VACCGQGPYNG+GLCTPLS+LC+NR EYAFWDAFHPSEKA
Sbjct  279   GKMHNNFVSNPQQFGFVTAKVACCGQGPYNGLGLCTPLSNLCSNRGEYAFWDAFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+I +++M+GS  YM+PMNLST+L +D+
Sbjct  339   NRLIAEEIMSGSKAYMNPMNLSTILDLDA  367



>emb|CAN67727.1| hypothetical protein VITISV_038832 [Vitis vinifera]
 emb|CBI28653.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   506 bits (1304),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++L T+ARADSPPYGIDYPT RPTGRFSNGLNIPDI+SE++GSEPT+PYL+P
Sbjct  38    SLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFSNGLNIPDILSEQIGSEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF+NII+I++QL+YF +YQQR++ LIG E+ ++L
Sbjct  98    ELTGERLLVGANFASAGIGILNDTGIQFLNIIRIWKQLEYFRQYQQRVSGLIGVEQTQRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL RL++LGARRV+
Sbjct  158   VNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLIRLFELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VT TGPLGCVPAELA  S  G+CA ELQ AA +FNP+L +++  LN EI    F+A N  
Sbjct  218   VTATGPLGCVPAELALRSRTGECAIELQRAAGLFNPQLFQMLDGLNNEIGSQVFIAANAF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI+NP+A+GFVTS+VACCGQGPYNG+GLCT  S LC NR+ YAFWDAFHPSE+AN
Sbjct  278   GMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTVASSLCPNRNLYAFWDAFHPSERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV +++ GS  YM+PMNLST++ +DS 
Sbjct  338   RIIVQRILTGSTEYMYPMNLSTIMDLDSR  366



>gb|ACU23289.1| unknown [Glycine max]
Length=370

 Score =   506 bits (1304),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 290/329 (88%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++LG+E T+PYL+
Sbjct  39    SLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLGAEATLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQF+N+I++Y+QL YF EYQ R+ A+IG  + K 
Sbjct  99    PELRGNKLLVGANFASAGIGILNDTGIQFINVIRMYRQLQYFKEYQNRVRAIIGASQTKS  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV ++I+EY+K+L++LYDLGARRV
Sbjct  159   LVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVKYLISEYQKLLQKLYDLGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CA ELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  219   LVTGTGPLGCVPSELAQRGRNGQCATELQQAAELFNPQLEQMLLQLNRKIGKDTFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H +F+TNP+ FGF+TSQ+ACCGQGPYNG+GLCTPLS+LC NRD+YAFWDAFHPSEKA
Sbjct  279   GKMHNNFVTNPQQFGFITSQIACCGQGPYNGLGLCTPLSNLCPNRDQYAFWDAFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+++M+G   YM+PMNLST+LA+D+
Sbjct  339   NRLIVEEIMSGFKIYMNPMNLSTILALDA  367



>ref|XP_004489545.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=366

 Score =   506 bits (1303),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 290/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARAD+PPYGIDYPTH PTGRFSNG NIPD+IS++LG+E T+PYL+P
Sbjct  37    SLVDSGNNNYLATTARADAPPYGIDYPTHAPTGRFSNGYNIPDLISQQLGAESTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTG+QF+N+I++Y+QL+YF EYQ RL+A+IG  +AK  
Sbjct  97    ELRGERLLVGANFASAGIGILNDTGVQFINVIRMYRQLEYFEEYQNRLSAIIGAAQAKSR  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLIT+GGNDFVNNYYL+P+S RSRQ+ LP YV ++I+EY+K+L++LYDLGARRV+
Sbjct  157   VNEALVLITVGGNDFVNNYYLVPYSARSRQYQLPQYVKYLISEYQKLLQKLYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+ELAQ   +G+C+ ELQ AA +FNP+L  ++  LN++I  + F+A NT 
Sbjct  217   VTGTGPLGCVPSELAQRGRNGQCSTELQKAASLFNPQLESMLLALNKKIGRDVFIAANTA  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H +F++NP  FGF TS+VACCGQGPYNG+GLCT +S+LC+NR+ YAFWDAFHPSEKAN
Sbjct  277   KMHNNFVSNPSQFGFKTSKVACCGQGPYNGLGLCTAVSNLCSNRELYAFWDAFHPSEKAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV ++M+GS  YM+PMNLST+LA+D+
Sbjct  337   RLIVQEIMSGSKAYMNPMNLSTILALDA  364



>ref|XP_002268296.2| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
Length=384

 Score =   506 bits (1304),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN++L T+ARADSPPYGIDYPT RPTGRFSNGLNIPDI+SE++GSEPT+PYL+P
Sbjct  55    SLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFSNGLNIPDILSEQIGSEPTLPYLSP  114

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF+NII+I++QL+YF +YQQR++ LIG E+ ++L
Sbjct  115   ELTGERLLVGANFASAGIGILNDTGIQFLNIIRIWKQLEYFRQYQQRVSGLIGVEQTQRL  174

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL RL++LGARRV+
Sbjct  175   VNQALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLIRLFELGARRVL  234

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VT TGPLGCVPAELA  S  G+CA ELQ AA +FNP+L +++  LN EI    F+A N  
Sbjct  235   VTATGPLGCVPAELALRSRTGECAIELQRAAGLFNPQLFQMLDGLNNEIGSQVFIAANAF  294

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI+NP+A+GFVTS+VACCGQGPYNG+GLCT  S LC NR+ YAFWDAFHPSE+AN
Sbjct  295   GMHMDFISNPQAYGFVTSKVACCGQGPYNGLGLCTVASSLCPNRNLYAFWDAFHPSERAN  354

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV +++ GS  YM+PMNLST++ +DS 
Sbjct  355   RIIVQRILTGSTEYMYPMNLSTIMDLDSR  383



>ref|XP_010263996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score =   506 bits (1303),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 290/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGIDYPTHRPTGRFSNGLNIPDIISE +G E T+PYL+P
Sbjct  37    SLVDNGNNNYLATTARADSYPYGIDYPTHRPTGRFSNGLNIPDIISEAMGEESTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVG+LNDTGIQFV+II+I QQL YF +YQ+R++ +IG E+ ++L
Sbjct  97    ELRGKKLLVGANFASAGVGVLNDTGIQFVSIIRINQQLQYFQQYQRRVSKMIGEEQTQQL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQ++LP+YV FVI+EYKKVL RLY+LGARRV+
Sbjct  157   VNQALVLITLGGNDFVNNYYLVPFSARSRQYSLPDYVRFVISEYKKVLARLYELGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S++G+C  ELQ AA +FNP+L  IIK LN EI  + F+A NT+
Sbjct  217   VTGTGPMGCVPAELAMRSVNGECVVELQRAADLFNPQLTEIIKQLNSEIGSDNFIAANTN  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP+AFGFVTS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSE+AN
Sbjct  277   RMHMDFISNPQAFGFVTSKIACCGQGPYNGIGLCTAASNLCPNRDVYAFWDPFHPSERAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q++ GS  YMHPMNLSTV+A+D+ 
Sbjct  337   RIIVQQILAGSTDYMHPMNLSTVMALDAK  365



>ref|XP_010558733.1| PREDICTED: GDSL esterase/lipase LTL1 [Tarenaya hassleriana]
Length=366

 Score =   506 bits (1302),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 286/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+ PYGID P HR TGRFSNGLNIPDIISE+LG   T+PYL+P
Sbjct  35    SLVDNGNNNYLATTARADNYPYGIDLPNHRATGRFSNGLNIPDIISEQLGMPSTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G++LL+GANFASAG+GILNDTG+QFVNII+I +QL+YF +YQ+R++A+IG  + +KL
Sbjct  95    GLTGERLLVGANFASAGIGILNDTGVQFVNIIRIGKQLEYFEQYQRRVSAMIGPAQTQKL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVL+TLGGNDFVNNYYL+P+S RSRQ+ LP+YV ++++EY+K+L R+Y+LGARRV+
Sbjct  155   VNEALVLMTLGGNDFVNNYYLVPYSARSRQYALPDYVVYIVSEYRKILTRVYELGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA HS +G+C  EL  AA +FNP+LV +I  LN EI  + F+A N +
Sbjct  215   VTGTGPMGCVPAELALHSRNGECGVELMRAAALFNPQLVDMINQLNSEIGSDVFIAANAN  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H+DF+TNP+ FGFVTS+VACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSEKAN
Sbjct  275   EMHLDFVTNPQQFGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLYAFWDPFHPSEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV QM+ GS+ YMHPMNLST L +DS +
Sbjct  335   RIIVQQMLTGSSKYMHPMNLSTALLLDSSS  364



>gb|AES82718.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   506 bits (1303),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 226/327 (69%), Positives = 288/327 (88%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLNIPD+IS+KLG E  +PYL+P
Sbjct  41    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNIPDLISQKLGIESVLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL GANFASAG+GILNDTG+QF+NII++Y+QLDYF EYQ R+A++IG  +A+KL
Sbjct  101   RLRGEKLLAGANFASAGIGILNDTGVQFLNIIRMYRQLDYFEEYQHRVASMIGAARAEKL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSR+++L +YV F+I EY+K+L+RLYD+GARRV+
Sbjct  161   VNKALVLITVGGNDFVNNYYLVPYSARSREYSLQDYVKFLIIEYRKLLERLYDIGARRVL  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE+A    DG C+ ELQ AA ++NP+L  +++ LN++I  + F+A NT 
Sbjct  221   VTGTGPLGCVPAEMAMRGTDGGCSAELQRAATLYNPQLQHMVQGLNKKIGKDVFIATNTA  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              IH DF+TNPKA+GF+TS++ACCGQG YNG+GLCTPLS+LC +RD YAFWDAFHPSEKAN
Sbjct  281   LIHSDFVTNPKAYGFITSRIACCGQGAYNGIGLCTPLSNLCPDRDLYAFWDAFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             +IIV+++++GS  YM+PMNLST+LA+D
Sbjct  341   KIIVERILSGSKRYMNPMNLSTILALD  367



>ref|XP_003543915.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 290/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++L +E T+PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLSAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL YF EYQ R+  LIG  + K 
Sbjct  100   PELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLQYFKEYQNRVRDLIGASQTKS  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+LKRLYDLGARRV
Sbjct  160   LVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLKRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNGQCAPELQQAAALFNPQLEQMLLRLNRKIGKDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR++YAFWDAFHPSEKA
Sbjct  280   GKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_004302115.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 286/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT ARAD+PPYGIDYPT R TGRFSNG NIPD IS+ LG+E T+PYL+P
Sbjct  36    SLVDNGNNNYLATQARADAPPYGIDYPTGRATGRFSNGYNIPDFISQALGAEATLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+KLL+GANFASAG+GILNDTG+QF+NII++++Q +YF +YQQRL+ALIG E+A++L
Sbjct  96    ELNGEKLLVGANFASAGIGILNDTGVQFINIIRMFRQYEYFEQYQQRLSALIGPEQAQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VNDAL+L+T+GGNDFVNNYYL+PFS RSRQ+ LP YV+++I+E++K+L RLYDLG RRV+
Sbjct  156   VNDALILLTVGGNDFVNNYYLVPFSARSRQYPLPEYVEYLISEFRKLLLRLYDLGGRRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CAPELQ AA +FNP+L ++I+ +N E+  + F+A NT 
Sbjct  216   VTGTGPLGCVPAELAMRSTNGQCAPELQRAASLFNPQLTQMIREVNSELGADIFIAANTQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
               H DF++NP+A+GF TS++ACCGQGPYNG+GLCT LS++C +RD YAFWDAFHPSE+AN
Sbjct  276   LSHYDFVSNPQAYGFTTSKIACCGQGPYNGLGLCTALSNVCPDRDLYAFWDAFHPSERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R +V  ++NG   YM PMNLST+LA+DS 
Sbjct  336   RYVVQAILNGGTEYMSPMNLSTILALDSR  364



>ref|XP_007151676.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
 gb|ESW23670.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
Length=370

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 292/329 (89%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDY-PTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDY PTHRPTGRFSNG NIPD+IS+K+G+E T+PYL+
Sbjct  39    SLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSNGYNIPDLISQKIGAESTLPYLS  98

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTG+QFVN+I++Y+QL+YF EYQ R++A+IG  + K 
Sbjct  99    PELRGNKLLVGANFASAGIGILNDTGLQFVNVIRMYRQLEYFKEYQNRVSAIIGSSQTKS  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RSRQ+ LP YV+++I+EY+K+L++LYDLGARRV
Sbjct  159   LVNQALVLITVGGNDFVNNYFLVPNSARSRQYPLPQYVNYLISEYQKLLQKLYDLGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   +G+CA ELQ AA +FNP+L +++  LNR++  + F+A NT
Sbjct  219   LVTGTGPLGCVPSELAQRGTNGQCAAELQRAAALFNPQLEQMLLQLNRKLGKDVFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGF+T++VACCGQGPYNG+GLCTPLS+LC NR +YAFWDAFHPSEKA
Sbjct  279   GKTHNDFVSNPQQFGFITAKVACCGQGPYNGLGLCTPLSNLCPNRGQYAFWDAFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NR+IV+++M+GS  YM+PMNLST+LA+D+
Sbjct  339   NRLIVEEIMSGSKAYMNPMNLSTILALDA  367



>ref|XP_008443761.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Cucumis 
melo]
Length=366

 Score =   505 bits (1301),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 288/330 (87%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGID+PTHRPTGRFSNGLNIPD IS++LGSE  +PYLNP
Sbjct  36    SLVDNGNNNYLATTARADSYPYGIDFPTHRPTGRFSNGLNIPDYISQQLGSEFLLPYLNP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++LL GANFASAG+GILNDTGIQF+NII++++Q +YF EYQ+R+  +IG E+AK+L
Sbjct  96    ELNGRRLLDGANFASAGIGILNDTGIQFINIIRMFRQFEYFEEYQRRVGRVIGDERAKEL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLIT+GGNDFVNNYYL+PFS RSRQ++LP+YV+ +I EY+K+L RLY+LGARRV+
Sbjct  156   VKGALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVNLLIVEYRKILLRLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S  G+C+ ELQ AA ++NP+L ++IK LN ++  N F+AVNT
Sbjct  216   VTGTGPLGCVPAELAMRGSTGGQCSAELQRAAALYNPKLFQMIKGLNSQLGSNVFVAVNT  275

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H+DFI+NP+A+GF TS+VACCGQGPYNG+GLCT  S+LC+NRD YAFWDAFHPS+KA
Sbjct  276   QQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASNLCSNRDAYAFWDAFHPSQKA  335

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             N IIV QM +G+  YM+PMNL+T+L +DS 
Sbjct  336   NGIIVKQMFSGTTQYMYPMNLTTILQLDSK  365



>ref|XP_003626492.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82710.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=369

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGIDYPTHR TGRFSNGLN+PD+ISE++GS+PT+PYL+P
Sbjct  40    SLVDNGNNNYLATTARADSYPYGIDYPTHRATGRFSNGLNMPDLISERIGSQPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+ LL+GANFASAG+GILNDTGIQF NII+I +QL YF +YQQR++ALIG E+  +L
Sbjct  100   ELNGEALLVGANFASAGIGILNDTGIQFFNIIRITRQLQYFEQYQQRVSALIGEEETVRL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL L+TLGGNDFVNNY+L+PFS RSRQF LP+YV ++I+EY+K+L RLY+LGARRV+
Sbjct  160   VNEALYLMTLGGNDFVNNYFLVPFSARSRQFRLPDYVVYLISEYRKILARLYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELAQHS +G+C  ELQ AA +FNP+LV ++  LN EI  + F++ N  
Sbjct  220   VTGTGPLGCVPAELAQHSRNGECYAELQEAANLFNPQLVDLLGQLNSEIGSDVFISANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              ++MDFI NP+A+GF TS+VACCGQGPYNG+GLCTP S++C NRD Y FWDAFHPS++AN
Sbjct  280   AMNMDFIGNPEAYGFATSKVACCGQGPYNGIGLCTPASNICPNRDAYVFWDAFHPSDRAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV++ M GS+ YMHPMNLST++ +DS 
Sbjct  340   RLIVERFMIGSSEYMHPMNLSTIMLLDSR  368



>emb|CDY12384.1| BnaC08g08210D [Brassica napus]
Length=365

 Score =   505 bits (1301),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FL T+ARAD+ PYGID+PTH PTGRFSNGLNIPD+ISE LG    +PYL+P
Sbjct  36    SLVDNGNNDFLVTTARADNYPYGIDFPTHLPTGRFSNGLNIPDLISEHLGQASPLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLLIGANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ R++ L+G E+ ++L
Sbjct  96    MLKKDKLLIGANFASAGIGILNDTGIQFLNIIRITKQLEYFEQYKVRVSGLVGEEEMERL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LITLGGNDFVNNYYL+PFS RSRQF+LP+YV +V++EY+KVL+++YDLGARRV+
Sbjct  156   VNGALGLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYVVSEYRKVLRKMYDLGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  216   VTGTGPMGCVPAELAQRSRSGECSTELQRAASLFNPQLVQMINDLNNEVGSSAFIAANTQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  276   QMHMDFISDPEAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++NGS  YMHPMNLST+L +DS
Sbjct  336   RIIAQQILNGSPEYMHPMNLSTILTLDS  363



>ref|XP_007147234.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
 gb|ESW19228.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
Length=389

 Score =   506 bits (1303),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 284/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+PPYGID+P+HRPTGRFSNGLNIPD+IS +LG EPT+PYL+P
Sbjct  60    SLVDSGNNDFLATTARADAPPYGIDFPSHRPTGRFSNGLNIPDLISLELGLEPTLPYLSP  119

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLL+GANFASAG+GILNDTGIQF+NII IY+QL  F EYQ RL+A IG E  + L
Sbjct  120   LLVGEKLLVGANFASAGIGILNDTGIQFLNIIHIYKQLKLFHEYQLRLSAHIGAEGTRNL  179

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQF+LP+YV ++I+EY+KVL+RLYDLG RRV+
Sbjct  180   VNRALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVRYLISEYRKVLRRLYDLGTRRVL  239

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S  G C  ELQ AA +FNP+LV+++  LN+E+    F+A N +
Sbjct  240   VTGTGPMGCVPAELAMRSRTGDCDVELQRAAALFNPQLVQMLNGLNQELGSEVFIAANAY  299

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDF++NP+A+GFVTS++ACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSE+A+
Sbjct  300   RMHMDFVSNPRAYGFVTSKIACCGQGPYNGIGLCTPASNLCPNRDLYAFWDPFHPSERAS  359

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q++ G+  YMHPMNL+T++ +DS  
Sbjct  360   RIIVQQILRGTTEYMHPMNLTTIMELDSRT  389



>emb|CDY47551.1| BnaA08g07360D [Brassica napus]
Length=366

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 229/328 (70%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FL T+ARAD+ PYGID+PTH PTGRFSNGLNIPD+ISE LG    +PYL+P
Sbjct  37    SLVDNGNNDFLVTTARADNYPYGIDFPTHLPTGRFSNGLNIPDLISEHLGQASPLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLLIGANFASAG+GILNDTGIQF+NII+I +QL+Y  +Y+ R++ L+G E+ ++L
Sbjct  97    MLKKDKLLIGANFASAGIGILNDTGIQFLNIIRITKQLEYLEQYKVRVSGLVGEEEMERL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV +V++EY+KVL+++YDLGARRV+
Sbjct  157   VNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYVVSEYRKVLRKMYDLGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA +FNP+LV++I  LN E+  +AF+A NT 
Sbjct  217   VTGTGPMGCVPAELAQRSRTGECSTELQRAASLFNPQLVQMINDLNNEVGSSAFIAANTQ  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCTPLS+LC NRD +AFWD FHPSEKA+
Sbjct  277   QMHMDFISDPQAYGFVTSKVACCGQGPYNGIGLCTPLSNLCPNRDLFAFWDPFHPSEKAS  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q+++GS  YMHPMNLST+L +DS
Sbjct  337   RIIAQQILDGSPEYMHPMNLSTILTLDS  364



>ref|XP_009134760.1| PREDICTED: GDSL esterase/lipase LTL1 [Brassica rapa]
Length=366

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 284/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE LG   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEALGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +Y+QR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFEQYRQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNRALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI    F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQEVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|XP_006437267.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
 gb|ESR50507.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
Length=368

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 284/328 (87%), Gaps = 1/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD GNNN+LAT ARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE++G  E  +PYL+
Sbjct  37    SLVDVGNNNYLATIARADAPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGQPESPLPYLS  96

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G++LL GANFASAG+GILNDTGIQF+NII++++QL  F EYQ R++ALIG +  K+
Sbjct  97    PELTGERLLNGANFASAGIGILNDTGIQFLNIIRLFRQLHCFEEYQHRVSALIGVQNTKQ  156

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNYYL+PFS RSRQ+ LP YV ++I+EYKK LKRLY+LGARRV
Sbjct  157   LVNKALVLITVGGNDFVNNYYLVPFSARSRQYPLPEYVKYLISEYKKQLKRLYELGARRV  216

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA    DG C+ ELQ AA ++NP+LV++++ LNREI    F+  NT
Sbjct  217   LVTGTGPLGCVPAELAMRGTDGGCSAELQRAAALYNPQLVQMLQELNREIGETIFIGANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+HMDF+++P+A+GFVTS++ACCGQGPYNG+GLCT LS+LC NRD YAFWD FHPSEKA
Sbjct  277   QQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNLCPNRDLYAFWDPFHPSEKA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             NRIIV Q+M+GS  YM+PMNLSTVLA+D
Sbjct  337   NRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>ref|XP_006484791.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   504 bits (1299),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 284/328 (87%), Gaps = 1/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD GNNN+LAT ARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE++G  E  +PYL+
Sbjct  37    SLVDVGNNNYLATIARADAPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGQPESPLPYLS  96

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G++LL GANFASAG+GILNDTGIQF+NII++++QL  F EYQ R++ALIG +  K+
Sbjct  97    PELTGERLLNGANFASAGIGILNDTGIQFLNIIRLFRQLHCFEEYQHRVSALIGLQNTKQ  156

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNYYL+PFS RSRQ+ LP YV ++I+EYKK LKRLY+LGARRV
Sbjct  157   LVNKALVLITVGGNDFVNNYYLVPFSARSRQYPLPEYVKYLISEYKKQLKRLYELGARRV  216

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA    DG C+ ELQ AA ++NP+LV++++ LNREI    F+  NT
Sbjct  217   LVTGTGPLGCVPAELAMRGTDGGCSAELQRAAALYNPQLVQMLQELNREIGETIFIGANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+HMDF+++P+A+GFVTS++ACCGQGPYNG+GLCT LS+LC NRD YAFWD FHPSEKA
Sbjct  277   QQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNLCPNRDLYAFWDPFHPSEKA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             NRIIV Q+M+GS  YM+PMNLSTVLA+D
Sbjct  337   NRIIVQQIMSGSTKYMNPMNLSTVLALD  364



>ref|XP_004494758.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=369

 Score =   504 bits (1298),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 283/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFL T+ARADS PYGIDYPTHR TGRFSNGLNIPD+ISE++GSEPT+PYLNP
Sbjct  40    SLVDNGNNNFLVTTARADSYPYGIDYPTHRATGRFSNGLNIPDLISEQIGSEPTLPYLNP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LL GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+  KL
Sbjct  100   ELDGERLLNGANFASAGIGILNDTGIQFINIIRISRQLQYFEQYQQRVSALIGEEETVKL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LI LGGNDFVNNY+L+PFS RSRQF LP+YV ++I+EY+K+L RLY+LGARRVM
Sbjct  160   VNGALFLIALGGNDFVNNYFLVPFSARSRQFALPDYVVYLISEYRKILARLYELGARRVM  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELAQHS +G+C  ELQ A+ +F+P+LV+++  LN EI  + F++ N  
Sbjct  220   VTGTGPLGCAPAELAQHSRNGECFAELQQASDLFDPQLVQLLTQLNSEIGSDVFISANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
               +MDFI NP+AFGF TS+VACCGQGPYNG+GLCTPLS++C NRD Y FWD +HPSE+AN
Sbjct  280   SRNMDFIGNPQAFGFATSKVACCGQGPYNGIGLCTPLSNVCPNRDIYVFWDPYHPSERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV++ M GS  YM+PMNLST++ +DS  
Sbjct  340   RLIVEKFMIGSTKYMYPMNLSTIMLLDSRT  369



>ref|XP_003554733.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score =   504 bits (1299),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 282/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD+ISE++G E  +PYL+P
Sbjct  41    SLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDLISERMGGESVLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL  + LL GANFASAG+GILNDTG QF+NII++Y+QLDYF EYQQR++ LIG  +AKKL
Sbjct  101   QLKSENLLNGANFASAGIGILNDTGSQFLNIIRMYRQLDYFEEYQQRVSILIGVARAKKL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQ++L +YV F+I EY+K+L RLYDLGARRV+
Sbjct  161   VNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLIVEYRKLLMRLYDLGARRVI  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+L  +I+ LN++I    F+A NT 
Sbjct  221   VTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTHMIQGLNKKIGKEVFIAANTA  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF++NP A+GF TSQ+ACCGQGPYNG+GLCTPLS+LC NR+ +AFWD FHPSEKAN
Sbjct  281   LMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSNLCPNRNSHAFWDPFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+Q+M+GS  YM PMNLSTVLA+D+ 
Sbjct  341   RLIVEQIMSGSKRYMKPMNLSTVLALDAR  369



>ref|XP_007133949.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
 gb|ESW05943.1| hypothetical protein PHAVU_010G005800g [Phaseolus vulgaris]
Length=369

 Score =   504 bits (1298),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD  PYGID  +HR +GRFSNGLN+PD+ISEK+GSEPT+PYL+P
Sbjct  40    SLVDNGNNNYLATTARADGYPYGIDSASHRASGRFSNGLNMPDLISEKIGSEPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+KLL+GANFASAGVGILNDTG QF+NII+I +QL YF +YQQR++ALIG E+++ L
Sbjct  100   ELNGEKLLVGANFASAGVGILNDTGFQFINIIRIREQLAYFRQYQQRVSALIGEEQSRDL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ ALVLITLGGNDFVNNY+L+PFS RSR++ LP+YV  +I+EY+K+L  LY+LGARRV+
Sbjct  160   VDKALVLITLGGNDFVNNYFLVPFSARSREYALPDYVVLLISEYRKILVDLYELGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA ELQ A  MFNP+LV++++ LN +I  + F++ N  
Sbjct  220   VTGTGPLGCVPAELAMHSRNGECATELQRAVNMFNPQLVQLLQELNAQIGSHVFISANAF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H+DF+T+P+A+GFVTS+VACCGQG YNG+GLCTP S+LC NR+ YAFWDAFHPSE AN
Sbjct  280   AMHLDFVTDPQAYGFVTSKVACCGQGAYNGIGLCTPASNLCPNRNLYAFWDAFHPSETAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IVD+ M GS  YMHPMNLST+LA+DS
Sbjct  340   RLIVDKFMTGSTDYMHPMNLSTILALDS  367



>ref|XP_009386573.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   504 bits (1297),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 226/328 (69%), Positives = 284/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADSPPYGID P+ +PTGRFSNGLNIPDI+SE LG+EPT+PYL+P
Sbjct  36    SLVDNGNNNFLATTARADSPPYGIDTPSQQPTGRFSNGLNIPDILSEHLGAEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G++LL+GANFASAG+GILNDTGIQF+NII+I +QL +F EYQ+RL A+IG  +A+KL
Sbjct  96    DLQGERLLVGANFASAGIGILNDTGIQFINIIRINRQLQHFEEYQERLRAMIGQSQAQKL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LITLGGNDFVNNYYLIPFS RSRQF+LP+YVD+++ EYKK+L RL+++G RR +
Sbjct  156   VNQALFLITLGGNDFVNNYYLIPFSVRSRQFSLPDYVDYILFEYKKILTRLHEMGGRRAL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  SLDG+C PELQ AA +FN +L ++++ LN +   + F++ N  
Sbjct  216   VTGTGPLGCVPAELALRSLDGECDPELQRAASLFNSQLFQVLQELNTQFGADVFISANAF  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HM+++TNP+AFGF TS++ACCGQGPYNG+GLCT  S+LC +R +YAFWDAFHPSEKA 
Sbjct  276   RMHMNYVTNPEAFGFTTSRIACCGQGPYNGLGLCTVASNLCEDRSKYAFWDAFHPSEKAC  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RI+V   M+GS+ YM+PMNLST+LAMD+
Sbjct  336   RIVVSHFMDGSSEYMNPMNLSTILAMDA  363



>ref|XP_011002017.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Populus euphratica]
Length=364

 Score =   504 bits (1297),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 285/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPTHRPTGRFSNGLNIPD+IS+++GSE  +PYL+P
Sbjct  35    SLVDSGNNNYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDLISKRIGSESVLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQ+LL GANFASAG+GILNDTG+QF+NII++Y+QL+YF EYQ+R  AL+G ++ K+L
Sbjct  95    ALRGQRLLNGANFASAGIGILNDTGVQFINIIRMYRQLEYFQEYQRRARALVGVDQTKRL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLIT+GGNDFVNNYYLIP+S RSRQF++PNYV ++I+EY+K+L +LY LGARRV+
Sbjct  155   VKGALVLITVGGNDFVNNYYLIPYSARSRQFSVPNYVKYLISEYEKLLMKLYKLGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+LV+++K LN++I    F+A NT 
Sbjct  215   VTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLVQMLKGLNKKIGKTVFVAANTQ  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q H+DFI+NP+A+GF T++ ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEKAN
Sbjct  275   QSHLDFISNPRAYGFTTTKRACCGQGPYNGLGLCTAASNLCPNRDLYAFWDAFHPSEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV+Q+ +G+  YM PMNLST++ +D+ A
Sbjct  335   RLIVEQIYSGTTKYMDPMNLSTIMTLDARA  364



>ref|XP_011084387.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=354

 Score =   503 bits (1295),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 233/330 (71%), Positives = 282/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYPT R TGRFSNGLNIPD+ISE +G SE  +PYL+
Sbjct  24    SLVDSGNNNYLATTARADAPPYGIDYPTRRATGRFSNGLNIPDLISESIGGSESPLPYLS  83

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P L+G +LL+GANFASAGVGILNDTG+QFVNII+I QQL YF +YQQR++ LIG E+A++
Sbjct  84    PALNGPRLLVGANFASAGVGILNDTGVQFVNIIRIGQQLQYFEQYQQRVSGLIGAEEAQR  143

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLITLGGNDFVNNYYL+PFS RSRQF LP+YV F+I+EY+ +L RLY LGARRV
Sbjct  144   LVNQALVLITLGGNDFVNNYYLVPFSARSRQFALPDYVPFLISEYRNILLRLYQLGARRV  203

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA    +G+C+ ELQ AA +FNP+L +++  LN ++  N F+A NT
Sbjct  204   LVTGTGPLGCVPAELAMRGRNGQCSTELQQAAALFNPQLTQMLLALNEQLGDNVFIAANT  263

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
                H DFI+NP+AFGFVTS+VACCGQGP+NG+GLCT LS+LC NRD YAFWD FHPSE+A
Sbjct  264   QLTHYDFISNPQAFGFVTSKVACCGQGPFNGLGLCTQLSNLCPNRDVYAFWDPFHPSERA  323

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV Q+M GS  YM+PMNLST+LA+DS 
Sbjct  324   NRLIVQQIMTGSIEYMNPMNLSTILALDSR  353



>gb|KDO46628.1| hypothetical protein CISIN_1g041652mg [Citrus sinensis]
Length=368

 Score =   504 bits (1297),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 284/328 (87%), Gaps = 1/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD GNNN+LAT ARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE++G  E  +PYL+
Sbjct  37    SLVDVGNNNYLATIARADAPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGQPESPLPYLS  96

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G++LL GANFASAG+GILNDTGIQF+NII++++QL  F EYQ R++ALIG +  K+
Sbjct  97    PELTGERLLNGANFASAGIGILNDTGIQFLNIIRLFRQLHCFEEYQHRVSALIGLQNTKQ  156

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNYYL+PFS RSRQ+ LP YV ++I+EYKK LKRLY+LGAR+V
Sbjct  157   LVNKALVLITVGGNDFVNNYYLVPFSARSRQYPLPEYVKYLISEYKKQLKRLYELGARQV  216

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA    DG+C+ ELQ AA ++NP+LV++++ LNREI    F+  NT
Sbjct  217   LVTGTGPLGCVPAELAMRGTDGECSAELQRAAALYNPQLVQMLQELNREIGETIFIGANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+HMDF+++P+A+GFVTS++ACCGQGPYNG+GLCT LS+LC NRD YAFWD FHPSEKA
Sbjct  277   QQMHMDFVSDPQAYGFVTSKIACCGQGPYNGLGLCTALSNLCPNRDLYAFWDPFHPSEKA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             NRIIV Q+M GS  YM+PMNLSTVLA+D
Sbjct  337   NRIIVQQIMRGSTKYMNPMNLSTVLALD  364



>ref|XP_002884438.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60697.1| Li-tolerant lipase 1 [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score =   503 bits (1296),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 284/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q++YF +YQQR++ALIG E  ++L
Sbjct  96    HLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQMEYFEQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYY+IPFS RSRQF LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYVIPFSARSRQFALPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD++TNP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLST + +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTAMLLDS  363



>gb|KFK24279.1| hypothetical protein AALP_AAs47157U000200 [Arabis alpina]
Length=366

 Score =   503 bits (1295),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPTHRPTGRFSNGLNIPD+ISE LG    +PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTHRPTGRFSNGLNIPDLISEHLGQASPLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLL+GANFASAG+GILNDTGIQF+NII+I +QL+YF +Y+ RLA LIG E+ ++ 
Sbjct  96    MLTKDKLLLGANFASAGIGILNDTGIQFLNIIRITKQLEYFQQYKVRLAGLIGEEEMERR  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++++EY+KVL+++YDLGARRV+
Sbjct  156   VNEALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYIVSEYRKVLRKMYDLGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S  G+C+ ELQ AA ++NP+LV++I  LN E+  +AF+A NT 
Sbjct  216   VTGTGPMGCVPAELAQRSRTGECSTELQRAAALYNPQLVQMINDLNNEVGSSAFIAANTQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+HMDFI++P+A+GF+TS+VACCGQGPYNG+GLCT LS+LC NRD +AFWD FHPSEKA+
Sbjct  276   QMHMDFISDPQAYGFITSKVACCGQGPYNGIGLCTALSNLCPNRDLFAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RII  Q++NGS  YMHPMNLS++L +DS
Sbjct  336   RIIAQQILNGSPEYMHPMNLSSILTVDS  363



>gb|KDO52498.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=368

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 282/330 (85%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD IS+ +GSEPT+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G +LL+GANFASAG+GILNDTGIQFVNII++++Q +YF EYQ R+ ALIG ++ K+L
Sbjct  99    ELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGPQRTKQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LIT+GGNDFVNNYYL+P+S RSRQF+LP+YV +VI+EY+K+L RLYDLGARRV+
Sbjct  159   VNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLYDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A    +G+CA +LQ AA ++NP+LV+++K LN +     F+AVNT 
Sbjct  219   VTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIFVAVNTG  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  +FI+NP+AFGF TS+VACCGQGPYNG+GLCTP S+LC NR  YAFWD FHPSE+AN
Sbjct  279   KMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRAVYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
               IV + M GS  YM+PMNLST++A+DS  
Sbjct  339   GFIVQEFMTGSTEYMYPMNLSTIMALDSRT  368



>gb|KHN41491.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 289/330 (88%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYP-THRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP +HRPTGRFSNG NIPD+IS++L +E T+PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSNGYNIPDLISQRLSAESTLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G KLL+GANFASAG+GILNDTGIQFVN+I++Y+QL YF EYQ R+  LIG  + K 
Sbjct  100   PELRGNKLLVGANFASAGIGILNDTGIQFVNVIRMYRQLQYFKEYQNRVRDLIGASQTKS  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNY+L+P S RS+Q+ LP YV ++I+EY+K+LKRLYDLGARRV
Sbjct  160   LVNKALVLITVGGNDFVNNYFLVPNSARSQQYPLPAYVKYLISEYQKLLKRLYDLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVP+ELAQ   + +CAPELQ AA +FNP+L +++  LNR+I  + F+A NT
Sbjct  220   LVTGTGPLGCVPSELAQRGRNEQCAPELQQAAALFNPQLEQMLLRLNRKIGKDVFIAANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H DF++NP+ FGFVTSQVACCGQGPYNG+GLCT LS+LC+NR++YAFWDAFHPSEKA
Sbjct  280   GKTHNDFVSNPQQFGFVTSQVACCGQGPYNGLGLCTALSNLCSNREQYAFWDAFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+++M+GS  YM+PMNLST+LA+D++
Sbjct  340   NRLIVEEIMSGSKAYMNPMNLSTILALDAN  369



>ref|XP_004953113.1| PREDICTED: GDSL esterase/lipase LTL1-like [Setaria italica]
Length=366

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 279/330 (85%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTHR TGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  36    SLVDNGNNNYLLTTARADAPPYGIDFPTHRATGRFSNGLNIPDIISEHLGAEPALPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVGILNDTGIQFVNII+I  QL YF EYQ++L ALIG E+A +L
Sbjct  96    ELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIGDQLQYFREYQRKLRALIGEEQAAQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQ+ LP+YV F+++EY+K+L RLY+LGAR+V+
Sbjct  156   VNQALVLITLGGNDFVNNYYLVPMSVRSRQYALPDYVRFIVSEYRKILLRLYELGARKVI  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA EL  A  +FNP+LV + + LNRE+  + F+  NT 
Sbjct  216   VTGTGPLGCVPAELALHSQNGECATELTRAVNLFNPQLVDMARGLNRELGADVFVTANTL  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++ D+I NP+ FGF   QVACCGQGPYNG+GLCTP S++C NRD +AFWDAFHP+E+AN
Sbjct  276   RMNFDYINNPERFGFTNVQVACCGQGPYNGIGLCTPASNVCNNRDVFAFWDAFHPTERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q MNG   YMHPMNLST+LAMD   
Sbjct  336   RIIVGQFMNGDTDYMHPMNLSTILAMDREG  365



>emb|CDP04255.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARAD+PPYGIDYPTHRPTGRFSNGLNIPDIISE++G +  +PYL P
Sbjct  39    SLVDNGNNNYLLTSARADAPPYGIDYPTHRPTGRFSNGLNIPDIISERMGMQSPLPYLAP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +  GQ+LL GANFASAGVGILNDTG QF+NII+I +QL+Y+ ++Q R+ +LIG ++  +L
Sbjct  99    ENTGQRLLNGANFASAGVGILNDTGFQFLNIIRITKQLEYYQQFQTRVGSLIGEQQTTQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN  LVLITLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L RLY+LG+R+V+
Sbjct  159   VNQGLVLITLGGNDFVNNYYLVPFSARSRQFALPDYVRYLISEYRKILMRLYELGSRKVI  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELAQ S +G+C+ ELQ+AA +FNP+L ++I  +N ++  N F+A NT 
Sbjct  219   VTGTGPIGCVPAELAQRSRNGECSAELQHAASLFNPQLAQLISDINSQLGSNVFMAANTM  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDF++NP+AFGFVTS++ACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSE+AN
Sbjct  279   AMHMDFVSNPQAFGFVTSKIACCGQGPYNGIGLCTPLSNLCPNRDIYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q+ +GS  YMHPMNLS  LAMD+
Sbjct  339   RIIVQQIFSGSPQYMHPMNLSAALAMDT  366



>ref|XP_004142546.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=365

 Score =   502 bits (1293),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 229/331 (69%), Positives = 288/331 (87%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGID+PTHRPTGRFSNGLNIPD IS++LGSE  +PYLNP
Sbjct  35    SLVDNGNNNYLATTARADSYPYGIDFPTHRPTGRFSNGLNIPDYISQQLGSEFLLPYLNP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++LL GANFASAG+GILNDTGIQF+NII++++Q +YF EYQ+R+  +IG E+ K+L
Sbjct  95    ELNGRRLLDGANFASAGIGILNDTGIQFINIIRMFRQYEYFEEYQRRVGRIIGEERTKEL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLIT+GGNDFVNNYYL+PFS RSRQ++LP+YV+ +I EY+K+L RLY+LGARRV+
Sbjct  155   VKGALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVNLLIVEYRKLLLRLYELGARRVL  214

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S  G+C+ ELQ AA ++NP+L+++IK LN ++  N F+AVNT
Sbjct  215   VTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLLQMIKGLNTQLGSNVFVAVNT  274

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H+DFI+NP+A+GF TS+VACCGQGPYNG+GLCT  S+LC+NRD YAFWDAFHPSEKA
Sbjct  275   QQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASNLCSNRDAYAFWDAFHPSEKA  334

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N IIV QM +G+  YM+PMNL+T+L +DS  
Sbjct  335   NGIIVKQMFSGTTQYMYPMNLTTILQLDSKT  365



>ref|XP_003521785.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score =   502 bits (1293),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 283/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD+ISE++G E  +PYL+P
Sbjct  36    SLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDLISERIGGESVLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL GANFASAG+GILNDTG QF+NII++Y+QLDYF EYQQR++ LIG  +AKKL
Sbjct  96    QLKGENLLNGANFASAGIGILNDTGSQFLNIIRMYRQLDYFEEYQQRVSILIGVARAKKL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQ++L +YV F+I EY+K+L RLYDLGARRV+
Sbjct  156   VNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLIVEYRKLLMRLYDLGARRVI  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+L  +I+ LN++I  + F+A NT 
Sbjct  216   VTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTHMIQGLNKKIGKDVFIAANTA  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF++NP A+GF TSQ+ACCGQGPYNG+GLCTPLS LC NR+ +AFWD FHPSEK+N
Sbjct  276   LMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSDLCPNRNLHAFWDPFHPSEKSN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+Q+M+GS  YM PMNLSTV+++D+ 
Sbjct  336   RLIVEQIMSGSKRYMKPMNLSTVISLDAR  364



>ref|XP_007030303.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10805.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=367

 Score =   502 bits (1293),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 284/327 (87%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID P+ RPTGRFSNG NIPD IS+ LGSEP +PYL+P
Sbjct  36    SLVDNGNNNYLATTARADSPPYGIDTPSRRPTGRFSNGKNIPDFISDALGSEPVLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAG+GILNDTGIQF+NII++++QL YF EYQ RLA L+G  +A+++
Sbjct  96    ELRGDKLLVGANFASAGIGILNDTGIQFINIIRMFRQLLYFQEYQSRLADLVGYNEAQRI  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+D+LVLIT+GGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+K+L++LYDLGARRV+
Sbjct  156   VSDSLVLITVGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKLLRKLYDLGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  SL G+CAP+LQ AA ++NP+LV++I  LN EI    F+A NT 
Sbjct  216   VTGTGPLGCVPAELAMRSLSGQCAPDLQRAAALYNPQLVQMINGLNSEIGAKVFIAANTQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DFI+NP+A+GF TS+VACCGQGP+NG+GLCT LS+LC NR++Y FWD FHPSE+AN
Sbjct  276   QQTNDFISNPRAYGFATSKVACCGQGPFNGLGLCTLLSNLCPNRNQYVFWDPFHPSERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             RIIVD ++ GS  ++ PMNLST+LA+D
Sbjct  336   RIIVDTILRGSTDHVSPMNLSTLLALD  362



>ref|XP_006297961.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
 gb|EOA30859.1| hypothetical protein CARUB_v10014002mg [Capsella rubella]
Length=367

 Score =   501 bits (1291),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 282/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  37    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTG+QFVNII+I +Q +YF +YQ R++A+IG E  ++L
Sbjct  97    QLTGENLLVGANFASAGIGILNDTGVQFVNIIRISKQFEYFQQYQLRVSAMIGPEATQQL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY KVL++LY+LGARRV+
Sbjct  157   VNRALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYGKVLRKLYELGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N +
Sbjct  217   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFVAANAY  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD++TNP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  277   QMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS  YMHPMNLST + +DS
Sbjct  337   RIIVNQILTGSAKYMHPMNLSTAMLLDS  364



>ref|XP_006478980.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score =   501 bits (1291),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 283/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD IS+ +GSEPT+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G +LL+GANFASAG+GILNDTGIQFVNII++++Q +YF EYQ R+ ALIG ++ K+L
Sbjct  99    ELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGPQRTKQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LIT+GGNDFVNNYYL+P+S RSRQF+LP+YV +VI+EY+K+L RL+DLGARRV+
Sbjct  159   VNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLHDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A    +G+CA +LQ AA ++NP+LV+++K LN +     F+AVNT 
Sbjct  219   VTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIFVAVNTG  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  +FI+NP+AFGF TS+VACCGQGPYNG+GLCTP S+LC NR+ YAFWD FHPSE+AN
Sbjct  279   KMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRNVYAFWDPFHPSERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
               IV + M GS  YM+PMNLST++A+DS  
Sbjct  339   GFIVQEFMTGSTEYMYPMNLSTIMALDSRT  368



>ref|XP_006443290.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
 gb|ESR56530.1| hypothetical protein CICLE_v10020515mg [Citrus clementina]
Length=392

 Score =   502 bits (1293),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 283/330 (86%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD IS+ +GSEPT+PYL+P
Sbjct  63    SLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPTLPYLSP  122

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G +LL+GANFASAG+GILNDTGIQFVNII++++Q +YF EYQ R+ ALIG ++ K+L
Sbjct  123   ELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGPQRTKQL  182

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LIT+GGNDFVNNYYL+P+S RSRQF+LP+YV +VI+EY+K+L RL+DLGARRV+
Sbjct  183   VNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLHDLGARRVL  242

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A    +G+CA +LQ AA ++NP+LV+++K LN +     F+AVNT 
Sbjct  243   VTGTGPLGCVPAERAMRGRNGQCAADLQRAADLYNPQLVQLVKDLNSQYGSEIFVAVNTG  302

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  +FI+NP+AFGF TS+VACCGQGPYNG+GLCTP S+LC NR+ YAFWD FHPSE+AN
Sbjct  303   KMQYNFISNPRAFGFTTSKVACCGQGPYNGLGLCTPASNLCPNRNVYAFWDPFHPSERAN  362

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
               IV + M GS  YM+PMNLST++A+DS  
Sbjct  363   GFIVQEFMTGSTEYMYPMNLSTIMALDSRT  392



>gb|KHN35335.1| GDSL esterase/lipase [Glycine soja]
Length=349

 Score =   500 bits (1287),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 282/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD+ISE++G E  +PYL+P
Sbjct  20    SLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDLISERIGGESVLPYLSP  79

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL GANFASAG+GILNDTG QF+NII++Y+QLDYF EYQQR++ LIG  +AKKL
Sbjct  80    QLKGENLLNGANFASAGIGILNDTGSQFLNIIRMYRQLDYFEEYQQRVSILIGVARAKKL  139

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQ++L +YV F+I EY+K+L RLYDLGARR +
Sbjct  140   VNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLIVEYRKLLMRLYDLGARRAI  199

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+L  +I+ LN++I  + F+A NT 
Sbjct  200   VTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTHMIQGLNKKIGKDVFIAANTA  259

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF++NP A+GF TSQ+ACCGQGPYNG+GLCTPLS LC NR+ +AFWD FHPSEK+N
Sbjct  260   LMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLSDLCPNRNLHAFWDPFHPSEKSN  319

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+Q+M+GS  YM PMNLSTV+++D+ 
Sbjct  320   RLIVEQIMSGSKRYMKPMNLSTVISLDAR  348



>ref|XP_008810066.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=366

 Score =   500 bits (1287),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPTH+PTGRFSNGLNIPDIISE LG+EPT+PYL+P
Sbjct  37    SLVDNGNNNYLATTARADSPPYGIDYPTHQPTGRFSNGLNIPDIISEHLGAEPTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTGIQFVNII+I +QL YF +YQQ L++L+G  + K+L
Sbjct  97    ELRGGKLLVGANFASAGVGILNDTGIQFVNIIRISEQLLYFEQYQQSLSSLVGRAQTKRL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLI+LGGNDFVNNY+L+PFS RS +F LP+YV ++I+EYKK+L RLY+LGARRV+
Sbjct  157   VNQALVLISLGGNDFVNNYFLVPFSVRSIEFALPDYVYYLISEYKKILARLYELGARRVL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELAQ SL+G C PEL  AA  FN  L++ +K LN     + F++ N  
Sbjct  217   VTGTGPLGCAPAELAQRSLNGDCDPELLGAADQFNSLLLQTLKELNNHFGSDIFISANAF  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + HMDFI++P+A+GFVTS+VACCGQGPYNG+GLCT  S+LC NR+ YAFWDAFHP+E  N
Sbjct  277   RTHMDFISDPEAYGFVTSKVACCGQGPYNGLGLCTVASNLCANRNLYAFWDAFHPTEIGN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q M GS  YMHPMNLST+LAMD+
Sbjct  337   RIIVSQFMIGSAEYMHPMNLSTILAMDA  364



>gb|KFK37853.1| hypothetical protein AALP_AA3G037800 [Arabis alpina]
Length=366

 Score =   499 bits (1286),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 229/328 (70%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT  PTGRFSNGLNIPD+ISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRIPTGRFSNGLNIPDMISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G++LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +YQQR+ ALIG E  ++L
Sbjct  96    HLTGEELLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFEQYQQRMNALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNP+LV +IK +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQAAAALFNPQLVYLIKSINSEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS  YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSTKYMHPMNLSTVMLVDS  363



>ref|XP_009405750.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   499 bits (1284),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 281/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGID P+HR TGRFSNG N+PDI+SE LG+E T+PYL+P
Sbjct  34    SLVDNGNNNYLATTARADAPPYGIDTPSHRATGRFSNGKNVPDIVSEYLGAESTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL+GANFASAG+GILNDTGIQF NII+I +QL YF +YQQRL++LIG EK ++L
Sbjct  94    ELHGERLLVGANFASAGIGILNDTGIQFANIIRITKQLQYFEQYQQRLSSLIGPEKTERL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ LVLITLGGNDFVNNYYL+PFS RSRQF LP+YV ++++EYKK+L RLY+LG+RRV+
Sbjct  154   VNEGLVLITLGGNDFVNNYYLVPFSLRSRQFALPDYVRYLVSEYKKILSRLYELGSRRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG GPLGCVPAELA  S  G C PELQ    ++NP+L++++  LN +   + F+AVN +
Sbjct  214   VTGIGPLGCVPAELALRSRTGACDPELQRVPDLYNPQLMQLLSDLNTQYGSSVFVAVNAY  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFITNP A+GF+TS+VACCGQGPYNG+GLCT LS+LC NR+ YAFWDAFHP+EKAN
Sbjct  274   KMHMDFITNPGAYGFITSRVACCGQGPYNGIGLCTILSNLCPNRNVYAFWDAFHPTEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M G   YM PMNLS++LAMD+ 
Sbjct  334   RIIVSQFMTGLEEYMSPMNLSSILAMDAR  362



>ref|XP_004249922.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
 gb|AEJ88779.1| cutin-deficient 1 protein [Solanum lycopersicum]
Length=362

 Score =   499 bits (1284),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 228/331 (69%), Positives = 286/331 (86%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD+GNNN+LAT+ARADSPPYGIDYPT R TGRFSNG NIPDIIS+++GS E  +PYL+
Sbjct  32    SLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSNGYNIPDIISQQIGSSESPLPYLD  91

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P L GQ+LL+GANFASAG+GILNDTGIQF+NII++ QQL YF +YQ R++ LIG    ++
Sbjct  92    PALTGQRLLVGANFASAGIGILNDTGIQFINIIRMPQQLAYFRQYQSRVSGLIGEANTQR  151

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVL+TLGGNDFVNNYYL+P S RSRQF++ +YV ++I EY+K+L  +Y+LGARRV
Sbjct  152   LVNQALVLMTLGGNDFVNNYYLVPNSARSRQFSIQDYVPYLIREYRKILMNVYNLGARRV  211

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELAQ S +G+C+PELQ AA +FNP+L ++++ LN E+  + F+A NT
Sbjct  212   IVTGTGPLGCVPAELAQRSRNGECSPELQRAAGLFNPQLTQMLQGLNSELGSDVFIAANT  271

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H +FITNP+A+GF+TS+VACCGQGPYNG+GLCTPLS+LC NRD YAFWD FHPSE+A
Sbjct  272   QQMHTNFITNPQAYGFITSKVACCGQGPYNGLGLCTPLSNLCPNRDVYAFWDPFHPSERA  331

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N+IIV Q+M+G+   M+PMNLST+LAMDSHA
Sbjct  332   NKIIVQQIMSGTTELMNPMNLSTILAMDSHA  362



>ref|XP_008370770.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   498 bits (1283),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 281/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYGIDYPT RPTGRFSNGL IPD IS+KLG+EPT+PYL+P
Sbjct  32    SLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNGLTIPDYISQKLGAEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQKLL+GANFASAG+GILNDTG+QF NII++  QL  F +YQQRL+A IG ++ K+L
Sbjct  92    QLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQLLNFQQYQQRLSAQIGPQRTKQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF+LP+YV ++I+E +K+L ++YDLGARRV+
Sbjct  152   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVKYLISELRKILLKMYDLGARRVL  211

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+CA ELQ A+ ++NP+L+++++ +N ++  + F+A N  
Sbjct  212   VTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQMLRSVNSQLGSDVFVAANVQ  271

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +   DFI NP+AFGF TS+VACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEK N
Sbjct  272   ETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRASNLCPNRDLYAFWDAFHPSEKGN  331

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+ ++ G   YM+PMNLST+LA+DS 
Sbjct  332   RLIVENILTGDEKYMYPMNLSTILALDSR  360



>gb|ACU23502.1| unknown [Glycine max]
Length=370

 Score =   499 bits (1284),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 280/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD+ISE++G E  +PYL+P
Sbjct  41    SLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDLISERMGGESVLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL  + LL GANFASAG+GILNDTG QF+NII++Y+QLDYF EYQQR++ LIG  +AKKL
Sbjct  101   QLKSENLLNGANFASAGIGILNDTGSQFLNIIRMYRQLDYFEEYQQRVSILIGVARAKKL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQ++L +YV F+I EY+K+L RLYDLGARRV+
Sbjct  161   VNQALVLITVGGNDFVNNYYLVPYSARSRQYSLQDYVKFLIVEYRKLLMRLYDLGARRVI  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+L  +I+ LN++I    F+A NT 
Sbjct  221   VTGTGPMGCVPAELAMRGTNGGCSAELQRAASLYNPQLTHMIQGLNKKIGKEVFIAANTA  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF++NP A+GF TSQ+ACCGQGPYNG+GLCTPL +LC NR+ +AFWD FHPSEKAN
Sbjct  281   LMHNDFVSNPAAYGFTTSQIACCGQGPYNGIGLCTPLFNLCPNRNSHAFWDPFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+Q+M+G   YM PMNLSTVLA+D+ 
Sbjct  341   RLIVEQIMSGFKRYMKPMNLSTVLALDAR  369



>gb|KHG28665.1| hypothetical protein F383_15485 [Gossypium arboreum]
Length=369

 Score =   498 bits (1283),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 226/328 (69%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID P+ RPTGRFSNG NIPD ISE LGSEP +PYL+P
Sbjct  38    SLVDNGNNNYLATTARADSPPYGIDSPSRRPTGRFSNGKNIPDFISEALGSEPLLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G +LL+GANFASAG+GILNDTGIQF+NII++++Q +YF EYQ RLA L+G  +A+++
Sbjct  98    ELNGDRLLVGANFASAGIGILNDTGIQFINIIRMFRQFEYFQEYQGRLANLVGTTEAQRI  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V++ALVLIT+GGNDFVNNY+L+PFS RSRQF+LP+YV ++I+EY+K+L RLY+LGAR+V+
Sbjct  158   VSEALVLITVGGNDFVNNYFLVPFSARSRQFSLPDYVRYLISEYRKLLMRLYELGARKVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ AA +FNP+LV++I  LN ++  N F+A NT 
Sbjct  218   VTGTGPLGCVPAELAMRSPNGQCAAELQRAAGLFNPQLVQMINGLNSDLGANVFIAANTQ  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DFI+NP AFGF TS++ACCGQGPYNG+GLCT  S+LC NRD YAFWD FHPSEKAN
Sbjct  278   QQTNDFISNPGAFGFTTSKIACCGQGPYNGLGLCTIASNLCPNRDLYAFWDPFHPSEKAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+ ++ GS  YM PMNLS++LA+D+
Sbjct  338   RIIVNMILRGSTNYMSPMNLSSLLALDT  365



>gb|KDP23751.1| hypothetical protein JCGZ_23584 [Jatropha curcas]
Length=367

 Score =   498 bits (1282),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 282/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTM-PYLN  928
             SLVDNGNNN+LAT+ARADSPPYGID+PT RPTGRFSNG NIPD IS+ +GS   + PYL+
Sbjct  37    SLVDNGNNNYLATTARADSPPYGIDFPTRRPTGRFSNGYNIPDYISQAIGSRNLLLPYLS  96

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             PQL+G++LL GANFASAG+GILNDTGIQF NII+++QQ DYF +YQ+R+  LIG ++ K+
Sbjct  97    PQLNGERLLDGANFASAGIGILNDTGIQFANIIRMFQQFDYFEQYQRRVTGLIGAQRTKQ  156

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLIT+GGNDFVNNYYL+P+S RSRQ++LP+YV F+I+EYKK+L+RLYDLGARRV
Sbjct  157   LVNGALVLITVGGNDFVNNYYLVPYSIRSRQYSLPDYVKFLISEYKKLLQRLYDLGARRV  216

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELAQ   +G+C+ ELQ AA +FNP+L ++++ LN +   + F+A NT
Sbjct  217   LVTGTGPLGCVPAELAQRGRNGQCSAELQRAASLFNPQLTQMLRQLNSQYGSDVFIAANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++  DFITNP A+GFVTS+VACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSEKA
Sbjct  277   GRMTGDFITNPGAYGFVTSKVACCGQGPYNGIGLCTPASNLCPNRDVYAFWDPFHPSEKA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR I  Q+++GS  YM PMNLST++A+DS 
Sbjct  337   NRYIAQQILSGSTDYMSPMNLSTIMALDSR  366



>ref|NP_187079.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
 sp|Q9M8Y5.1|LTL1_ARATH RecName: Full=GDSL esterase/lipase LTL1; AltName: Full=Extracellular 
lipase LTL1; AltName: Full=Lithium-tolerant lipase 1; 
Short=AtLTL1; Short=Li-tolerant lipase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26785.1|AC016829_9 putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AAM61681.1| putative GDSL-motif lipase/acylhydrolase [Arabidopsis thaliana]
 gb|AEE74063.1| Li-tolerant lipase 1 [Arabidopsis thaliana]
Length=366

 Score =   497 bits (1280),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q++YF +YQ R++ALIG E  ++L
Sbjct  96    HLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQMEYFEQYQLRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQ+ LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQYALPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNP+LV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVDLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPVSNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLST + +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTAMLLDS  363



>ref|XP_010043319.1| PREDICTED: GDSL esterase/lipase LTL1-like [Eucalyptus grandis]
 gb|KCW85324.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=365

 Score =   497 bits (1279),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 289/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD PPYGIDYPTHRPTGRFSNGLNIPD+ISE +GSEPT+PYL+P
Sbjct  36    SLVDNGNNNYLATTARADLPPYGIDYPTHRPTGRFSNGLNIPDLISEAIGSEPTLPYLDP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+ LL+GANFASAG+GILNDTGIQF+NII+I+QQL  F +YQQR+AALIG E+A++L
Sbjct  96    ELNGENLLVGANFASAGIGILNDTGIQFINIIRIFQQLQLFQQYQQRVAALIGEEQAQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V++ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+ +L RLY+LGARRV+
Sbjct  156   VSNALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRNILARLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+ELAQ S +G+C  ELQ AA +FNP+LV+++  LN EI  N F+A N  
Sbjct  216   VTGTGPLGCVPSELAQRSRNGECVAELQRAAALFNPQLVQMVSSLNNEIGSNVFIAANAQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+  +FI+NP+AFGFVTS+VACCGQG YNG+GLCT  S+LC NRD YAFWDAFHPSE+AN
Sbjct  276   QMSSNFISNPRAFGFVTSKVACCGQGRYNGLGLCTVASNLCPNRDVYAFWDAFHPSERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R IV +++ G   YM+PMNLST++A+D+ 
Sbjct  336   RFIVREILTGDTRYMYPMNLSTIMALDTR  364



>ref|XP_008677149.1| PREDICTED: uncharacterized protein LOC100280267 isoform X1 [Zea 
mays]
 gb|ACF85174.1| unknown [Zea mays]
 gb|AFW63006.1| anther-specific proline-rich protein APG [Zea mays]
Length=366

 Score =   496 bits (1277),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 278/330 (84%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH+ TGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  36    SLVDNGNNNYLLTTARADAPPYGIDFPTHQATGRFSNGLNIPDIISEHLGAEPALPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVGILNDTGIQFVNII+I  QL YF EYQ++L AL+G  +A +L
Sbjct  96    ELRGEKLLVGANFASAGVGILNDTGIQFVNIIRIGDQLQYFREYQRKLRALVGEPQATQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQ+ LP+YV F+++EY+K+L RLY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLVPMSVRSRQYALPDYVRFIVSEYRKILSRLYELGARRVI  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS +G+CA EL  A  +FNP++V +++ LNR I  + F+  NT+
Sbjct  216   VTGTGPLGCVPAELALHSQNGECAAELTRAVNLFNPQMVDMVRGLNRAIGADVFVTANTY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++ D++ NP+ FGF   QVACCGQGPYNG+GLCT  S++C NRD +AFWDAFHP+E+AN
Sbjct  276   RMNFDYLANPQDFGFTNVQVACCGQGPYNGIGLCTAASNVCDNRDVFAFWDAFHPTERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M+G   YMHPMNLST+LAMD   
Sbjct  336   RIIVAQFMHGDTDYMHPMNLSTILAMDQEG  365



>ref|XP_006350316.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Solanum tuberosum]
Length=363

 Score =   496 bits (1277),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 276/328 (84%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADSPPYG+DYPTHRPTGRFSNGLNI D+IS++LG++PT+PYL+P
Sbjct  35    SLVDNGNNNFLATTARADSPPYGVDYPTHRPTGRFSNGLNIADLISKQLGADPTLPYLDP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG KLL+GANFASAG+GILNDTGIQFVNI++IY QLD F +YQQR++ALIG E+  +L
Sbjct  95    ALDGDKLLVGANFASAGIGILNDTGIQFVNILRIYDQLDLFQQYQQRVSALIGAEQTTRL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGND+VNNY+L P S R  Q+ + +Y   VI EY K+L RL+DLGARRV+
Sbjct  155   VNGALVLITLGGNDYVNNYFLTPISVRQLQYNIQDYSHVVITEYSKILTRLHDLGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ A+ +FNP LV++   LN+++  + F+AVN  
Sbjct  215   VTGTGPLGCVPAELALWSSNGECANELQQASKIFNPLLVQMTTRLNQQLSSDIFVAVNAM  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DFI  PK FGFVTS++ACCGQGPYNG+GLCT  S+LCTNRDEYAFWDAFHP+EKAN
Sbjct  275   ELQNDFIDKPKEFGFVTSKIACCGQGPYNGLGLCTTASNLCTNRDEYAFWDAFHPTEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             +IIV  +  GSN YM PMNLST++ +DS
Sbjct  335   KIIVKTIFTGSNKYMSPMNLSTIMEIDS  362



>ref|XP_009385316.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=366

 Score =   496 bits (1276),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 280/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD PPYGID P+HR TGRFSN  N+PDI+SE LG+EPT+PYL+P
Sbjct  37    SLVDNGNNNYLATTARADEPPYGIDTPSHRATGRFSNAKNVPDIVSEYLGAEPTLPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QLDG+KLL+GANFASAG+GILNDTG QF NII+I +QL YF +YQ RL++LIG E+ KKL
Sbjct  97    QLDGEKLLVGANFASAGIGILNDTGFQFANIIRINKQLHYFEQYQGRLSSLIGAERTKKL  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ LVLITLGGNDFVNNYYL+P+S RSR+F+LP+Y+ ++I+EYKK+L +LYDLG RR +
Sbjct  157   VNEGLVLITLGGNDFVNNYYLVPYSVRSREFSLPDYIRYLISEYKKILMKLYDLGCRRFL  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG GPLGCVPA LA  S  G C PE+Q    ++NP+LV+++  LN +   + F+AVN +
Sbjct  217   VTGIGPLGCVPAILATRSRSGACDPEMQRVPDLYNPQLVQLMSELNSQYGDDVFVAVNAY  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI++P A+GFVTS+VACCGQGPYNG+GLCT LS+LC NR+ YAFWDA+HP+EKAN
Sbjct  277   KMHMDFISDPAAYGFVTSKVACCGQGPYNGLGLCTVLSNLCPNRNIYAFWDAYHPTEKAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M GSN YM+PMNLST+LAMD+ 
Sbjct  337   RIIVGQFMTGSNEYMNPMNLSTILAMDAR  365



>ref|XP_002522022.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40426.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   496 bits (1276),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 281/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYGIDYPTHR TGRFSNGLNIPDIISE++GSEP +PYL+P
Sbjct  39    SLVDSGNNNYLATTARADSYPYGIDYPTHRATGRFSNGLNIPDIISERIGSEPVLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G++LL GANFASAG+GILNDTG+QF+NII++Y+Q  YF EYQ+R+ ALIG  + K+L
Sbjct  99    ELTGKRLLNGANFASAGIGILNDTGVQFLNIIRMYRQFQYFGEYQRRVRALIGSSRTKRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQF LP+YV ++I+EYKK+L  LY LGARRV+
Sbjct  159   VNGALVLITVGGNDFVNNYYLVPYSARSRQFALPDYVKYLISEYKKLLMALYKLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSL-DGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA     +G C+ ELQ AA ++NP+LV+++  LNR+I    F+  NT
Sbjct  219   VTGTGPLGCVPAELAMRGANNGGCSAELQRAASLYNPQLVQMLNGLNRKIGKTVFIGANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+HMDFI++P+A+GF TS+VACCGQGPYNG+GLCT  S+LC NR  YAFWD FHPSEKA
Sbjct  279   QQMHMDFISSPQAYGFTTSKVACCGQGPYNGLGLCTLASNLCPNRGLYAFWDPFHPSEKA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV+Q+ +G+  YM PMNLST++A+D+ 
Sbjct  339   NRLIVEQIFSGTTNYMVPMNLSTIMALDAR  368



>gb|ABX75139.1| lipase [Gossypium hirsutum]
Length=367

 Score =   495 bits (1275),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 283/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGID P+  PTGRFSNG NIPD I++ LGSEPT+PYL+P
Sbjct  36    SLVDNGNNNYLATTARADSPPYGIDTPSRHPTGRFSNGKNIPDFITDALGSEPTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAG+GIL+DTGIQF+NII++++Q  YF EYQ++LA L+G ++A+++
Sbjct  96    ELKGDKLLVGANFASAGIGILDDTGIQFMNIIRMFRQFQYFEEYQKKLADLVGKDEAQRI  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V++ALVLIT+GGNDFVNNY+L+PFS RSRQF LP+YV ++I+EY+K+L RLYDLGAR+V+
Sbjct  156   VSEALVLITVGGNDFVNNYFLVPFSARSRQFNLPDYVRYLISEYRKLLVRLYDLGARKVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S  G+CA ELQ AA ++NP+LV ++  LN ++  N F+A NT 
Sbjct  216   VTGTGPLGCVPAELAMRSPSGQCATELQQAAALYNPQLVEMVNGLNSQLGANIFIAANTQ  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DFI+NP A+GF TS++ACCGQGPYNG+GLCT LS+LC+NR+EY FWDAFHPSE+AN
Sbjct  276   QQTSDFISNPGAYGFTTSKIACCGQGPYNGLGLCTQLSNLCSNRNEYVFWDAFHPSERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              IIVD ++NGS +YM+PMNL+  LA+D+ 
Sbjct  336   GIIVDMILNGSTSYMNPMNLNAFLALDTK  364



>ref|XP_008345728.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   495 bits (1274),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 279/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYGIDYPT RPTGRFSNGL IPD IS+KLG+EPT+PYL+P
Sbjct  32    SLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNGLTIPDYISQKLGAEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQKLL+GANFASAG+GILNDTG+QF NII++  QL  F +YQQRL+A IG ++ K+L
Sbjct  92    QLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQLLNFQQYQQRLSAQIGPQRTKQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF+LP+YV ++I+E +K+L ++YDLGARRV+
Sbjct  152   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVKYLISELRKILLKMYDLGARRVL  211

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+CA ELQ A+ ++NP+L+++++ +N ++  + F+A N  
Sbjct  212   VTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQMLRSVNSQLGSDVFVAANVQ  271

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +   DFI NP+AFGF TS+VACCGQGPY G+GLCT  S+LC NRD YAFWDAFHPSEK N
Sbjct  272   ETRNDFIXNPQAFGFTTSKVACCGQGPYXGLGLCTRASNLCPNRDLYAFWDAFHPSEKGN  331

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+ +  G   YM+PMNLST+LA+DS 
Sbjct  332   RLIVENIXTGDEKYMYPMNLSTILALDSR  360



>ref|XP_008370782.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score =   495 bits (1274),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 279/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYGIDYPT RPTGRFSNGL IPD IS+KLG+EPT+PYL+P
Sbjct  32    SLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSNGLTIPDYISQKLGAEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQKLL+GANFASAG+GILNDTG+QF NII++  QL  F +YQQRL+A IG ++ K+L
Sbjct  92    QLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQLLNFQQYQQRLSAQIGPQRTKQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF+LP+YV ++I+E +K+L ++YDLGARRV+
Sbjct  152   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVKYLISELRKILLKMYDLGARRVL  211

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GC PAELA  S +G+CA ELQ A+ ++NP+L+++++ +N ++  + F+A N  
Sbjct  212   VTGTGPMGCXPAELAMRSRNGECAAELQRASALYNPQLIQMLRSVNSQLGSDVFVAANVQ  271

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +   DFI NP+AFGF TS+VACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEK N
Sbjct  272   ETRNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTRASNLCPNRDLYAFWDAFHPSEKGN  331

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+ +  G   YM+PMNLST+LA+DS 
Sbjct  332   RLIVENIXTGDEKYMYPMNLSTILALDSR  360



>ref|NP_001146251.1| hypothetical protein precursor [Zea mays]
 gb|ACL53571.1| unknown [Zea mays]
 tpg|DAA48526.1| TPA: hypothetical protein ZEAMMB73_975942 [Zea mays]
Length=384

 Score =   495 bits (1274),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 223/331 (67%), Positives = 281/331 (85%), Gaps = 1/331 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYG+DYPTHR TGRFSNG N+PDIISE LG+EP +PYL+P
Sbjct  49    SLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSNGKNVPDIISEYLGAEPALPYLSP  108

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG+KLL+GANFASAGVG+LNDTG+QF NII++ +QL YF +YQ RL+ L+G + A +L
Sbjct  109   HLDGRKLLVGANFASAGVGVLNDTGVQFANIIRVQKQLRYFRQYQDRLSRLVGEDAAARL  168

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVL+TLGGNDF+NNYYL+PFS RSR+F LP+YV +V++EY KVL++LY LGARRV+
Sbjct  169   VRGALVLVTLGGNDFINNYYLVPFSARSREFALPDYVRYVVSEYAKVLRQLYSLGARRVL  228

Query  564   VTGTGPLGCVPAELA-QHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTG+GPLGC PAELA + S DG+C  ELQ AA ++NP+LV +IK +N E+  + F+AVN 
Sbjct  229   VTGSGPLGCAPAELALRGSRDGECDAELQRAAALYNPQLVDMIKGVNAELGADVFVAVNA  288

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++HMDFI++P A+GFVTS+VACCGQGPYNG+GLCT  S +C +R  YAFWD FHP+EKA
Sbjct  289   YRMHMDFISDPAAYGFVTSKVACCGQGPYNGVGLCTAASSVCPDRSVYAFWDNFHPTEKA  348

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             NRIIV Q M+G   YMHP+NLST+LA+D+ A
Sbjct  349   NRIIVSQFMDGPQEYMHPLNLSTILAVDARA  379



>ref|XP_003618755.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES74973.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=366

 Score =   494 bits (1272),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDY-PTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLN  928
             SLVDNGNNN+LAT+ARAD+PPYGIDY P+HRPTGRFSNG NIPDIIS+KLG+EPT+PYL+
Sbjct  36    SLVDNGNNNYLATTARADAPPYGIDYQPSHRPTGRFSNGYNIPDIISQKLGAEPTLPYLS  95

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G+KLL+GANFASAG+GILNDTGIQF+NII++Y+Q +YF EYQ RL+ALIG  +AK 
Sbjct  96    PELRGEKLLVGANFASAGIGILNDTGIQFINIIRMYRQYEYFQEYQSRLSALIGASQAKS  155

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
              VN ALVLIT+GGNDFVNNYYL+P+S RSRQ+ LP YV ++I+EY+K+L++LYDLGARRV
Sbjct  156   RVNQALVLITVGGNDFVNNYYLVPYSARSRQYPLPEYVKYLISEYQKLLQKLYDLGARRV  215

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGP+GCVP+E+AQ   +G+C+ ELQ A+ +FNP+L  ++  LN++I  + F+A NT
Sbjct  216   LVTGTGPMGCVPSEIAQRGRNGQCSTELQRASSLFNPQLENMLLGLNKKIGRDVFIAANT  275

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              + H++FI NP  +GF TS++ACCGQGP NG+GLCT LS+LC+NRD  AFWDAFHPSEKA
Sbjct  276   GKTHLNFINNPGQYGFKTSKIACCGQGPNNGIGLCTQLSNLCSNRDLNAFWDAFHPSEKA  335

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             N++IV+ +M G+  YM+PMNLST+LA+D+
Sbjct  336   NKLIVNDIMTGTKAYMNPMNLSTILALDA  364



>ref|XP_010936081.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=368

 Score =   494 bits (1272),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 288/330 (87%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD PPYGIDYPTH+ TGRFSNGLN+PDIISE LG+EPT+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADRPPYGIDYPTHQATGRFSNGLNLPDIISENLGAEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQFVNII+I +Q+ YF +YQQRL++LIG  +A++L
Sbjct  99    ELRGEKLLVGANFASAGIGILNDTGIQFVNIIRIRKQVQYFQQYQQRLSSLIGSAQARRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSR+F+LP+YV ++I+EYK++L  LY+LGARRV+
Sbjct  159   VNQALVLITLGGNDFVNNYYLVPYSARSREFSLPDYVTYLISEYKQILASLYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S  G+C PEL  A+ +FNP+L++ +  +N +I  + F+AVN+ 
Sbjct  219   VTGTGPLGCVPAELALRSTTGRCDPELNRASDLFNPQLIQALTEINSQIGSDVFVAVNSR  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DFI+NP+A+GF TS++ACCGQGPYNG+GLCTPLS +C NR+ YAFWD +HP+EKAN
Sbjct  279   KMHSDFISNPQAYGFATSKIACCGQGPYNGIGLCTPLSSVCPNRNLYAFWDQYHPTEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M GS  YM+PMNLST+LAMD+ +
Sbjct  339   RIIVSQFMTGSTEYMNPMNLSTILAMDARS  368



>ref|XP_002265999.1| PREDICTED: GDSL esterase/lipase At4g28780 [Vitis vinifera]
 emb|CBI37236.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   494 bits (1271),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 283/329 (86%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLV+ GNNN+LAT+ARADSPPYGIDYPTH+ TGRFSNGLNIPDIISE+LG+E T+PYL+P
Sbjct  39    SLVEQGNNNYLATTARADSPPYGIDYPTHQATGRFSNGLNIPDIISEQLGAESTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQKLL+GANFASAG+GILNDTGIQF+NII+I +QL++F +YQQR++ALIG E+ ++L
Sbjct  99    QLTGQKLLVGANFASAGIGILNDTGIQFLNIIRISRQLEFFQQYQQRVSALIGEEQTQRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNY+L P S RSRQ +LP+Y  +VI+EY+K+L +LY+LGARRV+
Sbjct  159   VNQALVLITLGGNDFVNNYFL-PLSLRSRQMSLPDYSRYVISEYRKILMKLYELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+CA E Q AA +FNP+L+ + + LN E+  N F+  N  
Sbjct  218   VTGTGPLGCVPAELAMSRSNGQCAEEPQRAAAIFNPQLIEMAQGLNSELGSNIFITANAF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFIT+P+ +GFVTS+VACCGQGPYNG+G CT  S+LC NR+ YAFWD +HP+E+AN
Sbjct  278   EMHMDFITDPQLYGFVTSKVACCGQGPYNGLGFCTLASNLCPNRNIYAFWDPYHPTERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M+GS+ YM+PMNLST++ MDS 
Sbjct  338   RLIVQQIMSGSSKYMNPMNLSTIMEMDSR  366



>ref|XP_009348738.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   493 bits (1269),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 278/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD GNNN+LATSARADSPPYGIDYPT RPTGRFSNGL+IPD IS+KLG+EPT+PYL+P
Sbjct  32    SLVDTGNNNYLATSARADSPPYGIDYPTRRPTGRFSNGLSIPDYISQKLGAEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L GQKLL+GANFASAG+GILNDTG+QF NII++  QL  F +YQ+RL+A IG ++ K+L
Sbjct  92    LLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPAQLLNFQQYQRRLSAQIGPQRTKQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF LP+YV ++I+E +K+L ++YDLGARRV+
Sbjct  152   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFALPDYVRYLISELRKILLKMYDLGARRVL  211

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELA  S +G+CA ELQ AA ++NP+L+++++ +N ++  + F+A N  
Sbjct  212   VTGTGPLGCAPAELAMRSRNGECAAELQRAAALYNPQLIQMLRSVNSQLGSDVFVAANVQ  271

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +   DFI NP+AFGF TS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEK N
Sbjct  272   ETRNDFIKNPQAFGFTTSKIACCGQGPYNGLGLCTRASNLCPNRDLYAFWDAFHPSEKGN  331

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+ +M G   YM+PMNLST+LA+DS 
Sbjct  332   RLIVENIMTGDEKYMYPMNLSTILALDSR  360



>ref|NP_001047441.1| Os02g0617400 [Oryza sativa Japonica Group]
 dbj|BAD21448.1| putative anther-specific proline-rich protein [Oryza sativa Japonica 
Group]
 dbj|BAF09355.1| Os02g0617400 [Oryza sativa Japonica Group]
 gb|EAZ23825.1| hypothetical protein OsJ_07539 [Oryza sativa Japonica Group]
Length=367

 Score =   493 bits (1269),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 278/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGIDYPTH+ TGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  35    SLVDNGNNNYLITTARADAPPYGIDYPTHQATGRFSNGLNIPDIISEHLGAEPALPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTG+QFVNII+I  QL YF EYQ++L AL+G E+AK++
Sbjct  95    ELRGDKLLVGANFASAGVGILNDTGVQFVNIIRIGDQLQYFREYQRKLRALVGEEQAKRI  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQ+ + +YV F+I+EY+K+L RLY+LGARRV+
Sbjct  155   VNGALVLITLGGNDFVNNYYLVPMSVRSRQYAIQDYVPFIISEYRKILSRLYELGARRVI  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS  G+CA EL  A  ++NP+LV +++ LNR I    F+  NT+
Sbjct  215   VTGTGPLGCVPAELALHSRRGECAAELTRAVDLYNPQLVNMVRGLNRAIGAEVFVTANTN  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++ D+I+NP+ +GF   QVACCGQGPYNG+GLCT  S++C +R+ +AFWDAFHP+EKAN
Sbjct  275   RMNFDYISNPQNYGFTNVQVACCGQGPYNGIGLCTAASNVCDDREAFAFWDAFHPTEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RI+V Q M+GS  YMHPMNLST+LA+D  
Sbjct  335   RIVVGQFMHGSTEYMHPMNLSTILAVDDE  363



>gb|EAY86703.1| hypothetical protein OsI_08086 [Oryza sativa Indica Group]
Length=367

 Score =   493 bits (1269),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 278/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGIDYPTH+ TGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  35    SLVDNGNNNYLITTARADAPPYGIDYPTHQATGRFSNGLNIPDIISEHLGAEPALPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTG+QFVNII+I  QL YF EYQ++L AL+G E+AK++
Sbjct  95    ELRGDKLLVGANFASAGVGILNDTGVQFVNIIRIGDQLQYFREYQRKLRALVGEEQAKRI  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P S RSRQ+ + +YV F+I+EY+K+L RLY+LGARRV+
Sbjct  155   VNGALVLITLGGNDFVNNYYLVPMSVRSRQYAIQDYVPFIISEYRKILSRLYELGARRVI  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA HS  G+CA EL  A  ++NP+LV +++ LNR I    F+  NT+
Sbjct  215   VTGTGPLGCVPAELALHSRRGECAAELTRAVDLYNPQLVNMVRGLNRAIGAEVFVTANTN  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++ D+I+NP+ +GF   QVACCGQGPYNG+GLCT  S++C +R+ +AFWDAFHP+EKAN
Sbjct  275   RMNFDYISNPQNYGFTNVQVACCGQGPYNGIGLCTAASNVCDDREAFAFWDAFHPTEKAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RI+V Q M+GS  YMHPMNLST+LA+D  
Sbjct  335   RIVVGQFMHGSTEYMHPMNLSTILAVDDE  363



>ref|XP_004976167.1| PREDICTED: GDSL esterase/lipase LTL1-like [Setaria italica]
Length=363

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 283/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGSEP +PYL+P
Sbjct  34    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEHLGSEPALPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G +LL+GANFASAGVGILNDTGIQFVNII+I QQL+ F EYQQ+LAA +G + A ++
Sbjct  94    DLRGDRLLVGANFASAGVGILNDTGIQFVNIIRIGQQLENFQEYQQKLAAFVGVDAAAQV  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV+
Sbjct  154   VNNALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILVRLYELGARRVV  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA EL  AA +FNP+L +++  LN EI  + F++ NT+
Sbjct  214   VTGTGMIGCVPAELAMHSIDGECARELTEAADLFNPQLAQMLGELNAEIGRDVFISANTN  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DF+ NP+ +GFVTS+VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  274   RVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M+GS  ++ PMN+ST+LAMD+ 
Sbjct  334   RIIVGQFMHGSTDHISPMNISTILAMDNR  362



>gb|KCW85323.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=367

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 289/331 (87%), Gaps = 2/331 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD PPYGIDYPTHRPTGRFSNGLNIPD+ISE +GSEPT+PYL+P
Sbjct  36    SLVDNGNNNYLATTARADLPPYGIDYPTHRPTGRFSNGLNIPDLISEAIGSEPTLPYLDP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFV--NIIKIYQQLDYFAEYQQRLAALIGGEKAK  751
             +L+G+ LL+GANFASAG+GILNDTGIQFV  NII+I+QQL  F +YQQR+AALIG E+A+
Sbjct  96    ELNGENLLVGANFASAGIGILNDTGIQFVSINIIRIFQQLQLFQQYQQRVAALIGEEQAQ  155

Query  750   KLVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARR  571
             +LV++ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+ +L RLY+LGARR
Sbjct  156   QLVSNALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVYLISEYRNILARLYELGARR  215

Query  570   VMVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVN  391
             V+VTGTGPLGCVP+ELAQ S +G+C  ELQ AA +FNP+LV+++  LN EI  N F+A N
Sbjct  216   VLVTGTGPLGCVPSELAQRSRNGECVAELQRAAALFNPQLVQMVSSLNNEIGSNVFIAAN  275

Query  390   THQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEK  211
               Q+  +FI+NP+AFGFVTS+VACCGQG YNG+GLCT  S+LC NRD YAFWDAFHPSE+
Sbjct  276   AQQMSSNFISNPRAFGFVTSKVACCGQGRYNGLGLCTVASNLCPNRDVYAFWDAFHPSER  335

Query  210   ANRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ANR IV +++ G   YM+PMNLST++A+D+ 
Sbjct  336   ANRFIVREILTGDTRYMYPMNLSTIMALDTR  366



>ref|XP_009587010.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=367

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 280/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYG+DYPTHRPTGRFSNGLNIPD+IS++LG+EPT+PYL+P
Sbjct  39    SLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSNGLNIPDLISQQLGAEPTLPYLDP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G KLL+GANFASAG+GILNDTGIQF NII++ +QL+ F EYQQR++ALIG E+ ++L
Sbjct  99    ALTGDKLLVGANFASAGIGILNDTGIQFANIIRMPRQLELFQEYQQRVSALIGAEQTQRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL+LITLGGND+VNNY+L P S R  Q+ + +Y  +++ EY+K+LKRL DLGARRV+
Sbjct  159   VNNALILITLGGNDYVNNYFLTPVSARRIQYNIQDYSRYLVTEYRKILKRLDDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G CA E Q AA  FNP LV++IK LN+E+  + F+AVN  
Sbjct  219   VTGTGPLGCVPAELAMRSSNGDCAKEPQQAAAAFNPLLVQMIKRLNQELGSDIFVAVNAM  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DFI NPKAFGFVTS++ACCGQGP+NG+GLCT  S+LC NR+EYAFWD FHPSEKAN
Sbjct  279   EMQNDFINNPKAFGFVTSKIACCGQGPFNGIGLCTAASNLCPNREEYAFWDPFHPSEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             +IIV  + +GS+ Y+ PMNLST++A+DS
Sbjct  339   KIIVKTIYSGSDKYITPMNLSTIMAIDS  366



>ref|XP_004494759.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=362

 Score =   492 bits (1266),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 224/328 (68%), Positives = 289/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+ PYGIDYPTHRPTGRFSNG NIPD+IS +LG EPT+P ++P
Sbjct  33    SLVDSGNNDFLATTARADNYPYGIDYPTHRPTGRFSNGRNIPDLISLELGLEPTLPIMSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTG QF++II IY+QL  F  YQ+RL+A IG + A+ L
Sbjct  93    LLVGEKLLIGANFASAGIGILNDTGFQFLHIIHIYKQLQLFELYQKRLSAHIGSQGARNL  152

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+P+S RSRQ++LP+YV ++I+EY+KVL+RLYDLGARRV+
Sbjct  153   VNRALVLITLGGNDFVNNYYLVPYSARSRQYSLPDYVRYIISEYRKVLRRLYDLGARRVL  212

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GC PAE+A  S +G+CA ELQ AA ++NP+LV++IK LN+EI  + F+A + +
Sbjct  213   VTGTGPIGCAPAEIALKSPNGECALELQRAAAIYNPQLVQMIKGLNQEIGSDIFIAADAY  272

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+NP+A+GFVT++VACCGQGPYNG+GLCTP+S+LC NRD Y FWDAFHP+E+A+
Sbjct  273   RMHMDFISNPQAYGFVTAKVACCGQGPYNGIGLCTPVSNLCPNRDLYVFWDAFHPTERAS  332

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             +IIV Q+++GS  YM+PMNL+T++A+DS
Sbjct  333   KIIVQQILSGSPEYMYPMNLTTIMALDS  360



>ref|XP_009379724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=363

 Score =   492 bits (1266),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 289/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNGLNIPD IS++LG+EPT+PYL+P
Sbjct  34    SLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSNGLNIPDFISQQLGAEPTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++ +Q +YF +YQQRL++LIG ++ K+L
Sbjct  94    ELTGQKLLVGANFASAGIGILNDTGIQFINIIRMTRQFEYFQQYQQRLSSLIGPQRTKQL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF LP+YV ++I+E +K+L ++YDLGARRV+
Sbjct  154   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFALPDYVRYLISELRKLLLKMYDLGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+C+ ELQ AA ++NP+L++++K +N ++  + F+A NT 
Sbjct  214   VTGTGPLGCVPAELAMRSRNGECSAELQRAASLYNPQLIQMLKSVNSQLGSDVFIAANTQ  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q H DF++NP+AFGF TS++ACCGQGPYNG+GLCT  S+LC NR++YAFWDAFHPSEKAN
Sbjct  274   QTHNDFVSNPQAFGFSTSKIACCGQGPYNGLGLCTVASNLCPNRNQYAFWDAFHPSEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  ++ G   YM+PMNLST+LA+DS 
Sbjct  334   KLIVQNILKGDEKYMYPMNLSTILALDSR  362



>ref|XP_007147237.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
 gb|ESW19231.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
Length=365

 Score =   492 bits (1266),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 226/328 (69%), Positives = 278/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPT + TGRFSNGLNIPD+ISE +G E  +PYL+P
Sbjct  36    SLVDSGNNNYLATTARADSPPYGIDYPTGKATGRFSNGLNIPDLISEGMGGESVLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G  LL GANFASAG+GILNDTG QF+NII++Y+QLDYF EYQQR++ L G  +AKKL
Sbjct  96    QLKGDNLLNGANFASAGIGILNDTGAQFLNIIRMYRQLDYFEEYQQRVSILTGVARAKKL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLIT+GGNDFVNNYYL+P+S RSRQF+L NYV ++I EY+K+L RLYDLGARRV+
Sbjct  156   VNQALVLITVGGNDFVNNYYLVPYSARSRQFSLQNYVKYLIVEYRKLLMRLYDLGARRVI  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA     G C+ ELQ AA ++NP+L  +I+ LN++I  + F+A NT 
Sbjct  216   VTGTGPMGCVPAELALRGTSGGCSAELQRAASLYNPQLQHMIQGLNKKIGKDVFIAANTA  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H DF+ NP A+GF TS++ACCGQGPYNG+GLCTPLS+LC +R+ +AFWD FHPSEKA+
Sbjct  276   LMHNDFVNNPAAYGFTTSRIACCGQGPYNGIGLCTPLSNLCPDRNLHAFWDPFHPSEKAS  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q+M+GS  YM PMNLSTVLA+D+
Sbjct  336   RIIVEQIMSGSKRYMKPMNLSTVLALDA  363



>gb|ACG37655.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score =   492 bits (1266),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 282/329 (86%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH  TGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  38    SLVDNGNNNYLMTTARADAPPYGIDFPTHMATGRFSNGLNIPDIISEHLGSQPALPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G +LL+GANFASAGVGILNDTGIQFVNII+I QQL  F EYQQRLAA +G + A++ 
Sbjct  98    DLRGAQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLRNFQEYQQRLAAFVGEDAARQA  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+DALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV+
Sbjct  158   VSDALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLYELGARRVV  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+LV+++  LN +I  + F+A NT+
Sbjct  218   VTGTGMIGCVPAELAMHSVDGECARDLTEAADLFNPQLVQMLSELNADIGADVFIAANTN  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DF+ NP+ +GFVTS+VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  278   RVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M+GS  ++ PMN+ST+LAMD+ 
Sbjct  338   RIIVGQFMHGSTDHISPMNISTILAMDNR  366



>gb|ACR37591.1| unknown [Zea mays]
Length=369

 Score =   491 bits (1265),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 274/328 (84%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NIPDIISE LG+EPT+PYL+P
Sbjct  39    SLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEHLGAEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTG QFV+II++ +QL YF EYQ +L+AL+G  +A++L
Sbjct  99    ELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKLSALVGAARARQL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF LP YV ++++EYKK+L RLY +G RRV+
Sbjct  159   VRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKILIRLYAMGCRRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PA LAQ S +G+CA EL  AA +FNP+L R++  LN       F+A N  
Sbjct  219   VTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNARFGAGTFIAANAF  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DF+++P AFGF T++ ACCGQGP+NG+GLCTPLS+LC +R +Y FWDA+HP+E+AN
Sbjct  279   RVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYVFWDAYHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV Q M+GS  Y+ PMNLSTVL MD+
Sbjct  339   RVIVSQFMSGSLDYVSPMNLSTVLQMDA  366



>ref|XP_006660400.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Oryza brachyantha]
Length=367

 Score =   491 bits (1264),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 275/330 (83%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYG+DYPTHR TGRFSNGLN+PDIISE LG++  +PYL+P
Sbjct  36    SLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEYLGADSVLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG KLL GANFASAGVGILNDTGIQF NII+I +QL YF +YQ R+  LIGG  A++L
Sbjct  96    HLDGAKLLHGANFASAGVGILNDTGIQFANIIRIEKQLRYFQQYQDRVRWLIGGAAARRL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+PFS RSR+F LP+YV ++IAEY KVL++LYD+GARRV+
Sbjct  156   VEGALVLITLGGNDFVNNYYLVPFSARSREFALPDYVRYIIAEYSKVLRQLYDMGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG+GPLGC PAELA  S  G+C  ELQ AA ++NP+LVR+ + LN ++  + F+AVN +
Sbjct  216   VTGSGPLGCAPAELATRSATGECDAELQRAAALYNPQLVRMTRELNEQLGADVFVAVNAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI++P A+GF TS+ ACCGQGPYNG+GLCT +S +C +R  Y FWD FHP+E+AN
Sbjct  276   RMHMDFISDPAAYGFATSKGACCGQGPYNGVGLCTAMSSICPDRSLYVFWDNFHPTERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M+GS  YMHP NLST+LAMD+ A
Sbjct  336   RIIVSQFMSGSPDYMHPFNLSTILAMDAAA  365



>ref|XP_010530492.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Tarenaya 
hassleriana]
Length=361

 Score =   491 bits (1263),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 281/329 (85%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN+FLAT+ARAD+ PYGID+PTH  TGRFSNGLNI DIISE +G    +PYL+P
Sbjct  31    SLVDNGNNDFLATTARADNYPYGIDFPTHMATGRFSNGLNIADIISEYIGQPAPLPYLSP  90

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L   KLLIGANFASAG+GILNDTGIQF+NII+I +QL+YF +YQ+R++A+IG  + ++L
Sbjct  91    FLKKHKLLIGANFASAGIGILNDTGIQFINIIRITKQLEYFEQYQRRVSAMIGEAQTRQL  150

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF LP+YV ++++EY+KVL++LYDLGARRV+
Sbjct  151   VNGALVLITLGGNDFVNNYYLVPFSLRSRQFALPDYVVYLVSEYRKVLRKLYDLGARRVL  210

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPE-LQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGP+GCVPAELAQ S DG+CA E  + AA +FNPRL ++I  LN E+  + F+A NT
Sbjct  211   VTGTGPMGCVPAELAQRSRDGECAVEQRRRAASLFNPRLAQMINDLNGEVGSSVFIAANT  270

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++HMDFI++P+A+GFVTS++ACCGQGPYNG+GLCTP S+LC NRD YAFWD FHPSEKA
Sbjct  271   QRMHMDFISDPQAYGFVTSKIACCGQGPYNGIGLCTPASNLCPNRDLYAFWDPFHPSEKA  330

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NRII  Q++ GS  YMHPMNLS++L +DS
Sbjct  331   NRIIARQILTGSPQYMHPMNLSSILTLDS  359



>gb|EMT19317.1| GDSL esterase/lipase [Aegilops tauschii]
Length=369

 Score =   491 bits (1263),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 277/330 (84%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYG+DYPTHR TGRFSNGLN+PDIISE LG+EP +PYL+P
Sbjct  38    SLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEHLGAEPVLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG KLL GANFASAGVGILNDTGIQFVNII+I +QL YF +YQ R+  LIG    ++L
Sbjct  98    HLDGHKLLGGANFASAGVGILNDTGIQFVNIIRIQKQLRYFEQYQSRVRRLIGEPATQRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+PFS RSRQF LP+Y+ ++IAEYK +L++L+ LGARRV+
Sbjct  158   VRSALVLITLGGNDFVNNYYLLPFSARSRQFALPDYIRYLIAEYKTILQQLHGLGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG+GP+GC PAELA  S +G+C  ELQ AA ++NP+LV++ K LN +   + F+AVN +
Sbjct  218   VTGSGPIGCAPAELATRSANGECDLELQRAAALYNPQLVQMTKDLNAQFGADVFVAVNAY  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+ P A+GFVTS+VACCGQGPYNG+GLCT +S +C +R  YAFWD FHP+E+AN
Sbjct  278   RMHMDFISAPAAYGFVTSKVACCGQGPYNGVGLCTAMSSVCPDRSLYAFWDNFHPTERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M GS  YMHP+NLST+LAMD+ A
Sbjct  338   RIIVSQFMAGSPDYMHPLNLSTILAMDAAA  367



>gb|ACG46653.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=392

 Score =   491 bits (1265),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 274/328 (84%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NIPDIISE LG+EPT+PYL+P
Sbjct  62    SLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEHLGAEPTLPYLSP  121

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTG QFV+II++ +QL YF EYQ +L+AL+G  +A++L
Sbjct  122   ELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKLSALVGAARARQL  181

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF LP YV ++++EYKK+L RLY +G RRV+
Sbjct  182   VRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKILIRLYAMGCRRVL  241

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PA LAQ S +G+CA EL  AA +FNP+L R++  LN       F+A N  
Sbjct  242   VTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNARFGAGTFIAANAF  301

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DF+++P AFGF T++ ACCGQGP+NG+GLCTPLS+LC +R +Y FWDA+HP+E+AN
Sbjct  302   RVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYVFWDAYHPTERAN  361

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV Q M+GS  Y+ PMNLSTVL MD+
Sbjct  362   RVIVSQFMSGSLDYVSPMNLSTVLQMDA  389



>ref|XP_003626493.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82711.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=362

 Score =   490 bits (1261),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 287/330 (87%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNN+FLAT+ARAD+ PYGIDYP+HRPTGRFSNG NIPD+IS +LG EPT+PYL+P
Sbjct  32    SLVDSGNNDFLATTARADNYPYGIDYPSHRPTGRFSNGYNIPDLISLELGLEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+KLLIGANFASAG+GILNDTG QF++II+IY+QL  F  YQ+R++A IG E A+ L
Sbjct  92    LLVGEKLLIGANFASAGIGILNDTGFQFIHIIRIYKQLRLFELYQKRVSAHIGSEGARNL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EY+KVL+RLYDLGARRV+
Sbjct  152   VNRALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLRRLYDLGARRVL  211

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGP+GC PAELA     +G+C+ EL+ AA ++NP+LV +I+ LN+EI  + F+A + 
Sbjct  212   VTGTGPMGCAPAELAMRGGPNGQCSVELERAASLYNPQLVDMIRSLNQEIGSDIFVAADA  271

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++HMD+ITNP+A+GF TS+VACCGQGPYNG+GLCTP S+LC NR+  AFWDAFHPSEKA
Sbjct  272   YRMHMDYITNPQAYGFATSKVACCGQGPYNGLGLCTPASNLCPNRELNAFWDAFHPSEKA  331

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             N+IIV++++ GS  YM+PMNLST++A+DS 
Sbjct  332   NKIIVNRILRGSAQYMYPMNLSTIMALDSR  361



>ref|XP_007030301.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10803.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=370

 Score =   490 bits (1261),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 283/330 (86%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLG-SEPTMPYLN  928
             SLVD+GNNN+LAT+ARAD+PPYGIDYP+ RPTGRFSNGLNIPD+I E++G SE  +PYL+
Sbjct  40    SLVDSGNNNYLATTARADAPPYGIDYPSRRPTGRFSNGLNIPDLIGEQIGLSESPLPYLS  99

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+ +GQK+L+GANFASAGVGILNDTG+QFVNII++  QL+YF EY++RL AL+G ++A +
Sbjct  100   PEFNGQKMLVGANFASAGVGILNDTGVQFVNIIRMSGQLEYFKEYKRRLTALVGSKQAHQ  159

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV+ ALVLIT+GGNDFVNNYYL+P+S RSRQ+ LP+YV F+I+EY+++L RLY LGARRV
Sbjct  160   LVSQALVLITVGGNDFVNNYYLVPYSARSRQYKLPDYVKFLISEYRRLLMRLYKLGARRV  219

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGP+GCVPAELA    +G C+ ELQ AA ++NP+L +++  LN+ I  + F++ NT
Sbjct  220   LVTGTGPMGCVPAELAMRGTNGGCSEELQRAASLYNPQLAQMLNGLNKNIGRDVFVSANT  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H DF+++P+AFGF TSQ+ACCGQGPYNG+GLCT LS+LC NR  YAFWD FHPSEKA
Sbjct  280   QKMHNDFVSDPRAFGFTTSQIACCGQGPYNGLGLCTRLSNLCPNRALYAFWDPFHPSEKA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IV Q+M GS  YM+PMNL+T++A+DS 
Sbjct  340   NRLIVQQIMTGSTEYMNPMNLTTIMALDSR  369



>ref|XP_009124003.1| PREDICTED: GDSL esterase/lipase LTL1-like [Brassica rapa]
Length=366

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFQQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQFTLP+YV ++I+EY KVL++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFTLPDYVVYLISEYGKVLRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNP+LV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVNLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD++TNP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|NP_001141295.1| uncharacterized protein LOC100273386 precursor [Zea mays]
 gb|ACF86005.1| unknown [Zea mays]
 tpg|DAA37014.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 282/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH  TGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  39    SLVDNGNNNYLMTTARADAPPYGIDFPTHMATGRFSNGLNIPDIISEHLGSQPALPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKA-KK  748
              L G +LL+GANFASAGVGILNDTGIQFVNII+I QQL  F EYQQRLAA +G E A ++
Sbjct  99    DLRGAQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLRNFQEYQQRLAAFVGDEDAARQ  158

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
              V+DALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV
Sbjct  159   AVSDALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLYELGARRV  218

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+LV+++  LN +I  + F+A NT
Sbjct  219   VVTGTGMIGCVPAELAMHSVDGECARDLTEAADLFNPQLVQMLSELNADIGADVFIAANT  278

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++  DF+ NP+ +GFVTS+VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+A
Sbjct  279   NRVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERA  338

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NRIIV Q M+GS  ++ PMN+ST+LAMD+ 
Sbjct  339   NRIIVGQFMHGSTDHISPMNISTILAMDNR  368



>ref|XP_009348740.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score =   489 bits (1258),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 278/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYGIDYP  +PTGRFSNGL IPD IS+ LG+EPT+PYL+P
Sbjct  32    SLVDNGNNNYLATSARADSPPYGIDYPNRQPTGRFSNGLTIPDYISQNLGAEPTLPYLSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL GQKLL+GANFASAG+GILNDTG+QF NII++  QL  F +YQQRL+A IG ++ K+L
Sbjct  92    QLTGQKLLVGANFASAGIGILNDTGVQFANIIRMPLQLLNFQQYQQRLSAQIGPQRTKQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF+LP+YV ++I+E +K+L ++YDLG RRV+
Sbjct  152   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFSLPDYVKYLISELRKILLKMYDLGVRRVL  211

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVPAELA  S +G+CA ELQ A+ ++NP+L+++++ +N ++  + F+A N  
Sbjct  212   VTGTGPMGCVPAELAMRSRNGECAAELQRASALYNPQLIQMLRSVNSQLGSDVFVAANIQ  271

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +   DFI NP+AFGF TS++ACCGQGPYNG+GLCT  S+LC NRD YAFWDAFHPSEK N
Sbjct  272   ETRNDFIRNPQAFGFTTSKIACCGQGPYNGLGLCTRASNLCPNRDLYAFWDAFHPSEKGN  331

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV+ ++ G   YM+PMNLST+LA+DS 
Sbjct  332   RLIVENILTGDEKYMYPMNLSTILALDSR  360



>ref|XP_004247304.1| PREDICTED: GDSL esterase/lipase At4g28780 [Solanum lycopersicum]
Length=367

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 275/328 (84%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADSPPYG+DYPTHRPTGRFSNGLNI D+IS++LG++ T+PYL+P
Sbjct  39    SLVDNGNNNFLATTARADSPPYGVDYPTHRPTGRFSNGLNIADLISKQLGADLTLPYLDP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG KLL+GANFASAG+GILNDTGIQFVNI++IY QL+ F +YQQR++ LIG E+ K+L
Sbjct  99    ALDGDKLLVGANFASAGIGILNDTGIQFVNILRIYDQLNLFQQYQQRVSGLIGAEQTKRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNY+L P S R  ++ + +Y   VI EY K+L RL+DLGARRV+
Sbjct  159   VNGALVLITLGGNDFVNNYFLTPISVRQLEYNIQDYSRIVINEYSKILTRLHDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ A  +FNP L++++  LN+++  + F+AVN  
Sbjct  219   VTGTGPLGCVPAELALWSSNGECANELQQATKIFNPLLIQMVTRLNQQLSSDIFVAVNAM  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DFI  PK FGFVTS++ACCGQGPYNG+GLCT  S+LCTNRDEYAFWDAFHP+EKAN
Sbjct  279   ELQNDFINKPKEFGFVTSKIACCGQGPYNGLGLCTTASNLCTNRDEYAFWDAFHPTEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             +IIV  +  GS+ YM PMNLST++ +DS
Sbjct  339   KIIVKTIFTGSDEYMSPMNLSTIMEIDS  366



>emb|CDY49349.1| BnaA05g33110D [Brassica napus]
Length=366

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFQQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQFTLP+YV ++I+EY KVL++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFTLPDYVVYLISEYGKVLRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNP+LV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVNLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD++TNP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>ref|NP_001136990.1| uncharacterized protein LOC100217152 [Zea mays]
 gb|ACF83028.1| unknown [Zea mays]
 tpg|DAA49763.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=406

 Score =   490 bits (1262),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 274/328 (84%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NIPDIISE LG+EPT+PYL+P
Sbjct  76    SLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEHLGAEPTLPYLSP  135

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTG QFV+II++ +QL YF EYQ +L+AL+G  +A++L
Sbjct  136   ELRGQKLLVGANFASAGVGILNDTGFQFVDIIRMSRQLHYFGEYQGKLSALVGAARARQL  195

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF LP YV ++++EYKK+L RLY +G RRV+
Sbjct  196   VRRSLVLITLGGNDFVNNYYLVPFSLRSRQFALPEYVGYIVSEYKKILIRLYAMGCRRVL  255

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PA LAQ S +G+CA EL  AA +FNP+L R++  LN       F+A N  
Sbjct  256   VTGTGPLGCAPAILAQRSRNGECAAELMRAAALFNPQLARVLDQLNARFGAGTFIAANAF  315

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DF+++P AFGF T++ ACCGQGP+NG+GLCTPLS+LC +R +Y FWDA+HP+E+AN
Sbjct  316   RVHFDFVSDPAAFGFATAKDACCGQGPHNGLGLCTPLSNLCADRSKYVFWDAYHPTERAN  375

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV Q M+GS  Y+ PMNLSTVL MD+
Sbjct  376   RVIVSQFMSGSLDYVSPMNLSTVLQMDA  403



>ref|XP_009766488.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana sylvestris]
Length=366

 Score =   489 bits (1258),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 280/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LATSARADSPPYG+DYPTHRPTGRFSNG NIPD+IS++LG+EPT+PYL+P
Sbjct  38    SLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSNGFNIPDLISQQLGAEPTLPYLDP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G KLL+GANFASAG+GILNDTGIQF NII++ +QL+ F +YQQR++ALIG E+ ++L
Sbjct  98    ALTGDKLLVGANFASAGIGILNDTGIQFANIIRMPRQLELFQQYQQRVSALIGAEETQRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+AL+LITLGGND+VNNY+L P S R  Q+ + +Y  +++ +Y+K+LKRL+DLG RRV+
Sbjct  158   VNNALILITLGGNDYVNNYFLTPVSARRIQYNIQDYSRYLVTKYRKILKRLHDLGGRRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA E Q AA  FNP LV++IK LN+E+  + F+AVN  
Sbjct  218   VTGTGPLGCVPAELATRSSNGECAKEPQQAAAAFNPLLVQMIKRLNQELGSDIFVAVNAM  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DFI NPKAFGFVTS++ACCGQGPYNG+GLCT  S+LC NR+EYAFWD FHPSEKAN
Sbjct  278   EMQNDFINNPKAFGFVTSKIACCGQGPYNGIGLCTAASNLCPNREEYAFWDPFHPSEKAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             +IIV  + +GS+ Y+ PMNLST++A+DS
Sbjct  338   KIIVKTIYSGSDKYITPMNLSTIMAIDS  365



>emb|CDY42916.1| BnaC05g47350D [Brassica napus]
Length=366

 Score =   489 bits (1258),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFQQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQFTLP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFTLPDYVVYLISEYGKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNP+LV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPQLVNLIASVNAEIGQDVFVAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD++TNP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLTNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q++ GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILTGSSKYMHPMNLSTVMLLDS  363



>dbj|BAK06471.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   489 bits (1258),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 276/330 (84%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADS PYG+DYPTHR TGRFSNGLN+PDIISE LG+EP +PYL+P
Sbjct  42    SLVDSGNNNYLATTARADSAPYGLDYPTHRATGRFSNGLNVPDIISEHLGAEPVLPYLSP  101

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG KLL+GANFASAGVGILNDTGIQFVNII+I +QL YF +YQ R+  LIG    ++L
Sbjct  102   HLDGHKLLVGANFASAGVGILNDTGIQFVNIIRIQKQLRYFEQYQGRVRRLIGEPATQRL  161

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+P S RSRQF LP+YV ++IAEYK +L++L+ LGARRV+
Sbjct  162   VRSALVLITLGGNDFVNNYYLLPVSARSRQFALPDYVRYLIAEYKTILQQLHGLGARRVL  221

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG+GP+GC PAELA  S +G+C  ELQ AA ++NP+LV+I K LN +   + F+AVN +
Sbjct  222   VTGSGPIGCAPAELATRSANGECDLELQRAAALYNPQLVQITKELNAQFGADVFVAVNAY  281

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++HMDFI+ P A+GFVTS+VACCGQGPYNG+GLCT +S +C +R  YAFWD FHP+E+AN
Sbjct  282   RMHMDFISAPAAYGFVTSKVACCGQGPYNGVGLCTAMSSVCPDRSLYAFWDNFHPTERAN  341

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M GS  YMHP+NLST+LAMD+ A
Sbjct  342   RIIVSQFMAGSPDYMHPLNLSTILAMDAAA  371



>ref|XP_002467122.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
 gb|EER94120.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
Length=352

 Score =   488 bits (1256),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 273/328 (83%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NIPDIISE LG+EPT+PYL+P
Sbjct  18    SLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSNGKNIPDIISEHLGAEPTLPYLSP  77

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAGVGILNDTG QFVNII++ +QL +F EYQ +L AL+G  +A+++
Sbjct  78    ELRGQKLLVGANFASAGVGILNDTGFQFVNIIRMSRQLQHFGEYQGKLRALVGAARARQM  137

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++I+EYKK+L RLY +G RRV+
Sbjct  138   VRRSLVLITLGGNDFVNNYYLVPFSLRSRQFSLPDYVRYIISEYKKILIRLYAMGCRRVL  197

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PA LAQ S +G+CA EL  AA +FNP+L R++  LN       F+A N  
Sbjct  198   VTGTGPLGCAPAILAQRSRNGECAAELMRAASLFNPQLARVLDQLNARFGAGTFIAANAF  257

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DF+++P AFGF T++ ACCGQGP+NG+GLCTP S+LC +R +Y FWDA+HP+E+AN
Sbjct  258   RVHFDFVSDPAAFGFATAKEACCGQGPHNGLGLCTPASNLCPDRSKYVFWDAYHPTERAN  317

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R IV Q M+GS  Y+ PMNLSTVL MD+
Sbjct  318   RFIVSQFMSGSLDYVSPMNLSTVLQMDA  345



>ref|XP_006408203.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
 gb|ESQ49656.1| hypothetical protein EUTSA_v10020986mg [Eutrema salsugineum]
Length=366

 Score =   488 bits (1257),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 286/328 (87%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNN++L T+ARAD+ PYGIDYPT RPTGRFSNGLNIPDIISE +G   T+PYL+P
Sbjct  36    SLVDNGNNDYLVTTARADNYPYGIDYPTRRPTGRFSNGLNIPDIISEAIGMPSTLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G+ LL+GANFASAG+GILNDTGIQFVNII+I +Q +YF +YQQR++ALIG E  ++L
Sbjct  96    QLTGENLLVGANFASAGIGILNDTGIQFVNIIRISKQFEYFQQYQQRVSALIGPEATQQL  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF LP+YV ++I+EY K+L++LY+LGARRV+
Sbjct  156   VNQALVLITLGGNDFVNNYYLIPFSARSRQFALPDYVVYLISEYAKILRKLYELGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELAQHS +G+C   LQ AA +FNPRLV +I  +N EI  + F+A N +
Sbjct  216   VTGTGAMGCAPAELAQHSRNGECYGALQTAAALFNPRLVDLIASVNAEIGQDVFIAANAY  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q++MD+++NP+ FGFVTS+VACCGQGPYNG+GLCTP+S+LC NRD YAFWDAFHP+EKAN
Sbjct  276   QMNMDYLSNPEQFGFVTSKVACCGQGPYNGIGLCTPISNLCPNRDLYAFWDAFHPTEKAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV+Q+++GS+ YMHPMNLSTV+ +DS
Sbjct  336   RIIVNQILSGSSKYMHPMNLSTVMLLDS  363



>ref|XP_002446760.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
 gb|EES11088.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
Length=395

 Score =   489 bits (1259),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 283/328 (86%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  40    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEHLGSQPALPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G +LL+GANFASAGVGILNDTGIQFVNII+I QQL  F +YQQRLA  +G + A+++
Sbjct  100   DLRGDQLLVGANFASAGVGILNDTGIQFVNIIRIGQQLQNFQDYQQRLAEFVGEDAARQV  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV+
Sbjct  160   VNNALVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLYELGARRVV  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+LV+++  LN +I  + F+A NT+
Sbjct  220   VTGTGMIGCVPAELAMHSIDGECARDLTEAADLFNPQLVQMLSQLNADIGGDVFIAANTN  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DF+ NP+ +GFVTS+VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  280   RVSFDFMFNPQDYGFVTSKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q M+GS  ++ PMN+ST+LAMD+
Sbjct  340   RIIVGQFMHGSTDHITPMNISTILAMDN  367



>gb|KEH28987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   488 bits (1256),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 225/332 (68%), Positives = 278/332 (84%), Gaps = 2/332 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNNFLAT+ARADS PYGID  THR +GRFSNGLN+PD+ISEK+GSEPT+PYL+P
Sbjct  39    SLVDNGNNNFLATTARADSYPYGIDSQTHRASGRFSNGLNMPDLISEKIGSEPTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG++LLIGANFASAG+GILNDTG+QF+NII+I  QL YF +YQQR++ALIG  +A+KL
Sbjct  99    ELDGERLLIGANFASAGIGILNDTGVQFINIIRITAQLAYFKQYQQRVSALIGESEAQKL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL LITLGGNDFVNNYYL+P+S RSR++ LP+YV F+I+EY+K+L  LY+LGARRV+
Sbjct  159   VNQALTLITLGGNDFVNNYYLVPYSARSREYALPDYVVFLISEYRKILMNLYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKC--NAFLAVN  391
             VTGTGPLGCVPAELA    +G+C   LQ A  +FNP+LV +I  LN EI    + F+  N
Sbjct  219   VTGTGPLGCVPAELAMQGRNGECGVPLQTATNLFNPQLVELINQLNSEIGGPNHVFIYAN  278

Query  390   THQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEK  211
                +H+DF++NP+A+GF TS+ ACCGQGP+NG+GLCTP S+LC NRD YAFWD FHPSE+
Sbjct  279   AFAMHLDFVSNPQAYGFETSKQACCGQGPFNGVGLCTPASNLCPNRDLYAFWDPFHPSER  338

Query  210   ANRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             ANR+IVD+ M G+  YMHP NLST++AMDS  
Sbjct  339   ANRLIVDKFMTGTTDYMHPYNLSTLIAMDSRT  370



>gb|EYU19868.1| hypothetical protein MIMGU_mgv1a008447mg [Erythranthe guttata]
Length=373

 Score =   488 bits (1256),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 227/330 (69%), Positives = 278/330 (84%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGS-EPTMPYLN  928
             SLVD+GNNN+L T+ARAD+PPYGID P HRP+GRFSNGLNI DIISE +G  E  +PYLN
Sbjct  42    SLVDSGNNNYLVTTARADAPPYGIDSPNHRPSGRFSNGLNIADIISESIGGRESPLPYLN  101

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P L+G +LL+GANFASAGVGILNDTG+QFVNII I QQL  F +YQQR++ALIG  + ++
Sbjct  102   PALNGPRLLVGANFASAGVGILNDTGVQFVNIIGISQQLTNFQQYQQRVSALIGVSETQR  161

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV ++LVLITLGGNDFVNNYYL+PFS RSRQF +P+YV ++I+EY+K+L RLY LGARRV
Sbjct  162   LVKESLVLITLGGNDFVNNYYLVPFSARSRQFAIPDYVRYLISEYQKILLRLYGLGARRV  221

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTGTGPLGCVPAELA  S +G+CA ELQ AA +F+P+L  ++  LN +I  N F+A NT
Sbjct  222   LVTGTGPLGCVPAELAMRSRNGECATELQRAASLFDPQLTDMLLRLNSQIGSNVFIAANT  281

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI NP+AFGF TS+VACCGQGPYNG+GLCT LS+LC NRD YAFWDAFHPSE+A
Sbjct  282   QLMNNDFIRNPQAFGFTTSKVACCGQGPYNGLGLCTQLSNLCPNRDVYAFWDAFHPSERA  341

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+IVDQ+M GS  YM+PMNL+T++ +DSH
Sbjct  342   NRLIVDQIMTGSLQYMNPMNLTTIMELDSH  371



>ref|XP_011083094.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Sesamum 
indicum]
Length=363

 Score =   488 bits (1255),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 276/330 (84%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPT RPTGRFSNG NIPD+IS+ LG+E T+ YLNP
Sbjct  34    SLVDNGNNNYLVTTARADSPPYGIDYPTRRPTGRFSNGYNIPDLISQALGAESTLAYLNP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF NII+IYQQL +F +YQ+R++ LIG ++  +L
Sbjct  94    ELRGEKLLVGANFASAGIGILNDTGIQFANIIRIYQQLGFFEQYQRRVSGLIGEDETIQL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNY+L P + R  QF L +Y  ++I+EYKK+L RLYDLGARRV+
Sbjct  154   VNGALVLITLGGNDFVNNYFLTPITIRRLQFNLQDYSKYLISEYKKILMRLYDLGARRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPA LA  S +G+CA E Q AA +FNP LV++I  LN+EI  N F+AVN  
Sbjct  214   VTGTGPLGCVPAVLATRSRNGECAVEPQRAAAIFNPLLVQMIGALNQEIGSNVFVAVNAM  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DFITNP+AFGF+TS+VACCGQGPYNG+GLCT LS+LC NRD YAFWD FHP+E+AN
Sbjct  274   EMQNDFITNPQAFGFITSKVACCGQGPYNGLGLCTVLSNLCPNRDVYAFWDPFHPTERAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R IV  ++ GS+ YM+PMNLST++A+DS  
Sbjct  334   RFIVRTILTGSDKYMYPMNLSTIMALDSKT  363



>ref|XP_011002019.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=367

 Score =   488 bits (1256),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 287/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYG+DYPTHR TGRFSNGLNIPD+IS+ +GSEPT+PYL+P
Sbjct  38    SLVDNGNNNYLVTTARADAPPYGVDYPTHRATGRFSNGLNIPDLISQAIGSEPTLPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF+NII+I +QL YF +YQQR++ALIG E+A++L
Sbjct  98    ELRGEKLLVGANFASAGIGILNDTGIQFLNIIRIGRQLQYFQQYQQRVSALIGSEQAQRL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L R+Y+LGARRV+
Sbjct  158   VNQALVLVTLGGNDFVNNYYLVPFSARSRQFALPDYVVYLISEYRKILVRVYELGARRVL  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A  S +G+CA ELQ AA +FNP+LV+++  LNREI  + F+A N  
Sbjct  218   VTGTGPLGCVPAERAMRSRNGECAAELQRAAALFNPQLVQMLMELNREIGSDVFIAANAF  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
               +MDF+TNP+A+GFVTSQVACCGQG +NG+GLCT  S+LC NR+ +AFWD FHP+E+AN
Sbjct  278   DANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNREIFAFWDPFHPTERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV  ++ GS  YM+PMNLST++A+DS
Sbjct  338   RIIVSSIVTGSTKYMNPMNLSTIMALDS  365



>ref|XP_008235540.1| PREDICTED: GDSL esterase/lipase At4g28780 [Prunus mume]
Length=374

 Score =   488 bits (1256),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 278/330 (84%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGID+PTHRPTGRFSNGLN+PDIISE++GSE  +PYL+P
Sbjct  44    SLVDSGNNNYLATTARADSPPYGIDFPTHRPTGRFSNGLNLPDIISEEIGSERVLPYLSP  103

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLLIGANFASAG+GILNDTG+QFV +I+IY+Q + F EYQQRL AL+G  +A +L
Sbjct  104   ELTGQKLLIGANFASAGIGILNDTGVQFVTVIRIYRQFELFQEYQQRLTALVGAPQATRL  163

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL L+TLGGNDFVNNY+L P S RSRQ+++P +  ++I E++K+L  LY+LGARRV+
Sbjct  164   VNGALYLMTLGGNDFVNNYFLAPVSQRSRQYSVPEFSRYLITEFRKILMNLYELGARRVL  223

Query  564   VTGTGPLGCVPAELAQ-HSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVP+ELAQ  S +G+C PELQ AA +FNP+LV++++ LN ++  + F+  N 
Sbjct  224   VTGTGPLGCVPSELAQSRSRNGECNPELQGAAAIFNPQLVQMLQGLNTQLGSDVFVTANA  283

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               +  DFI+NP+ FGFVT++VACCGQGPYNGMG C P S+LC NR+ YAFWDAFHP+EKA
Sbjct  284   FDMKADFISNPQKFGFVTAKVACCGQGPYNGMGQCNPTSNLCPNRNLYAFWDAFHPTEKA  343

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  344   TRLIVKQIMTGSTKYMNPMNLSTIMALDSR  373



>ref|NP_001241754.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG35356.1| anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 282/330 (85%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  39    SLVDNGNNNYLMTTARADAPPYGIDFPTHLPTGRFSNGLNIPDIISEHLGSQPALPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G +LL+GANFASAGVGILNDTGIQFVNII I QQL  F +YQQRLAA +G + A+++
Sbjct  99    DLRGDQLLVGANFASAGVGILNDTGIQFVNIIGIGQQLHNFQDYQQRLAAFVGDDAARQV  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V++ALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV+
Sbjct  159   VSNALVLITLGGNDFVNNYYLVPFSFRSRQFAIQDYVPYLISEYRKILTRLYELGARRVV  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+LV+++  LN  I  + F+A NT+
Sbjct  219   VTGTGMIGCVPAELAMHSIDGECARDLTEAADLFNPQLVQMLSDLNAAIGGDVFIAANTN  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DF+ NP+ +GFVT++VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  279   RLSFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M+GS  ++ PMN+ST+LAMD+  
Sbjct  339   RIIVAQFMHGSTDHISPMNISTILAMDNRG  368



>ref|XP_002303095.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE82368.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=370

 Score =   486 bits (1252),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 216/330 (65%), Positives = 282/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGIDYPTHRPTGRFSNG N PDIIS+ +G EPT+PYL+P
Sbjct  40    SLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSNGFNFPDIISQSMGLEPTLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+GQ+LL GANFASAG+GILNDTGIQFVNI+++++Q   F EYQQR++A+IG ++ ++L
Sbjct  100   ELNGQRLLNGANFASAGIGILNDTGIQFVNILRMFRQFQLFEEYQQRVSAIIGTDRTQQL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNY+L PF+PR RQF+LP+Y  F+++EY+K+L RLYDLG RR++
Sbjct  160   VNNALVLITLGGNDFVNNYFLTPFAPRRRQFSLPDYCRFLVSEYRKLLMRLYDLGGRRIL  219

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S +G+CAPE Q AA +FNP+L ++++ LNRE+  + F+  N 
Sbjct  220   VTGTGPLGCVPAELAMSGSTNGECAPEPQRAAQIFNPQLFQMLQNLNRELGSDVFITANA  279

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ D I +P+ FGFVTS+VACCGQG YNG+GLCT +S+LC NR+ Y FWDAFHP+E+A
Sbjct  280   FAMNTDLINSPQRFGFVTSKVACCGQGLYNGLGLCTVVSNLCPNRNVYVFWDAFHPTERA  339

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR++V Q+M G+  YM+PMNLST++A+D+ 
Sbjct  340   NRVLVQQLMTGTTEYMNPMNLSTIMALDAK  369



>dbj|BAK07334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   486 bits (1252),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 276/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHR TGRFSNGLNIPDIISE+LG+EPT+PYL P
Sbjct  40    SLVDNGNNNYLMTTARADSPPYGIDYPTHRATGRFSNGLNIPDIISEQLGAEPTLPYLCP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTGIQFVNI+++ +QL YF EYQ +L AL+G  +A ++
Sbjct  100   ELHGAKLLVGANFASAGVGILNDTGIQFVNIVRMSRQLHYFGEYQGKLRALVGASQATQI  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQF+LP+YV ++IAEYKK+L RLY++GARRV+
Sbjct  160   VNRALVLITLGGNDFVNNYYLIPFSLRSRQFSLPDYVRYLIAEYKKILMRLYEMGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELA  S DG+C  +L  AA +FNP+L +I++ LN       F+A N+ 
Sbjct  220   VTGTGPLGCAPAELALRSRDGECDRDLMRAAELFNPQLSQILEDLNARYGDGTFIAANSF  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DFI+NP A+GF T++ ACCGQGP+NG+GLCT +S+LC +RD+Y FWD++HP+E+AN
Sbjct  280   RVHFDFISNPAAYGFRTAKEACCGQGPHNGVGLCTAVSNLCADRDQYVFWDSYHPTERAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV Q M GS  Y+ P+NLST L +D+ 
Sbjct  340   RIIVSQFMTGSLDYVSPLNLSTALHIDAR  368



>gb|KGN66731.1| hypothetical protein Csa_1G665920 [Cucumis sativus]
Length=357

 Score =   486 bits (1251),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 282/331 (85%), Gaps = 9/331 (3%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADS PYGID+PTHRPTGRFSNGLNIPD IS++LGSE  +PYLNP
Sbjct  35    SLVDNGNNNYLATTARADSYPYGIDFPTHRPTGRFSNGLNIPDYISQQLGSEFLLPYLNP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G++LL GANFASAG+GILNDTGIQF+NII++++Q +YF EYQ+R+  +IG E+ K+L
Sbjct  95    ELNGRRLLDGANFASAGIGILNDTGIQFINIIRMFRQYEYFEEYQRRVGRIIGEERTKEL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLIT+GGNDFVNNYYL+PFS RSRQ++LP+YV+ +I        RLY+LGARRV+
Sbjct  155   VKGALVLITVGGNDFVNNYYLVPFSARSRQYSLPDYVNLLI--------RLYELGARRVL  206

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S  G+C+ ELQ AA ++NP+L+++IK LN ++  N F+AVNT
Sbjct  207   VTGTGPLGCVPAELAMRGSSGGQCSEELQRAAALYNPKLLQMIKGLNTQLGSNVFVAVNT  266

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q+H+DFI+NP+A+GF TS+VACCGQGPYNG+GLCT  S+LC+NRD YAFWDAFHPSEKA
Sbjct  267   QQMHIDFISNPRAYGFETSKVACCGQGPYNGLGLCTVASNLCSNRDAYAFWDAFHPSEKA  326

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             N IIV QM +G+  YM+PMNL+T+L +DS  
Sbjct  327   NGIIVKQMFSGTTQYMYPMNLTTILQLDSKT  357



>ref|XP_008388753.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008350647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=363

 Score =   486 bits (1251),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 287/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARADSPPYGIDYPT RPTGRFSNG+NIPD IS++LG+EPT+PYL+P
Sbjct  34    SLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSNGMNIPDFISQQLGAEPTLPYLSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLL+GANFASAG+GILNDTGIQF+NII++ +Q DYF +YQQRL++LIG ++ K+L
Sbjct  94    ELTGQKLLVGANFASAGIGILNDTGIQFINIIRMTRQFDYFQQYQQRLSSLIGPQRTKQL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+T+GGNDFVNNYYL+PFS RSRQF LP+YV ++I+E +K+L ++YDLG RRV+
Sbjct  154   VNQALVLLTVGGNDFVNNYYLVPFSARSRQFALPDYVKYLISELRKLLLKMYDLGVRRVL  213

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+C+ ELQ AA ++NP+LV++++ LN ++  + F+A NT 
Sbjct  214   VTGTGPLGCVPAELAMRSRNGECSAELQRAASLYNPQLVQLLRSLNSQLGSDVFIAANTQ  273

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q   DF++NP+A+GF TS++ACCGQGPYNG+GLCT  S+LC NR++YAFWDAFHP+EKAN
Sbjct  274   QTRNDFVSNPQAYGFSTSKIACCGQGPYNGLGLCTVASNLCPNRNQYAFWDAFHPTEKAN  333

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             ++IV  ++ G   YM+PMNLST+LA+DS 
Sbjct  334   KLIVQNILTGDEKYMYPMNLSTILALDSR  362



>ref|NP_001132075.1| uncharacterized protein LOC100193489 precursor [Zea mays]
 ref|XP_008661412.1| PREDICTED: uncharacterized protein LOC100193489 isoform X1 [Zea 
mays]
 gb|ACF80762.1| unknown [Zea mays]
 gb|AFW58801.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 281/330 (85%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  37    SLVDNGNNNYLMTTARADAPPYGIDFPTHLPTGRFSNGLNIPDIISEHLGSQPALPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G +LL+GANFASAGVGILNDTGIQFVNII I QQL  F +YQQRLAA +G + A+++
Sbjct  97    DLRGDQLLVGANFASAGVGILNDTGIQFVNIIGIGQQLHNFQDYQQRLAAFVGDDAARQV  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V++ALVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RLY+LGARRV+
Sbjct  157   VSNALVLITLGGNDFVNNYYLVPFSFRSRQFAIQDYVPYLISEYRKILTRLYELGARRVV  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GC PAELA HS+DG+CA +L  AA +FNP+LV+++  LN  I  + F+A NT+
Sbjct  217   VTGTGMIGCAPAELAMHSIDGECARDLTEAADLFNPQLVQMLSDLNAAIGGDVFIAANTN  276

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++  DF+ NP+ +GFVT++VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  277   RLSFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCPNRDVYAYWDAFHPTERAN  336

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             RIIV Q M+GS  ++ PMN+ST+LAMD+  
Sbjct  337   RIIVAQFMHGSTDHISPMNISTILAMDNRG  366



>ref|XP_003580102.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=375

 Score =   485 bits (1248),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 278/330 (84%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGIDYPTH PTGRFSNGLNIPDIISE LGSEP +PYL+P
Sbjct  45    SLVDNGNNNYLMTTARADAPPYGIDYPTHLPTGRFSNGLNIPDIISEYLGSEPALPYLSP  104

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+ LL+GANFASAGVGILNDTG+QFVNII+I QQL  F  YQQ+LAA +G + A++ 
Sbjct  105   NLRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQAYQQKLAAYVGEDAARQR  164

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ ALVLITLGGNDFVNNYYL+PFS RS+QF + +YV ++I+EYKK+L RLY+LGARRV+
Sbjct  165   VSQALVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPYIISEYKKILARLYELGARRVV  224

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTG +GCVPAELA HSLDG CAP+L  AA +FNP+L +++  LN E+   + FLA NT
Sbjct  225   VTGTGMIGCVPAELAMHSLDGSCAPDLTRAADLFNPQLEQMLTELNSELGHDDVFLAANT  284

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             ++   DF+ NP+ +GFVT+++ACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+A
Sbjct  285   NRASFDFMFNPQQYGFVTAKIACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFHPTERA  344

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NRIIV   M+GS  ++ PMNLSTVLAMD+ 
Sbjct  345   NRIIVGNFMHGSTDHISPMNLSTVLAMDNR  374



>ref|XP_004489173.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=370

 Score =   484 bits (1247),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 217/328 (66%), Positives = 278/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NI D+IS+++G++ T+PYL+P
Sbjct  41    SLVDNGNNNYLHTNARADSPPYGIDYPTHRPTGRFSNGFNIADLISQRIGAKSTLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             QL G  LLIGANFASAG+GILNDTG QF+N+ +++ QLDYF  YQ+R+ ALIG  + K+L
Sbjct  101   QLKGYNLLIGANFASAGIGILNDTGAQFMNVTRMHTQLDYFKAYQRRMTALIGATRTKRL  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL L+T+GGNDFVNNYYL+P S RSRQ++LP YV  +I EY+K L+RLY+LGARRV+
Sbjct  161   VNQALFLMTVGGNDFVNNYYLVPSSARSRQYSLPQYVKLLICEYRKHLQRLYNLGARRVL  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG+GPLGC PAELA H  +G C+P+LQ  A ++NP+LV++++ LNR++  + F+A NT 
Sbjct  221   VTGSGPLGCAPAELAGHGRNGHCSPKLQLGAALYNPQLVKMLQGLNRKLGRDIFIAANTA  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+H DF+T+P+A+GFVTS+VACCGQGPYNG+G+C   S+LC NR+ YAFWD FHPSEKAN
Sbjct  281   QMHKDFVTHPRAYGFVTSKVACCGQGPYNGVGVCRTFSNLCPNRNLYAFWDQFHPSEKAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV ++M+GS  YM PMNLST+LA+D+
Sbjct  341   RIIVHRIMSGSTRYMKPMNLSTILALDA  368



>ref|XP_008382662.1| PREDICTED: GDSL esterase/lipase At4g28780 [Malus domestica]
Length=368

 Score =   484 bits (1246),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 288/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARADSPPYGID+PTHRPTGRFSNGLN+PDIISE++GSE  +PYLN 
Sbjct  39    SLVDSGNNNYLATTARADSPPYGIDFPTHRPTGRFSNGLNLPDIISEQIGSERVLPYLNS  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+ II+I  Q +YF +YQQRL AL+G E+A +L
Sbjct  99    ELTGEKLLIGANFASAGIGILNDTGVQFITIIRISMQFEYFQQYQQRLTALVGAEQATRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVLITLGGNDFVNNY++ PFS RSRQ+++P++  ++I+EY+K+L RLY+LGAR+V+
Sbjct  159   VNNALVLITLGGNDFVNNYFIQPFSLRSRQYSVPDFSRYLISEYRKILLRLYELGARKVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP+ELAQ S +G+C PELQNA  +FNP+LV++++ LN+++  + F+  N  
Sbjct  219   VTGTGPLGCVPSELAQRSQNGECNPELQNAGAIFNPQLVQMVQGLNKQLGSDIFITANAF  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HMDFI++P+ FGFVTS+VACCGQGPYNG+G C  LS+LC NRD YAFWDAFHP+EKA 
Sbjct  279   DMHMDFISDPQKFGFVTSKVACCGQGPYNGLGQCNRLSNLCPNRDLYAFWDAFHPTEKAT  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV Q+M+GS+ YM+PMNLST++A+DS
Sbjct  339   RLIVQQIMSGSSKYMNPMNLSTIMALDS  366



>ref|XP_002454777.1| hypothetical protein SORBIDRAFT_04g037130 [Sorghum bicolor]
 gb|EES07753.1| hypothetical protein SORBIDRAFT_04g037130 [Sorghum bicolor]
Length=377

 Score =   484 bits (1247),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 270/329 (82%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGID P HR TGRFSNG N+PDIISE LG+EP +PYL+P
Sbjct  39    SLVDNGNNNYLITAARADSPPYGIDTPDHRATGRFSNGKNVPDIISEHLGAEPVLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG+K+L+GANFASAGVGILNDTGIQF NII I +QL YF +YQ+RL ALIG + A +L
Sbjct  99    ELDGEKMLVGANFASAGVGILNDTGIQFANIIHIAKQLRYFEQYQKRLTALIGADAATRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+P+S RSR+F+LP+YV ++++EY +VL+ +YDLGARRV+
Sbjct  159   VRGALVLITLGGNDFVNNYYLVPYSARSREFSLPDYVSYILSEYAQVLEHMYDLGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             V G GP+GCVPAELA HSLDG C PELQ AA M+NPRL+ +++ LN       F+ VN  
Sbjct  219   VQGVGPIGCVPAELALHSLDGTCDPELQRAAEMYNPRLMSLLQDLNARHGGEVFVGVNMK  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +IH DFI +PKA+GF T+  ACCGQG +NGMGLCT +S LC +RD Y FWDAFHP+E+AN
Sbjct  279   RIHDDFIDDPKAYGFETATEACCGQGRFNGMGLCTMVSSLCADRDSYVFWDAFHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q M+GS  Y+ PMNLSTVLA+D  
Sbjct  339   RLIVQQFMSGSVEYIAPMNLSTVLAIDEE  367



>emb|CDP03830.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   484 bits (1246),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 278/329 (84%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGIDYPTHRPTGRFSNG NIPD+IS+ LG+E T+PYL+P
Sbjct  39    SLVDNGNNNYLLTTARADSPPYGIDYPTHRPTGRFSNGYNIPDLISQALGAESTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+KLL+GANFASAG+GILNDTGIQF NII+I QQL+ FA YQQRL ALIG ++A++ 
Sbjct  99    ELNGEKLLVGANFASAGIGILNDTGIQFANIIRIAQQLELFARYQQRLGALIGADQAEQR  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGND+VNNY+L P S R  Q+ + +Y  F+I+EY+K+L RLY+LGARRV+
Sbjct  159   VNQALVLITLGGNDYVNNYFLTPLSARRLQYNIQDYSVFLISEYRKILLRLYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGP+GCVP ELA  S +G+CA E Q AA +FNP L+++I+ LN+++  N F+AVN  
Sbjct  219   VTGTGPIGCVPGELATRSRNGECAEEPQQAAAIFNPLLIQMIQGLNQDLGSNVFVAVNAM  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q+  DFIT+P+AFGFVTS+VACCGQG +NG+GLCT  S+LC +R+ YAFWD FHP+E+AN
Sbjct  279   QMQYDFITSPRAFGFVTSKVACCGQGAFNGVGLCTAASNLCPDRNVYAFWDPFHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             +IIV  ++ GS+ YM PMNLST++A+DS 
Sbjct  339   KIIVQTIITGSDKYMTPMNLSTIMALDSK  367



>ref|NP_001053264.1| Os04g0507700 [Oryza sativa Japonica Group]
 emb|CAE04723.1| OSJNBa0043L24.11 [Oryza sativa Japonica Group]
 emb|CAE05693.2| OSJNBb0002J11.20 [Oryza sativa Japonica Group]
 dbj|BAF15178.1| Os04g0507700 [Oryza sativa Japonica Group]
 emb|CAH67339.1| OSIGBa0157A06.8 [Oryza sativa Indica Group]
 emb|CAH67558.1| OSIGBa0101P20.1 [Oryza sativa Indica Group]
 gb|EAY94790.1| hypothetical protein OsI_16569 [Oryza sativa Indica Group]
 gb|EAZ31291.1| hypothetical protein OsJ_15397 [Oryza sativa Japonica Group]
Length=368

 Score =   484 bits (1245),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 279/329 (85%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  38    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGSQPALPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G+ LL+GANFASAGVGILNDTGIQFVNII+I QQLD F  YQ+ LAA +G + A+++
Sbjct  98    DLRGENLLVGANFASAGVGILNDTGIQFVNIIRIGQQLDNFENYQRNLAAFVGEDAARQV  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RL+DLG RRV+
Sbjct  158   VQQSLVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLHDLGPRRVI  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+L R++  LN E+  + F+A NT+
Sbjct  218   VTGTGMIGCVPAELAMHSIDGECATDLTRAADLFNPQLERMLAELNSELGGHVFIAANTN  277

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +I  DF+ NP+ +GFVT++VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  278   KISFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFHPTERAN  337

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             R+IV Q+M+GS  ++ PMNLST+LAMD  
Sbjct  338   RLIVAQIMHGSTDHISPMNLSTILAMDER  366



>ref|XP_002319124.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
 gb|EEE95047.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
Length=419

 Score =   485 bits (1248),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 289/329 (88%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYG+DYPT R TGRFSNGLNIPD+ISE +GSEPT+PYL P
Sbjct  90    SLVDNGNNNYLATTARADAPPYGVDYPTRRATGRFSNGLNIPDLISEAIGSEPTLPYLAP  149

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+KLL+GANFASAG+GILNDTG+QF+NII+I QQL +F +YQQR++ALIG E+A++L
Sbjct  150   ELNGEKLLVGANFASAGIGILNDTGVQFLNIIRIGQQLQFFQQYQQRVSALIGPEQAQRL  209

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVL+TLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L R+Y+LGARR++
Sbjct  210   VNEALVLMTLGGNDFVNNYYLVPFSARSRQFALPDYVVYLISEYRKILVRVYELGARRIL  269

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A  S +G+CA ELQ AA +FNP+LV++I  LN EI  + F+A N +
Sbjct  270   VTGTGPLGCVPAERATRSRNGECAVELQRAATLFNPQLVQMITELNMEIGSDVFIAANAY  329

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +++MDF+TNP+A+GFVTSQVACCGQG +NG+GLCT  S+LC NRD +AFWD FHP+E+AN
Sbjct  330   EMNMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNRDIFAFWDPFHPTERAN  389

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV  ++ G   YM+PMNLST++A+DS 
Sbjct  390   RIIVSTIVTGDTKYMNPMNLSTIMALDSR  418



>ref|XP_010069682.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Eucalyptus grandis]
 gb|KCW58101.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
 gb|KCW58102.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
Length=374

 Score =   482 bits (1241),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 215/330 (65%), Positives = 281/330 (85%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPP GIDYPTHRPTGRFSNGLN+PDIISE++GSEPT+PYL+P
Sbjct  44    SLVDSGNNNYLVTTARADSPPNGIDYPTHRPTGRFSNGLNLPDIISEQIGSEPTLPYLSP  103

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L+G+KLL+GANFASAG+GILNDTG+QFV II+++QQ   F  YQ RL+ALIG ++A++ 
Sbjct  104   ELNGEKLLVGANFASAGIGILNDTGVQFVTIIRMFQQFANFQVYQARLSALIGADQARQR  163

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVL+TLGGNDFVNNY+L P SPR R+F L  + D++I+EY+ +L+RLYDLGARRV+
Sbjct  164   VNEALVLMTLGGNDFVNNYFLTPLSPRRREFNLQAFSDYLISEYRNILRRLYDLGARRVL  223

Query  564   VTGTGPLGCVPAELA-QHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA Q SL+G+C  E Q AA +FNP LVR+++ LN+E+  + F+A N 
Sbjct  224   VTGTGPLGCVPAELASQGSLNGECVAEPQQAAAIFNPALVRMVQGLNQELGSDVFIAANA  283

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              Q++MDFI++P+ +GF+TS+VACCGQG YNG+G+C PLS+LC +R+ YAFWD FHP+E+A
Sbjct  284   FQMNMDFISDPQRYGFITSKVACCGQGAYNGVGICNPLSNLCPDRNVYAFWDPFHPTERA  343

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+I   +++G   YM PMNLST++A+DS 
Sbjct  344   TRLIAQMILSGPADYMSPMNLSTIMALDSK  373



>gb|EPS69813.1| hypothetical protein M569_04951, partial [Genlisea aurea]
Length=337

 Score =   480 bits (1236),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 219/328 (67%), Positives = 272/328 (83%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGIDYPTHRPTGRFSNG NIPD+IS+ LG+EPT+PYL+P
Sbjct  10    SLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSNGFNIPDLISQALGAEPTLPYLDP  69

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              LDG+ LL+GANFASAGVGILNDTGIQF NII+I QQL+ F +YQ R+++LIG E +  L
Sbjct  70    NLDGENLLVGANFASAGVGILNDTGIQFANIIRIEQQLELFRQYQGRVSSLIGEEASGSL  129

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGND+VNNY+  P S R  Q++L ++   +I+EY+KVL  LYDLGARRV+
Sbjct  130   VNGALVLITLGGNDYVNNYFFTPLSLRRMQYSLEDFTTLLISEYRKVLSTLYDLGARRVL  189

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVP++LA  S++G+CA E Q AA +FNP L++++  LN E+  + F+A N +
Sbjct  190   VTGTGPLGCVPSQLATQSINGQCAQEPQRAAALFNPLLLQMVSELNGELGSDVFIASNAN  249

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             Q H DF+ +P+AFGFVTS+VACCGQGPYNG+GLC   S++C NRDEYAFWD FHP+E+AN
Sbjct  250   QQHGDFVKDPQAFGFVTSKVACCGQGPYNGVGLCRSTSNICANRDEYAFWDPFHPTERAN  309

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV  ++ GS  YM PMNLST++AMD+
Sbjct  310   RIIVQGLLTGSQEYMFPMNLSTIIAMDA  337



>emb|CDP04257.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   481 bits (1238),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 273/327 (83%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNG N+PD+I +  G E T+PYL+P
Sbjct  35    SLVDNGNNNYLVTTARADTPPYGIDFPTHSPTGRFSNGYNLPDLIGQYYGLEATLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL GANFASAGVGILNDTG+QF+NII +Y Q+ YF +YQ+RL+  IG E A KL
Sbjct  95    ELSGDKLLHGANFASAGVGILNDTGVQFINIIGMYDQIAYFLQYQKRLSDQIGAENATKL  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V ++LVLITLGGNDFVNNYYLIP+SPRS+QF L +Y  ++I+EY+K+L+RL+++GA RV+
Sbjct  155   VKESLVLITLGGNDFVNNYYLIPYSPRSQQFNLQDYCKYLISEYRKILQRLHEVGAERVI  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA  S +G+CA ELQ AA +FNP+L  ++  LN+EI  + F+A NT+
Sbjct  215   VTGTGPLGCVPAELAMRSSNGECADELQTAASLFNPQLAEMLTGLNKEIGSDVFVAANTN  274

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + HMDFI NP+AFGF T+++ACCGQGPYNG+GLCTP S+LC NR  Y FWDAFHP+E+AN
Sbjct  275   RAHMDFIANPQAFGFETAKIACCGQGPYNGIGLCTPFSNLCPNRGTYVFWDAFHPTERAN  334

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             R+IV QM NGS  YM+PMNLST+  +D
Sbjct  335   RLIVQQMFNGSTFYMNPMNLSTIRILD  361



>ref|XP_010524958.1| PREDICTED: GDSL esterase/lipase At5g18430 [Tarenaya hassleriana]
Length=377

 Score =   481 bits (1239),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 279/330 (85%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSE-PTMPYLN  928
             SLVD+GNNN+L T+ARADSPPYGID+PT RPTGRFSNGLN+PD+IS+++G+E P +PYL+
Sbjct  46    SLVDSGNNNYLVTTARADSPPYGIDFPTRRPTGRFSNGLNLPDLISQEMGNEEPPLPYLS  105

Query  927   PQLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKK  748
             P+L G++LL GANFASAG+GILNDTG QF+NII++Y+QLD F EYQ R+  LIG  + ++
Sbjct  106   PELRGRRLLNGANFASAGIGILNDTGFQFLNIIRMYEQLDNFEEYQTRVGRLIGQTQTRR  165

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LV+ +LVLIT+GGNDFVNNY+L+P+S RSRQF LP+YV  +I+EYKK+L RLY LG  RV
Sbjct  166   LVSQSLVLITVGGNDFVNNYFLVPYSARSRQFALPDYVKLLISEYKKILWRLYSLGVCRV  225

Query  567   MVTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVN  391
             +VTGTGPLGC PAELA   S DG+C+  LQ AA ++NP+LVR++  LN +I  N F+A N
Sbjct  226   LVTGTGPLGCAPAELANSGSRDGECSATLQRAASLYNPQLVRMLNGLNTKIGRNVFIAAN  285

Query  390   THQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEK  211
             THQ+ MDF++NP+A+GFVTS+VACCGQGPYNGMGLCT +S+LC NRD   FWDAFHPSEK
Sbjct  286   THQMQMDFLSNPQAYGFVTSKVACCGQGPYNGMGLCTFVSNLCRNRDLNVFWDAFHPSEK  345

Query  210   ANRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             ANRIIV Q+  GS  YM+PMNLSTV+A+DS
Sbjct  346   ANRIIVRQIFTGSINYMNPMNLSTVMALDS  375



>ref|XP_006652494.1| PREDICTED: GDSL esterase/lipase LTL1-like [Oryza brachyantha]
Length=374

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LGS+P +PYL+P
Sbjct  41    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGSQPALPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G  LL+GANFASAGVGILNDTGIQFVNII+I QQL+ F  YQQ+LAA  G + A+++
Sbjct  101   DLRGDNLLVGANFASAGVGILNDTGIQFVNIIRIGQQLENFQNYQQKLAAFAGEDAARQV  160

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYL+PFS RSRQF + +YV ++I+EY+K+L RL++LG RRV+
Sbjct  161   VAGSLVLITLGGNDFVNNYYLVPFSVRSRQFAIQDYVPYLISEYRKILTRLHELGPRRVI  220

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTG +GCVPAELA HS+DG+CA +L  AA +FNP+L R++  LN E+  + F+A NT+
Sbjct  221   VTGTGMIGCVPAELAMHSIDGECATDLTQAADLFNPQLERMLAELNSELGGHVFIAANTN  280

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +I  DF+ NP+ +GFVT++VACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+AN
Sbjct  281   KISFDFMFNPQDYGFVTAKVACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFHPTERAN  340

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             R+IV Q+M+GS  ++ PMNLST+LAMD+
Sbjct  341   RLIVAQLMHGSTDHIRPMNLSTILAMDA  368



>ref|XP_003573228.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Brachypodium 
distachyon]
Length=375

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 275/332 (83%), Gaps = 2/332 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYG+DYPTHR TGRFSNGLN+PDIISE LGS P +PYL+P
Sbjct  41    SLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSNGLNVPDIISEHLGSPPVLPYLSP  100

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKA--K  751
              LDG  LL GANFASAGVGILNDTGIQF NII++ +QL YF +YQ RL   + G+ A  +
Sbjct  101   HLDGPTLLTGANFASAGVGILNDTGIQFANIIRMPKQLRYFQQYQTRLTRSLAGDAAAAR  160

Query  750   KLVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARR  571
             +LV  ALVLITLGGNDFVNNYYL+PFS RSRQF+LP+YV ++IAEY+K+L++LYDLGARR
Sbjct  161   RLVRSALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLIAEYRKILRQLYDLGARR  220

Query  570   VMVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVN  391
             V+VTG+GP+GC PAELA  S +G+C  ELQ AA ++NP+LV + + LN     + F+AVN
Sbjct  221   VLVTGSGPIGCAPAELATRSANGECDIELQRAAALYNPQLVAMTRELNAGYGADVFVAVN  280

Query  390   THQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEK  211
              +++HMDFI+ P A+GF+TS+VACCGQGPYNG+GLCT LS +C +R  YAFWD FHP+E+
Sbjct  281   AYRMHMDFISAPAAYGFLTSKVACCGQGPYNGVGLCTALSSVCPDRSLYAFWDNFHPTER  340

Query  210   ANRIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             ANRIIV Q M GS  YMHP+NLST+LA+D+ A
Sbjct  341   ANRIIVSQFMVGSPEYMHPLNLSTILAVDAAA  372



>ref|XP_008364335.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=368

 Score =   480 bits (1236),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 215/330 (65%), Positives = 279/330 (85%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT + ADSPPYGID+PTHRPTG FSNGLN PDIISE++GSE  +PYL+ 
Sbjct  39    SLVDSGNNNYLATPSSADSPPYGIDFPTHRPTGSFSNGLNFPDIISEQIGSERVLPYLSS  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L GQKLLIGANFASAG+GILN+TG+QFV  I+I++Q + F +YQQRL AL+G E+A +L
Sbjct  99    ELTGQKLLIGANFASAGIGILNETGVQFVTSIRIFRQFELFQQYQQRLTALVGAEQATRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGND+VNNY++ P SPR RQ+++P +  ++I+EY+K+L +LY+LGARRV+
Sbjct  159   VNSALVLITLGGNDWVNNYFVQPVSPRQRQYSVPAFSTYLISEYRKILLKLYELGARRVL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VT TG LGCVP+ELAQ S +G+C  ELQNAA +FNP+LV++I+ LNR++  N F+  N  
Sbjct  219   VTSTGSLGCVPSELAQRSRNGECVAELQNAAAIFNPQLVQMIQGLNRQLGSNVFITANAF  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              ++MDFI+NP+  GFVTS+VACCGQG +NG+G C P S+LC NRD YAFWDAFHP+EKAN
Sbjct  279   DMNMDFISNPEKSGFVTSKVACCGQGRFNGLGQCNPTSNLCPNRDLYAFWDAFHPTEKAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV Q+M+GS+ YM+PMNLST++A+DS +
Sbjct  339   RLIVKQIMSGSSKYMNPMNLSTMMALDSMS  368



>ref|XP_011038450.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=368

 Score =   480 bits (1236),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 286/329 (87%), Gaps = 0/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYG+DYPT R TGRFSNGLNIPD+ISE +GSEPT+PYL P
Sbjct  39    SLVDNGNNNYLATTARADAPPYGVDYPTRRATGRFSNGLNIPDLISEAIGSEPTLPYLAP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQF+NII+I QQL +F +YQQR++ALIG E+A++L
Sbjct  99    ELKGEKLLVGANFASAGIGILNDTGIQFLNIIRIGQQLQFFQQYQQRVSALIGPEQAQRL  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN+ALVL+TLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L R+Y+LGARR++
Sbjct  159   VNEALVLMTLGGNDFVNNYYLVPFSVRSRQFALPDYVVYLISEYRKILVRVYELGARRIL  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAE A  S +G+CA ELQ AA MFNP+LV++I  LN+EI  + F+A N +
Sbjct  219   VTGTGPLGCAPAERATRSRNGECAVELQRAAAMFNPQLVQMITELNKEIGSDVFIATNAY  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              ++ DF+TNP+A+GFVTSQVACCGQG +NG+GLCT  S+LC NR+ +AFWD FHP+E+AN
Sbjct  279   DMNTDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNREIFAFWDPFHPTERAN  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             RIIV  ++ G   YM+PMNLST++A+DS 
Sbjct  339   RIIVSTIVTGDTKYMNPMNLSTIMALDSR  367



>gb|EMT08293.1| GDSL esterase/lipase LTL1 [Aegilops tauschii]
Length=369

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 279/329 (85%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  38    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGAEPALPYLSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              + G+ LL+GANFASAGVGILNDTG+QFVNII+I QQL  F +YQ+RLAA IG + A++ 
Sbjct  98    YMRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLAAYIGEDAARER  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ +LVLITLGGNDFVNNYYL+PFS RS+QF + +YV F+I+EYKKVL RLY+LGARRV+
Sbjct  158   VSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIISEYKKVLARLYELGARRVI  217

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTG +GCVPAELA HSLDG CAP+L  AA +FNP+L R++  LN E+   + F+A NT
Sbjct  218   VTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEVGHDDVFIAANT  277

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++  DF+ NP+ +GF T+++ACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+A
Sbjct  278   NRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFHPTERA  337

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NRIIV   M+G+  ++ PMNLST+LAMD+
Sbjct  338   NRIIVANFMHGTTDHISPMNLSTILAMDN  366



>gb|EMS62626.1| GDSL esterase/lipase LTL1 [Triticum urartu]
Length=368

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 279/329 (85%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  37    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGAEPALPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              + G+ LL+GANFASAGVGILNDTG+QFVNII+I QQL  F +YQ+RLAA IG + A++ 
Sbjct  97    YMRGENLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLAAYIGEDAARER  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ +LVLITLGGNDFVNNYYL+PFS RS+QF + +YV F+I+EYKKVL RLY+LGARRV+
Sbjct  157   VSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIISEYKKVLARLYELGARRVI  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTG +GCVPAELA HSLDG CAP+L  AA +FNP+L R++  LN E+   + F+A NT
Sbjct  217   VTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEVGHDDVFIAANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++  DF+ NP+ +GF T+++ACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+A
Sbjct  277   NRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDVYAYWDAFHPTERA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NRIIV   M+G+  ++ PMNLST+LAMD+
Sbjct  337   NRIIVANFMHGTTDHISPMNLSTILAMDN  365



>dbj|BAJ85303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 278/329 (84%), Gaps = 1/329 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARAD+PPYGID+PTH PTGRFSNGLNIPDIISE LG+EP +PYL+P
Sbjct  37    SLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSNGLNIPDIISEYLGAEPALPYLSP  96

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              + G  LL+GANFASAGVGILNDTG+QFVNII+I QQL  F +YQ+RLAA IG + A++ 
Sbjct  97    YMRGDNLLVGANFASAGVGILNDTGVQFVNIIRIAQQLQNFQDYQRRLAAYIGEDAARQR  156

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ +LVLITLGGNDFVNNYYL+PFS RS+QF + +YV F+++EYKKVL RLY+LGARRV+
Sbjct  157   VSQSLVLITLGGNDFVNNYYLVPFSARSQQFEIHDYVPFIVSEYKKVLARLYELGARRVI  216

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTG +GCVPAELA HSLDG CAP+L  AA +FNP+L R++  LN E+   + F+A NT
Sbjct  217   VTGTGMIGCVPAELALHSLDGSCAPDLTRAADLFNPQLERMLTELNGEVGHDDVFIAANT  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
             +++  DF+ NP+ +GF T+++ACCGQGPYNG+GLCTP S++C NRD YA+WDAFHP+E+A
Sbjct  277   NRVSFDFMFNPQQYGFATAKIACCGQGPYNGIGLCTPASNVCANRDAYAYWDAFHPTERA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             NRIIV   M+G+  ++ PMNLST+LAMD+
Sbjct  337   NRIIVANFMHGTTDHISPMNLSTILAMDN  365



>ref|XP_009398857.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   479 bits (1233),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 219/328 (67%), Positives = 279/328 (85%), Gaps = 1/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+LAT+ARAD+ PYGID P+HRPTGRFSNG NI D++SE+LG EPT+PYL+P
Sbjct  35    SLVDSGNNNYLATTARADNIPYGIDSPSHRPTGRFSNGRNIADVMSEQLGGEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAGVGIL+DTGIQF N+I+I +QL YF EYQ++L+AL+G  +A+K+
Sbjct  95    ELRGEKLLVGANFASAGVGILDDTGIQFANVIRISKQLQYFEEYQEKLSALVGRSQARKI  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+  LV+ITLGGNDFVNNYYLIP S RSRQF+LP++V ++I EY+KVL RLY+LGAR ++
Sbjct  155   VSHGLVMITLGGNDFVNNYYLIPLSLRSRQFSLPDFVRYLIFEYRKVLVRLYELGARLIL  214

Query  564   VTGTGPLGCVPAELA-QHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA + SL G+C PELQ AA MFN  L  +++ LN EI   +F+A N 
Sbjct  215   VTGTGPLGCVPAELALRRSLSGECDPELQRAADMFNMLLFDVVRELNLEIDYVSFIAANA  274

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               +HM++ITNP+ +GF+TS+VACCGQG +NG+GLCT +S LC +RDEYAFWDAFHP+E+A
Sbjct  275   FNMHMNYITNPQVYGFITSKVACCGQGLFNGVGLCTAVSKLCEDRDEYAFWDAFHPTERA  334

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMD  124
              RIIV ++++GS  YMHPMNLST+LA D
Sbjct  335   CRIIVREILSGSEEYMHPMNLSTILARD  362



>ref|XP_009389128.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   481 bits (1239),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 219/324 (68%), Positives = 276/324 (85%), Gaps = 0/324 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYGID P+HRP+GRFSNG NIPDI+SE+LG+E T+PYL+P
Sbjct  39    SLVDNGNNNYLATTARADAPPYGIDTPSHRPSGRFSNGRNIPDIMSEQLGAETTLPYLSP  98

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLL+GANFASAG+GILNDTGIQFVNII+I +QL YF EYQ++L+ LIG  +A+  
Sbjct  99    ELRGEKLLVGANFASAGIGILNDTGIQFVNIIRINRQLQYFEEYQKKLSDLIGASQAEMR  158

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIP+S RSRQF LP+YV ++I+EY K+L+RLYDLGARRV+
Sbjct  159   VNQALVLITLGGNDFVNNYYLIPYSFRSRQFALPDYVRYLISEYYKILQRLYDLGARRVI  218

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAELA    +G+C  ELQ AA +FNP+LV+I+  LN +I  + F++ N  
Sbjct  219   VTGTGPLGCVPAELALRGRNGQCDSELQRAAGLFNPQLVQILNRLNSKIGSDVFVSANAF  278

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +HM+++ NP+AFGF TS++ACCGQGPYNG+GLC   S+LC +RD+YAFWD +HP+E+A 
Sbjct  279   GMHMNYVANPQAFGFTTSKIACCGQGPYNGIGLCNAASNLCPDRDKYAFWDPYHPTERAC  338

Query  204   RIIVDQMMNGSNTYMHPMNLSTVL  133
             RI+V  MM GS  +M+PMNLST+L
Sbjct  339   RIVVSHMMTGSTEFMNPMNLSTIL  362



>ref|XP_003533553.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score =   479 bits (1233),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 278/330 (84%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T ARA++PPYGIDYPTHR TGRFSNG NIPD IS++LG+E TMPYL+P
Sbjct  40    SLVDNGNNNYLQTIARANAPPYGIDYPTHRATGRFSNGFNIPDFISQELGAESTMPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L  + LL+GANFASAGVGILNDTG QF+NIIK++QQL+YF EYQQRL+ALIG  + K+L
Sbjct  100   DLTRENLLVGANFASAGVGILNDTGDQFMNIIKMHQQLEYFKEYQQRLSALIGVPRTKRL  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN AL+LIT+GGNDFVNNY+L+  + RSRQ++LP+YV F+I  Y K L+RLYDLGARRV+
Sbjct  160   VNQALILITVGGNDFVNNYFLVDSTARSRQYSLPDYVKFLITRYSKHLQRLYDLGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELA    +G+C+ +LQ AA ++NP+L +++  LN+++  + F+A NT 
Sbjct  220   VTGTGPLGCAPAELAMRGKNGECSADLQRAAALYNPQLEQMLLELNKKLGSDVFIAANTA  279

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
              +H D+ITNP A+GF TS+VACCGQGPYNGMGLC P+S+LC NR+ +AFWD FHP+EKAN
Sbjct  280   LMHNDYITNPNAYGFNTSKVACCGQGPYNGMGLCLPVSNLCPNRELHAFWDPFHPTEKAN  339

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             +++V+Q+M+GS  YM PMNLST+LA+D+ A
Sbjct  340   KLVVEQIMSGSTKYMKPMNLSTILALDARA  369



>ref|XP_002325359.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
 gb|EEE99740.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
Length=405

 Score =   480 bits (1236),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 287/328 (88%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+LAT+ARAD+PPYG+DYPTHR TGRFSNG NIPD+ISE +GSEPT+PYL+P
Sbjct  76    SLVDNGNNNYLATTARADAPPYGVDYPTHRATGRFSNGFNIPDLISEAIGSEPTLPYLSP  135

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+ LL+GANFASAG+GILNDTGIQF+NII++ +QL YF +YQQR++ALIG E+A++L
Sbjct  136   ELRGENLLVGANFASAGIGILNDTGIQFLNIIRMGRQLQYFQQYQQRVSALIGPEQAQRL  195

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNYYL+PFS RSRQF LP+YV ++I+EY+K+L  +Y+LGARRV+
Sbjct  196   VNQALVLMTLGGNDFVNNYYLVPFSARSRQFALPDYVVYLISEYRKILVSVYELGARRVL  255

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGCVPAE A  S +G+CA ELQ AA MFNP+LV+++  LN+EI  + F++ N +
Sbjct  256   VTGTGPLGCVPAERAMRSRNGECAAELQRAAAMFNPQLVQMLMELNKEIGSDVFISANAY  315

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + +MDF+TNP+A+GFVTSQVACCGQG +NG+GLCT  S+LC NR+ +AFWD FHP+E+AN
Sbjct  316   EANMDFVTNPQAYGFVTSQVACCGQGRFNGIGLCTIASNLCPNREIFAFWDPFHPTERAN  375

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV  ++ GS  YM+PMNLST++A+DS
Sbjct  376   RIIVSTIVTGSTKYMNPMNLSTIIALDS  403



>ref|XP_010447915.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score =   478 bits (1231),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 275/330 (83%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLN+PDIISE++GSEPT+P L+P
Sbjct  38    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSP  97

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+NI++I +Q + F EYQ+R++ +IG EK ++L
Sbjct  98    ELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEIIGSEKTQQL  157

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNY+  PFS R RQ +L  +   +I+EYKK+L RLY+LGARRVM
Sbjct  158   VNGALVLMTLGGNDFVNNYFF-PFSSRRRQSSLEEFSQLLISEYKKILARLYELGARRVM  216

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S++G+CAPE Q AA +FNP LV++++ LN EI  + F+  N 
Sbjct  217   VTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLVQMLQGLNSEIGSDVFIGANA  276

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI NP+ FGFVTS+VACCGQG YNG G+CTPLS LC +R+ YAFWD FHP+EKA
Sbjct  277   FNMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTPLSSLCPDRNAYAFWDPFHPTEKA  336

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  337   TRLIVQQIMTGSAEYMNPMNLSTIMALDSR  366



>ref|XP_003570388.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Brachypodium 
distachyon]
Length=365

 Score =   478 bits (1230),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 271/330 (82%), Gaps = 1/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADS PYGID P HR TGRFSNG N+PD+ISE LGSEP +PYL+P
Sbjct  33    SLVDNGNNNYLVTSARADSWPYGIDTPDHRATGRFSNGKNVPDLISEHLGSEPLLPYLSP  92

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKA-KK  748
             +LDG KLLIGANFASAG+GILNDTGIQF NII+I +QL YFA+YQ R+  L+G + A  K
Sbjct  93    ELDGDKLLIGANFASAGIGILNDTGIQFANIIRIEKQLSYFAQYQHRITKLLGSQAAATK  152

Query  747   LVNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRV  568
             LVN ALVLITLGGNDFVNNYYLIP+S RSR+F+LP+Y+ ++I+EYK+VL+ ++ LGARRV
Sbjct  153   LVNSALVLITLGGNDFVNNYYLIPYSARSREFSLPDYIIYIISEYKQVLRHIHSLGARRV  212

Query  567   MVTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             +VTG GP+GCVPAELA HSLDG C PELQ AA  +NP+LV +++ LN E+  + F+ VNT
Sbjct  213   LVTGVGPIGCVPAELALHSLDGSCDPELQRAAEAYNPKLVAMLQELNNEVGGDVFVGVNT  272

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H DFI +P+A+GF T+  ACCGQG +NG+G+CT +S LC +RD Y FWDAFHP+E+A
Sbjct  273   RRMHADFIDDPRAYGFQTATDACCGQGRFNGIGICTMVSSLCADRDAYVFWDAFHPTERA  332

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
             NR+I  Q + GS  Y+ PMNLST+L +D H
Sbjct  333   NRLIAQQFVTGSEEYITPMNLSTILKLDRH  362



>ref|XP_010438383.1| PREDICTED: GDSL esterase/lipase At4g28780 [Camelina sativa]
Length=363

 Score =   478 bits (1229),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 275/330 (83%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLN+PDIISE++GSEPT+P L+P
Sbjct  34    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSP  93

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+NI++I +Q + F EYQ+R++ +IG +K ++L
Sbjct  94    ELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEIIGSDKTQQL  153

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNY+  P S R RQ +L  +   +I+EYKK+L RLY+LGARRVM
Sbjct  154   VNGALVLMTLGGNDFVNNYFF-PLSSRRRQSSLEEFSQLLISEYKKILVRLYELGARRVM  212

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S++G+CAPE Q AA +FNP LV++++ LNREI  + F+  N 
Sbjct  213   VTGTGPLGCVPAELASSGSVNGECAPEAQQAAAIFNPLLVQMLQGLNREIGSDVFIGANA  272

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              +++ DFI NP+ FGFVTS+VACCGQG YNG G+CTPLS LC +R+ YAFWD FHP+EKA
Sbjct  273   FEMNADFINNPQRFGFVTSKVACCGQGAYNGRGICTPLSSLCPDRNAYAFWDPFHPTEKA  332

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM PMNLST++A+DS 
Sbjct  333   TRLIVQQIMTGSVEYMSPMNLSTIMALDSR  362



>ref|XP_004955275.1| PREDICTED: GDSL esterase/lipase At5g33370-like, partial [Setaria 
italica]
Length=412

 Score =   479 bits (1233),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 273/327 (83%), Gaps = 0/327 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T+ARADSPPYGID P HR TGRFSNG N+PDIISE LG+EP +PYL+P
Sbjct  78    SLVDNGNNNYLLTAARADSPPYGIDTPDHRATGRFSNGKNVPDIISEHLGAEPVLPYLSP  137

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG K+L+GANFASAGVGILNDTGIQF NII I +QL YF +YQ+RL++LIG E+  +L
Sbjct  138   ELDGDKMLVGANFASAGVGILNDTGIQFANIIHISKQLLYFQQYQKRLSSLIGPEQTARL  197

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V+ +LVLITLGGNDFVNNYYL+P+S RSR+F+LP+Y++++++EY+++L +LYDLGARRV+
Sbjct  198   VSGSLVLITLGGNDFVNNYYLVPYSARSREFSLPDYINYILSEYRQILTKLYDLGARRVL  257

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             V G GP+GCVPAELA HSLDG C  ELQ AA M+NPRL+ ++  LN     + F+ VNT 
Sbjct  258   VQGVGPIGCVPAELALHSLDGSCDRELQRAAEMYNPRLMALLADLNAGYGSDVFVGVNTQ  317

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             +IH DFI +PKA+GF T+  ACCGQG +NGMGLCT +S LC +RD + FWDAFHP+E+AN
Sbjct  318   RIHNDFIDDPKAYGFETATQACCGQGRFNGMGLCTMVSSLCADRDAFVFWDAFHPTERAN  377

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             R+IV Q M+GS  Y+ PMNLSTVLA+D
Sbjct  378   RLIVQQFMSGSVDYIAPMNLSTVLAID  404



>gb|AAN05519.1| putative early nodulin gene (Enod) related protein [Oryza sativa 
Japonica Group]
 gb|EAZ16343.1| hypothetical protein OsJ_31806 [Oryza sativa Japonica Group]
Length=383

 Score =   478 bits (1230),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 270/322 (84%), Gaps = 1/322 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARAD PPYGID+P+HRPTGRFSNGLNIPDIISE LG+EPT+PYL+P
Sbjct  28    SLVDNGNNNYLLTSARADMPPYGIDHPSHRPTGRFSNGLNIPDIISEHLGAEPTLPYLSP  87

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G KLL+GANFASAGVGILNDTGIQFVNI+++ +QL YFAEYQ+RL AL+G  +A+++
Sbjct  88    DLRGAKLLVGANFASAGVGILNDTGIQFVNIVRMSRQLQYFAEYQERLRALVGAARARRI  147

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RS+QF LP+YV F+I+EYKK+L+RLYD+GARRV+
Sbjct  148   VNGALVLITLGGNDFVNNYYLVPFSLRSQQFALPDYVRFLISEYKKILQRLYDMGARRVL  207

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTGPLGC PAE A     G CAP++  AA +FNP+L R +  +N  + +  AF+A N+
Sbjct  208   VTGTGPLGCAPAERALRGRGGGCAPQVMRAAELFNPQLSRALGEMNARVGRPGAFMAANS  267

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H DFI+NP AFGF T++ ACCGQGP NG+GLCT +S+LC +RD Y FWDA+HP+EKA
Sbjct  268   FRVHFDFISNPAAFGFATARDACCGQGPNNGLGLCTAMSNLCADRDAYVFWDAYHPTEKA  327

Query  207   NRIIVDQMMNGSNTYMHPMNLS  142
             NRIIV Q + GS  Y+ P+NLS
Sbjct  328   NRIIVSQFVRGSLDYVSPLNLS  349



>ref|NP_001064786.1| Os10g0463200 [Oryza sativa Japonica Group]
 gb|AAP54162.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26700.1| Os10g0463200 [Oryza sativa Japonica Group]
Length=390

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 270/322 (84%), Gaps = 1/322 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARAD PPYGID+P+HRPTGRFSNGLNIPDIISE LG+EPT+PYL+P
Sbjct  35    SLVDNGNNNYLLTSARADMPPYGIDHPSHRPTGRFSNGLNIPDIISEHLGAEPTLPYLSP  94

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
              L G KLL+GANFASAGVGILNDTGIQFVNI+++ +QL YFAEYQ+RL AL+G  +A+++
Sbjct  95    DLRGAKLLVGANFASAGVGILNDTGIQFVNIVRMSRQLQYFAEYQERLRALVGAARARRI  154

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYL+PFS RS+QF LP+YV F+I+EYKK+L+RLYD+GARRV+
Sbjct  155   VNGALVLITLGGNDFVNNYYLVPFSLRSQQFALPDYVRFLISEYKKILQRLYDMGARRVL  214

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREI-KCNAFLAVNT  388
             VTGTGPLGC PAE A     G CAP++  AA +FNP+L R +  +N  + +  AF+A N+
Sbjct  215   VTGTGPLGCAPAERALRGRGGGCAPQVMRAAELFNPQLSRALGEMNARVGRPGAFMAANS  274

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
              ++H DFI+NP AFGF T++ ACCGQGP NG+GLCT +S+LC +RD Y FWDA+HP+EKA
Sbjct  275   FRVHFDFISNPAAFGFATARDACCGQGPNNGLGLCTAMSNLCADRDAYVFWDAYHPTEKA  334

Query  207   NRIIVDQMMNGSNTYMHPMNLS  142
             NRIIV Q + GS  Y+ P+NLS
Sbjct  335   NRIIVSQFVRGSLDYVSPLNLS  356



>ref|XP_009129278.1| PREDICTED: GDSL esterase/lipase At4g28780 [Brassica rapa]
Length=361

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 276/330 (84%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLN+PDIISE++GSEPT+P L+P
Sbjct  32    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+NI++I +Q + F EYQ+R++ +IG +K ++L
Sbjct  92    ELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEIIGSDKTQQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNY+L PFS RSRQ +L  +   +I+EYKK+L RLY+LGARRVM
Sbjct  152   VNGALVLMTLGGNDFVNNYFL-PFSARSRQSSLSEFSQLLISEYKKILMRLYELGARRVM  210

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S +G+CAPE Q AA +FNP L ++++ LNR++  + F+  N 
Sbjct  211   VTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLDQMLQGLNRQVGSDVFIGANA  270

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI NP+ FGFVTS+VACCGQG YNG G+CTPLS LC +R+ YAFWD FHP+EKA
Sbjct  271   FNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSSLCPDRNAYAFWDPFHPTEKA  330

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  331   TRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



>emb|CDY35219.1| BnaA01g08120D [Brassica napus]
Length=346

 Score =   476 bits (1224),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 276/330 (84%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLN+PDIISE++GSEPT+P L+P
Sbjct  17    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSP  76

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+NI++I +Q + F EYQ+R++ +IG +K ++L
Sbjct  77    ELTGEKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEIIGSDKTQQL  136

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNY+L PFS RSRQ +L  +   +I+EYKK+L RLY+LGARRVM
Sbjct  137   VNGALVLMTLGGNDFVNNYFL-PFSARSRQSSLSEFSQLLISEYKKILMRLYELGARRVM  195

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S +G+CAPE Q AA +FNP L ++++ LNR++  + F+  N 
Sbjct  196   VTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLDQMLQGLNRQVGSDVFIGANA  255

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI NP+ FGFVTS+VACCGQG YNG G+CTPLS LC +R+ YAFWD FHP+EKA
Sbjct  256   FNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSSLCPDRNAYAFWDPFHPTEKA  315

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  316   TRLIVQQIMTGSVEYMNPMNLSTIMALDSR  345



>gb|EAY88013.1| hypothetical protein OsI_09436 [Oryza sativa Indica Group]
Length=388

 Score =   477 bits (1228),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 272/330 (82%), Gaps = 0/330 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGID P HR TGRFSNG N+PDIISE LG+EP +PYL+P
Sbjct  36    SLVDNGNNNYLITSARADSPPYGIDTPDHRATGRFSNGKNMPDIISEHLGAEPVLPYLSP  95

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG +LL+GANFASAG+GILNDTG+QF NII I +Q+ YF +YQ RL A++G E+AKK+
Sbjct  96    ELDGDRLLVGANFASAGIGILNDTGVQFANIIHIEKQIRYFEQYQDRLRAVVGDEQAKKV  155

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  +LVLITLGGNDFVNNYYLIP+SPRSR+F+LP+Y+ ++++EYK+VL+ ++ LGARRV+
Sbjct  156   VAGSLVLITLGGNDFVNNYYLIPYSPRSREFSLPDYIRYILSEYKQVLRHIHALGARRVL  215

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTG GP+GCVPAELA HSLDG C  ELQ AA  +NP+LV ++  LN E+  + F+ VNT 
Sbjct  216   VTGVGPIGCVPAELALHSLDGGCDAELQRAADAYNPQLVAMLAELNAEVGGDVFVGVNTK  275

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             + H DFI +P+A GF TS  ACCGQG +NGMGLCT +S+LC +RD Y FWDAFHP+E+AN
Sbjct  276   RAHDDFIEDPRAHGFETSTEACCGQGRFNGMGLCTLVSNLCADRDSYVFWDAFHPTERAN  335

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDSHA  115
             R+IV Q M+GS  Y+ PMNLST+L +D  A
Sbjct  336   RLIVQQFMHGSLDYITPMNLSTILKLDQQA  365



>ref|XP_003574015.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=374

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 221/328 (67%), Positives = 269/328 (82%), Gaps = 0/328 (0%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L TSARADSPPYGID+PTHR TGRFSNGLNIPDIISE LG+EPT+PYL P
Sbjct  42    SLVDNGNNNYLMTSARADSPPYGIDFPTHRATGRFSNGLNIPDIISEHLGAEPTLPYLCP  101

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G KLL+GANFASAGVGILNDTGIQFVNI+++ +QL YF EYQ +L AL+G  +A ++
Sbjct  102   ELHGAKLLVGANFASAGVGILNDTGIQFVNIVRMSRQLHYFREYQAKLRALVGAAQATQV  161

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVLITLGGNDFVNNYYLIPFS RSRQ+ LP+YV  +I+EYKK+L  LY++GARRV+
Sbjct  162   VNRALVLITLGGNDFVNNYYLIPFSLRSRQYALPDYVRLLISEYKKILVNLYEMGARRVL  221

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNTH  385
             VTGTGPLGC PAELA  S DG+C  +L  AA +FNP+L  ++  LN       F+A N  
Sbjct  222   VTGTGPLGCAPAELALRSRDGECDKDLMRAAGLFNPQLSDVLGELNGRYGDGTFIAANAM  281

Query  384   QIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKAN  205
             ++H DFI++P A+GF T++ ACCGQGP+NG+GLCT  S++C NRDEY FWD++HP+E+AN
Sbjct  282   KVHFDFISDPAAYGFRTAKEACCGQGPHNGLGLCTVASNMCANRDEYVFWDSYHPTERAN  341

Query  204   RIIVDQMMNGSNTYMHPMNLSTVLAMDS  121
             RIIV Q M GS  Y+ P+NLSTVL MD+
Sbjct  342   RIIVSQFMTGSLDYVSPLNLSTVLHMDA  369



>gb|AFW64010.1| hypothetical protein ZEAMMB73_688590 [Zea mays]
Length=376

 Score =   476 bits (1226),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 268/329 (81%), Gaps = 2/329 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVDNGNNN+L T ARADSPPYGID P HR TGRFSNG N+PDIISE LG+EP +PYL+P
Sbjct  40    SLVDNGNNNYLLTEARADSPPYGIDTPDHRATGRFSNGKNVPDIISEHLGAEPVLPYLSP  99

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +LDG K+L+GANFASAGVGILNDTGIQF NII I +QL YF +YQ+RLAALIG E A ++
Sbjct  100   ELDGDKMLVGANFASAGVGILNDTGIQFANIIHISKQLRYFEQYQRRLAALIGPEAASRV  159

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             V  ALVLITLGGNDFVNNYYL+P+S RSR+F+LP+YV ++++EY +VL RLYDLGARRV+
Sbjct  160   VRGALVLITLGGNDFVNNYYLVPYSARSREFSLPDYVTYLLSEYAQVLDRLYDLGARRVL  219

Query  564   VTGTGPLGCVPAELAQHSLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCN--AFLAVN  391
             V G GP+GCVPAELA HSLDG C  ELQ AA M+NPRL+ +++ LN         F+ VN
Sbjct  220   VQGVGPIGCVPAELALHSLDGTCDAELQRAAEMYNPRLMALLEELNARHGGGDPVFVGVN  279

Query  390   THQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEK  211
               +IH DFI +PKA+GF T+  ACCGQG +NGMGLCT +S LC +RD Y FWDAFHP+E+
Sbjct  280   MQRIHNDFIDDPKAYGFQTATDACCGQGRFNGMGLCTMVSSLCADRDTYVFWDAFHPTER  339

Query  210   ANRIIVDQMMNGSNTYMHPMNLSTVLAMD  124
             ANR+IV Q M+GS  Y+ PMNLSTVLA+D
Sbjct  340   ANRLIVQQFMSGSTDYITPMNLSTVLAVD  368



>emb|CDY06871.1| BnaC01g09700D [Brassica napus]
Length=361

 Score =   476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 276/330 (84%), Gaps = 2/330 (1%)
 Frame = -3

Query  1104  SLVDNGNNNFLATSARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEKLGSEPTMPYLNP  925
             SLVD+GNNN+L T+ARADSPPYGIDYPT RPTGRFSNGLN+PDIISE++GSEPT+P L+P
Sbjct  32    SLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSNGLNLPDIISEQIGSEPTLPILSP  91

Query  924   QLDGQKLLIGANFASAGVGILNDTGIQFVNIIKIYQQLDYFAEYQQRLAALIGGEKAKKL  745
             +L G+KLLIGANFASAG+GILNDTG+QF+NI++I +Q + F EYQ+R++ +IG +K ++L
Sbjct  92    ELTGKKLLIGANFASAGIGILNDTGVQFLNILRIGRQFELFQEYQERVSEIIGSDKTQQL  151

Query  744   VNDALVLITLGGNDFVNNYYLIPFSPRSRQFTLPNYVDFVIAEYKKVLKRLYDLGARRVM  565
             VN ALVL+TLGGNDFVNNY+L PFS RSRQ +L  +   +I+EYKK+L RLY+LGARRVM
Sbjct  152   VNGALVLMTLGGNDFVNNYFL-PFSARSRQSSLSEFSQLLISEYKKILMRLYELGARRVM  210

Query  564   VTGTGPLGCVPAELAQH-SLDGKCAPELQNAAYMFNPRLVRIIKCLNREIKCNAFLAVNT  388
             VTGTGPLGCVPAELA   S +G+CAPE Q AA +FNP L ++++ LNR++  + F+  N 
Sbjct  211   VTGTGPLGCVPAELASSGSANGECAPEAQQAAAIFNPLLDQMLQGLNRKVGSDVFIGANA  270

Query  387   HQIHMDFITNPKAFGFVTSQVACCGQGPYNGMGLCTPLSHLCTNRDEYAFWDAFHPSEKA  208
               ++ DFI NP+ FGFVTS+VACCGQG YNG G+CTPLS LC +R+ YAFWD FHP+EKA
Sbjct  271   FNMNADFINNPQRFGFVTSKVACCGQGAYNGQGVCTPLSSLCPDRNAYAFWDPFHPTEKA  330

Query  207   NRIIVDQMMNGSNTYMHPMNLSTVLAMDSH  118
              R+IV Q+M GS  YM+PMNLST++A+DS 
Sbjct  331   TRLIVQQIMTGSVEYMNPMNLSTIMALDSR  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3333114759636