BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21577_g2_i1 len=866 path=[1557:0-371 1929:372-407 1965:408-527
2085:528-555 336:556-595 376:596-865]

Length=866
                                                                      Score     E

ref|XP_006464565.1|  PREDICTED: RING-H2 finger protein ATL78-like       231   1e-71   
ref|XP_006427854.1|  hypothetical protein CICLE_v10027222mg             231   2e-71   
ref|XP_006371011.1|  zinc finger family protein                         229   8e-71   
gb|KDP26113.1|  hypothetical protein JCGZ_22214                         229   2e-70   
ref|XP_002298709.2|  zinc finger family protein                         228   5e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011045714.1|  PREDICTED: RING-H2 finger protein ATL78-like       226   2e-69   
ref|XP_011046373.1|  PREDICTED: RING-H2 finger protein ATL78-like       225   5e-69   
ref|XP_007048258.1|  RING zinc finger protein                           223   2e-68   
ref|XP_006351048.1|  PREDICTED: RING-H2 finger protein ATL78-like       223   4e-68   
ref|XP_002522191.1|  RING-H2 finger protein ATL1L, putative             222   7e-68   Ricinus communis
emb|CDP12783.1|  unnamed protein product                                221   2e-67   
ref|XP_010260922.1|  PREDICTED: RING-H2 finger protein ATL78            218   2e-66   
ref|XP_004249865.1|  PREDICTED: RING-H2 finger protein ATL78-like       218   2e-66   
ref|XP_009333999.1|  PREDICTED: RING-H2 finger protein ATL78            218   2e-66   
emb|CAN75293.1|  hypothetical protein VITISV_042413                     218   3e-66   Vitis vinifera
ref|XP_011099792.1|  PREDICTED: RING-H2 finger protein ATL78-like       218   3e-66   
ref|XP_002282494.2|  PREDICTED: RING-H2 finger protein ATL78            218   3e-66   Vitis vinifera
ref|XP_007212035.1|  hypothetical protein PRUPE_ppa011240mg             217   7e-66   
ref|XP_009772408.1|  PREDICTED: RING-H2 finger protein ATL78-like       217   1e-65   
ref|XP_008232929.1|  PREDICTED: RING-H2 finger protein ATL78            216   1e-65   
ref|XP_008391276.1|  PREDICTED: RING-H2 finger protein ATL78            216   3e-65   
ref|XP_007137692.1|  hypothetical protein PHAVU_009G147700g             215   4e-65   
ref|XP_009342079.1|  PREDICTED: RING-H2 finger protein ATL78            215   5e-65   
gb|EYU43498.1|  hypothetical protein MIMGU_mgv1a017986mg                215   6e-65   
ref|XP_009623345.1|  PREDICTED: RING-H2 finger protein ATL78-like       214   8e-65   
gb|KHN29152.1|  RING-H2 finger protein ATL78                            213   2e-64   
ref|XP_010027695.1|  PREDICTED: RING-H2 finger protein ATL78            213   2e-64   
ref|XP_009780401.1|  PREDICTED: RING-H2 finger protein ATL78-like       213   3e-64   
ref|XP_009147913.1|  PREDICTED: RING-H2 finger protein ATL78-like       211   9e-64   
ref|XP_003525110.1|  PREDICTED: RING-H2 finger protein ATL78-like       211   2e-63   
ref|NP_001235294.1|  uncharacterized protein LOC100527126               211   3e-63   
emb|CDX92270.1|  BnaA05g21370D                                          210   3e-63   
ref|XP_009599874.1|  PREDICTED: RING-H2 finger protein ATL78-like       210   4e-63   
ref|XP_002883149.1|  hypothetical protein ARALYDRAFT_479387             209   4e-63   
ref|XP_004502903.1|  PREDICTED: RING-H2 finger protein ATL78-like       209   1e-62   
ref|XP_006578803.1|  PREDICTED: RING-H2 finger protein ATL78-like       209   1e-62   
ref|XP_006406566.1|  hypothetical protein EUTSA_v10021473mg             209   1e-62   
ref|XP_010556018.1|  PREDICTED: RING-H2 finger protein ATL78            208   1e-62   
gb|ACU18824.1|  unknown                                                 208   2e-62   Glycine max [soybeans]
ref|XP_006299842.1|  hypothetical protein CARUB_v10016045mg             207   3e-62   
ref|XP_003526853.1|  PREDICTED: RING-H2 finger protein ATL78-like       207   4e-62   
ref|XP_009145859.1|  PREDICTED: RING-H2 finger protein ATL78-like       207   4e-62   
ref|XP_010465991.1|  PREDICTED: RING-H2 finger protein ATL78-like       207   6e-62   
gb|KHN09585.1|  RING-H2 finger protein ATL78                            207   6e-62   
dbj|BAB01805.1|  unnamed protein product                                206   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159812.1|  hypothetical protein PHAVU_002G269500g             206   1e-61   
ref|XP_007048260.1|  RING zinc finger protein, putative                 206   1e-61   
gb|KHN34052.1|  RING-H2 finger protein ATL78                            205   2e-61   
ref|XP_010507135.1|  PREDICTED: RING-H2 finger protein ATL78-like       206   2e-61   
gb|ACU18212.1|  unknown                                                 206   2e-61   Glycine max [soybeans]
ref|XP_010027694.1|  PREDICTED: RING-H2 finger protein ATL78-like       205   4e-61   
ref|XP_010487800.1|  PREDICTED: RING-H2 finger protein ATL78-like       204   4e-61   
ref|XP_006393284.1|  hypothetical protein EUTSA_v10011772mg             204   6e-61   
ref|XP_006351102.1|  PREDICTED: RING-H2 finger protein ATL78-like       204   7e-61   
emb|CDX99317.1|  BnaC05g34320D                                          203   1e-60   
ref|XP_003602549.1|  Ring-H2 zinc finger protein                        203   2e-60   
ref|XP_004306591.1|  PREDICTED: RING-H2 finger protein ATL78-like       203   2e-60   
gb|KCW54274.1|  hypothetical protein EUGRSUZ_I00237                     202   3e-60   
ref|XP_006305976.1|  hypothetical protein CARUB_v10011239mg             202   4e-60   
ref|XP_009599868.1|  PREDICTED: RING-H2 finger protein ATL78-like       202   4e-60   
ref|XP_009107312.1|  PREDICTED: RING-H2 finger protein ATL78-like       200   1e-59   
gb|KDO53392.1|  hypothetical protein CISIN_1g042990mg                   198   2e-59   
ref|XP_010093096.1|  RING-H2 finger protein ATL78                       200   3e-59   
ref|XP_010680275.1|  PREDICTED: RING-H2 finger protein ATL78-like       200   4e-59   
ref|NP_175349.1|  RING-H2 finger protein ATL78                          199   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461760.1|  PREDICTED: RING-H2 finger protein ATL78            199   7e-59   
ref|XP_010479357.1|  PREDICTED: RING-H2 finger protein ATL78            199   7e-59   
ref|XP_010500464.1|  PREDICTED: RING-H2 finger protein ATL78-like       199   7e-59   
gb|KFK36034.1|  hypothetical protein AALP_AA4G069000                    198   8e-59   
gb|AFK42323.1|  unknown                                                 199   9e-59   
ref|XP_009619519.1|  PREDICTED: RING-H2 finger protein ATL78-like       199   1e-58   
ref|XP_006427853.1|  hypothetical protein CICLE_v10026487mg             197   2e-58   
emb|CDX77259.1|  BnaC08g03040D                                          199   2e-58   
ref|XP_006464564.1|  PREDICTED: RING-H2 finger protein ATL78-like       197   3e-58   
emb|CDY16485.1|  BnaA08g02820D                                          198   3e-58   
ref|XP_009780400.1|  PREDICTED: RING-H2 finger protein ATL78-like       196   4e-58   
ref|XP_004249864.1|  PREDICTED: RING-H2 finger protein ATL78-like       196   4e-58   
ref|XP_010241725.1|  PREDICTED: RING-H2 finger protein ATL78-like       196   8e-58   
emb|CDX95503.1|  BnaC01g33950D                                          196   1e-57   
ref|XP_006351101.1|  PREDICTED: RING-H2 finger protein ATL78-like       194   3e-57   
ref|XP_009599867.1|  PREDICTED: RING-H2 finger protein ATL78-like       195   3e-57   
ref|XP_006351190.1|  PREDICTED: RING-H2 finger protein ATL78-like       193   4e-57   
ref|XP_006351103.1|  PREDICTED: RING-H2 finger protein ATL78-like       194   5e-57   
ref|XP_009619518.1|  PREDICTED: RING-H2 finger protein ATL78-like       194   6e-57   
ref|XP_004250440.1|  PREDICTED: RING-H2 finger protein ATL78-like       193   1e-56   
ref|XP_002298708.2|  hypothetical protein POPTR_0001s31720g             192   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_009112396.1|  PREDICTED: RING-H2 finger protein ATL78-like       192   2e-56   
ref|XP_004250441.1|  PREDICTED: RING-H2 finger protein ATL78-like...    191   5e-56   
ref|XP_003630197.1|  RING finger protein                                191   8e-56   
ref|XP_006351100.1|  PREDICTED: RING-H2 finger protein ATL78-like       191   1e-55   
ref|XP_009772838.1|  PREDICTED: RING-H2 finger protein ATL78-like       190   2e-55   
ref|XP_011045715.1|  PREDICTED: RING-H2 finger protein ATL78-like       189   3e-55   
ref|XP_006427851.1|  hypothetical protein CICLE_v10026409mg             187   2e-54   
ref|XP_009765992.1|  PREDICTED: RING-H2 finger protein ATL78-like       188   2e-54   
gb|AFK36272.1|  unknown                                                 186   2e-54   
ref|XP_007048259.1|  RING/U-box superfamily protein, putative           184   1e-53   
ref|XP_008460910.1|  PREDICTED: RING-H2 finger protein ATL78-like       185   1e-53   
ref|XP_004503972.1|  PREDICTED: RING-H2 finger protein ATL78-like       185   2e-53   
ref|XP_004250442.2|  PREDICTED: RING-H2 finger protein ATL78-like       183   5e-53   
gb|AET04682.2|  RING-H2 finger protein ATL1L                            183   7e-53   
ref|XP_010312460.1|  PREDICTED: RING-H2 finger protein ATL78-like...    182   2e-52   
gb|KDO53396.1|  hypothetical protein CISIN_1g026797mg                   182   2e-52   
ref|XP_004147380.1|  PREDICTED: RING-H2 finger protein ATL78-like       182   2e-52   
ref|XP_003630211.1|  RING-H2 finger protein ATL1L                       181   3e-52   
ref|XP_006464867.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    181   6e-52   
ref|XP_006306489.1|  hypothetical protein CARUB_v10012468mg             180   1e-51   
ref|XP_003630235.1|  RING-H2 finger protein ATL5F                       179   2e-51   
ref|XP_006427850.1|  hypothetical protein CICLE_v10027372mg             179   4e-51   
gb|KDO53397.1|  hypothetical protein CISIN_1g042698mg                   178   4e-51   
ref|XP_010680272.1|  PREDICTED: RING-H2 finger protein ATL78-like       179   9e-51   
gb|KDO53399.1|  hypothetical protein CISIN_1g027813mg                   177   2e-50   
ref|XP_006427848.1|  hypothetical protein CICLE_v10026446mg             176   7e-50   
ref|XP_010680273.1|  PREDICTED: RING-H2 finger protein ATL78-like       176   9e-50   
ref|XP_003630203.1|  Ring finger protein                                175   9e-50   
ref|NP_175348.1|  RING-H2 finger protein ATL10                          176   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306107.1|  hypothetical protein CARUB_v10011539mg             174   3e-49   
ref|XP_006371010.1|  hypothetical protein POPTR_0019s02610g             173   4e-49   
ref|NP_175347.1|  E3 ubiquitin-protein ligase ATL76                     173   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393289.1|  hypothetical protein EUTSA_v10012018mg             173   8e-49   
ref|XP_010500467.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    173   9e-49   
ref|XP_010479358.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    172   2e-48   
ref|XP_002883148.1|  zinc finger family protein                         171   2e-48   
ref|XP_002891482.1|  zinc finger family protein                         171   3e-48   
ref|XP_009147915.1|  PREDICTED: RING-H2 finger protein ATL75            171   3e-48   
emb|CDY48586.1|  BnaCnng16450D                                          171   3e-48   
gb|KEH20889.1|  RING-H2 finger protein ATL1L                            171   4e-48   
ref|XP_010461761.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    171   5e-48   
emb|CDY48856.1|  BnaA06g03260D                                          171   5e-48   
gb|AAF69722.1|AC016041_27  F27J15.3                                     173   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891483.1|  zinc finger family protein                         170   9e-48   
ref|XP_009599873.1|  PREDICTED: RING-H2 finger protein ATL78-like       170   1e-47   
gb|AAF69723.1|AC016041_28  F27J15.2                                     175   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500465.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    169   2e-47   
emb|CDY48082.1|  BnaC06g02460D                                          169   3e-47   
ref|XP_010912405.1|  PREDICTED: RING-H2 finger protein ATL78-like       169   3e-47   
emb|CDY18543.1|  BnaA01g26520D                                          168   3e-47   
ref|XP_010500468.1|  PREDICTED: RING-H2 finger protein ATL75-like       169   4e-47   
ref|XP_009147916.1|  PREDICTED: RING-H2 finger protein ATL75-like       168   5e-47   
ref|XP_010461763.1|  PREDICTED: RING-H2 finger protein ATL75            168   5e-47   
ref|XP_010461762.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76       168   5e-47   
emb|CDY16483.1|  BnaA08g02840D                                          167   8e-47   
emb|CDY48857.1|  BnaA06g03250D                                          168   8e-47   
ref|XP_009112407.1|  PREDICTED: RING-H2 finger protein ATL77-like       167   9e-47   
emb|CDY64958.1|  BnaAnng19830D                                          167   1e-46   
ref|XP_011046374.1|  PREDICTED: RING-H2 finger protein ATL78-like       167   1e-46   
ref|XP_008441014.1|  PREDICTED: RING-H2 finger protein ATL78-like       167   1e-46   
ref|XP_006393294.1|  hypothetical protein EUTSA_v10011764mg             167   2e-46   
ref|XP_010479360.1|  PREDICTED: RING-H2 finger protein ATL75-like       167   2e-46   
ref|XP_004148642.1|  PREDICTED: RING-H2 finger protein ATL78-like       166   2e-46   
gb|KFK30303.1|  hypothetical protein AALP_AA7G244200                    166   2e-46   
ref|NP_175346.1|  RING-H2 finger protein ATL75                          166   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850610.1|  RING-H2 finger protein ATL77                          166   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479359.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    166   3e-46   
ref|XP_010680274.1|  PREDICTED: RING-H2 finger protein ATL78-like       167   3e-46   
ref|XP_009107315.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    166   4e-46   
ref|XP_003630209.1|  Ring finger protein                                171   5e-46   
emb|CDX92269.1|  BnaA05g21380D                                          165   5e-46   
ref|XP_006427847.1|  hypothetical protein CICLE_v10026452mg             165   6e-46   
ref|XP_006303349.1|  hypothetical protein CARUB_v10010227mg             165   8e-46   
ref|XP_006427846.1|  hypothetical protein CICLE_v10027045mg             164   1e-45   
gb|KFK36035.1|  hypothetical protein AALP_AA4G069500                    165   1e-45   
ref|XP_009145860.1|  PREDICTED: RING-H2 finger protein ATL77            164   1e-45   
gb|KDO39742.1|  hypothetical protein CISIN_1g035743mg                   164   1e-45   
ref|XP_006406567.1|  hypothetical protein EUTSA_v10021951mg             164   1e-45   
ref|XP_010680271.1|  PREDICTED: RING-H2 finger protein ATL78-like       165   1e-45   
ref|XP_010556017.1|  PREDICTED: RING-H2 finger protein ATL75-like       164   1e-45   
ref|XP_002891481.1|  zinc finger family protein                         164   2e-45   
emb|CDY61981.1|  BnaC03g73800D                                          164   2e-45   
emb|CDX95504.1|  BnaC01g33960D                                          163   3e-45   
ref|XP_003630207.1|  RING finger protein                                163   4e-45   
emb|CDX99318.1|  BnaC05g34330D                                          162   5e-45   
ref|XP_006393288.1|  hypothetical protein EUTSA_v10011758mg             163   5e-45   
emb|CDX82327.1|  BnaA03g34940D                                          162   7e-45   
ref|XP_009135597.1|  PREDICTED: RING-H2 finger protein ATL77-like       162   8e-45   
gb|AAL33552.1|AF436851_1  RING-H2 zinc finger protein                   158   6e-44   Cucumis melo [Oriental melon]
ref|XP_006652278.1|  PREDICTED: RING-H2 finger protein ATL78-like       158   2e-43   
gb|AFK33954.1|  unknown                                                 159   2e-43   
ref|XP_010507128.1|  PREDICTED: RING-H2 finger protein ATL77-like       157   6e-43   
ref|XP_008784248.1|  PREDICTED: RING-H2 finger protein ATL78-like       157   1e-42   
ref|XP_009107314.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    157   1e-42   
ref|XP_010931361.1|  PREDICTED: RING-H2 finger protein ATL74-like       155   1e-42   
ref|XP_006854529.1|  hypothetical protein AMTR_s00030p00032810          155   2e-42   
ref|XP_010930995.1|  PREDICTED: RING-H2 finger protein ATL72-like       156   2e-42   
ref|XP_006299288.1|  hypothetical protein CARUB_v10015442mg             155   2e-42   
ref|XP_010487798.1|  PREDICTED: RING-H2 finger protein ATL77-like       156   2e-42   
ref|XP_010489924.1|  PREDICTED: RING-H2 finger protein ATL77-like       156   3e-42   
ref|XP_010465990.1|  PREDICTED: RING-H2 finger protein ATL77-like       155   3e-42   
ref|XP_008456776.1|  PREDICTED: RING-H2 finger protein ATL74            155   4e-42   
ref|XP_008663190.1|  PREDICTED: RING-H2 finger protein ATL73-like...    154   5e-42   
ref|XP_008663188.1|  PREDICTED: RING-H2 finger protein ATL73-like...    154   6e-42   
ref|XP_010239893.1|  PREDICTED: RING-H2 finger protein ATL78-like       152   3e-41   
ref|XP_008792228.1|  PREDICTED: RING-H2 finger protein ATL74-like       152   3e-41   
ref|XP_010911967.1|  PREDICTED: RING-H2 finger protein ATL78            152   5e-41   
ref|NP_001052775.2|  Os04g0419500                                       152   6e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975603.1|  PREDICTED: RING-H2 finger protein ATL78-like       151   8e-41   
gb|ABK25761.1|  unknown                                                 152   9e-41   Picea sitchensis
emb|CDY16484.1|  BnaA08g02830D                                          151   1e-40   
ref|XP_010922739.1|  PREDICTED: RING-H2 finger protein ATL74-like       150   1e-40   
ref|XP_009414837.1|  PREDICTED: RING-H2 finger protein ATL78-like       151   1e-40   
gb|KGN45834.1|  hypothetical protein Csa_6G014550                       150   2e-40   
ref|XP_010103646.1|  RING-H2 finger protein ATL73                       151   2e-40   
gb|EEE60987.1|  hypothetical protein OsJ_14782                          151   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007218405.1|  hypothetical protein PRUPE_ppa011446mg             150   3e-40   
ref|XP_002319337.2|  hypothetical protein POPTR_0013s09370g             150   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_002446457.1|  hypothetical protein SORBIDRAFT_06g016320          151   3e-40   Sorghum bicolor [broomcorn]
gb|AET04685.2|  RING-H2 finger protein ATL1L                            149   2e-39   
ref|XP_008809453.1|  PREDICTED: RING-H2 finger protein ATL74-like...    147   2e-39   
gb|ABK22591.1|  unknown                                                 147   2e-39   Picea sitchensis
dbj|BAK06500.1|  predicted protein                                      148   2e-39   
ref|XP_002325483.2|  hypothetical protein POPTR_0019s08600g             147   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010658180.1|  PREDICTED: RING-H2 finger protein ATL74            147   5e-39   
ref|XP_002520866.1|  RING-H2 finger protein ATL3C, putative             147   5e-39   Ricinus communis
ref|XP_010036001.1|  PREDICTED: RING-H2 finger protein ATL74            146   5e-39   
ref|XP_004302621.1|  PREDICTED: RING-H2 finger protein ATL72-like       147   5e-39   
ref|XP_008233881.1|  PREDICTED: RING-H2 finger protein ATL74-like       147   6e-39   
ref|XP_002531843.1|  ring finger protein, putative                      146   6e-39   Ricinus communis
emb|CAE02923.1|  OSJNBb0108J11.16                                       152   7e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952687.1|  PREDICTED: RING-H2 finger protein ATL78-like...    147   8e-39   
ref|XP_008809452.1|  PREDICTED: RING-H2 finger protein ATL74-like...    146   9e-39   
ref|XP_011001401.1|  PREDICTED: RING-H2 finger protein ATL74            145   9e-39   
ref|XP_008785904.1|  PREDICTED: RING-H2 finger protein ATL72-like       145   2e-38   
gb|KHG05103.1|  RING-H2 finger ATL74 -like protein                      145   2e-38   
emb|CDP13909.1|  unnamed protein product                                144   3e-38   
ref|XP_008244900.1|  PREDICTED: RING-H2 finger protein ATL74-like       144   5e-38   
ref|XP_002271473.1|  PREDICTED: RING-H2 finger protein ATL74            144   6e-38   Vitis vinifera
gb|KCW50353.1|  hypothetical protein EUGRSUZ_J00118                     144   6e-38   
ref|XP_010031086.1|  PREDICTED: RING-H2 finger protein ATL72 isof...    144   7e-38   
ref|XP_010031085.1|  PREDICTED: RING-H2 finger protein ATL72 isof...    144   7e-38   
ref|XP_006429572.1|  hypothetical protein CICLE_v10013579mg             143   8e-38   
ref|XP_003552318.1|  PREDICTED: RING-H2 finger protein ATL74-like       142   9e-38   
ref|XP_007033540.1|  RING/U-box superfamily protein isoform 2           143   9e-38   
gb|KDO64081.1|  hypothetical protein CISIN_1g043554mg                   142   1e-37   
ref|XP_006481185.1|  PREDICTED: RING-H2 finger protein ATL74-like       142   1e-37   
ref|XP_002323073.2|  zinc finger family protein                         142   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009395164.1|  PREDICTED: RING-H2 finger protein ATL74-like       142   1e-37   
ref|XP_007011313.1|  RING/U-box superfamily protein                     144   2e-37   
gb|KDP21873.1|  hypothetical protein JCGZ_00660                         142   2e-37   
ref|XP_010252063.1|  PREDICTED: RING-H2 finger protein ATL74            142   2e-37   
ref|XP_009147914.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    143   2e-37   
ref|XP_007140087.1|  hypothetical protein PHAVU_008G083200g             141   2e-37   
ref|XP_008645765.1|  PREDICTED: RING-H2 finger protein ATL72-like       143   3e-37   
gb|KDP21651.1|  hypothetical protein JCGZ_03322                         142   3e-37   
gb|KDO42949.1|  hypothetical protein CISIN_1g029206mg                   141   4e-37   
ref|XP_009622929.1|  PREDICTED: RING-H2 finger protein ATL74-like       141   5e-37   
ref|XP_009411192.1|  PREDICTED: RING-H2 finger protein ATL73            142   5e-37   
ref|XP_002266740.1|  PREDICTED: RING-H2 finger protein ATL74            140   6e-37   Vitis vinifera
ref|XP_007033539.1|  RING/U-box superfamily protein isoform 1           143   6e-37   
ref|XP_010680476.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...    139   7e-37   
ref|XP_009346909.1|  PREDICTED: RING-H2 finger protein ATL74-like       141   7e-37   
ref|XP_011002606.1|  PREDICTED: RING-H2 finger protein ATL74            140   8e-37   
ref|XP_006842471.1|  hypothetical protein AMTR_s00077p00074350          140   9e-37   
emb|CAN65088.1|  hypothetical protein VITISV_035033                     141   1e-36   Vitis vinifera
ref|XP_010109653.1|  RING-H2 finger protein ATL72                       141   1e-36   
emb|CDY48083.1|  BnaC06g02470D                                          140   1e-36   
ref|XP_006435916.1|  hypothetical protein CICLE_v10032803mg             140   2e-36   
gb|EEE57147.1|  hypothetical protein OsJ_07055                          140   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308979.1|  PREDICTED: RING-H2 finger protein ATL72-like       140   2e-36   
dbj|BAD28071.1|  putative RING-H2 zinc finger protein                   140   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011013335.1|  PREDICTED: RING-H2 finger protein ATL74-like       140   2e-36   
ref|XP_003533659.1|  PREDICTED: RING-H2 finger protein ATL74-like       139   2e-36   
ref|XP_003528016.1|  PREDICTED: RING-H2 finger protein ATL72-like       139   3e-36   
ref|XP_008370258.1|  PREDICTED: RING-H2 finger protein ATL74            139   3e-36   
ref|XP_008781397.1|  PREDICTED: RING-H2 finger protein ATL78-like       139   5e-36   
emb|CDX70162.1|  BnaA10g25110D                                          137   8e-36   
ref|XP_008388346.1|  PREDICTED: RING-H2 finger protein ATL74-like       138   9e-36   
ref|XP_009372015.1|  PREDICTED: RING-H2 finger protein ATL74-like       138   9e-36   
ref|XP_009122137.1|  PREDICTED: RING-H2 finger protein ATL73            137   1e-35   
ref|XP_008366804.1|  PREDICTED: RING-H2 finger protein ATL74-like       137   2e-35   
ref|XP_006358749.1|  PREDICTED: RING-H2 finger protein ATL72-like       137   2e-35   
ref|XP_009774817.1|  PREDICTED: RING-H2 finger protein ATL74-like       136   3e-35   
ref|XP_009349074.1|  PREDICTED: RING-H2 finger protein ATL74-like       137   4e-35   
ref|XP_009628109.1|  PREDICTED: RING-H2 finger protein ATL74-like       135   5e-35   
ref|XP_010253089.1|  PREDICTED: RING-H2 finger protein ATL74-like       136   5e-35   
ref|XP_010423485.1|  PREDICTED: RING-H2 finger protein ATL73            135   7e-35   
ref|XP_010452430.1|  PREDICTED: RING-H2 finger protein ATL73-like       135   7e-35   
ref|XP_004240864.1|  PREDICTED: RING-H2 finger protein ATL74-like...    135   9e-35   
ref|XP_009789233.1|  PREDICTED: RING-H2 finger protein ATL74-like       135   1e-34   
ref|XP_010322127.1|  PREDICTED: RING-H2 finger protein ATL74-like...    135   1e-34   
ref|XP_009416899.1|  PREDICTED: RING-H2 finger protein ATL78-like       135   1e-34   
ref|XP_008369369.1|  PREDICTED: RING-H2 finger protein ATL74-like       135   1e-34   
ref|XP_010491062.1|  PREDICTED: RING-H2 finger protein ATL73-like       134   1e-34   
ref|XP_010235509.1|  PREDICTED: RING-H2 finger protein ATL74-like       136   1e-34   
ref|XP_003623617.1|  RING-H2 finger protein ATL5H                       134   2e-34   
ref|XP_006289653.1|  hypothetical protein CARUB_v10003211mg             134   2e-34   
ref|XP_004492554.1|  PREDICTED: RING-H2 finger protein ATL74-like       134   2e-34   
ref|XP_009363798.1|  PREDICTED: RING-H2 finger protein ATL74-like       134   3e-34   
ref|XP_002452232.1|  hypothetical protein SORBIDRAFT_04g022150          135   3e-34   
ref|XP_010690791.1|  PREDICTED: RING-H2 finger protein ATL74-like       134   3e-34   
ref|NP_196147.1|  defective in anther dehiscence1-activating factor     133   5e-34   
ref|XP_010543917.1|  PREDICTED: RING-H2 finger protein ATL73            133   5e-34   
ref|XP_002873203.1|  zinc finger family protein                         132   5e-34   
emb|CDP04045.1|  unnamed protein product                                132   8e-34   
gb|KDP39976.1|  hypothetical protein JCGZ_03507                         132   9e-34   
ref|XP_007017083.1|  RING/U-box superfamily protein, putative           132   1e-33   
gb|EYU20094.1|  hypothetical protein MIMGU_mgv1a014454mg                131   3e-33   
ref|XP_009757302.1|  PREDICTED: RING-H2 finger protein ATL74-like       130   3e-33   
gb|KEH35547.1|  RING-H2 zinc finger protein                             130   4e-33   
gb|KDP39984.1|  hypothetical protein JCGZ_03515                         130   5e-33   
ref|XP_010490473.1|  PREDICTED: RING-H2 finger protein ATL72            129   7e-33   
ref|XP_011089528.1|  PREDICTED: RING-H2 finger protein ATL73-like       129   8e-33   
ref|NP_187702.1|  RING-H2 finger protein ATL72                          129   1e-32   
dbj|BAJ94010.1|  predicted protein                                      129   1e-32   
gb|EAY82042.1|  hypothetical protein OsI_37229                          128   2e-32   
ref|XP_010486714.1|  PREDICTED: RING-H2 finger protein ATL72-like       129   2e-32   
ref|XP_006296655.1|  hypothetical protein CARUB_v10015761mg             127   7e-32   
gb|ABA96288.1|  Zinc finger, C3HC4 type family protein, expressed       127   7e-32   
ref|XP_009779324.1|  PREDICTED: RING-H2 finger protein ATL78-like       128   1e-31   
ref|XP_011031848.1|  PREDICTED: RING-H2 finger protein ATL74-like       127   2e-31   
ref|XP_010686796.1|  PREDICTED: RING-H2 finger protein ATL80            125   3e-31   
ref|XP_002884820.1|  zinc finger family protein                         125   4e-31   
gb|EAY79719.1|  hypothetical protein OsI_34871                          124   6e-31   
ref|XP_009122550.1|  PREDICTED: RING-H2 finger protein ATL72            124   7e-31   
ref|XP_011076816.1|  PREDICTED: RING-H2 finger protein ATL74-like       124   7e-31   
ref|XP_006407493.1|  hypothetical protein EUTSA_v10021678mg             124   9e-31   
ref|XP_011100182.1|  PREDICTED: RING-H2 finger protein ATL80-like       124   1e-30   
emb|CDY36281.1|  BnaA01g31370D                                          124   1e-30   
gb|KFK24948.1|  hypothetical protein AALP_AA8G046900                    124   1e-30   
ref|XP_011074071.1|  PREDICTED: RING-H2 finger protein ATL80-like       123   2e-30   
ref|XP_002319423.2|  hypothetical protein POPTR_0013s15290g             122   2e-30   
gb|EYU23603.1|  hypothetical protein MIMGU_mgv1a014346mg                123   3e-30   
ref|XP_002304266.1|  hypothetical protein POPTR_0003s07270g             122   3e-30   
ref|XP_009384764.1|  PREDICTED: RING-H2 finger protein ATL72-like       122   3e-30   
ref|XP_009397078.1|  PREDICTED: RING-H2 finger protein ATL74-like       122   3e-30   
ref|XP_006369042.1|  hypothetical protein POPTR_0001s15930g             122   4e-30   
ref|NP_177767.1|  RING-H2 finger protein ATL8                           122   6e-30   
gb|AAM63811.1|  putative RING zinc finger protein                       122   7e-30   
gb|AFK42834.1|  unknown                                                 119   1e-29   
ref|XP_011021043.1|  PREDICTED: RING-H2 finger protein ATL74-like       121   1e-29   
ref|XP_011034822.1|  PREDICTED: RING-H2 finger protein ATL8-like        121   2e-29   
ref|XP_002510714.1|  protein with unknown function                      121   2e-29   
ref|XP_009405326.1|  PREDICTED: RING-H2 finger protein ATL78-like       121   2e-29   
ref|XP_009415472.1|  PREDICTED: RING-H2 finger protein ATL74-like       120   3e-29   
ref|XP_002301903.1|  zinc finger family protein                         120   3e-29   
emb|CDY31495.1|  BnaC05g16040D                                          120   4e-29   
gb|KDP36758.1|  hypothetical protein JCGZ_08049                         120   5e-29   
gb|KFK38478.1|  hypothetical protein AALP_AA3G118200                    119   5e-29   
ref|XP_011035481.1|  PREDICTED: RING-H2 finger protein ATL74-like       120   6e-29   
emb|CDY70578.1|  BnaCnng68910D                                          117   7e-29   
ref|XP_010537218.1|  PREDICTED: RING-H2 finger protein ATL80-like       119   7e-29   
ref|XP_008242103.1|  PREDICTED: RING-H2 finger protein ATL8             120   8e-29   
ref|XP_002887637.1|  hypothetical protein ARALYDRAFT_316562             119   8e-29   
emb|CDX87603.1|  BnaA07g32700D                                          119   8e-29   
ref|XP_002326072.2|  hypothetical protein POPTR_0019s15050g             119   9e-29   
emb|CDY33648.1|  BnaC08g19480D                                          119   9e-29   
ref|XP_002274304.2|  PREDICTED: RING-H2 finger protein ATL8             120   1e-28   
emb|CDX85948.1|  BnaC06g21860D                                          119   1e-28   
gb|EPS68943.1|  hypothetical protein M569_05824                         119   1e-28   
ref|XP_006416360.1|  hypothetical protein EUTSA_v10009964mg             119   1e-28   
gb|EYU35209.1|  hypothetical protein MIMGU_mgv1a017957mg                119   1e-28   
ref|XP_007202550.1|  hypothetical protein PRUPE_ppa011201mg             119   2e-28   
ref|XP_010428701.1|  PREDICTED: RING-H2 finger protein ATL8-like        118   2e-28   
ref|XP_009104676.1|  PREDICTED: RING-H2 finger protein ATL8-like        118   2e-28   
ref|XP_007018117.1|  RING/U-box superfamily protein, putative           118   2e-28   
ref|XP_010471794.1|  PREDICTED: RING-H2 finger protein ATL8-like        118   2e-28   
emb|CDY45988.1|  BnaA02g18080D                                          118   3e-28   
emb|CAN59779.1|  hypothetical protein VITISV_024654                     120   3e-28   
ref|XP_010416561.1|  PREDICTED: RING-H2 finger protein ATL8             117   3e-28   
ref|XP_011084821.1|  PREDICTED: RING-H2 finger protein ATL73-like       117   3e-28   
ref|XP_006390200.1|  hypothetical protein EUTSA_v10019183mg             118   3e-28   
ref|XP_010097125.1|  RING-H2 finger protein ATL73                       117   3e-28   
emb|CDX68098.1|  BnaA07g21380D                                          117   3e-28   
ref|XP_006302871.1|  hypothetical protein CARUB_v10021002mg             117   4e-28   
emb|CDY29504.1|  BnaA06g14660D                                          117   4e-28   
ref|XP_009360247.1|  PREDICTED: RING-H2 finger protein ATL79-like       118   5e-28   
ref|XP_004238452.1|  PREDICTED: RING-H2 finger protein ATL80-like       117   5e-28   
ref|XP_009128176.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    117   5e-28   
ref|XP_009149561.1|  PREDICTED: RING-H2 finger protein ATL80            117   5e-28   
ref|XP_011041176.1|  PREDICTED: RING-H2 finger protein ATL8             117   5e-28   
emb|CDX88272.1|  BnaC06g37160D                                          117   6e-28   
ref|XP_009604464.1|  PREDICTED: RING-H2 finger protein ATL80-like       117   7e-28   
ref|XP_009110211.1|  PREDICTED: RING-H2 finger protein ATL80            117   8e-28   
emb|CDX96619.1|  BnaA08g21620D                                          117   8e-28   
ref|XP_008346994.1|  PREDICTED: RING-H2 finger protein ATL79-like       117   9e-28   
ref|XP_009103326.1|  PREDICTED: RING-H2 finger protein ATL80-like       116   9e-28   
gb|ABK56013.1|  zinc finger protein                                     116   1e-27   
ref|XP_010237950.1|  PREDICTED: RING-H2 finger protein ATL74-like       117   1e-27   
ref|XP_009106302.1|  PREDICTED: RING-H2 finger protein ATL8             116   1e-27   
ref|XP_006303328.1|  hypothetical protein CARUB_v10010177mg             117   1e-27   
ref|XP_007041029.1|  RING/U-box superfamily protein                     117   1e-27   
ref|XP_011041786.1|  PREDICTED: RING-H2 finger protein ATL74-like       116   1e-27   
ref|XP_009413072.1|  PREDICTED: RING-H2 finger protein ATL80-like       116   1e-27   
ref|XP_006342165.1|  PREDICTED: RING-H2 finger protein ATL80-like       115   2e-27   
ref|XP_007135973.1|  hypothetical protein PHAVU_009G007400g             115   2e-27   
ref|XP_008662433.1|  PREDICTED: RING-H2 finger protein ATL74-like       116   2e-27   
ref|XP_010477335.1|  PREDICTED: RING-H2 finger protein ATL80            116   2e-27   
ref|XP_008453009.1|  PREDICTED: RING-H2 finger protein ATL80            115   2e-27   
gb|KHN20089.1|  RING-H2 finger protein ATL80                            114   2e-27   
ref|XP_010534292.1|  PREDICTED: RING-H2 finger protein ATL80-like       115   2e-27   
ref|NP_001241583.1|  uncharacterized protein LOC100794614               115   3e-27   
ref|XP_009766634.1|  PREDICTED: RING-H2 finger protein ATL8-like        115   3e-27   
ref|NP_195808.1|  RING-H2 finger protein ATL74                          114   3e-27   
ref|XP_002306993.2|  hypothetical protein POPTR_0005s27660g             115   3e-27   
ref|XP_008779008.1|  PREDICTED: RING-H2 finger protein ATL8-like        115   3e-27   
ref|XP_002276539.1|  PREDICTED: RING-H2 finger protein ATL80            115   3e-27   
ref|XP_003527275.1|  PREDICTED: RING-H2 finger protein ATL80-like       115   3e-27   
ref|XP_006435418.1|  hypothetical protein CICLE_v10004041mg             115   4e-27   
ref|XP_010462813.1|  PREDICTED: RING-H2 finger protein ATL80-like       115   4e-27   
emb|CDY01352.1|  BnaA07g11250D                                          115   4e-27   
ref|NP_173506.1|  RING-H2 finger protein ATL80                          115   4e-27   
ref|XP_009775127.1|  PREDICTED: RING-H2 finger protein ATL80-like       114   4e-27   
ref|XP_002442772.1|  hypothetical protein SORBIDRAFT_08g002630          115   5e-27   
ref|XP_010467517.1|  PREDICTED: RING-H2 finger protein ATL44-like       114   5e-27   
gb|ADI71977.1|  E3 ubiquitin ligase                                     114   5e-27   
ref|XP_004145558.1|  PREDICTED: RING-H2 finger protein ATL80-like       114   6e-27   
ref|XP_010266252.1|  PREDICTED: RING-H2 finger protein ATL80            114   6e-27   
ref|XP_010094527.1|  RING-H2 finger protein ATL80                       114   9e-27   
ref|XP_010498523.1|  PREDICTED: RING-H2 finger protein ATL80-like       114   1e-26   
ref|XP_003547414.1|  PREDICTED: RING-H2 finger protein ATL73-like       113   1e-26   
gb|KDP43788.1|  hypothetical protein JCGZ_22415                         114   1e-26   
ref|XP_009795598.1|  PREDICTED: RING-H2 finger protein ATL80-like       113   1e-26   
ref|XP_009620555.1|  PREDICTED: RING-H2 finger protein ATL80-like       113   2e-26   
ref|XP_003612411.1|  Ring finger protein                                114   2e-26   
ref|XP_009595867.1|  PREDICTED: RING-H2 finger protein ATL80            113   2e-26   
ref|XP_009395296.1|  PREDICTED: RING-H2 finger protein ATL8-like        112   2e-26   
ref|XP_002890411.1|  zinc finger family protein                         113   2e-26   
ref|XP_004232585.1|  PREDICTED: RING-H2 finger protein ATL8-like        112   2e-26   
ref|XP_004512286.1|  PREDICTED: RING-H2 finger protein ATL8-like        113   2e-26   
gb|EPS67603.1|  hypothetical protein M569_07172                         112   3e-26   
ref|XP_010029567.1|  PREDICTED: RING-H2 finger protein ATL8-like        112   3e-26   
ref|XP_002528684.1|  RING-H2 finger protein ATL5A, putative             112   3e-26   
emb|CDP01769.1|  unnamed protein product                                113   3e-26   
ref|XP_006398571.1|  hypothetical protein EUTSA_v10014876mg             111   3e-26   
ref|XP_003537694.1|  PREDICTED: RING-H2 finger protein ATL8-like        113   4e-26   
ref|XP_006298646.1|  hypothetical protein CARUB_v10014735mg             112   4e-26   
ref|XP_002437418.1|  hypothetical protein SORBIDRAFT_10g026650          111   5e-26   
ref|XP_002465936.1|  hypothetical protein SORBIDRAFT_01g048530          112   5e-26   
gb|KFK42061.1|  hypothetical protein AALP_AA2G206300                    111   7e-26   
ref|NP_001168249.1|  uncharacterized LOC100382012                       111   7e-26   
ref|XP_010935347.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...    111   8e-26   
ref|XP_002307200.1|  hypothetical protein POPTR_0005s10190g             111   8e-26   
ref|XP_010515011.1|  PREDICTED: RING-H2 finger protein ATL44            111   9e-26   
gb|KDO77278.1|  hypothetical protein CISIN_1g038049mg                   109   9e-26   
ref|XP_004502830.1|  PREDICTED: RING-H2 finger protein ATL72-like       110   1e-25   
ref|XP_003603861.1|  RING-H2 finger protein ATL1B                       111   1e-25   
ref|XP_011022135.1|  PREDICTED: RING-H2 finger protein ATL8-like        111   1e-25   
ref|XP_003533404.1|  PREDICTED: RING-H2 finger protein ATL80-like       111   1e-25   
ref|XP_008812592.1|  PREDICTED: RING-H2 finger protein ATL80-like       110   1e-25   
ref|NP_179337.1|  RING-H2 finger protein ATL44                          110   1e-25   
ref|XP_009125390.1|  PREDICTED: RING-H2 finger protein ATL74            109   1e-25   
gb|KFK44194.1|  hypothetical protein AALP_AA1G226700                    111   1e-25   
ref|XP_009359625.1|  PREDICTED: RING-H2 finger protein ATL80-like...    111   1e-25   
ref|XP_008392292.1|  PREDICTED: RING-H2 finger protein ATL80-like       111   1e-25   
ref|XP_006468543.1|  PREDICTED: RING-H2 finger protein ATL73-like       110   1e-25   
ref|XP_010908037.1|  PREDICTED: RING-H2 finger protein ATL8-like        110   2e-25   
ref|XP_010489373.1|  PREDICTED: RING-H2 finger protein ATL44-like       110   2e-25   
ref|XP_009359623.1|  PREDICTED: RING-H2 finger protein ATL80-like...    111   2e-25   
ref|XP_009772726.1|  PREDICTED: RING-H2 finger protein ATL80-like       110   2e-25   
ref|XP_007046460.1|  Basic helix-loop-helix DNA-binding superfami...    110   2e-25   
gb|KDO85202.1|  hypothetical protein CISIN_1g043163mg                   109   2e-25   
ref|XP_009373686.1|  PREDICTED: RING-H2 finger protein ATL79-like       110   2e-25   
ref|XP_009338623.1|  PREDICTED: RING-H2 finger protein ATL80-like       110   2e-25   
ref|XP_003629097.1|  Ring finger protein                                110   2e-25   
gb|KHN47727.1|  RING-H2 finger protein ATL73                            108   2e-25   
ref|XP_009350355.1|  PREDICTED: RING-H2 finger protein ATL79-like       110   3e-25   
ref|XP_008379650.1|  PREDICTED: RING-H2 finger protein ATL80-like       110   3e-25   
ref|XP_006279330.1|  hypothetical protein CARUB_v10012731mg             108   3e-25   
ref|XP_010670603.1|  PREDICTED: RING-H2 finger protein ATL73            110   3e-25   
gb|KDP30161.1|  hypothetical protein JCGZ_18194                         109   4e-25   
emb|CAN67111.1|  hypothetical protein VITISV_025310                     108   4e-25   
ref|XP_008463261.1|  PREDICTED: RING-H2 finger protein ATL74            108   5e-25   
ref|XP_007039274.1|  RING-H2 finger protein ATL79, putative             110   5e-25   
ref|XP_008804625.1|  PREDICTED: RING-H2 finger protein ATL8             108   5e-25   
ref|XP_007156261.1|  hypothetical protein PHAVU_003G271400g             109   5e-25   
ref|XP_007137636.1|  hypothetical protein PHAVU_009G143000g             108   6e-25   
ref|XP_006448631.1|  hypothetical protein CICLE_v10016941mg             108   6e-25   
ref|XP_007138847.1|  hypothetical protein PHAVU_009G242500g             108   6e-25   
ref|XP_007212135.1|  hypothetical protein PRUPE_ppa012179mg             108   6e-25   
ref|XP_003517122.1|  PREDICTED: RING-H2 finger protein ATL8-like        109   7e-25   
ref|XP_002886113.1|  ring-H2 finger A3A                                 108   7e-25   
ref|XP_006366657.1|  PREDICTED: RING-H2 finger protein ATL80-like       108   8e-25   
ref|XP_002872987.1|  zinc finger family protein                         107   8e-25   
ref|XP_009150790.1|  PREDICTED: RING-H2 finger protein ATL44-like       108   8e-25   
ref|XP_004509462.1|  PREDICTED: RING-H2 finger protein ATL80-like       109   8e-25   
ref|XP_002532473.1|  protein with unknown function                      108   8e-25   
gb|AES65135.2|  anaphase-promoting complex subunit 11 RING-H2 fin...    107   8e-25   
gb|KEH31413.1|  RING-H2 zinc finger protein                             107   9e-25   
ref|XP_008373388.1|  PREDICTED: RING-H2 finger protein ATL8             108   1e-24   
ref|XP_007158027.1|  hypothetical protein PHAVU_002G118000g             108   1e-24   
ref|XP_010914250.1|  PREDICTED: RING-H2 finger protein ATL74-like       108   1e-24   
ref|XP_003594884.1|  RING-H2 finger protein ATL2A                       108   1e-24   
gb|AFW90598.1|  E3 ubiquitin ligase                                     107   1e-24   
ref|NP_001174945.1|  Os06g0666500                                       107   1e-24   
gb|EAZ37937.1|  hypothetical protein OsJ_22287                          107   2e-24   
emb|CDY24337.1|  BnaA07g02620D                                          107   2e-24   
ref|XP_004487913.1|  PREDICTED: RING-H2 finger protein ATL73-like       107   2e-24   
ref|XP_009353998.1|  PREDICTED: RING-H2 finger protein ATL74-like       107   2e-24   
ref|XP_009383554.1|  PREDICTED: RING-H2 finger protein ATL45-like       107   2e-24   
ref|XP_009400319.1|  PREDICTED: RING-H2 finger protein ATL8-like        106   2e-24   
ref|XP_003572834.1|  PREDICTED: RING-H2 finger protein ATL80-like       107   2e-24   
ref|XP_002275910.3|  PREDICTED: RING-H2 finger protein ATL73            108   2e-24   
ref|XP_008225891.1|  PREDICTED: RING-H2 finger protein ATL74-like       107   2e-24   
ref|XP_009372616.1|  PREDICTED: RING-H2 finger protein ATL80            106   2e-24   
ref|XP_010490498.1|  PREDICTED: RING-H2 finger protein ATL74-like       106   3e-24   
ref|XP_004287710.1|  PREDICTED: RING-H2 finger protein ATL80-like       107   3e-24   
ref|XP_004504651.1|  PREDICTED: RING-H2 finger protein ATL73-like       105   3e-24   
emb|CDY69366.1|  BnaAnng30200D                                          107   3e-24   
emb|CDY49431.1|  BnaC07g06500D                                          107   3e-24   
gb|EMT03646.1|  RING-H2 finger protein ATL5B                            106   4e-24   
ref|XP_002526834.1|  protein with unknown function                      107   4e-24   
ref|XP_009797582.1|  PREDICTED: RING-H2 finger protein ATL73-like       105   4e-24   



>ref|XP_006464565.1| PREDICTED: RING-H2 finger protein ATL78-like [Citrus sinensis]
Length=219

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 154/217 (71%), Gaps = 15/217 (7%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPA-NSSFDTVAA-SSTTTFDANVVMVLSVLLCALICSLGVNS  267
            QDFL  F SR+ LL+AP P    S D     +   TFDANVVMVLSVLLCALICSLG+NS
Sbjct  13   QDFLGEFYSRRSLLTAPPPVPGKSHDPAEVYTGNNTFDANVVMVLSVLLCALICSLGLNS  72

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            II+C +RCSS+ A R+ A+  ++           N GIK+KALKTFPV+SY+A+  + GL
Sbjct  73   IIRCVVRCSSLVASRSGASNSAAILP--------NKGIKQKALKTFPVVSYSAELNLAGL  124

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCt  627
            DT+C ICLSEFAAGDR+RLLPKCNHGFHVRCIDKWLSSHSSCP CRHCLI+TCQKI+GC 
Sbjct  125  DTECVICLSEFAAGDRLRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHCLIETCQKIIGC-  183

Query  628  aaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
                +Q  + +  P      ++ I PL  EGLI NY 
Sbjct  184  ----SQAASSSENPVTAQETIVTITPLEPEGLIRNYR  216



>ref|XP_006427854.1| hypothetical protein CICLE_v10027222mg, partial [Citrus clementina]
 gb|ESR41094.1| hypothetical protein CICLE_v10027222mg, partial [Citrus clementina]
Length=210

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 154/217 (71%), Gaps = 15/217 (7%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPA-NSSFDTVAA-SSTTTFDANVVMVLSVLLCALICSLGVNS  267
            QDFL  F SR+ LL+AP P    S D     +   TFDANVVMVLSVLLCALICSLG+NS
Sbjct  4    QDFLGEFYSRRSLLTAPPPVPGKSHDPAEVYTGNNTFDANVVMVLSVLLCALICSLGLNS  63

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            II+C +RCSS+ A R+ A+  ++           N GIK+KALKTFPV+SY+A+  + GL
Sbjct  64   IIRCVVRCSSLVASRSGASNSAAILP--------NKGIKQKALKTFPVVSYSAELNLAGL  115

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCt  627
            DT+C ICLSEFAAGDR+RLLPKCNHGFHVRCIDKWLSSHSSCP CRHCLI+TCQKI+GC 
Sbjct  116  DTECVICLSEFAAGDRLRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHCLIETCQKIIGC-  174

Query  628  aaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
                +Q  + +  P      ++ I PL  EGLI NY 
Sbjct  175  ----SQAASSSENPVTAQETIVTITPLEPEGLIRNYR  207



>ref|XP_006371011.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP48808.1| zinc finger family protein [Populus trichocarpa]
Length=225

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 157/227 (69%), Gaps = 26/227 (11%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QDFL  F SR+LLL           + PAP NS+    +  + ++FDANVVMVLSVLL
Sbjct  10   LFQDFLGDFYSRRLLLHNPLYQSTNTATPPAPGNSAPSEPSTGTGSSFDANVVMVLSVLL  69

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCS+IAA  +AA   + S          NTG+ ++ALK+FPV+
Sbjct  70   CALICSLGLNSIIRCALRCSNIAASESAANPSTQSA---------NTGVNRRALKSFPVV  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y++D  +PGLDT+C ICLSEF  G+RVRLLPKC+HGFHV+CIDKWLSSHSSCPTCRHCL
Sbjct  121  NYSSDLNLPGLDTECVICLSEFTPGERVRLLPKCHHGFHVKCIDKWLSSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKI+GC         + +         ++ I PL  EGLI +Y
Sbjct  181  IETCQKIIGC------SQASTSGTSLPVQETIVSIMPLEPEGLIRDY  221



>gb|KDP26113.1| hypothetical protein JCGZ_22214 [Jatropha curcas]
Length=224

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 151/227 (67%), Gaps = 27/227 (12%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP---APA--------NSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QD +  F SR+LL   P   +P         NS   T   S   TFDANVVMVLSVLL
Sbjct  10   LFQDLVGDFYSRRLLQHTPLYQSPTVAAPPAPANSHDSTEPYSGDNTFDANVVMVLSVLL  69

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCS++ A  ++    +            NTG+K+KALKTFP +
Sbjct  70   CALICSLGLNSIIRCALRCSNLVASNSSGNSAARLA---------NTGVKQKALKTFPTV  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+AD K+PGLDT+C ICLSEF  G+RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL
Sbjct  121  NYSADLKLPGLDTECVICLSEFIPGERVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKIVGC           ++ P      ++ I PL  EGLI NY
Sbjct  181  IETCQKIVGC-------SQATSSGPAPMQESIVNIVPLEPEGLIRNY  220



>ref|XP_002298709.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE83514.2| zinc finger family protein [Populus trichocarpa]
Length=225

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 151/227 (67%), Gaps = 25/227 (11%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L Q FL  F SR+LLL           + PAP N++      S+  +FDANVVMVLSVLL
Sbjct  11   LFQGFLGDFYSRRLLLHTPLYQSSNTATPPAPGNTASSETYTSTDNSFDANVVMVLSVLL  70

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCS++ A  +AA   + +          NTG+K+KALKTFP++
Sbjct  71   CALICSLGLNSIIRCALRCSNLVASESAANPSTQAA---------NTGVKRKALKTFPIV  121

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
             Y+ D  +PGLDT C ICLSEF  G+ VRLLPKCNHGFHV+CIDKWLSSHSSCPTCRHCL
Sbjct  122  KYSTDLNLPGLDTQCVICLSEFTPGEHVRLLPKCNHGFHVKCIDKWLSSHSSCPTCRHCL  181

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TC+KI GC     +Q  T           ++ I PL  EGLI NY
Sbjct  182  IETCKKIAGC-----SQASTSGPTSLPVQEAIVSILPLEPEGLISNY  223



>ref|XP_011045714.1| PREDICTED: RING-H2 finger protein ATL78-like [Populus euphratica]
Length=225

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 150/227 (66%), Gaps = 25/227 (11%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L Q FL  F SR+LLL           + PAP N++      S+  +FDANVVMVLSVLL
Sbjct  11   LFQGFLGDFYSRRLLLHTPLYQSSNTATPPAPGNTASSEPYTSTDNSFDANVVMVLSVLL  70

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCS++ A  +AA   + +          NTG+K+KALKTFP++
Sbjct  71   CALICSLGLNSIIRCALRCSNLVASESAANPSTQAA---------NTGVKRKALKTFPIV  121

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
             Y+ D  +PGLDT C ICLSEF  G+ VRLLPKCNHGFHV+CIDKWLSSHSSCPTCRHCL
Sbjct  122  RYSTDLNLPGLDTQCVICLSEFTPGEHVRLLPKCNHGFHVKCIDKWLSSHSSCPTCRHCL  181

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TC KI GC     +Q  T           ++ I PL  EGLI NY
Sbjct  182  IETCNKIAGC-----SQASTSGPTSLPVQEAIVSILPLEPEGLISNY  223



>ref|XP_011046373.1| PREDICTED: RING-H2 finger protein ATL78-like [Populus euphratica]
Length=225

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 157/227 (69%), Gaps = 26/227 (11%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QDFL  + SR+LLL           + PAP NS+     + + ++FDANVVMVLSVLL
Sbjct  10   LFQDFLGDYYSRRLLLHTPLYQSTNTATPPAPGNSAPSEPYSGTGSSFDANVVMVLSVLL  69

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCS+IAA  +AA   +            NTG+ ++ALK+FPV+
Sbjct  70   CALICSLGLNSIIRCALRCSNIAASESAANPSTQLA---------NTGVNRRALKSFPVV  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y++D  +PGLDT+C ICLSEF  G+RVRLLPKC+HGFHV+CIDKWL SHSSCPTCRHCL
Sbjct  121  NYSSDLNLPGLDTECVICLSEFTTGERVRLLPKCHHGFHVKCIDKWLGSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKI+GC      +  + + P       ++ I PL  EGLI +Y
Sbjct  181  IETCQKIIGC------RQASTSGPSLPVQETIVSILPLEPEGLIRDY  221



>ref|XP_007048258.1| RING zinc finger protein [Theobroma cacao]
 gb|EOX92415.1| RING zinc finger protein [Theobroma cacao]
Length=220

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 153/233 (66%), Gaps = 27/233 (12%)
 Frame = +1

Query  70   IMASDLLGQDFLETFRSRKLLLSAP-----------APANSSFDTVAASSTTTFDANVVM  216
            I  S  L Q  L  F SR+LLL  P           +P N+   +   +   +FDANVVM
Sbjct  3    ISISTQLLQHLLGEFHSRRLLLHTPPFETPTTAAPASPENNHNSSDPYTGNNSFDANVVM  62

Query  217  VLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKAL  396
            VLSVLLCALICSLG+NSII+CALRC+ + A  + A+  +            NTG+K+KAL
Sbjct  63   VLSVLLCALICSLGLNSIIRCALRCTGLVASESGASTSARLA---------NTGVKRKAL  113

Query  397  KTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCP  576
            KTFP ++Y+AD K+PGLDT+C ICLS+F  GDRVRLLPKCNHGFHVRCIDKWLSSHSSCP
Sbjct  114  KTFPTVNYSADLKLPGLDTECIICLSDFTPGDRVRLLPKCNHGFHVRCIDKWLSSHSSCP  173

Query  577  TCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
             CRHCL++TCQKIVGC           ++ PP     ++ I P+  EGLI +Y
Sbjct  174  KCRHCLLETCQKIVGC-------SQASSSGPPPVQETIVTIAPVDPEGLIHSY  219



>ref|XP_006351048.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=226

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 161/230 (70%), Gaps = 16/230 (7%)
 Frame = +1

Query  73   MASDLLGQDFLETFR-SRKLLLSAPAPANSSFDTVAA-------SSTTTFDANVVMVLSV  228
            + S LL QDF++  + SR+LLL  PA      DT  A        +T TFDA+VVMVLSV
Sbjct  4    ITSTLLIQDFMKNLQYSRRLLL--PATPQYHHDTTLAPTDLSQGDTTNTFDAHVVMVLSV  61

Query  229  LLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFP  408
            LLCALICSLG+NSII+CALRC+S+ +   +++  ++   +       N GIKKKALK FP
Sbjct  62   LLCALICSLGLNSIIRCALRCTSLVSESDSSSMSTNLSATIKLT---NNGIKKKALKMFP  118

Query  409  VISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRH  588
            +I+Y  + K PGLD++C ICLSEF AG++VR+LPKCNHGFHVRCIDKWL+SHSSCPTCRH
Sbjct  119  IITYTTELKHPGLDSECVICLSEFVAGEKVRVLPKCNHGFHVRCIDKWLNSHSSCPTCRH  178

Query  589  CLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            CLI+TCQKIV      ++   T + P      ++++IEPL REG++ N+ 
Sbjct  179  CLIETCQKIVN---GGSSNSSTISNPQVAAQEIIIRIEPLQREGVVSNHQ  225



>ref|XP_002522191.1| RING-H2 finger protein ATL1L, putative [Ricinus communis]
 gb|EEF40166.1| RING-H2 finger protein ATL1L, putative [Ricinus communis]
Length=223

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 150/227 (66%), Gaps = 28/227 (12%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP-----------APANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QDF   F SR+LLL  P           AP  S   +   +   +FDANVVMVLSVLL
Sbjct  10   LFQDFQGDFYSRRLLLHTPLYHSPTAAAPPAPGYSQEASEPYTGNNSFDANVVMVLSVLL  69

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCSS+ A R+A    +            NTG+K+KALKTFP +
Sbjct  70   CALICSLGLNSIIRCALRCSSLVASRSADNSSAGLA---------NTGVKRKALKTFPTV  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+ D  +PGLDT+CAICLSEF  G+RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL
Sbjct  121  NYSTDLNLPGLDTECAICLSEFTPGERVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKIVGC           ++  P     ++ I PL  E LI +Y
Sbjct  181  IETCQKIVGC--------SQTSSSDPPVQESIVNIAPLEPEALIRSY  219



>emb|CDP12783.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 159/242 (66%), Gaps = 24/242 (10%)
 Frame = +1

Query  61   PVLIMASDLLGQDFLETFRSRKLLLSAPAPAN--------------SSFDTVAASSTTTF  198
            P    +S +L Q+ L  F  RKLLL  P                  SS      ++  +F
Sbjct  4    PSTSTSSPMLTQELLIQFHPRKLLLHTPLLQPPAAASATPPTIGNLSSHAPSEPAADNSF  63

Query  199  DANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTG  378
            DANVVMVLSVLLCALICSLG+NSII+CALRCSS  +   +    S+           NTG
Sbjct  64   DANVVMVLSVLLCALICSLGLNSIIRCALRCSSFVSSDQSNDNSSARLA--------NTG  115

Query  379  IKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLS  558
            IKKKALKTFP I+Y+ + K+P LDT+CAICLSEFA G+RVR+LPKCNHGFHVRCIDKWL+
Sbjct  116  IKKKALKTFPTINYSTELKLPALDTECAICLSEFATGERVRVLPKCNHGFHVRCIDKWLN  175

Query  559  SHSSCPTCRHCLIQTCQKIVGCtaa--aatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            SHSSCPTCRHCLI+TCQKIVGC+    ++   P+PA P P     +++I PL  EGL+ N
Sbjct  176  SHSSCPTCRHCLIETCQKIVGCSQQASSSRPAPSPAPPAPPAQETIVRIAPLEPEGLLHN  235

Query  733  YH  738
            Y 
Sbjct  236  YQ  237



>ref|XP_010260922.1| PREDICTED: RING-H2 finger protein ATL78 [Nelumbo nucifera]
Length=233

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 157/231 (68%), Gaps = 21/231 (9%)
 Frame = +1

Query  79   SDLLGQDFLETFRSRKLLLSAP--------APANSSFDTVAASSTTT----FDANVVMVL  222
            S+LL QD L   RSR+LLL  P        AP  ++     +S + T     DANVVM+L
Sbjct  12   SNLL-QDLLRDVRSRRLLLHTPLYQPPGTAAPPGTATTGHDSSESYTNGNSLDANVVMIL  70

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            SVLLCALIC+LG+NSII+CALRCS       ++   ++           NTGIK+KALKT
Sbjct  71   SVLLCALICALGLNSIIRCALRCSRRVNSDPSSNNTANRLA--------NTGIKRKALKT  122

Query  403  FPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTC  582
            FP ++Y+  +++P LD++C ICLSEFA GDRVR+LPKCNHGFH+RCIDKWL+SHSSCPTC
Sbjct  123  FPTLTYSTGSELPRLDSECVICLSEFAPGDRVRVLPKCNHGFHLRCIDKWLTSHSSCPTC  182

Query  583  RHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            RHCLI+TCQKIVGC+  ++++ P    P      +   + PL REGL+P++
Sbjct  183  RHCLIETCQKIVGCSQTSSSELPRLPPPALAIPPLARGVLPLQREGLMPSH  233



>ref|XP_004249865.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum lycopersicum]
Length=219

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 158/222 (71%), Gaps = 7/222 (3%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
            + S  L QDF++ F+  + LL    P  +  D     +T TFDA+VVMVLSVLLCAL+CS
Sbjct  4    ITSTSLIQDFMKNFQYPRRLLLPATPQQT--DLSQGETTNTFDAHVVMVLSVLLCALVCS  61

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            L +NSII+CALRC+S+ +   +++  S++  ++      N GIKKKALKTFP+I+Y  + 
Sbjct  62   LALNSIIRCALRCTSLVSESDSSSSISTNISATTKLT--NNGIKKKALKTFPIITYTTEL  119

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K PGLD++C ICLSEF AG++VR+LPKCNHGFHVRCIDKWL+SHS CPTCRHCLI+TCQK
Sbjct  120  KHPGLDSECVICLSEFVAGEKVRVLPKCNHGFHVRCIDKWLNSHSFCPTCRHCLIETCQK  179

Query  613  IVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            IV      ++   T + P  V   ++++IEPL REG++ N+ 
Sbjct  180  IVN---GGSSNSTTISNPQEVAQEIIIRIEPLQREGVVSNHQ  218



>ref|XP_009333999.1| PREDICTED: RING-H2 finger protein ATL78 [Pyrus x bretschneideri]
Length=231

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 153/228 (67%), Gaps = 25/228 (11%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAP--APANSSFDTVAASS-----------TTTFDANVVMVLSVLL  234
            Q+ L    SR+LLL  P   P N++   V+ ++             +FDANVVMVLSVLL
Sbjct  13   QEVLGGINSRRLLLQNPLYQPPNTASSPVSTNTIDSPLTDQYPGDNSFDANVVMVLSVLL  72

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSIIKCALRCSS  +   + +  +++  S+  A   NTG+KKKALKTFP +
Sbjct  73   CALICSLGLNSIIKCALRCSSFVSSSESRSAGNNNANSARLA---NTGVKKKALKTFPTV  129

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+A+ K+PGLDT+CAICLSEF AG+RVRLLPKCNHGFHVRCIDKWLSSHSSCP CRH L
Sbjct  130  NYSAELKLPGLDTECAICLSEFTAGERVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHNL  189

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            I+TCQKIVG          +  +        ++ I PL  EG + +Y 
Sbjct  190  IETCQKIVG---------YSQPSSSEPVQDTIVSIAPLEPEGFVRSYR  228



>emb|CAN75293.1| hypothetical protein VITISV_042413 [Vitis vinifera]
Length=224

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 147/227 (65%), Gaps = 28/227 (12%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QD +  F SR+LLL           S PA  NS   +   + + +FD NVVMVLSVLL
Sbjct  11   LFQDLVGDFYSRRLLLHSPLHESPATASPPATGNSHDSSEPYTGSNSFDTNVVMVLSVLL  70

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCSS+ A    +     +          NTG+KKKALKTFP +
Sbjct  71   CALICSLGLNSIIRCALRCSSLVASPGNSPSTRLA----------NTGVKKKALKTFPTL  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+A   +PGLDT+C ICLS+F  G+R+R+LPKCNHGFHVRCIDKWL+SHSSCPTCRHCL
Sbjct  121  NYSAGLNLPGLDTECVICLSDFTPGERIRILPKCNHGFHVRCIDKWLNSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKI+GC           ++  P P    + I PL  EG   NY
Sbjct  181  IETCQKIIGC-------SQASSSETPPPLQESMIIVPLEPEGFSRNY  220



>ref|XP_011099792.1| PREDICTED: RING-H2 finger protein ATL78-like [Sesamum indicum]
Length=225

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 146/221 (66%), Gaps = 26/221 (12%)
 Frame = +1

Query  100  FLETFRSRKLLLSAP---------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
                F  R+LLL  P          P  S  +      T TFD NVVMVLSVLLCALICS
Sbjct  20   IFNNFHPRRLLLHNPLYNSPPHPAPPPASHNNPTELRDTNTFDTNVVMVLSVLLCALICS  79

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG+NSII+CALRCS++ A  ++   +S+           NTGIKKKALKTFPVISYAAD 
Sbjct  80   LGLNSIIRCALRCSTLVAADSSQTGQSARLA--------NTGIKKKALKTFPVISYAADL  131

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K PGLDT+CAICLS+FAAG+RVR+LPKC+HGFHVRCIDKWL+SHSSCPTCRHCLI+TC K
Sbjct  132  KQPGLDTECAICLSDFAAGERVRVLPKCHHGFHVRCIDKWLNSHSSCPTCRHCLIETCNK  191

Query  613  IVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            IV              +       VV+++EPL  EG I NY
Sbjct  192  IV---------EAASTSATVPHQEVVVRMEPLQPEGFIRNY  223



>ref|XP_002282494.2| PREDICTED: RING-H2 finger protein ATL78 [Vitis vinifera]
Length=245

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 147/227 (65%), Gaps = 28/227 (12%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
            L QD +  F SR+LLL           S PA  NS   +   + + +FD NVVMVLSVLL
Sbjct  32   LFQDLVGDFYSRRLLLHSPLHESPATASPPATGNSHDSSEPYTGSNSFDTNVVMVLSVLL  91

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCSS+ A    +     +          NTG+KKKALKTFP +
Sbjct  92   CALICSLGLNSIIRCALRCSSLVASPGNSPSTRLA----------NTGVKKKALKTFPTL  141

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+A   +PGLDT+C ICLS+F  G+R+R+LPKCNHGFHVRCIDKWL+SHSSCPTCRHCL
Sbjct  142  NYSAGLNLPGLDTECVICLSDFTPGERIRILPKCNHGFHVRCIDKWLNSHSSCPTCRHCL  201

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            I+TCQKI+GC           ++  P P    + I PL  EG   NY
Sbjct  202  IETCQKIIGC-------SQASSSETPPPLQESMIIVPLEPEGFSRNY  241



>ref|XP_007212035.1| hypothetical protein PRUPE_ppa011240mg [Prunus persica]
 gb|EMJ13234.1| hypothetical protein PRUPE_ppa011240mg [Prunus persica]
Length=218

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 153/224 (68%), Gaps = 27/224 (12%)
 Frame = +1

Query  100  FLETFRSRKLLLSAP--APANSSFDTVAASST----------TTFDANVVMVLSVLLCAL  243
            F   F SR+LLL  P   P N++   V++++            +FDANVVMVLSVLLCAL
Sbjct  6    FFVNFNSRRLLLHNPLYQPPNTASSPVSSTNPHDPTDQYPGDNSFDANVVMVLSVLLCAL  65

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG+NSIIKCALRCSS    R++++  +S+  +       NTG+KKKALKTFP +SY+
Sbjct  66   ICSLGLNSIIKCALRCSSFVESRSSSSSNTSARLA-------NTGVKKKALKTFPTVSYS  118

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
            AD  +PGLDT+C ICLS+F AG+RVRLLPKCNHGFHVRCIDKWLSSHSSCP CRH LI+T
Sbjct  119  ADLNLPGLDTECVICLSDFTAGERVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHNLIET  178

Query  604  CQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CQKIVG            ++  P     ++ I PL  EGL+ NY
Sbjct  179  CQKIVG--------FTPASSSVPPVQETIVSIVPLEPEGLVRNY  214



>ref|XP_009772408.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana sylvestris]
Length=235

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 159/233 (68%), Gaps = 18/233 (8%)
 Frame = +1

Query  76   ASDLLGQDFLETFR--SRKLLLSAPAPANSSFDTVAAS-----STTTFDANVVMVLSVLL  234
             S L  Q+F+E F    R LLL A    +   +T+A +      + TFDA+VVMVLSVLL
Sbjct  4    TSTLFIQEFMENFHYSRRVLLLPATPQYHQDINTMAPTDLPQGESNTFDAHVVMVLSVLL  63

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRC+S+ +   +++  +++  +       N GI+KKALK FP+I
Sbjct  64   CALICSLGLNSIIRCALRCTSLVSASNSSSNYTNASATKLP----NNGIRKKALKMFPII  119

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y A+ K PGLD++C ICLSEF AG++VR+LPKCNHGFHVRCIDKWL+SHSSCPTCRHCL
Sbjct  120  TYTAELKHPGLDSECVICLSEFVAGEKVRVLPKCNHGFHVRCIDKWLNSHSSCPTCRHCL  179

Query  595  IQTCQKIV--GCtaaaatqpptpatpppvpatvvLQ-----IEPLHREGLIPN  732
            I+TCQKIV  G ++       +P       + V +Q     IEPL REG++ N
Sbjct  180  IETCQKIVNGGSSSTTTRSIASPQIVSNTSSAVPVQEVIIRIEPLQREGVVSN  232



>ref|XP_008232929.1| PREDICTED: RING-H2 finger protein ATL78 [Prunus mume]
Length=218

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 153/224 (68%), Gaps = 27/224 (12%)
 Frame = +1

Query  100  FLETFRSRKLLLSAP--APANSSFDTVAASST----------TTFDANVVMVLSVLLCAL  243
            F   F SR+LLL  P   P N++   +++++            +FDANVVMVLSVLLCAL
Sbjct  6    FFVNFNSRRLLLHNPLYQPPNTASSPISSTNPHDPTDQYPGDNSFDANVVMVLSVLLCAL  65

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG+NSIIKCALRCSS    R++++  +S+  +       NTG+KKKALKTFP +SY+
Sbjct  66   ICSLGLNSIIKCALRCSSFVESRSSSSSNASARLA-------NTGVKKKALKTFPTVSYS  118

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
            AD  +PGLDT+C ICLS+F AG+RVRLLPKCNHGFHVRCIDKWLSSHSSCP CRH LI+T
Sbjct  119  ADLNLPGLDTECVICLSDFTAGERVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHNLIET  178

Query  604  CQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CQKIVG            ++  P     ++ I PL  EGL+ NY
Sbjct  179  CQKIVG--------FTPASSSVPPVQETIVSIVPLEPEGLVRNY  214



>ref|XP_008391276.1| PREDICTED: RING-H2 finger protein ATL78 [Malus domestica]
Length=231

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 151/228 (66%), Gaps = 25/228 (11%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAP--APANSSFDTVAASST-----------TTFDANVVMVLSVLL  234
            Q+ L    SR+LLL  P   P N++   V+ +S             +FDANVVMVLSVLL
Sbjct  13   QEVLGGINSRRLLLQNPLYQPPNTASSPVSTNSIDSPSTDQYPGDNSFDANVVMVLSVLL  72

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+N IIKCALRCSS  +   + +  +++  S+  A   NTG+KKKALKTFP +
Sbjct  73   CALICSLGLNFIIKCALRCSSFVSSSESRSAGNNNATSARLA---NTGVKKKALKTFPTV  129

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y+ + K+PGLDT+CAICLSEF AG+RVRLLPKCNHGFHVRCIDKWLSSHSSCP CRH L
Sbjct  130  NYSVELKLPGLDTECAICLSEFTAGERVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRHNL  189

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            I+TCQKIVG          +  +        ++ I PL  EG + +Y 
Sbjct  190  IETCQKIVG---------YSQPSSSEPVQETIVSIAPLEPEGFVRSYR  228



>ref|XP_007137692.1| hypothetical protein PHAVU_009G147700g [Phaseolus vulgaris]
 gb|ESW09686.1| hypothetical protein PHAVU_009G147700g [Phaseolus vulgaris]
Length=226

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 145/217 (67%), Gaps = 16/217 (7%)
 Frame = +1

Query  103  LETFRSRKLLLSAP------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            L +F SR+LLL +P       PA+S   T        FDANVVMVLSVLLCALICSLG+N
Sbjct  16   LHSFHSRRLLLHSPLNQSAKPPASSHDSTETYLGDGNFDANVVMVLSVLLCALICSLGLN  75

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SII+CALRCS+     + A     +  +       NTG+KKKALKTFP +SY+A+  +P 
Sbjct  76   SIIRCALRCSNFVVSDSVATSSPPARVA-------NTGVKKKALKTFPTVSYSAELNLPS  128

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            LD++C ICLSEF+ GD+VR+LPKCNHGFHVRCID WLSSHSSCP CR CLI+TCQKIVGC
Sbjct  129  LDSECVICLSEFSNGDKVRILPKCNHGFHVRCIDMWLSSHSSCPKCRQCLIETCQKIVGC  188

Query  625  taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
               +  Q  +   P       +L I PL  EGL+ NY
Sbjct  189  ---SQQQASSSQQPVLQVPETILTITPLDPEGLVRNY  222



>ref|XP_009342079.1| PREDICTED: RING-H2 finger protein ATL78 [Pyrus x bretschneideri]
Length=232

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 153/239 (64%), Gaps = 24/239 (10%)
 Frame = +1

Query  61   PVLIMASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASST-------------TTFD  201
            P    ++  L QD L  F SR+LLL  P   + +  T   S+               +FD
Sbjct  2    PASTSSTHQLLQDVLGGFNSRRLLLQNPLYQSPNTATSPVSTNRIDSPSADQYPGDNSFD  61

Query  202  ANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGI  381
            ANVVMVLSVLLCALICSLG+NSIIKCALRCSS  +   + +  +++  S+  A   NTG+
Sbjct  62   ANVVMVLSVLLCALICSLGLNSIIKCALRCSSFGSSSESRSLGNNNATSARLA---NTGV  118

Query  382  KKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSS  561
            KKKALKTFP ++Y+A+ K+PGLDT+CAICLSEF   +RVRLLPKCNHGFHVRCIDKWLSS
Sbjct  119  KKKALKTFPTVNYSAELKLPGLDTECAICLSEFTTNERVRLLPKCNHGFHVRCIDKWLSS  178

Query  562  HSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            HSSCP CRH LI+TCQKIVG          T A         ++ I PL  EG + +Y 
Sbjct  179  HSSCPKCRHNLIKTCQKIVG--------YSTQAGSSEPVRETIVSIAPLEPEGFLRSYR  229



>gb|EYU43498.1| hypothetical protein MIMGU_mgv1a017986mg [Erythranthe guttata]
Length=235

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  184  STTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaar  363
               TFDANVVMVLSVLLCALICSLG+NSII+CALRCSS+     +A    ++     A  
Sbjct  58   QNNTFDANVVMVLSVLLCALICSLGLNSIIRCALRCSSLVGSADSANSPQAAQQCQLA--  115

Query  364  qaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCI  543
              NTGIKKKALKTFP IS++AD K+PGLDT+CAICLSEF AG+RVR+LPKC+HGFHVRCI
Sbjct  116  --NTGIKKKALKTFPTISFSADLKLPGLDTECAICLSEFTAGERVRVLPKCHHGFHVRCI  173

Query  544  DKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGL  723
            DKWL+ HSSCPTCRHCLI+TC KIV     + T P T      V   V ++IEPLH EGL
Sbjct  174  DKWLNCHSSCPTCRHCLIETCNKIVA----STTTPRTTTQSLVVVEEVCVRIEPLHPEGL  229

Query  724  IPNYH  738
            I NY 
Sbjct  230  IRNYQ  234



>ref|XP_009623345.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=234

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 155/237 (65%), Gaps = 25/237 (11%)
 Frame = +1

Query  79   SDLLGQDFLETFR-SRKLLL-SAPAPANSSFDTVAA-------SSTTTFDANVVMVLSVL  231
            S L  Q+F E F  SR+LLL     P   +  TVA        S   TFDANV+MVLSVL
Sbjct  5    STLFIQEFTENFHYSRRLLLIPTTVPQYHTEATVAPPPPAAEISRVNTFDANVIMVLSVL  64

Query  232  LCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPV  411
            +CALICSL +NSIIKCALRCS++ +  +     S+S          NTGIKKKALKT PV
Sbjct  65   VCALICSLALNSIIKCALRCSNLVSASSNYRNPSASLA--------NTGIKKKALKTLPV  116

Query  412  ISYAADAKMPGLDTD-CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRH  588
            I+Y  + K PGLDTD C ICLSEFAAG++VR+LPKC+HGFHVRCIDKWL+SHSSCPTCRH
Sbjct  117  ITYTTELKYPGLDTDECVICLSEFAAGEKVRVLPKCSHGFHVRCIDKWLNSHSSCPTCRH  176

Query  589  CLIQTCQKIVG-------CtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            CLI+TCQKIV          + A  Q  +  +       ++++IEPL REG+  N H
Sbjct  177  CLIETCQKIVNGGSSSSTTRSIANPQIVSNTSSAVPVQEIIIRIEPLQREGVTSNNH  233



>gb|KHN29152.1| RING-H2 finger protein ATL78 [Glycine soja]
Length=221

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 149/226 (66%), Gaps = 21/226 (9%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAP---APANSSFDTVAASSTTT--------FDANVVMVLSVLLCA  240
             D L    SRKLLL  P      NS+    A S  TT        FDANVVM+LSVLLCA
Sbjct  3    HDLLMDTNSRKLLLQDPLLHQSMNSANSPDAMSYNTTDSYFKGRDFDANVVMILSVLLCA  62

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +ICSLG+NSIIKC LRCS+I       +  S S  + +     NTGIKKKALKTFP +SY
Sbjct  63   VICSLGLNSIIKCVLRCSNIVINNNDPSSSSVSYNNPSPRLA-NTGIKKKALKTFPTVSY  121

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + + K+PGLDT+C ICLSEFA GD+VR+LPKCNHGFHVRCIDKWLSSHSSCP CR CLI+
Sbjct  122  STEMKLPGLDTECVICLSEFANGDKVRILPKCNHGFHVRCIDKWLSSHSSCPKCRQCLIE  181

Query  601  TCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            TC+KIVG               PPVP + +++I+PL  EGL  NY 
Sbjct  182  TCKKIVG---------SQIQPVPPVPESTIIRIQPLEPEGLERNYR  218



>ref|XP_010027695.1| PREDICTED: RING-H2 finger protein ATL78 [Eucalyptus grandis]
 gb|KCW54275.1| hypothetical protein EUGRSUZ_I00238 [Eucalyptus grandis]
Length=225

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 149/219 (68%), Gaps = 17/219 (8%)
 Frame = +1

Query  100  FLETFRSRKLLLSAPAPANSSFDTVAAS-------STTTFDANVVMVLSVLLCALICSLG  258
            F + + SR+LLL  P     +  T  +S       +  +FD+NVVMVLSVLLCALICSLG
Sbjct  13   FRDLYFSRRLLLHGPLHQTPNMATPPSSGIHEESPNDNSFDSNVVMVLSVLLCALICSLG  72

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            +NSII+CALRCSS+ +        S+           NTG+KKKALKTFPV++Y+++ K+
Sbjct  73   LNSIIRCALRCSSLVSSEANGHNASARLA--------NTGVKKKALKTFPVVNYSSELKL  124

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGLD +C ICLSEFA  DRVR+LPKC HGFHVRCIDKWL+SHSSCPTCRHCLI+TCQKIV
Sbjct  125  PGLDAECIICLSEFATNDRVRILPKCQHGFHVRCIDKWLNSHSSCPTCRHCLIETCQKIV  184

Query  619  GCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            GC   +A    +  +P P    + + + PL  EG + NY
Sbjct  185  GC--GSAQASTSAPSPSPPTPAIQITLAPLEPEGPVRNY  221



>ref|XP_009780401.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana sylvestris]
Length=236

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 150/233 (64%), Gaps = 19/233 (8%)
 Frame = +1

Query  79   SDLLGQDFLETFRSRKLLLSAPA--PANSSFDTVAA------SSTTTFDANVVMVLSVLL  234
            S +  Q+F E F   + LL  P   P N    T+A       S   TFDANV+MVLSVL+
Sbjct  5    STIFNQEFRENFHYSRRLLLIPTTLPQNHLEATLAPPPAAEISHVNTFDANVIMVLSVLV  64

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSL +NSIIKCALRCS++ +   +++   +   +  A    NTGIKKKALKTFPVI
Sbjct  65   CALICSLALNSIIKCALRCSNLVSASDSSSNYRNPSAAKLA----NTGIKKKALKTFPVI  120

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y  + K PG+DT+C ICLSEF AG+RV++LPKCNHGFHV+CIDKWL SHSSCPTCRHCL
Sbjct  121  TYTTELKHPGVDTECVICLSEFGAGERVKVLPKCNHGFHVKCIDKWLRSHSSCPTCRHCL  180

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvv-------LQIEPLHREGLIPN  732
            I+T QKIV   ++++    T         +         ++IEPL REG   N
Sbjct  181  IETSQKIVNVGSSSSNTRSTANPQIVSNTSSAVPVQEIIIRIEPLQREGGTSN  233



>ref|XP_009147913.1| PREDICTED: RING-H2 finger protein ATL78-like [Brassica rapa]
 emb|CDY48858.1| BnaA06g03240D [Brassica napus]
Length=214

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 137/188 (73%), Gaps = 14/188 (7%)
 Frame = +1

Query  64   VLIMASDLLGQDFLETFRSRKLLL-SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            V  M    + QD L +  +R+LLL  +P+PA S +     +  T FDANVVMVLSVLLCA
Sbjct  7    VPTMKQTQIFQDILRSSYARRLLLDQSPSPAPSPY-----ADDTNFDANVVMVLSVLLCA  61

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NS+I+CALRCSS+A       + ++           NTG+K+KALK+F  +SY
Sbjct  62   LVCSLGLNSVIRCALRCSSLAPSEAGDNQPAARLS--------NTGVKRKALKSFQTVSY  113

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +AD  +PGLDT+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  114  SADLNLPGLDTECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  173

Query  601  TCQKIVGC  624
            TCQKI  C
Sbjct  174  TCQKIADC  181



>ref|XP_003525110.1| PREDICTED: RING-H2 finger protein ATL78-like [Glycine max]
Length=231

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 150/228 (66%), Gaps = 21/228 (9%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP----------APANSSFDTVAASST-TTFDANVVMVLSVLL  234
            L  D L    SRKLLL  P          +P + S++T  +  T   FDANVVM+LSVLL
Sbjct  11   LVHDLLVDTNSRKLLLQDPLLHQSMNSANSPDSMSYNTTDSYFTGRDFDANVVMILSVLL  70

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CA+ICSLG+NSIIKC LRCS+I       +  SSS   + + R AN GIKKKALKTFP +
Sbjct  71   CAVICSLGLNSIIKCVLRCSNIVINNNDPSSSSSSASYNPSPRLANRGIKKKALKTFPTV  130

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            SY+ + K+PGLDT+C ICLSEFA GD+VR+LPKCNHGFHV CIDKWLSSHSSCP CR CL
Sbjct  131  SYSTEMKLPGLDTECVICLSEFANGDKVRILPKCNHGFHVCCIDKWLSSHSSCPKCRQCL  190

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            I+TC+KIVG          +   P       +++I+PL  EGL  NY 
Sbjct  191  IETCKKIVG----------SQIQPVAPVPETIIRIQPLEPEGLERNYR  228



>ref|NP_001235294.1| uncharacterized protein LOC100527126 [Glycine max]
 gb|ACU16173.1| unknown [Glycine max]
Length=232

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 132/187 (71%), Gaps = 12/187 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAP---APANSSFDTVAASSTTT--------FDANVVMVLSVLLCA  240
             D L    SRKLLL  P      NS+    A S  TT        FDANVVM+LSVLLCA
Sbjct  13   HDLLMDTNSRKLLLQDPLLHQSMNSANSPDAMSYNTTDSYFKGRDFDANVVMILSVLLCA  72

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +ICSLG+NSIIKC LRCS+I       +  S S  + +     NTGIKKKALKTFP +SY
Sbjct  73   VICSLGLNSIIKCVLRCSNIVINNNDPSSSSVSYNNPSPRLA-NTGIKKKALKTFPTVSY  131

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + + K+PGLDT+C ICLSEFA GD+VR+LPKCNHGFHVRCIDKWLSSHSSCP CR CLI+
Sbjct  132  STEMKLPGLDTECVICLSEFANGDKVRILPKCNHGFHVRCIDKWLSSHSSCPKCRQCLIE  191

Query  601  TCQKIVG  621
            TC+KIVG
Sbjct  192  TCKKIVG  198



>emb|CDX92270.1| BnaA05g21370D [Brassica napus]
Length=215

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 22/189 (12%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTT-----TFDANVVMVLSVLLC  237
            ++ +DFLE F SR+LLL      P  A+  F     +S +     +FDANVVMVLSVLLC
Sbjct  9    IIYEDFLENFYSRRLLLHTAYQPPTMASPPFGDAHEASHSHAHQMSFDANVVMVLSVLLC  68

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
            AL+CSLG++SII+C LR              SS      A R ANTG+K+KALK+F  +S
Sbjct  69   ALVCSLGLHSIIRCLLR-------------YSSEASEELAVRVANTGVKRKALKSFQTVS  115

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+A+  +PGLDT+CAICLSEF AG+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCR CLI
Sbjct  116  YSAEMNLPGLDTECAICLSEFVAGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRDCLI  175

Query  598  QTCQKIVGC  624
            QTCQKI GC
Sbjct  176  QTCQKIAGC  184



>ref|XP_009599874.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=235

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 155/233 (67%), Gaps = 18/233 (8%)
 Frame = +1

Query  76   ASDLLGQDFLETFR--SRKLLLSAPAPANSSFDTVAAS-----STTTFDANVVMVLSVLL  234
             S L  Q+F+E F    R LLL      +   +T+A +      + TFDA+VVMVLSVLL
Sbjct  4    TSTLFIQEFMENFHYSRRVLLLPVTQQYHQDINTMAPTHLPQGESNTFDAHVVMVLSVLL  63

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSLG+NSII+CALRCSS+ +   +++  +++  +       N GI+KKALK FP+I
Sbjct  64   CALICSLGLNSIIRCALRCSSVVSASDSSSNYTNASATKLP----NNGIRKKALKMFPII  119

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y  + K PGLD++C ICLSEF AG++VR+LPKC+HGFHVRCIDKWL+SHSSCPTCRHCL
Sbjct  120  TYTTELKHPGLDSECVICLSEFVAGEKVRVLPKCSHGFHVRCIDKWLNSHSSCPTCRHCL  179

Query  595  IQTCQKIVG-------CtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            I+TCQKIV          +    Q  +  +       ++++IEPL REG+  N
Sbjct  180  IETCQKIVNGGSSSSTTRSIVNPQIVSNTSSAVPVQEIIIRIEPLQREGVTSN  232



>ref|XP_002883149.1| hypothetical protein ARALYDRAFT_479387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59408.1| hypothetical protein ARALYDRAFT_479387 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 18/188 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTT-----TFDANVVMVLSVLLCA  240
            L QD    F SR+LLL      P  A+S F     +S T     +FDANVVMVLSVLLCA
Sbjct  15   LFQDIRGDFYSRRLLLHTAYQPPTTASSPFADAHETSHTYASHMSFDANVVMVLSVLLCA  74

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG++SII+CALR          +   SS      + R ANTG+K+KALK+F  +SY
Sbjct  75   LVCSLGLHSIIRCALR---------YSNLLSSEASDELSVRLANTGVKQKALKSFQTVSY  125

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             A+ K+PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  126  TAELKLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  185

Query  601  TCQKIVGC  624
            TC+KI GC
Sbjct  186  TCKKIAGC  193



>ref|XP_004502903.1| PREDICTED: RING-H2 finger protein ATL78-like [Cicer arietinum]
Length=225

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 148/226 (65%), Gaps = 26/226 (12%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP--APANSSFDTVAASSTT--------TFDANVVMVLSVLLC  237
            L  + +E F SR+LLL +P   P+N    T    ST+         FDANV+MVLSVLLC
Sbjct  11   LLHELVENFHSRRLLLHSPINQPSNPPISTNNHDSTSESSYLGDGNFDANVIMVLSVLLC  70

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
            ALICSLG+NSII+CALRCS++    +   E +++  +       NTGIKKKALK+F  IS
Sbjct  71   ALICSLGLNSIIRCALRCSNLVMMSSDHLENNTAVRAK------NTGIKKKALKSFTTIS  124

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+ +  +  LD++C ICLSEF+ GD+VRLLPKCNHGFHVRCIDKWLSSHSSCP CR CLI
Sbjct  125  YSPELNLSSLDSECVICLSEFSNGDKVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRQCLI  184

Query  598  QTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            +TC+KIVG          +  +   +    ++ I PL  EGL+ NY
Sbjct  185  ETCKKIVG----------SQGSSSQLVPETIVTIAPLEPEGLVRNY  220



>ref|XP_006578803.1| PREDICTED: RING-H2 finger protein ATL78-like [Glycine max]
 gb|KHN31123.1| RING-H2 finger protein ATL78 [Glycine soja]
Length=239

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 150/222 (68%), Gaps = 14/222 (6%)
 Frame = +1

Query  103  LETFR-SRKLLLSAP------APANSSFDTVAAS-STTTFDANVVMVLSVLLCALICSLG  258
            LE F  SR+LLL +P       P  SS D+         FDANVVMVLSVLLCALICSLG
Sbjct  17   LENFHYSRRLLLHSPYLNQSEKPPTSSHDSTETYLGDGNFDANVVMVLSVLLCALICSLG  76

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            +NSII+CALRCS+     + A   ++   ++  A   NTG+KKKALKTFP +SY+A+  +
Sbjct  77   LNSIIRCALRCSNFVVSDSVATNNNNPPAAARVA---NTGVKKKALKTFPTVSYSAELNL  133

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            P LD++C ICLSEF +GD+VR+LPKCNH FHVRCIDKWLSSHSSCP CR CLI+TCQKIV
Sbjct  134  PSLDSECVICLSEFTSGDKVRILPKCNHRFHVRCIDKWLSSHSSCPKCRQCLIETCQKIV  193

Query  619  GCtaaaatqpptpat---pppvpatvvLQIEPLHREGLIPNY  735
            GC+   A+             VP T+V  + PL  EGL+ NY
Sbjct  194  GCSTQQASSSQQQQQQQHVLAVPETIVTIVAPLEPEGLVRNY  235



>ref|XP_006406566.1| hypothetical protein EUTSA_v10021473mg [Eutrema salsugineum]
 gb|ESQ48019.1| hypothetical protein EUTSA_v10021473mg [Eutrema salsugineum]
Length=224

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 136/188 (72%), Gaps = 18/188 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            L QD L  F SR+LLL         ++P  +++   + + +   +FDANVVMVLSVLLCA
Sbjct  15   LFQDVLGNFHSRRLLLHTAYQPPTTASPPLSDAHEASHSYAHHMSFDANVVMVLSVLLCA  74

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG++S+I+C LR          +   SS      A R ANTG+K+KALK+F  +SY
Sbjct  75   LVCSLGLHSVIRCVLR---------YSNILSSEASEELAVRLANTGVKRKALKSFQTVSY  125

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + + K+PGLDTDCAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  126  STEPKLPGLDTDCAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  185

Query  601  TCQKIVGC  624
            TCQKI GC
Sbjct  186  TCQKIAGC  193



>ref|XP_010556018.1| PREDICTED: RING-H2 finger protein ATL78 [Tarenaya hassleriana]
Length=222

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 135/189 (71%), Gaps = 21/189 (11%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLC  237
            LL QD + +   R+LLL         + P+P N+     A +   +FDANVVMVLSVLLC
Sbjct  14   LLFQDIIGSSYPRRLLLQTLYQPPTSAPPSPVNAH---EAYTGDNSFDANVVMVLSVLLC  70

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
            AL+CSLG+NSIIKCALRCS++ +   +  +              NTG+K+KALK+F  ++
Sbjct  71   ALVCSLGLNSIIKCALRCSNLVSSEASGNQAVRLA---------NTGVKRKALKSFQTVN  121

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+ + K+PGLDT+CAICLSEFA  +RV+LLPKCNHGFHVRCIDKWL SHSSCPTCRHCLI
Sbjct  122  YSTELKLPGLDTECAICLSEFAPRERVKLLPKCNHGFHVRCIDKWLGSHSSCPTCRHCLI  181

Query  598  QTCQKIVGC  624
            +TCQKI GC
Sbjct  182  ETCQKIAGC  190



>gb|ACU18824.1| unknown [Glycine max]
Length=239

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 133/182 (73%), Gaps = 11/182 (6%)
 Frame = +1

Query  103  LETFR-SRKLLLSAP------APANSSFDTVAAS-STTTFDANVVMVLSVLLCALICSLG  258
            LE F  SR+LLL +P       P  SS D+         FDANVVMVLSVLLCALICSLG
Sbjct  17   LENFHYSRRLLLHSPYLNQSEKPPTSSHDSTETYLGDGNFDANVVMVLSVLLCALICSLG  76

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            +NSII+CALRCS+     + A   ++   ++  A   NTG+KKKALKTFP +SY+A+  +
Sbjct  77   LNSIIRCALRCSNFVVSDSVATNNNNPPAAARVA---NTGVKKKALKTFPTVSYSAELNL  133

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            P LD++C ICLSEF +GD+VR+LPKCNH FHVRCIDKWLSSHSSCP CR CLI+TCQKIV
Sbjct  134  PSLDSECVICLSEFTSGDKVRILPKCNHRFHVRCIDKWLSSHSSCPKCRQCLIETCQKIV  193

Query  619  GC  624
            GC
Sbjct  194  GC  195



>ref|XP_006299842.1| hypothetical protein CARUB_v10016045mg [Capsella rubella]
 gb|EOA32740.1| hypothetical protein CARUB_v10016045mg [Capsella rubella]
Length=221

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 138/195 (71%), Gaps = 18/195 (9%)
 Frame = +1

Query  67   LIMASDLLGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMV  219
             I     L QD    F SR+LLL         ++P  A++   + + +S  +FDANVVMV
Sbjct  8    FITKQTELFQDIRGEFYSRRLLLHTAYQPPITASPPFADAHEASHSYTSHMSFDANVVMV  67

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            LSVLLCAL+CSLG++SII+CALR          +   SS      A R ANTG+K+KALK
Sbjct  68   LSVLLCALVCSLGLHSIIRCALR---------YSNLLSSEASDELAVRFANTGVKQKALK  118

Query  400  TFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
            +F  +SY A+ ++PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPT
Sbjct  119  SFQTVSYTAELQLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPT  178

Query  580  CRHCLIQTCQKIVGC  624
            CRHCLIQTC+KI GC
Sbjct  179  CRHCLIQTCKKIAGC  193



>ref|XP_003526853.1| PREDICTED: RING-H2 finger protein ATL78-like [Glycine max]
Length=236

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 148/220 (67%), Gaps = 13/220 (6%)
 Frame = +1

Query  103  LETFR-SRKLLLSAP------APANSSFDTVAAS--STTTFDANVVMVLSVLLCALICSL  255
            LE F  SR+LLL +P       P  SS D+   +      FDANVVMVLSVLLCALICSL
Sbjct  17   LENFHYSRRLLLHSPYLNQSAKPPRSSHDSSTETYLGDGNFDANVVMVLSVLLCALICSL  76

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G+NSII+CALRCS+     + A   +++   +A     NTG+KKKALKTF  +SY+A+  
Sbjct  77   GLNSIIRCALRCSNFVVSDSVATNNNNNNPPAARVA--NTGVKKKALKTFTTVSYSAELN  134

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +P LD++C ICLSEF +G++VR+LPKCNHGFH+RCIDKWLSSHSSCP CR CLI+TCQKI
Sbjct  135  LPSLDSECVICLSEFTSGEKVRILPKCNHGFHIRCIDKWLSSHSSCPKCRQCLIETCQKI  194

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            VGC+   A+         P     +  I PL  EGL+ NY
Sbjct  195  VGCSTQQASSSQQHVLAVPETIVTI--IAPLEPEGLVRNY  232



>ref|XP_009145859.1| PREDICTED: RING-H2 finger protein ATL78-like [Brassica rapa]
Length=215

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 133/189 (70%), Gaps = 22/189 (12%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTT-----TFDANVVMVLSVLLC  237
            ++ +DFLE F SR+LLL      P  A+  F     +S +     +FDANVVMVLSVLLC
Sbjct  9    IIYEDFLENFYSRRLLLHRAYQPPTMASPPFGDAHEASHSHAHQMSFDANVVMVLSVLLC  68

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
            AL+CSLG++SII+C LR              SS        R ANTG+K+KALK+F  +S
Sbjct  69   ALVCSLGLHSIIRCLLR-------------YSSEASEELTVRMANTGVKRKALKSFQTVS  115

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+ +  +PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCR CLI
Sbjct  116  YSTEMNLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRDCLI  175

Query  598  QTCQKIVGC  624
            QTCQKI GC
Sbjct  176  QTCQKIAGC  184



>ref|XP_010465991.1| PREDICTED: RING-H2 finger protein ATL78-like [Camelina sativa]
Length=223

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 132/185 (71%), Gaps = 15/185 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTT--TFDANVVMVLSVLLCALIC  249
            L QD    F SR+LLL      P  A+  F   + SS    +FDANVVMVLSVLLCAL+C
Sbjct  17   LFQDIRVNFYSRRLLLHTAYQPPTTASPPFAEASQSSENHMSFDANVVMVLSVLLCALVC  76

Query  250  SLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAAD  429
            SLG++SII+CALR          +   SS      A R ANTG+K+ ALK+F  +SY A+
Sbjct  77   SLGLHSIIRCALR---------YSNLLSSEASEELAVRLANTGVKQNALKSFQTVSYTAE  127

Query  430  AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQ  609
             K+PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCR CLIQTC+
Sbjct  128  LKLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRQCLIQTCK  187

Query  610  KIVGC  624
            KI GC
Sbjct  188  KIAGC  192



>gb|KHN09585.1| RING-H2 finger protein ATL78 [Glycine soja]
Length=236

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 148/220 (67%), Gaps = 13/220 (6%)
 Frame = +1

Query  103  LETFR-SRKLLLSAP------APANSSFDTVAAS--STTTFDANVVMVLSVLLCALICSL  255
            LE F  SR+LLL +P       P  SS D+   +      FDANVVMVLS+LLCALICSL
Sbjct  17   LENFHYSRRLLLHSPYLNQSAKPPRSSHDSSTETYLGDGNFDANVVMVLSILLCALICSL  76

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G+NSII+CALRCS+     + A   +++   +A     NTG+KKKALKTF  +SY+A+  
Sbjct  77   GLNSIIRCALRCSNFVVSDSVATNNNNNNPPAARVA--NTGVKKKALKTFTTVSYSAELN  134

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +P LD++C ICLSEF +G++VR+LPKCNHGFH+RCIDKWLSSHSSCP CR CLI+TCQKI
Sbjct  135  LPSLDSECVICLSEFTSGEKVRILPKCNHGFHIRCIDKWLSSHSSCPKCRQCLIETCQKI  194

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            VGC+   A+         P     +  I PL  EGL+ NY
Sbjct  195  VGCSTQQASSSQQHVLAVPETIVTI--IAPLEPEGLVRNY  232



>dbj|BAB01805.1| unnamed protein product [Arabidopsis thaliana]
Length=222

 Score =   206 bits (525),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 18/187 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            L QD    F SR+LLL         ++P  A++   + +  S  +FDANVVMVLSVLLCA
Sbjct  15   LFQDIRGDFYSRRLLLHTAYQPPTAASPPFADAHEASHSYQSHMSFDANVVMVLSVLLCA  74

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG++SII+CALR          +   SS      + R ANTG+K+KALK+F  +SY
Sbjct  75   LVCSLGLHSIIRCALR---------YSNLLSSEASDEFSVRLANTGVKQKALKSFQTVSY  125

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             A+ K+PGLDT+CAICLSEFA+G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  126  TAELKLPGLDTECAICLSEFASGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  185

Query  601  TCQKIVG  621
            TC+KI G
Sbjct  186  TCKKIAG  192



>ref|XP_007159812.1| hypothetical protein PHAVU_002G269500g [Phaseolus vulgaris]
 gb|ESW31806.1| hypothetical protein PHAVU_002G269500g [Phaseolus vulgaris]
Length=224

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 150/226 (66%), Gaps = 24/226 (11%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP---APANSSFDTVAASSTTT------FDANVVMVLSVLLCA  240
            L +D L    SRKLLL  P        S D+++ +ST +      F+ANVVM+L+VLLCA
Sbjct  11   LLRDLLMDSSSRKLLLQEPLHQQDLTKSPDSISYNSTDSYFKAHDFNANVVMILAVLLCA  70

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +ICSLG+NSIIKC LRCS+I     +    S S   S + R ANTGIKKKALKTFP +SY
Sbjct  71   VICSLGLNSIIKCVLRCSNIVINDPSIMSNSPSVSYSPSPRLANTGIKKKALKTFPTVSY  130

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + + K+PGLDT+C ICLSEF  GD+VR+LPKCNHGFHVRCIDKWLSSHSSCP CR CLI+
Sbjct  131  STELKLPGLDTECVICLSEFVNGDKVRILPKCNHGFHVRCIDKWLSSHSSCPKCRQCLIE  190

Query  601  TCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
             C+KIVG                P+    +++I+PL  EGL  NY 
Sbjct  191  -CKKIVG--------------SQPLVPETIIRIQPLEPEGLERNYR  221



>ref|XP_007048260.1| RING zinc finger protein, putative [Theobroma cacao]
 gb|EOX92417.1| RING zinc finger protein, putative [Theobroma cacao]
Length=213

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 136/217 (63%), Gaps = 18/217 (8%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAA--SSTTTFDANVVMVLSVLLCALICSLGVNS  267
            QDFL  F SRKLLL  P P+  S        S  T  D NV M+LSVLLC LICSLG+N 
Sbjct  10   QDFLGNFHSRKLLLYKP-PSQPSVTAAPPPYSQNTNLDENVFMILSVLLCGLICSLGLNF  68

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            I++CA R          +   +S    + +A   N GI K+ALKTFPV++Y+A+ K+PGL
Sbjct  69   IVRCAFR---------ISDRAASESSDNPSAGTVNRGIGKEALKTFPVVNYSAEMKLPGL  119

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCt  627
            DT+C ICLSEF  G+R+RLLPKCNHGFHVRCIDKWL S SSCP CRHCLI+TCQKI+GC 
Sbjct  120  DTECVICLSEFVPGERLRLLPKCNHGFHVRCIDKWLKSQSSCPKCRHCLIETCQKIIGC-  178

Query  628  aaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
                      +         V+ + PL  EG++ +Y 
Sbjct  179  -----NQTRSSESRLPAQDNVVNMLPLEPEGMVRDYR  210



>gb|KHN34052.1| RING-H2 finger protein ATL78 [Glycine soja]
Length=197

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 142/202 (70%), Gaps = 11/202 (5%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASST-TTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagr  312
            SA +P + S++T  +  T   FDANVVM+LSVLLCA+ICSLG+NSIIKC LRCS+I    
Sbjct  3    SANSPDSMSYNTTDSYFTGRDFDANVVMILSVLLCAVICSLGLNSIIKCVLRCSNIVINN  62

Query  313  taaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGD  492
               +  SSS   + + R AN GIKKKALKTFP +SY+ + K+PGLDT+C ICLSEFA GD
Sbjct  63   NDPSSSSSSASYNPSPRLANRGIKKKALKTFPTVSYSTEMKLPGLDTECVICLSEFANGD  122

Query  493  RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatppp  672
            +VR+LPKCNHGFHV CIDKWLSSHSSCP CR CLI+TC+KIVG          +   P  
Sbjct  123  KVRILPKCNHGFHVCCIDKWLSSHSSCPKCRQCLIETCKKIVG----------SQIQPVA  172

Query  673  vpatvvLQIEPLHREGLIPNYH  738
                 +++I+PL  EGL  NY 
Sbjct  173  PVPETIIRIQPLEPEGLERNYR  194



>ref|XP_010507135.1| PREDICTED: RING-H2 finger protein ATL78-like [Camelina sativa]
Length=221

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 131/185 (71%), Gaps = 15/185 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTT--TFDANVVMVLSVLLCALIC  249
            L QD    F SR++LL      P  A+  F   + SS    +FDANVVMVLSVLLCAL+C
Sbjct  15   LFQDIRVNFYSRRVLLHTAYQPPTTASPPFAVASQSSANHMSFDANVVMVLSVLLCALVC  74

Query  250  SLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAAD  429
            SLG++SII+CALR              SS      A R ANTG+K+ ALK+F  +SY A+
Sbjct  75   SLGLHSIIRCALR---------YYNLLSSEASEELAVRLANTGVKQNALKSFQTVSYTAE  125

Query  430  AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQ  609
             K+PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCR CLIQTC+
Sbjct  126  LKLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRQCLIQTCK  185

Query  610  KIVGC  624
            KI GC
Sbjct  186  KIAGC  190



>gb|ACU18212.1| unknown [Glycine max]
Length=236

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 147/220 (67%), Gaps = 13/220 (6%)
 Frame = +1

Query  103  LETFR-SRKLLLSAP------APANSSFDTVAAS--STTTFDANVVMVLSVLLCALICSL  255
            LE F  SR+LLL +P       P  SS D+   +      FDANVVMVLSVLLC LICSL
Sbjct  17   LENFHYSRRLLLHSPYLNQSAKPPRSSHDSSTETYLGDGNFDANVVMVLSVLLCVLICSL  76

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G+NSII+CALRCS+     + A   +++   +A     NTG+KKKALKTF  +SY+A+  
Sbjct  77   GLNSIIRCALRCSNFVVSDSVATNNNNNNPPAARVA--NTGVKKKALKTFTTVSYSAELN  134

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +P LD++C ICLSEF +G++VR+LPKCNHGFH+RCIDKWLSSHSSCP CR CLI+TCQKI
Sbjct  135  LPSLDSECVICLSEFTSGEKVRILPKCNHGFHIRCIDKWLSSHSSCPKCRQCLIETCQKI  194

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            VGC+   A+         P     +  I PL  EGL+ NY
Sbjct  195  VGCSTQQASSSQQHVLAVPETIVTI--IAPLEPEGLVRNY  232



>ref|XP_010027694.1| PREDICTED: RING-H2 finger protein ATL78-like [Eucalyptus grandis]
Length=229

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 149/224 (67%), Gaps = 21/224 (9%)
 Frame = +1

Query  100  FLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALI  246
            F + + SR+LLL           +AP+ + S+ +   +    +FD+NVVM+L+VLLCA+I
Sbjct  13   FQDLYFSRRLLLHGPLHQTPNTATAPSYSRSTREEPYSPGYNSFDSNVVMILAVLLCAVI  72

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            CSLG+N II+CALRCSS  +  T     S            NTG+K+KALKTFP+++Y+A
Sbjct  73   CSLGLNFIIRCALRCSSFVSSDTNGHNSSVRLA--------NTGVKRKALKTFPIVNYSA  124

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTC  606
            + K+PGLD++C ICLSE+A  D+VR+LPKC+HGFHVRCIDKWL+SHSSCPTCRHCLI+TC
Sbjct  125  ELKLPGLDSECIICLSEYAINDQVRILPKCHHGFHVRCIDKWLNSHSSCPTCRHCLIETC  184

Query  607  QKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            QKI+GC    A    +  +P        + I PL  EG   NYH
Sbjct  185  QKIMGC--GGAQASVSGPSPSSPAQAFQITIAPLEPEGPARNYH  226



>ref|XP_010487800.1| PREDICTED: RING-H2 finger protein ATL78-like [Camelina sativa]
Length=222

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 136/185 (74%), Gaps = 15/185 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-SAPAPANSSFDTVAASSTTT-----FDANVVMVLSVLLCALIC  249
            L QD    F SR+LLL +A  P  ++    A +S ++     FDANVVMVLSVLLCAL+C
Sbjct  16   LFQDIRGNFYSRRLLLHTAYQPRTTASPPFAEASQSSANHMSFDANVVMVLSVLLCALVC  75

Query  250  SLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAAD  429
            SLG++SII+CALR          +   SS  G   A R ANTG+K++ALK+F  +SY A+
Sbjct  76   SLGLHSIIRCALR---------YSNLLSSEAGEELAVRLANTGVKQQALKSFQTVSYTAE  126

Query  430  AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQ  609
             K+PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCR CLIQTC+
Sbjct  127  LKLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRQCLIQTCK  186

Query  610  KIVGC  624
            KI GC
Sbjct  187  KIAGC  191



>ref|XP_006393284.1| hypothetical protein EUTSA_v10011772mg [Eutrema salsugineum]
 gb|ESQ30570.1| hypothetical protein EUTSA_v10011772mg [Eutrema salsugineum]
Length=213

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 131/178 (74%), Gaps = 15/178 (8%)
 Frame = +1

Query  94   QDFLETFRSRKLLL-SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            QD L +  SR+LLL  +P+PA S +     ++   FDANVVMVLSVLLCAL+CSLG+NSI
Sbjct  17   QDILVSSYSRRLLLDQSPSPAPSPY-----AADNNFDANVVMVLSVLLCALVCSLGLNSI  71

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            I+CALRCSS+          +            NTG+K+KALK+F  +SY++D  +PGLD
Sbjct  72   IRCALRCSSLVPSEAGGNHAARLT---------NTGVKRKALKSFQTVSYSSDLNLPGLD  122

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            T+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLI+TC+KI  C
Sbjct  123  TECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIETCKKIADC  180



>ref|XP_006351102.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=222

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 147/230 (64%), Gaps = 23/230 (10%)
 Frame = +1

Query  76   ASDLLGQDFLETFR-SRKLLLSA------PAPANSSFDTV----AASSTTTFDANVVMVL  222
             S LL Q+F+E F  SR+LL  A      P  A  S DT+       +  TFDANV+MVL
Sbjct  5    TSTLLIQEFMENFHYSRRLLWEAATMAPPPMEAGISHDTIDDLQIGKNVNTFDANVIMVL  64

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            +VL+ A+ICSL +NSIIKC  RCS++    + +   + S          N GIKKKALKT
Sbjct  65   AVLVSAIICSLVLNSIIKCFFRCSTLVLIDSYSNHTNPSST--------NKGIKKKALKT  116

Query  403  FPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTC  582
            FP+I+     K PGLD++C ICLSEF  G++V++LPKCNHGFHV+CIDKWL+SHSSCPTC
Sbjct  117  FPIITGTTKLKHPGLDSECVICLSEFVIGEKVKVLPKCNHGFHVKCIDKWLNSHSSCPTC  176

Query  583  RHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            RHCLI+TCQKIV           T A        +V++IEPL REG+I N
Sbjct  177  RHCLIETCQKIVN----GDNFVTTNAISSSTVEEIVIRIEPLEREGVISN  222



>emb|CDX99317.1| BnaC05g34320D [Brassica napus]
Length=215

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 132/189 (70%), Gaps = 22/189 (12%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSA----PAPANSSFDTVAASSTT-----TFDANVVMVLSVLLC  237
            ++ +DFLE F SR+LLL+     P  A+  F     +S +     +FDANVVMVLSVLLC
Sbjct  9    IIYEDFLENFYSRRLLLNTAYQPPTMASPPFGDAHEASHSHAHQMSFDANVVMVLSVLLC  68

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
            AL+CSLG++SII+C LR              SS        R ANTG+K+KALK+F  +S
Sbjct  69   ALVCSLGLHSIIRCLLR-------------YSSEASEELTVRMANTGVKRKALKSFQTVS  115

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+ +  +P LDT+C ICLSEF AG+RVRLLPKC+HGFHVRCIDKWLSSHSSCPTCR CLI
Sbjct  116  YSKEMNLPCLDTECVICLSEFVAGERVRLLPKCHHGFHVRCIDKWLSSHSSCPTCRDCLI  175

Query  598  QTCQKIVGC  624
            QTCQKI GC
Sbjct  176  QTCQKIAGC  184



>ref|XP_003602549.1| Ring-H2 zinc finger protein [Medicago truncatula]
 gb|AES72800.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=240

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 140/224 (63%), Gaps = 18/224 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTT--------TFDANVVMVLSVLLCAL  243
            L  + +E F SR+LLL +   AN    T    ST          FDANVVMVLSVLLCAL
Sbjct  11   LLHELVENFHSRRLLLHSSNSANPPISTSIHDSTKESSYAGDGNFDANVVMVLSVLLCAL  70

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSL +NSII+CAL+CS++       +  +    ++      NTGIKKKALK F  +SY+
Sbjct  71   ICSLCLNSIIRCALKCSNLVVMSGDRSANNIPVRAA------NTGIKKKALKKFTTVSYS  124

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             + K+P LD++C ICLSEF  GD+VRLLPKCNHGFHVRCIDKWLSSHSSCP CR CLI+T
Sbjct  125  DELKLPSLDSECVICLSEFTNGDKVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRQCLIET  184

Query  604  CQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            C KIVG    +      P          ++ I PL  EGL+ NY
Sbjct  185  CNKIVG----SQGSSSQPQPMLFPVPETIVTIAPLEPEGLVRNY  224



>ref|XP_004306591.1| PREDICTED: RING-H2 finger protein ATL78-like [Fragaria vesca 
subsp. vesca]
Length=235

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = +1

Query  190  TTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqa  369
             +FDANVVMVLSVLLCALICSLG+NSIIKCALRCSS  A  ++++  +S+  +       
Sbjct  57   NSFDANVVMVLSVLLCALICSLGLNSIIKCALRCSSFVAAESSSSSNNSARLA-------  109

Query  370  NTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDK  549
            NTG+KKKALKTFP ISY+A+ K+PGLD++C ICLSEF  G+RVRLLPKCNHGFHVRCIDK
Sbjct  110  NTGVKKKALKTFPTISYSAEIKLPGLDSECMICLSEFTTGERVRLLPKCNHGFHVRCIDK  169

Query  550  WLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIP  729
            WLSSHSSCP CR  LI+TCQKIVG  + AA       T        ++ I  L  EG I 
Sbjct  170  WLSSHSSCPKCRQSLIETCQKIVG-FSQAAGSSSETTTRALPVQETIVSIAALQPEGFIR  228

Query  730  NY  735
            NY
Sbjct  229  NY  230



>gb|KCW54274.1| hypothetical protein EUGRSUZ_I00237, partial [Eucalyptus grandis]
Length=219

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 136/186 (73%), Gaps = 19/186 (10%)
 Frame = +1

Query  100  FLETFRSRKLLL-----------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALI  246
            F + + SR+LLL           +AP+ + S+ +   +    +FD+NVVM+L+VLLCA+I
Sbjct  13   FQDLYFSRRLLLHGPLHQTPNTATAPSYSRSTREEPYSPGYNSFDSNVVMILAVLLCAVI  72

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            CSLG+N II+CALRCSS  +  T     S            NTG+K+KALKTFP+++Y+A
Sbjct  73   CSLGLNFIIRCALRCSSFVSSDTNGHNSSVRLA--------NTGVKRKALKTFPIVNYSA  124

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTC  606
            + K+PGLD++C ICLSE+A  D+VR+LPKC+HGFHVRCIDKWL+SHSSCPTCRHCLI+TC
Sbjct  125  ELKLPGLDSECIICLSEYAINDQVRILPKCHHGFHVRCIDKWLNSHSSCPTCRHCLIETC  184

Query  607  QKIVGC  624
            QKI+GC
Sbjct  185  QKIMGC  190



>ref|XP_006305976.1| hypothetical protein CARUB_v10011239mg [Capsella rubella]
 gb|EOA38874.1| hypothetical protein CARUB_v10011239mg [Capsella rubella]
Length=216

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 128/188 (68%), Gaps = 18/188 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            M    + Q+ L +  SRKLL      +P PA S +     +    FDANVVMVLSVLLCA
Sbjct  10   MKPTEIFQEILGSSYSRKLLFHNHDQSPTPAPSPY-----AGDNNFDANVVMVLSVLLCA  64

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NSII+CALRCS++                       NTG+K+KALK+F  +SY
Sbjct  65   LVCSLGLNSIIRCALRCSNLVPSEAGDNHPVRLT---------NTGVKRKALKSFQTVSY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGLDT+CAICLSEF + +RV+LLP CNHGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  116  STELNLPGLDTECAICLSEFVSEERVKLLPTCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  175

Query  601  TCQKIVGC  624
            TC+KI  C
Sbjct  176  TCEKIADC  183



>ref|XP_009599868.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=235

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 152/231 (66%), Gaps = 16/231 (7%)
 Frame = +1

Query  67   LIMASDLLGQDFLETFR-SRKLLLSA---PAPA----NSSFDTVA-ASSTTTFDANVVMV  219
            +   S L  ++F+E F  SR+LLL A   P PA    +  FD V   ++  TFDANV+MV
Sbjct  1    MATTSTLFIKEFMENFHYSRRLLLEATVAPPPAAKISHDPFDLVPLGNNINTFDANVIMV  60

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            L+VL+ ALICSL  NSIIKCA  CSS+ +   +++   +   +  A    NTGIKKK L 
Sbjct  61   LAVLVFALICSLVFNSIIKCAFTCSSMVSVSDSSSNHRNPSAAKLA----NTGIKKKTLN  116

Query  400  TFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
            TFPVI+Y  + K PGLD++C ICLSEF  G++V++LPKCNHGFHV+CIDKWL+SHSSCPT
Sbjct  117  TFPVITYTTELKHPGLDSECVICLSEFGVGEKVKVLPKCNHGFHVKCIDKWLNSHSSCPT  176

Query  580  CRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            CRHCLI+TCQK V       +   T      V   +V++IEPL REG+  N
Sbjct  177  CRHCLIETCQKFV---HGGTSVTTTAIPNTQVAQDIVIRIEPLQREGVTSN  224



>ref|XP_009107312.1| PREDICTED: RING-H2 finger protein ATL78-like [Brassica rapa]
Length=210

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 131/188 (70%), Gaps = 14/188 (7%)
 Frame = +1

Query  64   VLIMASDLLGQDFLETFRSRKLLLS-APAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            V  M    + QD L +  SR+LLL  +P+P  S +          FDANVVMVLSVLLCA
Sbjct  3    VPTMKQTNIFQDILVSCYSRRLLLEQSPSPTPSPY-----VEDNNFDANVVMVLSVLLCA  57

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
             +CSLG+NSII+CAL CSS+A       + ++           NTG+K+KALK+F  ISY
Sbjct  58   FLCSLGLNSIIRCALMCSSLAPSEADNNQTAARMT--------NTGVKRKALKSFQTISY  109

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            AAD  +PGLDT+C ICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCL++
Sbjct  110  AADLNLPGLDTECVICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLVE  169

Query  601  TCQKIVGC  624
            TCQKI  C
Sbjct  170  TCQKIADC  177



>gb|KDO53392.1| hypothetical protein CISIN_1g042990mg [Citrus sinensis]
Length=165

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 130/175 (74%), Gaps = 13/175 (7%)
 Frame = +1

Query  214  MVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKA  393
            MVLSVLLCALICSLG+NSII+C +RCSS+ A R+ A+  ++           N GIK+KA
Sbjct  1    MVLSVLLCALICSLGLNSIIRCVVRCSSLVASRSGASNSAAILP--------NKGIKQKA  52

Query  394  LKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSC  573
            LKTFPV+SY+A+  + GLDT+C ICLSEFAAGDR+RLLPKCNHGFHVRCIDKWLSSHSSC
Sbjct  53   LKTFPVVSYSAELNLAGLDTECVICLSEFAAGDRLRLLPKCNHGFHVRCIDKWLSSHSSC  112

Query  574  PTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            P CRHCLI+TCQKI+GC     +Q  + +  P      ++ I PL  EGLI NY 
Sbjct  113  PKCRHCLIETCQKIIGC-----SQAASSSENPVTAQETIVTITPLEPEGLIRNYR  162



>ref|XP_010093096.1| RING-H2 finger protein ATL78 [Morus notabilis]
 gb|EXB53534.1| RING-H2 finger protein ATL78 [Morus notabilis]
Length=226

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = +1

Query  190  TTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqa  369
            ++FDANVVMVLSVLLCALICSLG+NSII+CALRCS+  +   +++E  S   S+ +A   
Sbjct  47   SSFDANVVMVLSVLLCALICSLGLNSIIRCALRCSTFVSASGSSSESGSDSRSAQSAAA-  105

Query  370  NTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDK  549
            NTG+KKKALKTFP +S+++D  +PGLD++CAICLS+FAAGD +RLLPKCNHGFH RCIDK
Sbjct  106  NTGVKKKALKTFPTVSFSSDLNLPGLDSECAICLSDFAAGDSLRLLPKCNHGFHARCIDK  165

Query  550  WLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIP  729
            WL+SHSSCP CRH L++TCQKIVG     A            P+ VVL + PL  EG I 
Sbjct  166  WLNSHSSCPKCRHNLLETCQKIVG-----AASSSEQFPAVQDPSAVVLAVSPLEPEGPIR  220

Query  730  NY  735
            +Y
Sbjct  221  SY  222



>ref|XP_010680275.1| PREDICTED: RING-H2 finger protein ATL78-like [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 144/234 (62%), Gaps = 29/234 (12%)
 Frame = +1

Query  79   SDLLGQDFLETFRSRKLLLS--------------APAPANSSFD-TVAASSTTTFDANVV  213
            S LL Q+ +   +S + LL                P   N+  D T   S T  FDANVV
Sbjct  7    SPLLHQELVVNLQSSRRLLQHHPLYQTPPAAATLQPPRTNNQVDPTDPYSGTNGFDANVV  66

Query  214  MVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKA  393
            MVLSVLLCALICSLG+NSIIKCALRCS       +A   S            NTGIKKKA
Sbjct  67   MVLSVLLCALICSLGLNSIIKCALRCSYFMPRDPSATSGSE-----------NTGIKKKA  115

Query  394  LKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSC  573
            LKTF V++Y+ + K+PGL T+C ICLS+F  G+++RLLPKC+HGFH+RCIDKWL++HSSC
Sbjct  116  LKTFAVVNYSPNLKLPGLGTECVICLSDFTPGEKLRLLPKCHHGFHIRCIDKWLNTHSSC  175

Query  574  PTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            PTCRHCLI+TCQKIV    +       P T        ++ I PL RE L+ +Y
Sbjct  176  PTCRHCLIETCQKIVD---SDQASSSQPDTLALPLQPTIINIAPLEREDLVRSY  226



>ref|NP_175349.1| RING-H2 finger protein ATL78 [Arabidopsis thaliana]
 sp|Q6NQG7.1|ATL78_ARATH RecName: Full=RING-H2 finger protein ATL78 [Arabidopsis thaliana]
 gb|AAQ65112.1| At1g49230 [Arabidopsis thaliana]
 dbj|BAD43998.1| putative RING zinc finger protein [Arabidopsis thaliana]
 dbj|BAD44275.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE32407.1| RING-H2 finger protein ATL78 [Arabidopsis thaliana]
Length=219

 Score =   199 bits (505),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 125/181 (69%), Gaps = 17/181 (9%)
 Frame = +1

Query  94   QDFLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGV  261
            Q+ L +  SRKLL      +P PA S +          FDANVVMVLSVLLCAL+CSLG+
Sbjct  19   QEILGSSYSRKLLFHTHDQSPTPAPSPY-----VGDNNFDANVVMVLSVLLCALVCSLGL  73

Query  262  NSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMP  441
            NSII+CALRCS++                       NTG+K+KALK+F  +SY+ +  +P
Sbjct  74   NSIIRCALRCSNLVPSEAGGDNYPVRLT--------NTGVKRKALKSFQTVSYSTELNLP  125

Query  442  GLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            GLDT+CAICLSEF A +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLIQTC+KI  
Sbjct  126  GLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQTCEKIAD  185

Query  622  C  624
            C
Sbjct  186  C  186



>ref|XP_010461760.1| PREDICTED: RING-H2 finger protein ATL78 [Camelina sativa]
Length=216

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 127/188 (68%), Gaps = 18/188 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            M    + Q+ L +  SRKLL      +P PA S +          FDANVVMVLSVLLCA
Sbjct  10   MKPTEIFQEILGSSYSRKLLFHSRDQSPTPAPSPY-----VGDNNFDANVVMVLSVLLCA  64

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NSII+CALRCS++                       NTG+K+KALK+F  +SY
Sbjct  65   LVCSLGLNSIIRCALRCSNLVPSEAGDNHPVRLT---------NTGVKRKALKSFQTVSY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGLDT+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  116  STELNLPGLDTECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  175

Query  601  TCQKIVGC  624
            TC+KI  C
Sbjct  176  TCEKIADC  183



>ref|XP_010479357.1| PREDICTED: RING-H2 finger protein ATL78 [Camelina sativa]
Length=216

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 128/188 (68%), Gaps = 18/188 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            M    + Q+ L +  SRKLL      +P PA S +          FDANVVMVLSVLLCA
Sbjct  10   MKPTEIFQEILGSSYSRKLLSHSRDQSPTPAPSPY-----VGDNNFDANVVMVLSVLLCA  64

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NSII+CALRCS++        +              NTG+K+KALK+F  +SY
Sbjct  65   LVCSLGLNSIIRCALRCSNLVPSEAGDNQSVRLT---------NTGVKRKALKSFQTVSY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGLDT+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  116  STELNLPGLDTECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  175

Query  601  TCQKIVGC  624
            TC+KI  C
Sbjct  176  TCEKIADC  183



>ref|XP_010500464.1| PREDICTED: RING-H2 finger protein ATL78-like [Camelina sativa]
Length=216

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 127/188 (68%), Gaps = 18/188 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            M    + Q+ L +  SRKLL      +P PA S +          FDANVVMVLSVLLCA
Sbjct  10   MKPTEIFQEILGSSYSRKLLFHSRDQSPTPAPSPY-----VGDNNFDANVVMVLSVLLCA  64

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NSII+CALRCS++                       NTG+K+KALK+F  +SY
Sbjct  65   LVCSLGLNSIIRCALRCSNLVPSEAGDNHPVRLT---------NTGVKRKALKSFQTVSY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGLDT+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  116  STELNLPGLDTECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  175

Query  601  TCQKIVGC  624
            TC+KI  C
Sbjct  176  TCEKIADC  183



>gb|KFK36034.1| hypothetical protein AALP_AA4G069000 [Arabis alpina]
Length=216

 Score =   198 bits (504),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 129/188 (69%), Gaps = 18/188 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLL----LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            M    + Q+ L +  SR+LL    + +P PA S++     +    FDANVVMVLSVLLCA
Sbjct  10   MKQAQIFQEILGSSYSRRLLFHTRVQSPTPAPSAY-----AGDNNFDANVVMVLSVLLCA  64

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG+NSII+CALRCS++                       NTG+K+KALK F  +SY
Sbjct  65   LVCSLGLNSIIRCALRCSNLVPPEAGDNHAVGLT---------NTGVKRKALKRFQTVSY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + D  +PGLDT+CAICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCLI+
Sbjct  116  SPDLNLPGLDTECAICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIE  175

Query  601  TCQKIVGC  624
            TC+KI  C
Sbjct  176  TCEKIADC  183



>gb|AFK42323.1| unknown [Medicago truncatula]
Length=228

 Score =   199 bits (505),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 140/224 (63%), Gaps = 18/224 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTT--------TFDANVVMVLSVLLCAL  243
            L  + +E F SR+LLL +   AN    T    ST          FDANVVMVLSVLLCAL
Sbjct  11   LLHELVENFHSRRLLLHSSNSANPPISTSIHDSTKESSYAGDGNFDANVVMVLSVLLCAL  70

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSL +NSII+CAL+CS++   R   +  +    ++      NTGIKKKALK F  +SY+
Sbjct  71   ICSLCLNSIIRCALKCSNLVVMRGDRSANNIPVRAA------NTGIKKKALKKFTTVSYS  124

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             + K+  LD++C ICLSEF  GD+VRLLPKCNHGFHVRCIDKWLSSHSSCP CR CLI+T
Sbjct  125  DELKLLSLDSECVICLSEFTNGDKVRLLPKCNHGFHVRCIDKWLSSHSSCPKCRQCLIET  184

Query  604  CQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            C KIVG    +      P          ++ I PL  EGL+ NY
Sbjct  185  CNKIVG----SQGSSSQPQPMLFPVPETIVTIAPLEPEGLVRNY  224



>ref|XP_009619519.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=238

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 136/200 (68%), Gaps = 23/200 (12%)
 Frame = +1

Query  67   LIMASDLLGQDFLETFR-SRKLLL-------------SAPAPANS-SFDTVAASSTTTFD  201
            +   S +  Q+F+E F  SR+LLL              AP PA   S DT   +    FD
Sbjct  1    MATTSTIFNQEFMENFHHSRRLLLIPITLQQQHPETTVAPPPATGISHDT---TDQPPFD  57

Query  202  ANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGI  381
            ANVVMVLSVL+C++ICSL VN +IKCALRC+S     +++   + S    A     NTGI
Sbjct  58   ANVVMVLSVLICSIICSLIVNCLIKCALRCASRVLADSSSNHTNRSVAKLA-----NTGI  112

Query  382  KKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSS  561
            KKKALKTFPVI+Y  + K PG+ T+C IC+SEF  G++V++LPKCNHGFHV+CIDKWL+S
Sbjct  113  KKKALKTFPVITYTTELKYPGVGTECVICISEFGVGEKVKVLPKCNHGFHVKCIDKWLNS  172

Query  562  HSSCPTCRHCLIQTCQKIVG  621
            +SSCPTCRHCLI+TCQKIV 
Sbjct  173  NSSCPTCRHCLIETCQKIVN  192



>ref|XP_006427853.1| hypothetical protein CICLE_v10026487mg [Citrus clementina]
 gb|ESR41093.1| hypothetical protein CICLE_v10026487mg [Citrus clementina]
 gb|KDO53393.1| hypothetical protein CISIN_1g028342mg [Citrus sinensis]
Length=210

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 133/179 (74%), Gaps = 9/179 (5%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            L QDFL  F SRKLLL    P  ++  +      ++FD+NV+MVLSVLLCALIC++G+ S
Sbjct  11   LFQDFLGKFHSRKLLLQNQQPVIAAPPS-NRGGESSFDSNVLMVLSVLLCALICAIGLAS  69

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            ++KC+LRCS + A  ++A    S           ++GIK+KALKTF V+ Y+ + K+PGL
Sbjct  70   LVKCSLRCSRLEASESSANSSGSGSC--------SSGIKQKALKTFTVVKYSTELKLPGL  121

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            DT+C ICLSEFA G+RVRLLPKCNHGFHVRCIDKWL S+SSCP CRHCLI++CQKIVGC
Sbjct  122  DTECVICLSEFAPGERVRLLPKCNHGFHVRCIDKWLRSNSSCPKCRHCLIESCQKIVGC  180



>emb|CDX77259.1| BnaC08g03040D [Brassica napus]
Length=252

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 14/188 (7%)
 Frame = +1

Query  64   VLIMASDLLGQDFLETFRSRKLLLS-APAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            V  M    + QD L +  SR+LLL  +P+P  S +          FDANVVMVLSVLLCA
Sbjct  45   VPTMKQTNIFQDILVSCYSRRLLLEQSPSPTPSPY-----VEDNNFDANVVMVLSVLLCA  99

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
             +CSLG+NSII+CAL CSS+A       + ++           NTG+K++ALK+F  ISY
Sbjct  100  FLCSLGLNSIIRCALMCSSLAPSEADNNQTAARMT--------NTGVKREALKSFQTISY  151

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            AAD  +PGLDT+C ICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCL++
Sbjct  152  AADLNIPGLDTECVICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLVE  211

Query  601  TCQKIVGC  624
            TCQKI  C
Sbjct  212  TCQKIADC  219



>ref|XP_006464564.1| PREDICTED: RING-H2 finger protein ATL78-like [Citrus sinensis]
Length=229

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 133/179 (74%), Gaps = 9/179 (5%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            L QDFL  F SRKLLL    P  ++  +     ++ FD+NV+MVLSVLLCALIC++G+ S
Sbjct  30   LFQDFLGKFHSRKLLLQNQQPVIAAPPSNRGGESS-FDSNVLMVLSVLLCALICAIGLAS  88

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            ++KC+LRCS + A  ++A    S   S        +GIK+KALKTF V+ Y+ + K+PGL
Sbjct  89   LVKCSLRCSRLEASESSANSSGSGSCS--------SGIKQKALKTFTVVKYSTELKLPGL  140

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            DT+C ICLSEFA G+RVRLLPKCNHGFHVRCIDKWL S+SSCP CRHCLI++CQKIVGC
Sbjct  141  DTECVICLSEFAPGERVRLLPKCNHGFHVRCIDKWLRSNSSCPKCRHCLIESCQKIVGC  199



>emb|CDY16485.1| BnaA08g02820D [Brassica napus]
Length=252

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 14/188 (7%)
 Frame = +1

Query  64   VLIMASDLLGQDFLETFRSRKLLLS-APAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            V  M    + QD L +  SR+LLL  +P+P  S +          FDANVVMVLSVLLCA
Sbjct  45   VPTMKQTNIFQDILISCYSRRLLLEQSPSPTPSPY-----VEDNNFDANVVMVLSVLLCA  99

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
             +CSLG+NSII+CAL CSS+A       + ++           NTG+K++ALK+F  ISY
Sbjct  100  FLCSLGLNSIIRCALMCSSLAPSEADNNQTAARMT--------NTGVKREALKSFQTISY  151

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            AAD  +PGLDT+C ICLSEF + +RV+LLP C+HGFHVRCIDKWLSSHSSCPTCRHCL++
Sbjct  152  AADLNIPGLDTECVICLSEFVSEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLVE  211

Query  601  TCQKIVGC  624
            TCQKI  C
Sbjct  212  TCQKIADC  219



>ref|XP_009780400.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana sylvestris]
Length=198

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 141/204 (69%), Gaps = 16/204 (8%)
 Frame = +1

Query  139  APAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrta  318
            AP PA         S   TFDANV+MVLSVL+CALIC L +NSIIK ALRCS++ +   +
Sbjct  2    APPPA------AEISHVNTFDANVIMVLSVLVCALICLLALNSIIKRALRCSNLVSASNS  55

Query  319  aaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRV  498
            ++   +   S  A    NTGIKKKALKTF VI+Y  + K PG+DT+C ICLS+F AG++V
Sbjct  56   SSNYRNPSASKLA----NTGIKKKALKTFLVITYTTELKHPGVDTECVICLSDFVAGEKV  111

Query  499  RLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqp------ptpa  660
            R+LPKCNHGFHVRCIDKWL+SHSSCPTCRH LI+TCQKIV   +++ T+        +  
Sbjct  112  RVLPKCNHGFHVRCIDKWLNSHSSCPTCRHYLIETCQKIVNGGSSSTTRSIANPHIVSNT  171

Query  661  tpppvpatvvLQIEPLHREGLIPN  732
            +       ++++IEPL REG++ N
Sbjct  172  SSTVPVQEIIIRIEPLQREGVVSN  195



>ref|XP_004249864.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum lycopersicum]
Length=208

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 141/210 (67%), Gaps = 10/210 (5%)
 Frame = +1

Query  118  SRKLL----LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            SR+LL    +S P  A  S DT       T DANV+MVL+VL+CALICSL +NSIIKCA 
Sbjct  4    SRRLLREATMSPPPAARISHDTPLGHRVNTIDANVIMVLAVLVCALICSLVLNSIIKCAF  63

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA-DAKMPGLDTDCA  462
            +CSS+     ++   S++  SS      N GIKKKALKTFPVI+Y+  + K PGLD++C 
Sbjct  64   KCSSLILADPSSNHTSNNNSSSTKLV--NRGIKKKALKTFPVITYSTTEPKHPGLDSECV  121

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaat  642
            ICLSEF  GD++++LPKCNHGFHVRCIDKWL+SHSSCPTCRH LI TC+KIV       +
Sbjct  122  ICLSEFGVGDKIKVLPKCNHGFHVRCIDKWLNSHSSCPTCRHSLIDTCEKIVN---GGNS  178

Query  643  qpptpatpppvpatvvLQIEPLHREGLIPN  732
                          V+++IEPL REG+I N
Sbjct  179  STTNNNIREAAVQQVIVRIEPLQREGVISN  208



>ref|XP_010241725.1| PREDICTED: RING-H2 finger protein ATL78-like [Nelumbo nucifera]
Length=233

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 131/184 (71%), Gaps = 27/184 (15%)
 Frame = +1

Query  118  SRKLLL---------SAPAPA------NSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
            SR+LLL          AP PA      +SS  +   ++ ++ DANV+M+LSVLLCALIC+
Sbjct  23   SRRLLLHNSHYQSPGKAPPPAGTANVLDSSDSSDPYTTGSSLDANVIMILSVLLCALICA  82

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG+NSII+CALR              S    ++ + + ANTG+K+KALK FP ++Y+A  
Sbjct  83   LGLNSIIRCALR------------WSSRVTSNTTSQKLANTGVKRKALKAFPTLTYSAGL  130

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            ++PGLD+ CAICLSEF  G+RVR+LPKC HGFH+RCIDKWLSSHSSCPTCRHCLI+TCQK
Sbjct  131  ELPGLDSACAICLSEFCPGERVRILPKCKHGFHIRCIDKWLSSHSSCPTCRHCLIETCQK  190

Query  613  IVGC  624
            IVGC
Sbjct  191  IVGC  194



>emb|CDX95503.1| BnaC01g33950D [Brassica napus]
Length=224

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 134/190 (71%), Gaps = 18/190 (9%)
 Frame = +1

Query  82   DLLGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLL  234
             +L Q+ L  F SR+LLL         ++P  A++   +++ +   +FD NVVMVLSVL 
Sbjct  13   SVLFQNILGNFYSRRLLLHTSSQPPTIASPPFADTQEASLSYAHHMSFDTNVVMVLSVLF  72

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
             AL+CSLG++SII+  +R          +   SS   +  A R ANTG+K+KALK+F  +
Sbjct  73   FALVCSLGLHSIIRVVMR---------YSNLLSSEASNELAVRLANTGVKRKALKSFQTL  123

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            SY+ + K+PGL T+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCRHCL
Sbjct  124  SYSTELKLPGLGTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCL  183

Query  595  IQTCQKIVGC  624
            IQTCQKI GC
Sbjct  184  IQTCQKIAGC  193



>ref|XP_006351101.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=219

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 146/229 (64%), Gaps = 25/229 (11%)
 Frame = +1

Query  73   MASDLLGQDFLETFR-SRKLLLS---APAPA-----NSSFDTVAASSTTTFDANVVMVLS  225
            + S LL Q+F+E F  SR+LL     AP PA     +++          TFDANV+MVL+
Sbjct  4    ITSTLLIQEFMENFHYSRRLLTESTMAPPPAAGISHSTTNHQPFGHKVNTFDANVIMVLA  63

Query  226  VLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTF  405
            VLLCALICS  +N IIKC  RC+++    ++    +++  S+      N GI+KK LKTF
Sbjct  64   VLLCALICSFILNFIIKCVCRCTTLILVDSSLNHINNNPSSTKLV---NRGIEKKTLKTF  120

Query  406  PVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCR  585
            PVI+Y  + K PG D++C ICLSEF  G+++++LPKCNHGFHV+CIDKWL+SHSSCPTCR
Sbjct  121  PVITYTTELKHPGFDSECVICLSEFGIGEKIKVLPKCNHGFHVKCIDKWLNSHSSCPTCR  180

Query  586  HCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            HCLI+T QKIV                  +   VV++IEPL RE +I N
Sbjct  181  HCLIETYQKIVP-------------ISSALVQEVVIRIEPLQREDVISN  216



>ref|XP_009599867.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=226

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = +1

Query  121  RKLLLSAPAPANSSFDTVA----ASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALR  288
            R+  ++ P  A  S D        ++  TFDAN +MVL+VL+ ALICSL  NSIIKCAL 
Sbjct  22   REATMAPPPAAEISHDPTDLVPLGNNVNTFDANAIMVLAVLVFALICSLVFNSIIKCALT  81

Query  289  CssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAIC  468
            CSS       ++    +  ++      NTGIKKKALKTFPVI+Y  + K PGLD++C IC
Sbjct  82   CSSRLLSAPDSSSNRRNPSAAKLP---NTGIKKKALKTFPVITYTTELKDPGLDSECVIC  138

Query  469  LSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqp  648
            LSEF  G++V++LPKCNHGFHV+CIDKWL+SHSSCPTCRHCLI+TCQKI+      +   
Sbjct  139  LSEFGVGEKVKVLPKCNHGFHVKCIDKWLNSHSSCPTCRHCLIETCQKIIN---GGSATI  195

Query  649  ptpatpppvpatvvLQIEPLHREGLIPN  732
             T +T       +V++IEPL REG+  N
Sbjct  196  VTNSTSSAAVQEIVIRIEPLQREGVTSN  223



>ref|XP_006351190.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=193

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 132/201 (66%), Gaps = 20/201 (10%)
 Frame = +1

Query  142  PAPANSSFDTV----AASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaag  309
            P  A  S DT+       +  TFDANV+MVL+VL+ A+ICSL +NSIIKC  RCS+I   
Sbjct  5    PMEAGISHDTIDDLQIGKNVNTFDANVIMVLAVLVSAIICSLVLNSIIKCFFRCSTIVLI  64

Query  310  rtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAG  489
             + +   + S          N GIKKKALKTFP+I+Y  + K PGLD++C ICL EF  G
Sbjct  65   DSYSNHTNPSST--------NKGIKKKALKTFPIITYTTELKHPGLDSECVICLLEFIVG  116

Query  490  DRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpp  669
            ++V++LPKCNHGFHV+CIDKWL+SHSSCPTCRHCLI+TCQKIV              T  
Sbjct  117  EKVKVLPKCNHGFHVKCIDKWLNSHSSCPTCRHCLIETCQKIVN--------SDNSVTTN  168

Query  670  pvpatvvLQIEPLHREGLIPN  732
                 +V++IEPL REG+I N
Sbjct  169  ATVEEIVIRIEPLEREGVISN  189



>ref|XP_006351103.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=215

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 148/219 (68%), Gaps = 13/219 (6%)
 Frame = +1

Query  103  LETFR-SRKLL----LSAPAPANSSFDTVA----ASSTTTFDANVVMVLSVLLCALICSL  255
            +E F  SR+LL    +S P  A    DT+          T DANV+MVL+VL+CALICSL
Sbjct  1    MENFHYSRRLLREATMSPPPEAGIRHDTMDHPPLGHRVNTIDANVIMVLAVLVCALICSL  60

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
             +NSIIKCA +CSS+     ++   S++  SS      N GIKKKALKTFPVI+Y  + K
Sbjct  61   VLNSIIKCAFKCSSLILADPSSNHTSNNNSSSTKLV--NRGIKKKALKTFPVITYTTELK  118

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
             PGLD++C ICLSEF  GD++++LPKCNHGFHVRCIDKWL+SH+SCPTCRH LI+TC+KI
Sbjct  119  HPGLDSECVICLSEFGVGDKIKVLPKCNHGFHVRCIDKWLNSHTSCPTCRHSLIETCEKI  178

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            V      ++   T ++       V+++IEPL REG+I N
Sbjct  179  V--NGGNSSSNNTSSSSEAAVQEVIVRIEPLQREGVISN  215



>ref|XP_009619518.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=227

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 152/226 (67%), Gaps = 14/226 (6%)
 Frame = +1

Query  79   SDLLGQDFLETFR-SRKLLL-SAPAPANSSFDTVAA------SSTTTFDANVVMVLSVLL  234
            S L  Q+F E F  SR+LLL     P N    T+A       S   TFDANV+MVLSVL+
Sbjct  5    STLFIQEFTENFHHSRRLLLIPTTVPQNYPEATMAPLAEAEISHVNTFDANVIMVLSVLV  64

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALICSL +NSIIKCAL+    ++   +A++ SS+  + +AA+ ANTGIKKKALKTFPVI
Sbjct  65   CALICSLALNSIIKCALK---YSSSLVSASDSSSNYRNPSAAKLANTGIKKKALKTFPVI  121

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
            +Y  + K PGLD++C ICLSEF  G+++++LPKCNHGFHV CIDKWL+SHSSCPTCR+CL
Sbjct  122  TYTTELKHPGLDSECVICLSEFGVGEKIKVLPKCNHGFHVNCIDKWLNSHSSCPTCRNCL  181

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            I+    I G ++          +  P    ++++IE L REG+  N
Sbjct  182  IEI---INGGSSTTVELASNSTSSAPGIQEIIIRIESLQREGVTSN  224



>ref|XP_004250440.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum lycopersicum]
Length=210

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 141/222 (64%), Gaps = 24/222 (11%)
 Frame = +1

Query  103  LETFR-SRKLLLSA------PAPAN-SSFDTV----AASSTTTFDANVVMVLSVLLCALI  246
            +E F  SR+LL         P PA  +S +T+       +  TFDANV+MVL+V + A+I
Sbjct  1    MENFHHSRRLLWEVAAVVPPPMPAGITSPETIDDLQIGKNVNTFDANVIMVLAVFVSAII  60

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            CSL +NSIIKC  RCS++    + +   + S          N GIKKKALKTFP++ Y  
Sbjct  61   CSLVLNSIIKCFFRCSTLVLIDSYSNHTNPSST--------NKGIKKKALKTFPIVRYTT  112

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTC  606
            + K PGLD++C ICLSEF  GD+V++LPKCNHGFHV+CIDKWL+SHSSCPTCRHCLI+TC
Sbjct  113  ELKHPGLDSECVICLSEFIVGDKVKVLPKCNHGFHVKCIDKWLNSHSSCPTCRHCLIETC  172

Query  607  QKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            QKIV           T A        +V +IEPL REG+I N
Sbjct  173  QKIVN----GDNFVTTNAISSSTVEEIVTRIEPLEREGVISN  210



>ref|XP_002298708.2| hypothetical protein POPTR_0001s31720g [Populus trichocarpa]
 gb|EEE83513.2| hypothetical protein POPTR_0001s31720g [Populus trichocarpa]
Length=220

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 144/233 (62%), Gaps = 36/233 (15%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVA------------ASSTTTFDANVVMV  219
             S LL Q FL  F  RKLLL  P    SS  + +            A+    FD NVVMV
Sbjct  7    TSPLLFQQFLGDFHPRKLLLHNPLSQPSSIASPSPSGNIQDPLNPNANGDKHFDINVVMV  66

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            L VL+CAL+ SLG+NS I+CA+RCS +    +                  N GIKKKAL+
Sbjct  67   LIVLICALLVSLGLNSFIRCAVRCSYLNGNSS------------------NRGIKKKALR  108

Query  400  TFPVISYAAD-AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCP  576
            TFP+ +Y+ + +K+PGLDT C IC+SEF  GDRVR+LPKC+HGFHV+CID+WLSSHSSCP
Sbjct  109  TFPIENYSPEKSKLPGLDTQCVICISEFVHGDRVRILPKCSHGFHVKCIDEWLSSHSSCP  168

Query  577  TCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            TCRHCL++TCQKI G      +Q  +   PP V    V+ I PL REGL+ NY
Sbjct  169  TCRHCLMETCQKIAG-----VSQASSSEQPPSVAQERVVNIAPLEREGLVCNY  216



>ref|XP_009112396.1| PREDICTED: RING-H2 finger protein ATL78-like [Brassica rapa]
 emb|CDY18544.1| BnaA01g26510D [Brassica napus]
Length=224

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 133/188 (71%), Gaps = 18/188 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            L Q+ L  F SR+LLL         ++P  A++   +++ +   + D NVV+VLSVL  A
Sbjct  15   LFQNVLGKFYSRRLLLHLSSQPPTIASPPFADTQEASLSYAHHMSLDTNVVIVLSVLFFA  74

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            L+CSLG++SII+  +R          +   SS   +  A R ANTG+K+KALK+F  +SY
Sbjct  75   LVCSLGLHSIIRVVMR---------YSNLLSSEANNELAVRLANTGVKRKALKSFQTLSY  125

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + + K+PGLDT+CAICLSEF +G+RV+LLPKC+HGFHVRCIDKWLSSHSSCPTCRHCLIQ
Sbjct  126  SMELKLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ  185

Query  601  TCQKIVGC  624
            TCQKI GC
Sbjct  186  TCQKIAGC  193



>ref|XP_004250441.1| PREDICTED: RING-H2 finger protein ATL78-like isoform X1 [Solanum 
lycopersicum]
Length=220

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 148/229 (65%), Gaps = 26/229 (11%)
 Frame = +1

Query  76   ASDLLGQDFLETFR-SRKLL----LSAPAPANSSFDTVA----ASSTTTFDANVVMVLSV  228
             S LL Q+F+E F  SR+LL    ++ P  A  S  T           T DANV+MVL+V
Sbjct  5    TSTLLIQEFMENFHYSRRLLPESTMAPPPAAGISHSTTNHQPFGHKVNTLDANVIMVLAV  64

Query  229  LLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFP  408
            L+CALICS  +N IIKC  RC+++    +++   +++  S+      N GI+KKALKTFP
Sbjct  65   LVCALICSFILNFIIKCVCRCTNLILVDSSSNHTNNNPSSTKLV---NRGIEKKALKTFP  121

Query  409  VISYAA-DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCR  585
            VI+Y+  + K PGLD++C ICLSEF  G+++++LPKCNHGFHV+CIDKWL+SHSSCPTCR
Sbjct  122  VITYSTTEFKYPGLDSECVICLSEFGIGEKIKVLPKCNHGFHVKCIDKWLNSHSSCPTCR  181

Query  586  HCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            HCLI+TCQKIV                  +   VV++IEPL RE ++ N
Sbjct  182  HCLIETCQKIVP-------------ISSALVQEVVIRIEPLQREDVVSN  217



>ref|XP_003630197.1| RING finger protein [Medicago truncatula]
 gb|AET04673.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=228

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 135/193 (70%), Gaps = 15/193 (8%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAP----APANSSFDTVAASSTTT------FDANVVMVL  222
              S LL +  +E+  +R+LL   P    +P +S   T   +ST +      FDANVVM+L
Sbjct  7    FTSQLLHELLVES-HTRRLLFQNPIDYQSPTSSPVLTHNHNSTNSYFGIREFDANVVMIL  65

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            +VLLCALICSL +NSII+CALR     +        SSS  S+++ + AN GIKKKALKT
Sbjct  66   AVLLCALICSLALNSIIRCALR----FSNVALNNGSSSSSSSNSSPQLANKGIKKKALKT  121

Query  403  FPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTC  582
            FP +SY+ + K+P LDT+C ICLSEF  G++VR+LPKCNHGFHVRCIDKWL SHSSCP C
Sbjct  122  FPTVSYSTELKLPTLDTECVICLSEFTKGEKVRILPKCNHGFHVRCIDKWLKSHSSCPKC  181

Query  583  RHCLIQTCQKIVG  621
            R CL++TC+KIVG
Sbjct  182  RQCLLETCRKIVG  194



>ref|XP_006351100.1| PREDICTED: RING-H2 finger protein ATL78-like [Solanum tuberosum]
Length=218

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 145/229 (63%), Gaps = 24/229 (10%)
 Frame = +1

Query  73   MASDLLGQDFLETFR-SRKLL----LSAPAPANSSFDTVA----ASSTTTFDANVVMVLS  225
            + S LL Q+F+E F  SR+LL    ++ P  A    DT           TFD NV+MVL+
Sbjct  4    ITSTLLIQEFMENFHYSRRLLREATMAPPPAAGIRHDTTNHPPLGYKVNTFDENVIMVLA  63

Query  226  VLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTF  405
            +L+CA+ICS  +N IIKCA  CS++    ++++  +++  SS      N GI+KKALKTF
Sbjct  64   ILVCAIICSFVLNFIIKCAFHCSTLILANSSSSNHTNNNPSSTKLA--NRGIEKKALKTF  121

Query  406  PVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCR  585
            PVI+Y  + K P LD++C ICLSEF  G+++++LPKCNHGFHVRCIDKWL+SHSSCPTCR
Sbjct  122  PVITYTTELKHPRLDSECVICLSEFQIGEKIKVLPKCNHGFHVRCIDKWLNSHSSCPTCR  181

Query  586  HCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            HCLI+TCQKI                       V+++IEPL RE  I N
Sbjct  182  HCLIETCQKI-------------DPISLAPIQEVIIRIEPLQREDAISN  217



>ref|XP_009772838.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana sylvestris]
Length=224

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 142/206 (69%), Gaps = 8/206 (4%)
 Frame = +1

Query  121  RKLLLSAPAPANSSFDT--VAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            R+  ++ P  A  S D   +   +  TFDAN +MVL+VL+ A ICSL +NSIIKCALRCS
Sbjct  22   REANMAPPPAAEISHDATDLLLGNNNTFDANAIMVLAVLVFAFICSLVLNSIIKCALRCS  81

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
            S+A+   +++   +   +  A    NTGIKKKAL TFP+++Y  + K  GLD++C ICLS
Sbjct  82   SLASALDSSSNHRNPSATKLA----NTGIKKKALNTFPIVTYTTELKHAGLDSECVICLS  137

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqppt  654
            EF  G++V++LPKCNHGFHV+CIDKWL+SHSSCPTCRHCLI+TCQKI+     ++T    
Sbjct  138  EFGIGEKVKVLPKCNHGFHVKCIDKWLNSHSSCPTCRHCLIETCQKIIN--GGSSTIVTN  195

Query  655  patpppvpatvvLQIEPLHREGLIPN  732
             +T       +V++IEPL REG+  N
Sbjct  196  SSTSSAAVQEIVIRIEPLQREGVTSN  221



>ref|XP_011045715.1| PREDICTED: RING-H2 finger protein ATL78-like [Populus euphratica]
Length=220

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 143/233 (61%), Gaps = 36/233 (15%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVA------------ASSTTTFDANVVMV  219
             S LL Q F   F  RKLLL  P    SS  + +            AS    FD NVVMV
Sbjct  7    TSPLLFQQFPGDFHPRKLLLHNPLSQPSSIASPSPSGNIQDPLNPNASGDKHFDINVVMV  66

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            L VL+CAL+ SLG+NS I+CA+RCS +    +                  N GIKKKAL+
Sbjct  67   LIVLICALLVSLGLNSFIRCAVRCSYLNGHSS------------------NRGIKKKALR  108

Query  400  TFPVISYAAD-AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCP  576
            TFP+ +Y+ + +K+PGLDT C IC+SEF  GDRVR+LPKC+HGFHV+CID+WLSSHSSCP
Sbjct  109  TFPIENYSPEKSKLPGLDTQCVICISEFVHGDRVRILPKCSHGFHVKCIDEWLSSHSSCP  168

Query  577  TCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            TCRHCL++TC+KI G      +Q  +   PP V    V+ I PL REGL+ NY
Sbjct  169  TCRHCLMETCRKIAG-----VSQASSSEQPPSVAQERVVNIAPLEREGLVCNY  216



>ref|XP_006427851.1| hypothetical protein CICLE_v10026409mg [Citrus clementina]
 ref|XP_006464866.1| PREDICTED: RING-H2 finger protein ATL78-like [Citrus sinensis]
 gb|ESR41091.1| hypothetical protein CICLE_v10026409mg [Citrus clementina]
Length=231

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 144/221 (65%), Gaps = 15/221 (7%)
 Frame = +1

Query  88   LGQDFLETFRSRKLL-----LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
            L QDF     SRKLL     L+ P PA +       SS +  D NV++VLSVL+C +IC+
Sbjct  12   LFQDFPRKLHSRKLLPTHNPLNQP-PATAPPHPSLFSSESNLDKNVLIVLSVLVCTVICT  70

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            + +N +IKCAL               S SG +S+A +  N GI KKALK FPV+ Y+A+ 
Sbjct  71   IVLNFVIKCAL-------SSLRLLLSSDSGTNSSATKAINKGINKKALKAFPVVKYSAEL  123

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K+PGLD +C ICLS+FA G+RVRLLPKCNHGFHVRCID+WL S+SSCP CRHCLI+TC+K
Sbjct  124  KLPGLDAECVICLSDFALGERVRLLPKCNHGFHVRCIDRWLRSNSSCPKCRHCLIETCEK  183

Query  613  IVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            IVGC  +        ++  PV  TVV+ I PL  EG+I NY
Sbjct  184  IVGC--SQQQASSLASSTAPVQETVVISIVPLEPEGVIQNY  222



>ref|XP_009765992.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana sylvestris]
Length=239

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 143/237 (60%), Gaps = 24/237 (10%)
 Frame = +1

Query  79   SDLLGQDFLETFR-SRKLLL-------SAPAPANSSFDTVAASSTTT----FDANVVMVL  222
            S +  Q+ +E F  SR LLL         P  A +       S  TT    FDA+VVM+L
Sbjct  5    STIFNQELMENFHYSRSLLLIPTTLQQYHPETAVAQPPATGISHDTTDQPPFDADVVMIL  64

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            SVL+C++ICSL VN +IKCALRC+S     +++   + S    A     NTGIKK ALKT
Sbjct  65   SVLICSIICSLIVNCLIKCALRCASRVLEESSSNHTNPSVAKLA-----NTGIKKNALKT  119

Query  403  FPVISYAADA-KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
            FPVI+Y  +    PG+ T+C ICLSEF  G++V++LPKCNHGFHV+CIDKWL+SHSSCPT
Sbjct  120  FPVITYTTEILNYPGVGTECVICLSEFGVGEKVKVLPKCNHGFHVKCIDKWLNSHSSCPT  179

Query  580  CRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvv------LQIEPLHREGLIPN  732
            CRHCL +TCQKIV   ++  T             T        ++IE L REG+I N
Sbjct  180  CRHCLTETCQKIVNGGSSVTTTAIPNTQVATSTTTSAPVQEIIIRIESLQREGVISN  236



>gb|AFK36272.1| unknown [Lotus japonicus]
Length=175

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 124/180 (69%), Gaps = 13/180 (7%)
 Frame = +1

Query  214  MVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKA  393
            MVLSV+LCALICSLG+NSII+CALRCS++     +     +           NTG+KKKA
Sbjct  1    MVLSVVLCALICSLGLNSIIRCALRCSNLVVIGDSVTNSPTRAA--------NTGVKKKA  52

Query  394  LKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSC  573
            LKTFPV+SY+A+  +P LD++C ICLSEF  G++VR+LPKCNHGFHVRCIDKWLSSHSSC
Sbjct  53   LKTFPVVSYSAELNLPSLDSECVICLSEFTNGEKVRILPKCNHGFHVRCIDKWLSSHSSC  112

Query  574  PTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvL-----QIEPLHREGLIPNYH  738
            P CR CLI+TC+KIVG T +++    +     P     VL      I PL  EG++ +Y 
Sbjct  113  PKCRQCLIETCEKIVGATTSSSQPQLSVVVVTPNLLDPVLLETVVTIAPLEPEGMVRSYR  172



>ref|XP_007048259.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX92416.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=205

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 121/184 (66%), Gaps = 14/184 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
              QD LE F  RK LL        APA S     + + T  FD NV++V+S+L+C+LI S
Sbjct  10   FSQDLLENFHPRKFLLYSSLYETEAPAISPAPENSYAITNNFDTNVLIVISILICSLISS  69

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG+  I+KCAL+CSS+ A    A   S            N G+++KALK FP + Y ++ 
Sbjct  70   LGLFCIVKCALKCSSLVAAEPDANPPSKLA---------NAGVEQKALKAFPTVKYTSEL  120

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K+PGLDT C ICLSEFAAG+R+R+LPKCNHGFH  CID+WLS+HSSCPTCRHCL +T QK
Sbjct  121  KLPGLDTACVICLSEFAAGERLRILPKCNHGFHTHCIDQWLSAHSSCPTCRHCLTETDQK  180

Query  613  IVGC  624
             V C
Sbjct  181  TVNC  184



>ref|XP_008460910.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis melo]
Length=230

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 10/162 (6%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
            +AP+  +   +  +   +TTFD NVVMVLSVLLCALICSL +NS+I+CAL+CS       
Sbjct  35   AAPSAVHDQSEFYSGGDSTTFDTNVVMVLSVLLCALICSLALNSVIRCALKCSRFLVSND  94

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDR  495
                 + +          +TG+ KKA+K+F V+ ++ D  +PGLD++C ICLSEF  GD+
Sbjct  95   HRRHPAPT----------STGVHKKAIKSFTVVQFSPDLNLPGLDSECVICLSEFVTGDK  144

Query  496  VRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            +RLLPKCNHGFHV+CIDKWLSSHSSCP CR CL+QTC+KI G
Sbjct  145  LRLLPKCNHGFHVKCIDKWLSSHSSCPKCRQCLVQTCEKIAG  186



>ref|XP_004503972.1| PREDICTED: RING-H2 finger protein ATL78-like [Cicer arietinum]
Length=225

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 143/231 (62%), Gaps = 25/231 (11%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAP----ANSSFDTVAASST------TTFDANVVMVL  222
              S LL +  +++  SR+LL   P       NSS  T   +ST      + FD++VV +L
Sbjct  7    FTSQLLHEVLVKS-HSRRLLFQDPVDHLTLTNSSVSTNNHNSTDSYFGVSEFDSHVVTIL  65

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            +VLLCALICSL +NSI++CA R     +      + SS+  ++ + +  N GIKKKALKT
Sbjct  66   AVLLCALICSLALNSIVRCAFR----FSNVAINNDSSSNYSNNHSPQLVNKGIKKKALKT  121

Query  403  FPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTC  582
            FP++ Y+A+ K+P LD++C IC+SEF  G++VR+LPKCNHGFHVRCIDKWL  HSSCP C
Sbjct  122  FPIVKYSAELKLPSLDSECVICISEFRNGEKVRILPKCNHGFHVRCIDKWLKEHSSCPKC  181

Query  583  RHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            R CL++TCQKIVG          +           +++I+PL  E L  NY
Sbjct  182  RQCLLETCQKIVG----------SQQPSVLPVPETIIRIQPLQPEALERNY  222



>ref|XP_004250442.2| PREDICTED: RING-H2 finger protein ATL78-like [Solanum lycopersicum]
Length=214

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 13/192 (7%)
 Frame = +1

Query  73   MASDLLGQDFLETFR-SRKLL----LSAPAPANSSFDTVA-----ASSTTTFDANVVMVL  222
            + S LL Q+F+E F  SR+LL    ++ P  A  S DT            TFD NV+MVL
Sbjct  4    ITSSLLIQEFMENFHYSRRLLREATMAPPPAAGISHDTTNDPPPLGHKVNTFDENVIMVL  63

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            +VL+CA+ICSL +N IIKCA  CS++    ++++  +++  SS      N GI K+ALKT
Sbjct  64   AVLVCAIICSLVLNFIIKCAFNCSTLILTNSSSSNHTNNNPSSTKLA--NRGIAKRALKT  121

Query  403  FPVISYAA-DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
            FP+I+Y+  + K P LD++C ICLSEF  GD++++LPKCNHGFHVRCIDKWL+SHSSCPT
Sbjct  122  FPIITYSTTELKHPRLDSECVICLSEFGVGDKIKVLPKCNHGFHVRCIDKWLNSHSSCPT  181

Query  580  CRHCLIQTCQKI  615
            CRHCLI+TC  I
Sbjct  182  CRHCLIETCHPI  193



>gb|AET04682.2| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=218

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 128/186 (69%), Gaps = 11/186 (6%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASS---TTTFDANVVMVLSVLLCAL  243
              S LL +  +E+  +R+LL   P     + +  + +S      F++NVVM++SVLLCA+
Sbjct  7    FTSQLLHELLVES-HTRRLLFQNPVDHQFTHNNNSTNSYFGAREFESNVVMIVSVLLCAI  65

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICS+ +NSI++CAL             + S S   +++ + AN GIKKKALKTFP +SY+
Sbjct  66   ICSIALNSIVRCALN-------VAIINDSSLSSSINSSPQFANKGIKKKALKTFPTVSYS  118

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             + K+P LDT+C ICLSEF  G++VR+LPKCNHGFHVRCIDKWL SHSSCP CR CL++T
Sbjct  119  TELKLPTLDTECVICLSEFTKGEKVRILPKCNHGFHVRCIDKWLKSHSSCPKCRQCLLET  178

Query  604  CQKIVG  621
            C+KIVG
Sbjct  179  CRKIVG  184



>ref|XP_010312460.1| PREDICTED: RING-H2 finger protein ATL78-like isoform X2 [Solanum 
lycopersicum]
Length=207

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 142/220 (65%), Gaps = 26/220 (12%)
 Frame = +1

Query  103  LETFR-SRKLL----LSAPAPANSSFDTVA----ASSTTTFDANVVMVLSVLLCALICSL  255
            +E F  SR+LL    ++ P  A  S  T           T DANV+MVL+VL+CALICS 
Sbjct  1    MENFHYSRRLLPESTMAPPPAAGISHSTTNHQPFGHKVNTLDANVIMVLAVLVCALICSF  60

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA-DA  432
             +N IIKC  RC+++    +++   +++  S+      N GI+KKALKTFPVI+Y+  + 
Sbjct  61   ILNFIIKCVCRCTNLILVDSSSNHTNNNPSSTKLV---NRGIEKKALKTFPVITYSTTEF  117

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K PGLD++C ICLSEF  G+++++LPKCNHGFHV+CIDKWL+SHSSCPTCRHCLI+TCQK
Sbjct  118  KYPGLDSECVICLSEFGIGEKIKVLPKCNHGFHVKCIDKWLNSHSSCPTCRHCLIETCQK  177

Query  613  IVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPN  732
            IV                  +   VV++IEPL RE ++ N
Sbjct  178  IVP-------------ISSALVQEVVIRIEPLQREDVVSN  204



>gb|KDO53396.1| hypothetical protein CISIN_1g026797mg [Citrus sinensis]
Length=233

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 126/184 (68%), Gaps = 13/184 (7%)
 Frame = +1

Query  88   LGQDFLETFRSRKLL-----LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
            L QDF     SRKLL     L+ P PA +       SS +  D NV++VLSVL+C +IC+
Sbjct  12   LFQDFPRKLHSRKLLPTHNPLNQP-PATAPPHPSLFSSESNLDKNVLIVLSVLVCTVICT  70

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            + +N +IKCAL               S SG +S+A +  N GI KKALK FPV+ Y+A+ 
Sbjct  71   IVLNFVIKCAL-------SSLRLLLSSDSGTNSSATKAINKGINKKALKAFPVVKYSAEL  123

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K+PGLD +C ICLS+FA G+RVRLLPKCNHGFHVRCID+WL S+SSCP CRHCLI+TC+K
Sbjct  124  KLPGLDAECVICLSDFALGERVRLLPKCNHGFHVRCIDRWLRSNSSCPKCRHCLIETCEK  183

Query  613  IVGC  624
            IVGC
Sbjct  184  IVGC  187



>ref|XP_004147380.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis sativus]
 ref|XP_004170139.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis sativus]
 gb|KGN62136.1| hypothetical protein Csa_2G301540 [Cucumis sativus]
Length=236

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 10/160 (6%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
            + P+  +   +  +   +TTFD NVVMVLSVLLCALICSL +NSII+CAL+CS +     
Sbjct  42   APPSAVHDQSEFYSGGDSTTFDTNVVMVLSVLLCALICSLALNSIIRCALKCSRLIVSND  101

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDR  495
                 + +          +TG+ KKA+K+F V+ ++ D  +PGLD +C ICLSEFA GD+
Sbjct  102  HRHRLTPT----------STGVHKKAIKSFTVVQFSLDLNLPGLDPECVICLSEFATGDK  151

Query  496  VRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +RLLPKCNHGFHV+CIDKWLSSHSSCP CR CL+QTC+KI
Sbjct  152  LRLLPKCNHGFHVKCIDKWLSSHSSCPKCRQCLVQTCEKI  191



>ref|XP_003630211.1| RING-H2 finger protein ATL1L [Medicago truncatula]
 gb|AET04687.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=219

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 130/217 (60%), Gaps = 25/217 (12%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            LL QD +E    + L  S     N+   T +      FD+NV+M+L+VLLCALICSL +N
Sbjct  25   LLFQDPIE---HQSLTNSHVLTNNNHNSTDSYFGAREFDSNVIMILAVLLCALICSLALN  81

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SII+C LR              + +  +  +   +N GIKKKALKTFP +SY+A+ K+P 
Sbjct  82   SIIRCGLR------------FSNVALHNDPSLSSSNKGIKKKALKTFPTVSYSAELKLPS  129

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            LDT+C ICLSEF  G++VR+LPKCNHGFHVRCIDKWL  H SCP CR CL++TC+KIV  
Sbjct  130  LDTECIICLSEFTKGEKVRILPKCNHGFHVRCIDKWLKEHPSCPKCRQCLLETCRKIV--  187

Query  625  taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
                     +           V++I+PL  E L  NY
Sbjct  188  --------RSQQPIVMPVLETVIRIQPLEHEALERNY  216



>ref|XP_006464867.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Citrus sinensis]
Length=218

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 139/222 (63%), Gaps = 13/222 (6%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
             +S  L  DF   F SRKLL+  P            SS ++ ++N V+VLSVL+C +ICS
Sbjct  7    FSSTELFPDFFGKFHSRKLLIQNPLNEQPVTAAHPYSSESSLNSNAVIVLSVLVCGIICS  66

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG++ +I+C L         + +    S   ++++   A TGIKKKALK F ++ Y+ + 
Sbjct  67   LGLHFLIRCIL--------VSWSRLEYSGPRANSSTPLAKTGIKKKALKAFTIVKYSGEL  118

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
            K+PGLD +C ICLS+FA G+RVR+LPKCNHGFHVRCIDKWL S+SSCP CRHCLI++C++
Sbjct  119  KLPGLDNECVICLSDFAPGERVRILPKCNHGFHVRCIDKWLRSNSSCPKCRHCLIESCKQ  178

Query  613  IVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            I G     +TQP + +         V+ I PL  EG++ NY 
Sbjct  179  IEG-----STQPSSLSGISTPVQETVVNIRPLEPEGILRNYE  215



>ref|XP_006306489.1| hypothetical protein CARUB_v10012468mg [Capsella rubella]
 gb|EOA39387.1| hypothetical protein CARUB_v10012468mg [Capsella rubella]
Length=225

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 116/181 (64%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            Q FL  F SRKLLL  P   NS  D  AA S           NV+M+LSVL+C +IC LG
Sbjct  15   QQFLGGFVSRKLLLHNPFDQNSQRDLAAAPSPLMTNENNLRVNVLMLLSVLICGIICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA +        ++          S     +N GIKKKALK FPV+SY+ +  +
Sbjct  75   LHYIIRCAFK------RSSSFMISEPISSLSTPRGSSNKGIKKKALKMFPVVSYSPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  129  PGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHMTCPKCRHCLVETCQKIL  188

Query  619  G  621
            G
Sbjct  189  G  189



>ref|XP_003630235.1| RING-H2 finger protein ATL5F, partial [Medicago truncatula]
Length=209

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 118/178 (66%), Gaps = 15/178 (8%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            LL QD +E    + L  S     N+   T +      FD+NV+M+L+VLLCALICSL +N
Sbjct  25   LLFQDPIE---HQSLTNSHVLTNNNHNSTDSYFGAREFDSNVIMILAVLLCALICSLALN  81

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SII+C LR              + +  +  +   +N GIKKKALKTFP +SY+A+ K+P 
Sbjct  82   SIIRCGLR------------FSNVALHNDPSLSSSNKGIKKKALKTFPTVSYSAELKLPS  129

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            LDT+C ICLSEF  G++VR+LPKCNHGFHVRCIDKWL  H SCP CR CL++TC+KIV
Sbjct  130  LDTECIICLSEFTKGEKVRILPKCNHGFHVRCIDKWLKEHPSCPKCRQCLLETCRKIV  187



>ref|XP_006427850.1| hypothetical protein CICLE_v10027372mg [Citrus clementina]
 gb|ESR41090.1| hypothetical protein CICLE_v10027372mg [Citrus clementina]
Length=213

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 140/220 (64%), Gaps = 13/220 (6%)
 Frame = +1

Query  79   SDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLG  258
            + ++ ++F   F SRKLL+  P            SS ++ ++N V+VLSVL+C +ICSLG
Sbjct  4    NSVIFRNFFGKFHSRKLLIQNPLNEQPVTAAHPYSSESSLNSNAVIVLSVLVCGIICSLG  63

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ +I+C L         + +    S   ++++   A TGIKKKALK F ++ Y+ + K+
Sbjct  64   LHFLIRCIL--------VSWSRLEYSGPRANSSTPLAKTGIKKKALKAFTIVKYSGELKL  115

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGLD +C ICLS+FA G+RVR+LPKCNHGFHVRCIDKWL S+SSCP CRHCLI++C++I 
Sbjct  116  PGLDNECVICLSDFAPGERVRILPKCNHGFHVRCIDKWLRSNSSCPKCRHCLIESCKQIE  175

Query  619  GCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            G     +TQP + +         V+ I PL  EG++ NY 
Sbjct  176  G-----STQPSSLSGISTPVQETVVNIRPLEPEGILRNYE  210



>gb|KDO53397.1| hypothetical protein CISIN_1g042698mg, partial [Citrus sinensis]
Length=203

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 135/213 (63%), Gaps = 13/213 (6%)
 Frame = +1

Query  100  FLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKC  279
            F   F SRKLL+  P            SS ++ ++N V+VLSVL+C +ICSLG++ +I+C
Sbjct  1    FFGKFHSRKLLIQNPLNEQPVTAAHPYSSESSLNSNAVIVLSVLVCGIICSLGLHFLIRC  60

Query  280  ALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDC  459
             L         + +    S   ++++   A TGIKKKALK F ++ Y+ + K+PGLD +C
Sbjct  61   IL--------VSWSRLEYSGPRANSSTPLAKTGIKKKALKAFTIVKYSGELKLPGLDNEC  112

Query  460  AICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaa  639
             ICLS+FA G+RVR+LPKCNHGFHVRCIDKWL S+SSCP CRHCLI++C+KI G     +
Sbjct  113  VICLSDFAPGERVRILPKCNHGFHVRCIDKWLRSNSSCPKCRHCLIESCKKIEG-----S  167

Query  640  tqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
            TQP + +         V+ I PL  EG++ NY 
Sbjct  168  TQPSSLSGISTPVQETVVNIRPLEPEGILRNYE  200



>ref|XP_010680272.1| PREDICTED: RING-H2 finger protein ATL78-like [Beta vulgaris subsp. 
vulgaris]
Length=252

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  118  SRKLLL-------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            SR+LLL        AP P     D  ++     FDAN++M+L+VL+CALICSL +N+ I+
Sbjct  22   SRRLLLHNSPTTSQAPTPTYQVLDPGSSHGNNGFDANIIMILAVLVCALICSLCINTCIR  81

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            C ++CSS+  G         +           +G+ K+ALKTFP++ Y+ D ++ GL ++
Sbjct  82   CVIKCSSLLNGEPNYYLNMINDHDGKKKSV--SGLDKRALKTFPIVKYSKDVQIQGLGSE  139

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            C ICLSEF  G++VR+LPKCNHGFHV+CIDKWLSSHSSCPTCR  L++TCQKI+GC
Sbjct  140  CVICLSEFNGGEKVRILPKCNHGFHVKCIDKWLSSHSSCPTCRQSLVETCQKIIGC  195



>gb|KDO53399.1| hypothetical protein CISIN_1g027813mg [Citrus sinensis]
Length=218

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 20/217 (9%)
 Frame = +1

Query  97   DFLETFRSRKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            DFL  F+SRKLL+  P    P  ++  T  A S     +NVV VLS L+C+LICSLG + 
Sbjct  14   DFLGKFQSRKLLIQNPHNQEPITAAPPTYPAKSC--LHSNVVAVLSFLICSLICSLGFHF  71

Query  268  IIKCA-LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            ++KC  +RCS +    + A   ++SG         ++GIKKKAL+ FPV++Y+ + K+PG
Sbjct  72   LLKCVFIRCSRLLDSESNANSLTTSGK--------SSGIKKKALRNFPVVNYSTELKLPG  123

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            LDT+C ICLS F  G+RVR+LP CNHGFHVRCIDKWL SHSSCP CR CLI+TC+ IVG 
Sbjct  124  LDTECVICLSNFLPGERVRMLPICNHGFHVRCIDKWLRSHSSCPKCRRCLIETCENIVG-  182

Query  625  taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
                 +   + +          + I PL   G+I NY
Sbjct  183  -----STQASSSRHSVPETLTTVSIRPLEPHGIIRNY  214



>ref|XP_006427848.1| hypothetical protein CICLE_v10026446mg [Citrus clementina]
 ref|XP_006464562.1| PREDICTED: RING-H2 finger protein ATL10-like [Citrus sinensis]
 gb|ESR41088.1| hypothetical protein CICLE_v10026446mg [Citrus clementina]
Length=218

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 135/217 (62%), Gaps = 20/217 (9%)
 Frame = +1

Query  97   DFLETFRSRKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            DFL  F+SRKLL+  P    P  ++     A S     +NVV+VLS L+C+LICSLG + 
Sbjct  14   DFLGKFQSRKLLIQNPHNQEPITAAPPPYPAKSC--LHSNVVIVLSFLICSLICSLGFHF  71

Query  268  IIKCA-LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            ++KC  +RCS +    + A   ++SG         ++GIKKKAL+ FPV++Y+ + K+PG
Sbjct  72   LLKCVFIRCSRLLDSESNANSLTTSGK--------SSGIKKKALRNFPVVNYSTELKLPG  123

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            LDT+C ICLS F  G+RVR+LP CNHGFHVRCIDKWL SHSSCP CR CLI+TC+ IVG 
Sbjct  124  LDTECVICLSNFLPGERVRMLPICNHGFHVRCIDKWLRSHSSCPKCRRCLIETCENIVG-  182

Query  625  taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
                 +   + +          + I PL   G+I NY
Sbjct  183  -----STQASSSRHSAPETLTTVSIRPLEPHGIIRNY  214



>ref|XP_010680273.1| PREDICTED: RING-H2 finger protein ATL78-like [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 135/221 (61%), Gaps = 17/221 (8%)
 Frame = +1

Query  118  SRKLLLS-----------APAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            SR+LLL+           AP P     D  ++     FDAN++M+L+VL+CAL+CSL +N
Sbjct  21   SRRLLLNSPIYISPPTNQAPTPTYQVLDPGSSHGKNGFDANIIMILAVLVCALMCSLCIN  80

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            + I+C ++CSS+ +G         +            G+ K+ALKTFPV+ Y+ D ++ G
Sbjct  81   TFIRCVIKCSSMMSGEPNYYLSMINNHDEKKKSV--NGLDKRALKTFPVVKYSKDVQIQG  138

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            L ++C ICLSEF  G++VR+LPKCNHGFHV+CID+WLSSHS+CPTCR  L +TCQKI+GC
Sbjct  139  LGSECVICLSEFKEGEKVRILPKCNHGFHVKCIDEWLSSHSTCPTCRQSLSETCQKIIGC  198

Query  625  ----taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
                    ++      T   +   VV+ I PL RE L+ NY
Sbjct  199  DDDHHTTTSSSSSASLTSSSLRDVVVVSIVPLEREDLVRNY  239



>ref|XP_003630203.1| Ring finger protein [Medicago truncatula]
 gb|AET04679.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=225

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 125/202 (62%), Gaps = 14/202 (7%)
 Frame = +1

Query  130  LLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaag  309
            L ++P   N+   T +      FD+ VVM+L+V+LC  ICSL +NSII+CALR       
Sbjct  35   LTNSPTLTNNHNSTDSNFGDREFDSKVVMILAVILCVFICSLALNSIIRCALR-----FS  89

Query  310  rtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAG  489
              A    SSS  S+++ +  N GIKKKALK FP +SY+ D K+P LD +C ICLSEF  G
Sbjct  90   NVAINNDSSSSNSNSSLQSVNKGIKKKALKAFPTVSYSTDLKLPSLDAECMICLSEFTKG  149

Query  490  DRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpp  669
            ++VR+LPKCNHGFHVRCIDKWL  HSSCP CR CL++TC+KI G                
Sbjct  150  EKVRILPKCNHGFHVRCIDKWLKEHSSCPKCRQCLLETCRKIGG---------SQVQPIV  200

Query  670  pvpatvvLQIEPLHREGLIPNY  735
                 ++++IEPL  E L  NY
Sbjct  201  LPVPEIIIRIEPLEHEALERNY  222



>ref|NP_175348.1| RING-H2 finger protein ATL10 [Arabidopsis thaliana]
 sp|P0C034.1|ATL10_ARATH RecName: Full=RING-H2 finger protein ATL10 [Arabidopsis thaliana]
 gb|AAY78646.1| zinc finger (C3HC4-type RING finger) family protein [Arabidopsis 
thaliana]
 gb|AEE32406.1| RING-H2 finger protein ATL10 [Arabidopsis thaliana]
Length=251

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 116/181 (64%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            + FL  F SRKLLL  P   N+      A S           NV+M+LS+L+C +IC LG
Sbjct  15   EQFLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVMMLLSILICGIICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CALR        T           S+    +N GIKKKAL+ FPV+SY+ +  +
Sbjct  75   LHYIIRCALR------RSTRFMISEPVPSLSSTRGSSNKGIKKKALRMFPVVSYSPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGLD +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CR+CL++TCQKI+
Sbjct  129  PGLDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCLVETCQKIL  188

Query  619  G  621
            G
Sbjct  189  G  189



>ref|XP_006306107.1| hypothetical protein CARUB_v10011539mg [Capsella rubella]
 gb|EOA39005.1| hypothetical protein CARUB_v10011539mg [Capsella rubella]
Length=222

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 114/187 (61%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCA  240
            ++    + FL +F SRKLLL  P   N+      A S           NV+M+LSVL+C 
Sbjct  9    SAQAFQEQFLGSFVSRKLLLHNPFDHNTQRAFAVAPSPLINHEKNLSGNVLMLLSVLICG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II+C  R                          +N GIKKKAL+ FPV+SY
Sbjct  69   IICCLGLHYIIRCGSR------RSARFMISEPISSLPTTRGSSNKGIKKKALRMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PG+D +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  SPEMNLPGIDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>ref|XP_006371010.1| hypothetical protein POPTR_0019s02610g [Populus trichocarpa]
 gb|ERP48807.1| hypothetical protein POPTR_0019s02610g [Populus trichocarpa]
Length=213

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 142/220 (65%), Gaps = 29/220 (13%)
 Frame = +1

Query  94   QDFLETFRSRKLLLS---APAPANSSFDTVAASST--TTFDANVVMVLSVLLCALICSLG  258
            Q F   F  RKLLL    +P P++++   +  ++T   +F+ NVV+V  VL+CAL  SLG
Sbjct  13   QHFHGVFHLRKLLLHNPLSPLPSSNAHHPLNPNATGDKSFNINVVVVFIVLMCALFSSLG  72

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA-DAK  435
            +NS ++CAL CS++    +                  N GIKKKALKTFPV++Y+A D+K
Sbjct  73   LNSFVRCALWCSNVNGNSS------------------NRGIKKKALKTFPVVNYSAKDSK  114

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +PGLDT+C IC+SEF  GDRVR+LPKC+H FHVRCID WLSSHSSCPTCRHCL +TC KI
Sbjct  115  LPGLDTECVICISEFVFGDRVRILPKCSHVFHVRCIDMWLSSHSSCPTCRHCLKETCHKI  174

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
             G      +Q  +   PPP     V+ I PL REGL+ NY
Sbjct  175  AG-----VSQASSSEQPPPPIQERVVNIAPLEREGLVSNY  209



>ref|NP_175347.1| E3 ubiquitin-protein ligase ATL76 [Arabidopsis thaliana]
 sp|Q6NML0.1|ATL76_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL76; AltName: Full=RING-H2 
finger protein ATL76 [Arabidopsis thaliana]
 gb|AAR24710.1| At1g49210 [Arabidopsis thaliana]
 gb|AAS47653.1| At1g49210 [Arabidopsis thaliana]
 gb|AAZ14074.1| At1g49210 [Arabidopsis thaliana]
 gb|AEE32405.1| E3 ubiquitin-protein ligase ATL76 [Arabidopsis thaliana]
Length=225

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 118/183 (64%), Gaps = 11/183 (6%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANS-SFDTVAASSTTTFD----ANVVMVLSVLLCALICS  252
            L + FL +F +RKLLL  P   NS     VA S   T +     NV+M+LSVL+C +IC 
Sbjct  13   LQEQFLGSFVTRKLLLHDPFDHNSLRVFAVAPSPLITHENNLKGNVLMLLSVLICGIICC  72

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG++ II+CA R        +           S     +N GIKKKAL+ FPV+SY+ + 
Sbjct  73   LGLHYIIRCAFR------RSSRFMISEPISSLSTPRSSSNKGIKKKALRMFPVVSYSREM  126

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
             +PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQK
Sbjct  127  NLPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCLVETCQK  186

Query  613  IVG  621
            I+G
Sbjct  187  ILG  189



>ref|XP_006393289.1| hypothetical protein EUTSA_v10012018mg [Eutrema salsugineum]
 gb|ESQ30575.1| hypothetical protein EUTSA_v10012018mg [Eutrema salsugineum]
Length=222

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 130/219 (59%), Gaps = 20/219 (9%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFD-TVAASSTTTFD----ANVVMVLSVLLCALICSLG  258
            +     F SRKLLL  P   N+    TVA S   T D     NV+M+LSVL+C +IC LG
Sbjct  15   EQIFGGFISRKLLLHNPFDQNTQRAITVAPSPLITHDNNLSGNVLMLLSVLICGVICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++          S     +N GIKKKAL+ FPV+SY+ +  +
Sbjct  75   LHYIIRCAFR------RSSSFMISEPISSLSTPRGSSNKGIKKKALRMFPVVSYSPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG   +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL +TCQKI+
Sbjct  129  PGFGEECVICLSDFVSGEKLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLAETCQKII  188

Query  619  GCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            G          +      +  +VV++I PL  EG++ ++
Sbjct  189  G---------DSSQVTAALTESVVVRISPLEPEGIVNSF  218



>ref|XP_010500467.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=225

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALICSLG  258
            +  L  + SRKLLL  P   NS  D   A S    D      NV+M+LSVL+C +IC LG
Sbjct  15   EQLLGGYVSRKLLLHNPFDHNSQRDLAVAPSPLITDENNLKGNVLMLLSVLICGIICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++          S     +N GIKKKALK FPV+SYA +  +
Sbjct  75   LHYIIRCAFR------RSSSFMISEPISSLSTPRGSSNKGIKKKALKMFPVVSYAPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG+  DC ICLS+F +G+++RLLPKCNHGFH+RCIDKWL  H +CP CRHCL  TCQK++
Sbjct  129  PGVGEDCVICLSDFVSGEQLRLLPKCNHGFHIRCIDKWLQHHLTCPKCRHCLDDTCQKML  188

Query  619  G  621
            G
Sbjct  189  G  189



>ref|XP_010479358.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=229

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 120/187 (64%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFD-TVAASSTTTFDAN----VVMVLSVLLCA  240
            ++    + FL +F SRKLLL  P   N+     VA S   T + N    V+M+LSVL+C 
Sbjct  9    SAQAFQEQFLGSFVSRKLLLHNPFDHNTQQAFAVAPSPLITHENNLSGHVLMLLSVLVCG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II CA R        +           SA  R +N GIKKKALK FPV+SY
Sbjct  69   IICCLGLHYIIHCASR------RSSRYMISEPIASLSARRRSSNKGIKKKALKMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  SPEMNLPGVGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPNCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>ref|XP_002883148.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59407.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=217

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 114/180 (63%), Gaps = 7/180 (4%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSL  255
            +S +    F+++F SRKLL   P   N+               NV+M+LS+LLC +ICSL
Sbjct  10   SSQVFQDHFIDSFVSRKLLQQIPFAHNAQ--QAHVPDKNNLSGNVLMLLSILLCGIICSL  67

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G++ II+CA R       R+       S  S+      N GI+KKALK FPV++Y+ +  
Sbjct  68   GLHYIIRCAFR-----RSRSFMISDPISIPSTPRDSSVNKGIQKKALKMFPVVNYSPEIN  122

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
             PGL  +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL+ TCQK+
Sbjct  123  QPGLGEECVICLSDFVAGEQLRLLPKCNHGFHVRCIDKWLTQHMTCPKCRHCLVDTCQKV  182



>ref|XP_002891482.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67741.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 117/187 (63%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANS-SFDTVAASSTTTFD----ANVVMVLSVLLCA  240
            ++    + FL  F SRKLLL  P   NS     VA S   T +     NV+M+LSVL+C 
Sbjct  9    SAQYFQEGFLGDFVSRKLLLHDPFDHNSLRVLAVAPSPLITHENNLRGNVLMLLSVLICG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II+CA R        +                 ++ GIKKKAL+ FPV+SY
Sbjct  69   IICCLGLHYIIRCAFR------RSSRFMISEPISSLPTPRGSSDKGIKKKALRMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGL  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  SREMNLPGLGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLRQHLTCPKCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>ref|XP_009147915.1| PREDICTED: RING-H2 finger protein ATL75 [Brassica rapa]
Length=225

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 112/175 (64%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    V A S         + NV+M+LSVL+C +IC LG++ II+
Sbjct  21   FVSRKLLLHNPFDHNTQQAFVVAPSPLITHENNLNGNVLMLLSVLICGIICCLGLHYIIR  80

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R      G ++          S      N GIKKKALK FPV+SY+    +PG+  +
Sbjct  81   CAFR------GTSSFMISEPISSLSTRHGSPNKGIKKKALKMFPVVSYSPGMNLPGIGEE  134

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLP CNHGFHVRCIDKWL  H +CP+CRHCL++TCQKI+G
Sbjct  135  CVICLSDFVSGEKLRLLPNCNHGFHVRCIDKWLQQHLTCPSCRHCLVETCQKILG  189



>emb|CDY48586.1| BnaCnng16450D [Brassica napus]
Length=225

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 113/175 (65%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASST-----TTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    V A S+        + NV+M+LSVL+C +IC LG++ II+
Sbjct  21   FVSRKLLLHNPFDHNTQQAFVVAPSSLITHENNLNGNVLMLLSVLICGIICCLGLHYIIR  80

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R      G ++          S      N GIKKKALK FPV+SY+    +PG+  +
Sbjct  81   CAFR------GTSSFMISEPISSHSTRHGSPNKGIKKKALKMFPVVSYSPGMNLPGIGEE  134

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP+CRHCL++TCQKI+G
Sbjct  135  CIICLSDFVSGEKLRLLPKCNHGFHVHCIDKWLQQHLTCPSCRHCLVETCQKILG  189



>gb|KEH20889.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=211

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 116/167 (69%), Gaps = 7/167 (4%)
 Frame = +1

Query  121  RKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssi  300
            + L ++ P   N++  T +      FD++VVM+++VLLCA IC L +NSII+C LR    
Sbjct  33   QSLKINPPVFTNNNNSTDSKFGAREFDSDVVMIIAVLLCAFICLLVLNSIIRCFLR----  88

Query  301  aagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEF  480
                +   E SSS  S+++ +  N GIKKKALK FP +SY+ D K+P LD +C ICLSEF
Sbjct  89   ---ISNNNESSSSSNSNSSPQSVNKGIKKKALKAFPTVSYSTDLKLPSLDAECMICLSEF  145

Query  481  AAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
              G++VR+LPKCNHGFHVRCIDKWL  HSSCP CR CL++TC+KI G
Sbjct  146  TKGEKVRILPKCNHGFHVRCIDKWLKEHSSCPKCRQCLLETCRKIGG  192



>ref|XP_010461761.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=229

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFD-TVAASSTTTFDAN----VVMVLSVLLCA  240
            ++    + FL +F SRKLLL  P   N+     +A S   T + N    V+M+LSVL+C 
Sbjct  9    SAQAFQEQFLGSFVSRKLLLHNPFDHNTQQAFAIAPSPIITHENNLSGHVLMLLSVLVCG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II CA R        +           SA  R +N GIKKKALK FPV+SY
Sbjct  69   IICCLGLHYIIHCASR------RSSRYMISEPISSLSARRRSSNKGIKKKALKMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  SPEMNLPGVGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPNCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>emb|CDY48856.1| BnaA06g03260D [Brassica napus]
Length=225

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 111/175 (63%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    V A S         + NV+M+LSVL+C +IC LG++ II+
Sbjct  21   FVSRKLLLHNPFDHNTQQAFVVAPSPLITHENNLNGNVLMLLSVLICGIICCLGLHYIIR  80

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R      G ++          S      N GIKKKALK FPV+SY+    +PG+  +
Sbjct  81   CAFR------GTSSFMISEPISSLSTRHGSPNKGIKKKALKMFPVVSYSPGMNLPGIGEE  134

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLP CNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+G
Sbjct  135  CVICLSDFVSGEKLRLLPNCNHGFHVRCIDKWLQQHLTCPNCRHCLVETCQKILG  189



>gb|AAF69722.1|AC016041_27 F27J15.3 [Arabidopsis thaliana]
Length=319

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 118/183 (64%), Gaps = 11/183 (6%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANS-SFDTVAASSTTTFD----ANVVMVLSVLLCALICS  252
            L + FL +F +RKLLL  P   NS     VA S   T +     NV+M+LSVL+C +IC 
Sbjct  107  LQEQFLGSFVTRKLLLHDPFDHNSLRVFAVAPSPLITHENNLKGNVLMLLSVLICGIICC  166

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG++ II+CA R        +           S     +N GIKKKAL+ FPV+SY+ + 
Sbjct  167  LGLHYIIRCAFR------RSSRFMISEPISSLSTPRSSSNKGIKKKALRMFPVVSYSREM  220

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
             +PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQK
Sbjct  221  NLPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCLVETCQK  280

Query  613  IVG  621
            I+G
Sbjct  281  ILG  283



>ref|XP_002891483.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67742.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 110/175 (63%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+  D   + S           NV+M+LS+L+C +IC LG++ II+
Sbjct  21   FVSRKLLLHNPFDHNTQRDFAVSPSPLITHVNNLRGNVLMLLSILICGIICCLGLHYIIR  80

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R        +                 +N GIKKKAL+ FPV+SY+ +  +PGL  +
Sbjct  81   CASR------RSSRFMISEPIPSHPTTRGSSNKGIKKKALRMFPVVSYSPEMNLPGLGEE  134

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+G
Sbjct  135  CVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLVETCQKILG  189



>ref|XP_009599873.1| PREDICTED: RING-H2 finger protein ATL78-like [Nicotiana tomentosiformis]
Length=235

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 141/234 (60%), Gaps = 22/234 (9%)
 Frame = +1

Query  76   ASDLLGQD-FLETFRSRKLLLSA-------PAPANSSFDT-VAASSTTTFDANVVMVLSV  228
             S L  QD FL    SR+LL++A       PA  NS   T +   +    D NVV VLSV
Sbjct  4    TSTLFTQDQFLNFHYSRRLLVAATPQLAPSPAAGNSHDPTDLLLVNDIPIDTNVVPVLSV  63

Query  229  LLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFP  408
            +LC LICSL +NSIIKCA +            + SS+  S++  + AN GIKKK LKTFP
Sbjct  64   ILCGLICSLFLNSIIKCAFK-----YSSLMLTDSSSNHRSTSTEKLANKGIKKKTLKTFP  118

Query  409  VISYAADAKMPGLD-TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCR  585
            VI+Y    + PG+D ++C ICLSEF  G+++++LPKCNH FHV CIDKWL+SHSSCP CR
Sbjct  119  VITYTTGLEHPGIDDSECVICLSEFGVGEKIKVLPKCNHCFHVNCIDKWLNSHSSCPICR  178

Query  586  HCLIQTCQKIVGCtaaaatq-------pptpatpppvpatvvLQIEPLHREGLI  726
            HCLI+TCQK V   ++  T            ++       ++++IEPL RE ++
Sbjct  179  HCLIETCQKSVNGDSSVTTTAIPNSQVANNISSSSATVQEIIIRIEPLQREDVV  232



>gb|AAF69723.1|AC016041_28 F27J15.2 [Arabidopsis thaliana]
Length=426

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 118/187 (63%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCA  240
            ++    + FL  F SRKLLL  P   N+      A S           NV+M+LS+L+C 
Sbjct  9    SAQAFQEQFLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVMMLLSILICG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II+CALR        T           S+    +N GIKKKAL+ FPV+SY
Sbjct  69   IICCLGLHYIIRCALR------RSTRFMISEPVPSLSSTRGSSNKGIKKKALRMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGLD +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CR+CL++
Sbjct  123  SPEMNLPGLDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189


 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 20/133 (15%)
 Frame = +1

Query  226  VLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTF  405
            VLLCAL+CSLG+NSII+CALRCS++                       NTG+K+KALK+F
Sbjct  281  VLLCALVCSLGLNSIIRCALRCSNLVPSEAGGDNYPVRLT--------NTGVKRKALKSF  332

Query  406  PVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCR  585
              +SY+ +  +PGLDT+CAICLSEF A +RV+LLP C+HGFHVRCIDK            
Sbjct  333  QTVSYSTELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDK------------  380

Query  586  HCLIQTCQKIVGC  624
            HCLIQTC+KI  C
Sbjct  381  HCLIQTCEKIADC  393



>ref|XP_010500465.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=229

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 119/187 (64%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFD-TVAASSTTTFDAN----VVMVLSVLLCA  240
            ++    +  L +F SRKLLL  P   N+     +A S   T + N    V+M+LSVL+C 
Sbjct  9    SAQAFQEQLLGSFVSRKLLLHNPFDHNTQQAFAIAPSPLITHENNLSGHVLMLLSVLVCG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II CA R        +           SA  R +N GIKKKALK FPV+SY
Sbjct  69   IICCLGLHYIIHCASR------RSSRYMISEPISSLSATRRSSNKGIKKKALKMFPVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PG+  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  SPEMNLPGVGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPNCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>emb|CDY48082.1| BnaC06g02460D [Brassica napus]
Length=216

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    +   S           NV+M+LSVL+C +IC LG++ II+
Sbjct  15   FISRKLLLHNPFDHNTQQTFMVTPSPLITHENNLSGNVLMLLSVLICGIICCLGLHYIIR  74

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CALR        ++          S     +N GIKKKAL  FPV+SY+ +  +PG+  +
Sbjct  75   CALR------RTSSFMISEPISSLSTPHGSSNKGIKKKALNMFPVVSYSTEMNLPGVGEE  128

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP+CRHCL++TCQKI+G
Sbjct  129  CVICLSDFVSGEKLRLLPKCNHGFHVHCIDKWLQQHLTCPSCRHCLVETCQKILG  183



>ref|XP_010912405.1| PREDICTED: RING-H2 finger protein ATL78-like [Elaeis guineensis]
Length=221

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 124/228 (54%), Gaps = 33/228 (14%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAP-------------APANSSFDTVAASSTTTFDANVVMVLSVLL  234
               +  F SR+LL   P             +PA S  D+   +S+  FDANVVM+L+VLL
Sbjct  13   HSLIRDFYSRRLLFHTPLYKQPTQLSPSWTSPAGSEPDSGRPASS--FDANVVMILAVLL  70

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALIC+LG+NSI++CALRCS+                         TG+++KAL+  P  
Sbjct  71   CALICALGLNSIVRCALRCSNRIVVVEPDTNPVVRFA--------QTGLRRKALRALPTQ  122

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
             Y+A  K+ G +T+CAICLS+F  G+RVR LP+CNHGFHVRCID+WL + SSCPTCR CL
Sbjct  123  VYSAGVKLDGANTECAICLSDFVPGERVRFLPRCNHGFHVRCIDRWLMARSSCPTCRQCL  182

Query  595  IQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNYH  738
              +  K  GCT                       + PL  EGLI NY 
Sbjct  183  FCSSPKTSGCTEVNQPGQAPVQAV----------LVPLEPEGLITNYE  220



>emb|CDY18543.1| BnaA01g26520D [Brassica napus]
Length=209

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 110/179 (61%), Gaps = 4/179 (2%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            +  + F E F SRKLL   P   N                NV+MVLS+L+C +I SLG++
Sbjct  1    MYSEVFQEHFISRKLLQQLPFDHNMHQQEAHVPDKNNLSGNVLMVLSILVCGIIGSLGLH  60

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
             +I C  R     +     A+  SS  +   +  AN GIKKKALK FPV  Y+ +  + G
Sbjct  61   YVIGCIFR----RSSSFMIADPISSPSTPRGSATANKGIKKKALKMFPVTKYSPEMNLSG  116

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            L  +C ICLS+F AG++VRLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+G
Sbjct  117  LGEECVICLSDFVAGEQVRLLPKCNHGFHVRCIDKWLKQHVTCPKCRHCLVETCQKILG  175



>ref|XP_010500468.1| PREDICTED: RING-H2 finger protein ATL75-like [Camelina sativa]
Length=226

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 11/178 (6%)
 Frame = +1

Query  103  LETFRSRKLLLSAPAPANSSFDTVAASST-----TTFDANVVMVLSVLLCALICSLGVNS  267
            L  F SRKLLL  P   N+      A ST          NV+M+LSVL+C +IC LG++ 
Sbjct  19   LGGFVSRKLLLHNPFDHNTERAFAVAPSTLNSHENNLSGNVLMLLSVLICGIICCLGLHY  78

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            II+CA R        ++        G S +   ++ GIKKKAL+ FPV+SY+ +  +PGL
Sbjct  79   IIRCAFR------RTSSFMISDPISGFSTSRDSSDKGIKKKALRMFPVVSYSPEMNLPGL  132

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
              +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL  H +CP CRHCL++TCQKI+G
Sbjct  133  GEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQHHFTCPKCRHCLVETCQKILG  190



>ref|XP_009147916.1| PREDICTED: RING-H2 finger protein ATL75-like [Brassica rapa]
Length=216

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    + A S           NV+M+LSVL+C +IC LG++ II+
Sbjct  15   FISRKLLLHNPFDHNTQQTFMVAPSPLITHENNVSGNVLMLLSVLICGIICCLGLHYIIR  74

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R        ++          S     +N GIKKKAL  FPV+SY+ +  +PG+  +
Sbjct  75   CAFR------RTSSFMISEPISSLSTPHGSSNKGIKKKALNMFPVVSYSTEMNLPGVGEE  128

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP+CRHCL++TCQKI+G
Sbjct  129  CVICLSDFVSGEKLRLLPKCNHGFHVHCIDKWLQQHLTCPSCRHCLVETCQKILG  183



>ref|XP_010461763.1| PREDICTED: RING-H2 finger protein ATL75 [Camelina sativa]
Length=226

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 11/178 (6%)
 Frame = +1

Query  103  LETFRSRKLLLSAPAPANSSFDTVAASST-----TTFDANVVMVLSVLLCALICSLGVNS  267
            L  F SRKLLL  P   N+      A ST          NV+M+LSVL+C +IC LG++ 
Sbjct  19   LGGFVSRKLLLHNPFDHNTERAFAVAPSTFNSHENNLSGNVLMLLSVLICGIICCLGLHY  78

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            II+CA R        ++        G S +   ++ GIKKKAL+ FPV+SY+ +  +PGL
Sbjct  79   IIRCAFR------RTSSFMISDPISGFSTSRDSSDKGIKKKALRMFPVVSYSPEMNLPGL  132

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
              +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL  H +CP CRHCL++TCQKI+G
Sbjct  133  GEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQHHLTCPKCRHCLVETCQKILG  190



>ref|XP_010461762.1| PREDICTED: E3 ubiquitin-protein ligase ATL76 [Camelina sativa]
Length=225

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSS-FDTVAASSTTTFD----ANVVMVLSVLLCALICSLG  258
            +  L  + SRKLLL  P   NS  +  VA S   T +     NV+M+LSVL+C +IC LG
Sbjct  15   EQLLGGYVSRKLLLPNPFDHNSQRYLAVAPSPLITHENNLKGNVLMLLSVLICGIICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++          S     +N GIKKKALK FPV+SYA +  +
Sbjct  75   LHYIIRCAFR------RSSSFMISEPISSLSTPRGSSNKGIKKKALKMFPVVSYAPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG+  +C ICLS+F  G+++RLLPKCNHGFH+RCIDKWL  H +CP CRHCL +TCQK++
Sbjct  129  PGVGEECVICLSDFIFGEQLRLLPKCNHGFHIRCIDKWLQHHLTCPKCRHCLDETCQKML  188

Query  619  G  621
            G
Sbjct  189  G  189



>emb|CDY16483.1| BnaA08g02840D [Brassica napus]
Length=223

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 123/223 (55%), Gaps = 23/223 (10%)
 Frame = +1

Query  94   QDFLETFR----SRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALI  246
            Q+F E  R    SRKLLL  P   N       A S    D      NV+M+LSVL+C +I
Sbjct  11   QEFQELVRGGFVSRKLLLHNPFDHNPQGAFAVAPSPHITDENNLSGNVLMLLSVLVCGVI  70

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            C LG++ II+CA R         +                 N GIKKKAL  FPV++Y+ 
Sbjct  71   CCLGLHYIIRCAFR------RSPSFMISEPVSSIPTRRGSPNKGIKKKALNMFPVVTYSR  124

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTC  606
            +  +PGL  +C ICLS+F  G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TC
Sbjct  125  EMNLPGLGEECVICLSDFVCGEKLRLLPKCNHGFHVRCIDKWLKQHLTCPKCRHCLVETC  184

Query  607  QKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            QKI+G          +  T      ++ ++I PL  EG +  Y
Sbjct  185  QKILG--------DSSQVTATAPTESLTVRIAPLEPEGRVNTY  219



>emb|CDY48857.1| BnaA06g03250D [Brassica napus]
Length=242

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 11/175 (6%)
 Frame = +1

Query  112  FRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            F SRKLLL  P   N+    + A S           NV+M+LSVL+C +IC LG++ II+
Sbjct  15   FISRKLLLHNPFDHNTQQTFMVAPSPLITHENNVSGNVLMLLSVLICGIICCLGLHYIIR  74

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTD  456
            CA R        ++          S     +N GIKKKAL  FPV+SY+ +  +PG+  +
Sbjct  75   CAFR------RTSSFMISEPISSLSTPHGSSNKGIKKKALNMFPVVSYSTEMNLPGVGEE  128

Query  457  CAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP+CRHCL++TCQKI+G
Sbjct  129  CVICLSDFVSGEKLRLLPKCNHGFHVHCIDKWLQQHLTCPSCRHCLVETCQKILG  183



>ref|XP_009112407.1| PREDICTED: RING-H2 finger protein ATL77-like [Brassica rapa]
Length=209

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 110/179 (61%), Gaps = 4/179 (2%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            +  + F E F SRKLL   P   N                NV+MVLS+L+C +I SLG++
Sbjct  1    MYSEVFQEHFISRKLLQQLPFDHNMHQQEAHVPDKNNLSGNVLMVLSILVCGIIGSLGLH  60

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
             +I C  R     +     A+  SS  +   +  AN GIKKKALK FPVI Y+ +  + G
Sbjct  61   YVIGCIFR----RSSSFMIADPISSPSTPRGSATANKGIKKKALKMFPVIKYSPEMNLSG  116

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            L  +C ICLS+F AG++VRLLPKCNHGFHVRCIDKWL  H +CP CRH L++TCQKI+G
Sbjct  117  LGEECVICLSDFVAGEQVRLLPKCNHGFHVRCIDKWLKQHVTCPKCRHSLVETCQKILG  175



>emb|CDY64958.1| BnaAnng19830D [Brassica napus]
Length=223

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 124/223 (56%), Gaps = 23/223 (10%)
 Frame = +1

Query  94   QDFLETFR----SRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALI  246
            Q+F E  R    SRKLLL  P   N       A ST   D      NV+M+LSVL+C +I
Sbjct  11   QEFQELVRGGFVSRKLLLHNPFDHNPQGAFAVAPSTHITDENNLSGNVLMLLSVLVCGVI  70

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            C LG++ II+CA R         +                +N GIKKKAL  F V+SY+ 
Sbjct  71   CCLGLHYIIRCAFR------RSPSFMISEPVSSIPTRRGSSNKGIKKKALNMFHVVSYSR  124

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTC  606
            +  +PGL  +C ICLS+F  G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TC
Sbjct  125  EMNLPGLGEECVICLSDFVCGEKLRLLPKCNHGFHVRCIDKWLKQHLTCPKCRHCLVETC  184

Query  607  QKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            QKI+G          +  T      ++ ++I PL  EG +  Y
Sbjct  185  QKILG--------DSSQVTATAPTESLTVRIAPLEPEGRVNTY  219



>ref|XP_011046374.1| PREDICTED: RING-H2 finger protein ATL78-like [Populus euphratica]
Length=213

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 140/220 (64%), Gaps = 29/220 (13%)
 Frame = +1

Query  94   QDFLETFRSRKLLLS---APAPANSSFDTVAASST--TTFDANVVMVLSVLLCALICSLG  258
            Q F   F  RKLLL    +P+P++++   +  ++T   +F+ NVV+V  VL+CAL  S+G
Sbjct  13   QHFHGDFHLRKLLLHNPLSPSPSSNAHHPLNPNATGDKSFNINVVVVFIVLICALFSSVG  72

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA-DAK  435
            +NS I+C L CS++    +                  N GIKKKALKTFPV++Y+A D K
Sbjct  73   LNSFIRCTLWCSNLNGNSS------------------NRGIKKKALKTFPVVNYSAKDGK  114

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +PGLDT+C IC+S+F  GDRVR+LPKC+H FHVRCID WLSSHSSCPTCR CL +TC KI
Sbjct  115  LPGLDTECVICISDFVVGDRVRILPKCSHVFHVRCIDMWLSSHSSCPTCRRCLKETCHKI  174

Query  616  VGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
             G      +Q  +   PPP     V+ I PL REGL+ NY
Sbjct  175  AG-----VSQASSSEQPPPPIQERVVNIAPLEREGLVSNY  209



>ref|XP_008441014.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis melo]
Length=221

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 125/217 (58%), Gaps = 18/217 (8%)
 Frame = +1

Query  118  SRKLLLSAPAPANSSFDTVAASST-TTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            SR+ LL +P  A S  +         +FD NVVMVLSVLLCALICSLG+N+I+KCALRCS
Sbjct  6    SRRFLLPSPTAAASPPELAQPRPGFGSFDMNVVMVLSVLLCALICSLGLNAILKCALRCS  65

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA-KMPGLDTDCAICL  471
            ++ A  +      +             G+++  LK FP + Y+ +  K+ G+D +C ICL
Sbjct  66   TLLATVSGGRGGGALVVHP-------KGVRRNVLKKFPTVEYSKEGNKLRGIDGECVICL  118

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI-VGCtaaaatqp  648
             EF AGDRVR+LPKC HGFHV CIDKWLSSH+SCP CR+CL  TC KI  GC        
Sbjct  119  LEFEAGDRVRVLPKCYHGFHVHCIDKWLSSHTSCPKCRNCLTDTCHKIAAGCGQETPVTT  178

Query  649  ptpatp--------ppvpatvvLQIEPLHREGLIPNY  735
               A                V + I P+ REG+I NY
Sbjct  179  AATAAESSSSVEPPRAEEVEVNVVIAPVEREGMINNY  215



>ref|XP_006393294.1| hypothetical protein EUTSA_v10011764mg [Eutrema salsugineum]
 gb|ESQ30580.1| hypothetical protein EUTSA_v10011764mg [Eutrema salsugineum]
Length=221

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 129/219 (59%), Gaps = 21/219 (10%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            +  L  F SRKLLL  P   ++        S           NV+M+LSVL+C +IC LG
Sbjct  15   EQLLSGFVSRKLLLHNPFDHSTQRPLAMTPSPLITHENNLSGNVLMLLSVLICGVICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R         + +   S   SS +    + GIKKKAL+ FP++SY+AD  +
Sbjct  75   LHYIIRCAFR--------QSTSFMISEPISSLSNSSPSKGIKKKALRMFPIVSYSADLNL  126

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG+  +C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP CRHCL++TCQKI+
Sbjct  127  PGIGEECVICLSDFVSGEKLRLLPKCNHGFHVHCIDKWLQQHMTCPKCRHCLVETCQKII  186

Query  619  GCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            G          +  T      +V+++I+PL  EG +  +
Sbjct  187  G--------DSSQVTAAAPTESVIIRIDPLEPEGRVNTF  217



>ref|XP_010479360.1| PREDICTED: RING-H2 finger protein ATL75-like [Camelina sativa]
Length=226

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAA-----SSTTTFDANVVMVLSVLLCALICSLG  258
            +  L  F SRKLLL  P   N+      A     S       NV+M+LSVL+C +IC LG
Sbjct  16   EQSLAGFVSRKLLLHNPFDHNTERAFAVAPSALNSHENNLSGNVLMLLSVLICGIICCLG  75

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++        G S +   ++ GIKKKAL+ FPV+SY+ +  +
Sbjct  76   LHYIIRCAFR------RTSSFMISDPISGFSTSRDSSDKGIKKKALRMFPVVSYSPEMNL  129

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGL  +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  130  PGLGEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQHHLTCPKCRHCLVETCQKIL  189

Query  619  G  621
            G
Sbjct  190  G  190



>ref|XP_004148642.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis sativus]
 ref|XP_004168068.1| PREDICTED: RING-H2 finger protein ATL78-like [Cucumis sativus]
 gb|KGN48380.1| RING-H2 zinc finger protein [Cucumis sativus]
Length=218

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 116/188 (62%), Gaps = 14/188 (7%)
 Frame = +1

Query  193  TFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaN  372
            +FD NVVMVLSVLLCALICSLG+N+I+KCALRCS++ A  +      +            
Sbjct  32   SFDMNVVMVLSVLLCALICSLGLNAILKCALRCSTLLATVSGGRGGGALVVHP-------  84

Query  373  TGIKKKALKTFPVISYAADA-KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDK  549
             G+++  LK FP + Y+ +  K+ G+D +C ICL EF AGDRVR+LPKC HGFHV CIDK
Sbjct  85   KGVRRNVLKKFPTVEYSKEGNKLRGIDGECVICLLEFEAGDRVRVLPKCYHGFHVHCIDK  144

Query  550  WLSSHSSCPTCRHCLIQTCQKIV-GCtaaaatqpptpatpp-----pvpatvvLQIEPLH  711
            WLSSH+SCP CR+CL  TC KI  GC           ++            V + I P+ 
Sbjct  145  WLSSHTSCPKCRNCLTDTCHKITAGCAQETHVTTAAESSSSVEPPRAEEVGVNVVIAPVE  204

Query  712  REGLIPNY  735
            REG+I NY
Sbjct  205  REGMINNY  212



>gb|KFK30303.1| hypothetical protein AALP_AA7G244200 [Arabis alpina]
Length=220

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 114/179 (64%), Gaps = 6/179 (3%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            +  + F++ F SRKLL   P   ++               NV+++LS+L+C +ICSLG++
Sbjct  12   VFQEHFIDNFVSRKLLQQIPF-DHTIEQEAHVPDKNNLSGNVLLLLSILICGIICSLGLH  70

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
             +I+CA R        T       S  S+     AN GIKKKALK FP+++Y+ +    G
Sbjct  71   YVIRCAFR-----RSTTFMIAEPISSPSTPRGSVANKGIKKKALKMFPIVNYSPEMNQSG  125

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            L  +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL++TCQKI+G
Sbjct  126  LGEECVICLSDFVAGEQLRLLPKCNHGFHVRCIDKWLTQHLTCPKCRHCLVETCQKILG  184



>ref|NP_175346.1| RING-H2 finger protein ATL75 [Arabidopsis thaliana]
 sp|Q94BY6.1|ATL75_ARATH RecName: Full=RING-H2 finger protein ATL75 [Arabidopsis thaliana]
 gb|AAK62606.1| At1g49200/F27J15_35 [Arabidopsis thaliana]
 gb|AAM10377.1| At1g49200/F27J15_35 [Arabidopsis thaliana]
 gb|AEE32404.1| RING-H2 finger protein ATL75 [Arabidopsis thaliana]
Length=226

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            +  L  F SRKLLL  P   N+      A S           NV+M+LSVL+C +IC LG
Sbjct  16   EQSLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLITHENNLSGNVLMLLSVLICGIICCLG  75

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++        G S     +N GI KKAL+ FPV+SY+ +  +
Sbjct  76   LHYIIRCAFR------RTSSFMISEPIAGLSTPCGSSNKGINKKALRMFPVVSYSPEMNL  129

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGL  +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  130  PGLGEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCRHCLVETCQKIL  189

Query  619  G  621
            G
Sbjct  190  G  190



>ref|NP_850610.1| RING-H2 finger protein ATL77 [Arabidopsis thaliana]
 sp|Q9LS99.1|ATL77_ARATH RecName: Full=RING-H2 finger protein ATL77 [Arabidopsis thaliana]
 dbj|BAB01804.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64481.1| contains similarity to RING zinc finger protein [Arabidopsis 
thaliana]
 dbj|BAD95334.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF19045.1| At3g18773 [Arabidopsis thaliana]
 gb|AEE76145.1| RING-H2 finger protein ATL77 [Arabidopsis thaliana]
Length=220

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 116/182 (64%), Gaps = 7/182 (4%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSL  255
            +S +  + F+++F SRKLL   P   N+    V          NV+M+LS+LLC +ICSL
Sbjct  10   SSQVFQEHFIDSFVSRKLLQQIPFAHNAQQAHVP--DKNNLSGNVLMLLSILLCGIICSL  67

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G++ II+CA         R+       S  S+      N GIKKKALK  PV++Y+ +  
Sbjct  68   GLHYIIRCAF-----IRSRSFMISDPISIPSTPRDSSVNKGIKKKALKMLPVVNYSPEIN  122

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            +PG+  +C ICLS+F AG+++R+LPKCNHGFH+RCIDKWL+ H +CP CRHCL+ TCQK+
Sbjct  123  LPGVGEECVICLSDFVAGEQLRVLPKCNHGFHLRCIDKWLTQHMTCPKCRHCLVDTCQKV  182

Query  616  VG  621
            + 
Sbjct  183  LS  184



>ref|XP_010479359.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=225

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 112/181 (62%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDAN-----VVMVLSVLLCALICSLG  258
            +  L  + SRKLLL  P   NS  D   A S    D N     V+M+LSVL+C +IC LG
Sbjct  15   EQLLGGYVSRKLLLHNPFDHNSQRDLAVAPSPLITDENNLRRNVLMLLSVLICGIICCLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA          ++          S     +N GIKKKALK FP++SY+    +
Sbjct  75   LHYIIRCAF------TRSSSFMISEPISSLSTPRGSSNKGIKKKALKMFPIVSYSPKMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PG+  +C ICLS+F +G+++RLLPKCNHGFH+RCI+KWL  H +CP CRHCL +TCQKI+
Sbjct  129  PGVGEECVICLSDFVSGEQLRLLPKCNHGFHIRCIEKWLKHHLTCPKCRHCLDETCQKIL  188

Query  619  G  621
            G
Sbjct  189  G  189



>ref|XP_010680274.1| PREDICTED: RING-H2 finger protein ATL78-like [Beta vulgaris subsp. 
vulgaris]
Length=255

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 138/229 (60%), Gaps = 25/229 (11%)
 Frame = +1

Query  118  SRKLLL-------SAP------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLG  258
            SR+LLL       S+P       P     D  ++     FDAN++M+L+VL+CALICSL 
Sbjct  21   SRRLLLLNSHIIHSSPPTNQALTPTYQVLDPSSSHGKNGFDANIIMILAVLVCALICSLC  80

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            +N+ I+  ++CSS+ +G         +           +G+ K+ALKTFPV+ ++ D ++
Sbjct  81   INTFIRFVIKCSSMMSGEPNYYLSMINNHDEKKKSV--SGLDKRALKTFPVVKFSKDVQI  138

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             GL ++C ICLS+F  G++VR+LPKCNHGFHV+CID+WLSSHSSCP CR  L++TCQKI+
Sbjct  139  QGLGSECVICLSDFKVGEKVRILPKCNHGFHVKCIDEWLSSHSSCPICRQSLVETCQKII  198

Query  619  GC----------taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            GC          + + ++   +  +       VV+ IEPL RE L+ NY
Sbjct  199  GCDHDHHTTTSSSTSPSSSSSSLISSSSSRDVVVVSIEPLEREDLVRNY  247



>ref|XP_009107315.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Brassica rapa]
Length=223

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 123/224 (55%), Gaps = 23/224 (10%)
 Frame = +1

Query  91   GQDFLETFR----SRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCAL  243
             Q+F E  R    SRKLLL  P   N       A S    D      NV+M+LSVL+C +
Sbjct  10   AQEFQELVRGDFVSRKLLLHNPFDHNPQGAFAVAPSPHITDENNLSGNVLMLLSVLVCGV  69

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            IC LG++ II CA R         +                +N GIKKKAL  FPV++Y+
Sbjct  70   ICCLGLHYIILCAFR------RSPSFMISEPVSSIPTRRGSSNKGIKKKALNMFPVVTYS  123

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             +  +PGL  +C ICLS+F  G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++T
Sbjct  124  REMNLPGLGEECVICLSDFVCGEKLRLLPKCNHGFHVRCIDKWLKQHLTCPKCRHCLVET  183

Query  604  CQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CQKI+G          +  T      ++ ++I PL  EG +  Y
Sbjct  184  CQKILG--------DSSQVTATAPTESLTVRIAPLEPEGRVNTY  219



>ref|XP_003630209.1| Ring finger protein [Medicago truncatula]
Length=450

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 116/167 (69%), Gaps = 7/167 (4%)
 Frame = +1

Query  121  RKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssi  300
            + L ++ P   N++  T +      FD++VVM+++VLLCA IC L +NSII+C LR    
Sbjct  272  QSLKINPPVFTNNNNSTDSKFGAREFDSDVVMIIAVLLCAFICLLVLNSIIRCFLR----  327

Query  301  aagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEF  480
                +   E SSS  S+++ +  N GIKKKALK FP +SY+ D K+P LD +C ICLSEF
Sbjct  328  ---ISNNNESSSSSNSNSSPQSVNKGIKKKALKAFPTVSYSTDLKLPSLDAECMICLSEF  384

Query  481  AAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
              G++VR+LPKCNHGFHVRCIDKWL  HSSCP CR CL++TC+KI G
Sbjct  385  TKGEKVRILPKCNHGFHVRCIDKWLKEHSSCPKCRQCLLETCRKIGG  431


 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPA-----PANSSFDTVAASSTTT------FDANVVMV  219
              S LL +  +E+  +R+LL+  P        NS   T + +ST +      FD+NVVM+
Sbjct  7    FTSPLLHELLVES-HTRRLLIQNPVDHQSLKINSRIFTNSHNSTDSYFRAPEFDSNVVMI  65

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            L+V+LCA I  L +N II+ AL    I        + SSS  ++ + +  N GIKKKALK
Sbjct  66   LAVVLCAFIGPLALNFIIRRAL----IFLNVALNNDSSSSSSNNNSPQLVNKGIKKKALK  121

Query  400  TFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
             FP +SY+ +  +P LDTDC ICLSEF  G+++R+LPKCNHGFHVRCIDKWL  HSSCP 
Sbjct  122  KFPTMSYSTELNLPSLDTDCMICLSEFTKGEKLRILPKCNHGFHVRCIDKWLKEHSSCPK  181

Query  580  CRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CR CL++TC+KI G                      +++IEPL  E L  NY
Sbjct  182  CRQCLLETCRKIGG---------SQVQPILLPVPETIIRIEPLEHEALERNY  224



>emb|CDX92269.1| BnaA05g21380D [Brassica napus]
Length=213

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = +1

Query  73   MASDLL---GQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCAL  243
            M+SD L    Q F E F +RKLL   P    +      A        NV+++LSVL+C +
Sbjct  1    MSSDHLPSSSQVFQEHFIARKLLQQLPYSHTTQQQQAHAPEKNNLSGNVLLLLSVLVCGI  60

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG++ +I+C  R          ++   S   SS +   AN GIKKKALK FPV+ Y+
Sbjct  61   ICSLGLHYVIRCVFR--------RHSSFMISEPISSPSTLAANKGIKKKALKMFPVVKYS  112

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             +  + GL  DC ICLS+F AG+R+RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL++T
Sbjct  113  REMNLSGLGEDCVICLSDFVAGERIRLLPKCNHGFHVRCIDKWLTQHITCPKCRHCLVET  172

Query  604  CQKIVG  621
            CQKI+G
Sbjct  173  CQKILG  178



>ref|XP_006427847.1| hypothetical protein CICLE_v10026452mg [Citrus clementina]
 ref|XP_006464561.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Citrus sinensis]
 gb|ESR41087.1| hypothetical protein CICLE_v10026452mg [Citrus clementina]
 gb|KDO53400.1| hypothetical protein CISIN_1g046833mg [Citrus sinensis]
Length=218

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 135/229 (59%), Gaps = 20/229 (9%)
 Frame = +1

Query  61   PVLIMASDLLGQDFLETFRSRKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVL  231
            P    +S  L  DF+  F SRKLLL  P    P  ++     A     F  NVVM  S+L
Sbjct  2    PASSFSSTQLSHDFIGKFHSRKLLLQHPYNQQPITAAPPPYPAKGCLHF--NVVMFFSIL  59

Query  232  LCALICSLGVNSIIKCA-LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFP  408
            + A++CSLG + +I+C  LRCS +    + A   +  G         ++GI++++L+ FP
Sbjct  60   ISAVVCSLGFHFLIRCVFLRCSRLLDSESNANSSTPLGK--------SSGIQQESLRDFP  111

Query  409  VISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRH  588
            V++Y+ + K+ G DT+C ICLSEFA G+ +R+LPKCNHGFHV CIDKWL SHSSCP CRH
Sbjct  112  VVNYSTELKLSGSDTECVICLSEFAPGESLRVLPKCNHGFHVHCIDKWLRSHSSCPKCRH  171

Query  589  CLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CLI+TC++ VG +  ++++                 I PL  EG+I NY
Sbjct  172  CLIETCEESVGFSQTSSSEHSVVVPETVD------SIRPLEPEGIICNY  214



>ref|XP_006303349.1| hypothetical protein CARUB_v10010227mg [Capsella rubella]
 gb|EOA36247.1| hypothetical protein CARUB_v10010227mg [Capsella rubella]
Length=227

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 113/187 (60%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASST-----TTFDANVVMVLSVLLCA  240
            A   + +     F SRKLLL  P   N+      A S           NV+M+LSVL+C 
Sbjct  11   AQAFIQEQSFGGFVSRKLLLHNPFDHNTQRSFAVAPSALNSHEKNLSGNVLMLLSVLICG  70

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC LG++ II+CA R        ++        G S     +  GI KKAL+ FPV+SY
Sbjct  71   IICCLGLHYIIRCAFR------RTSSFMISDPISGLSTPRGSSEKGISKKALRMFPVVSY  124

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            + +  +PGL  +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL  H +CP CRHCL++
Sbjct  125  SQEMNLPGLGEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCRHCLVE  184

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  185  TCQKILG  191



>ref|XP_006427846.1| hypothetical protein CICLE_v10027045mg, partial [Citrus clementina]
 gb|ESR41086.1| hypothetical protein CICLE_v10027045mg, partial [Citrus clementina]
Length=198

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 14/188 (7%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVLLCAL  243
             +S  L QDF+  F  RKLL   P    P  ++  + A S     D++V++VLSVLLCAL
Sbjct  6    FSSPKLPQDFIGKFHLRKLLPQNPLTQQPIAAAAPSDAISKN--LDSSVLLVLSVLLCAL  63

Query  244  ICSLGVNSIIKCAL-RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            ICSLG+N +I+  L +CS +AA  + A   + S          ++GIK  A+KTFPV+ Y
Sbjct  64   ICSLGLNFLIRYILIKCSRLAATESYANSSTPSVK--------SSGIKNNAIKTFPVVKY  115

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +A+ K+PGLD +C ICLSEFA+G+ VRLLPKCNHGFHVRCIDKWL  HSSCP CRHCLI+
Sbjct  116  SAELKIPGLDAECVICLSEFASGELVRLLPKCNHGFHVRCIDKWLRLHSSCPKCRHCLIE  175

Query  601  TCQKIVGC  624
            TC+KI+GC
Sbjct  176  TCEKIMGC  183



>gb|KFK36035.1| hypothetical protein AALP_AA4G069500 [Arabis alpina]
Length=233

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 111/182 (61%), Gaps = 12/182 (7%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS------TTTFDANVVMVLSVLLCALICSL  255
            +  L  F SRKLLL  P   N+      + S          + NV+M+LS+L+C +IC L
Sbjct  15   EQVLGGFISRKLLLHNPFDHNTQQAFAVSPSPPLITHENNLNGNVLMLLSILICGIICCL  74

Query  256  GVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK  435
            G++ II+CA R        ++          S     +N GI KKALK FPV+SY+    
Sbjct  75   GLHYIIRCAFR------RTSSFMISEPISSPSTPKGSSNKGISKKALKMFPVVSYSTKMN  128

Query  436  MPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI  615
            + GL  +C ICLS+F +G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI
Sbjct  129  LSGLGEECVICLSDFVSGEKLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLVETCQKI  188

Query  616  VG  621
            +G
Sbjct  189  LG  190



>ref|XP_009145860.1| PREDICTED: RING-H2 finger protein ATL77 [Brassica rapa]
Length=213

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 117/186 (63%), Gaps = 11/186 (6%)
 Frame = +1

Query  73   MASDLL---GQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCAL  243
            M+SD L    Q F E F SRKLL   P           A        NV+++LSVL+C +
Sbjct  1    MSSDHLPSSSQVFREHFISRKLLQQLPFSHTIQQQQAHAPEKNNLSGNVLLLLSVLVCGI  60

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG++ +I+C  R          ++   S   SS +   AN GIKKKALK FPV+ Y+
Sbjct  61   ICSLGLHYVIRCVFR--------RHSSFMISEPISSPSTLAANKGIKKKALKMFPVVKYS  112

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             +  + GL  DC ICLS+F AG+R+RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL++T
Sbjct  113  REMNLSGLGEDCVICLSDFVAGERIRLLPKCNHGFHVRCIDKWLTQHITCPKCRHCLVET  172

Query  604  CQKIVG  621
            CQKI+G
Sbjct  173  CQKILG  178



>gb|KDO39742.1| hypothetical protein CISIN_1g035743mg, partial [Citrus sinensis]
Length=198

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 131/190 (69%), Gaps = 18/190 (9%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTT-----TFDANVVMVLSVLLC  237
             +S  L QDF+  F  RKLL   P     +   +AA++ +       D++V++VLSVLLC
Sbjct  6    FSSPKLPQDFIGKFHLRKLLPQNPL----TQQPIAAAAPSDAINKNLDSSVLLVLSVLLC  61

Query  238  ALICSLGVNSIIKCAL-RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            ALICSLG+N +I+  L +CS +AA  + A   + S          ++GIK  A+KTFPV+
Sbjct  62   ALICSLGLNFLIRYILIKCSRLAATESYANSSTPSVK--------SSGIKNNAIKTFPVV  113

Query  415  SYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCL  594
             Y+A+ K+PGLD +C ICLSEFA+G+ VRLLPKCNHGFHVRCIDKWL  HSSCP CRHCL
Sbjct  114  KYSAELKIPGLDAECVICLSEFASGELVRLLPKCNHGFHVRCIDKWLRLHSSCPKCRHCL  173

Query  595  IQTCQKIVGC  624
            I+TC+KI+GC
Sbjct  174  IETCEKIMGC  183



>ref|XP_006406567.1| hypothetical protein EUTSA_v10021951mg [Eutrema salsugineum]
 dbj|BAJ33918.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48020.1| hypothetical protein EUTSA_v10021951mg [Eutrema salsugineum]
Length=225

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 119/186 (64%), Gaps = 9/186 (5%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANSSFDTVAAS---STTTFDANVVMVLSVLLCALI  246
            +S +  + F+++F SRKLL   P   N+       +         ANV+++LS+L+C +I
Sbjct  9    SSQVFQEHFMDSFISRKLLQQLPFHHNTQQQQQEQAHVPDKNNLSANVLLLLSILVCGII  68

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            CSL ++ +I+CA R        +          S+    +AN GIKKKALK FPV++Y+ 
Sbjct  69   CSLALHYVIRCAFR-----RSSSFMISDPIPSQSTPRGSEANKGIKKKALKMFPVVNYSP  123

Query  427  DAKMP-GLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
            +  +  G+  +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL++T
Sbjct  124  EMNIESGVGEECVICLSDFVAGEQLRLLPKCNHGFHVRCIDKWLTQHMTCPKCRHCLVET  183

Query  604  CQKIVG  621
            CQKI+G
Sbjct  184  CQKILG  189



>ref|XP_010680271.1| PREDICTED: RING-H2 finger protein ATL78-like [Beta vulgaris subsp. 
vulgaris]
Length=232

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 117/187 (63%), Gaps = 17/187 (9%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLL-----SAPAPANSSFDTVAASST---TTFDANVVMVLSVLLCAL  243
            L Q  +     R++LL     S P PA    D V   S+   ++ DA+VVM+ SVLLC L
Sbjct  7    LPQHLISANLPRRMLLLNSPNSHPNPAPPPADYVTYPSSRRGSSIDADVVMIFSVLLCLL  66

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            I S+ VN +I+C L+C  +   +  +  +             + G+ K+AL+TFPV+ Y+
Sbjct  67   IFSICVNCLIRCMLKCFVVITAQDQSNLQKKII---------SNGVDKRALRTFPVVKYS  117

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             + K+ GL T+C ICLSEF  G++VR+LPKCNHGFHV CIDKWLSS SSCPTCR  L+ T
Sbjct  118  KEVKIQGLSTECVICLSEFKGGEKVRILPKCNHGFHVHCIDKWLSSQSSCPTCRQSLVDT  177

Query  604  CQKIVGC  624
            C+KI+GC
Sbjct  178  CKKIIGC  184



>ref|XP_010556017.1| PREDICTED: RING-H2 finger protein ATL75-like [Tarenaya hassleriana]
Length=228

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 122/188 (65%), Gaps = 14/188 (7%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAP---APANSSFDTVAASSTT---TFDANVVMVLSVLLC  237
            +S++  +D L  F SRKLLL  P    P  S  +   +   T       N +M+LSVL+C
Sbjct  8    SSNVFQEDNLSGFVSRKLLLHNPFNPNPQQSLLELTPSPPETESNNLSGNALMLLSVLIC  67

Query  238  ALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVIS  417
             +ICSLG++ II+CALR         +++   S   S+++   +NTGIK+K L+ FPV+S
Sbjct  68   GIICSLGLHYIIRCALR--------RSSSFMISDPISTSSPSTSNTGIKQKVLRMFPVVS  119

Query  418  YAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            Y+ +  + GL  +CAICLS+F  G+ +RLLPKCNHGFHVRCIDKWL  H SCP CRH L+
Sbjct  120  YSPEMNLSGLGDECAICLSDFVNGEHLRLLPKCNHGFHVRCIDKWLKLHLSCPKCRHSLV  179

Query  598  QTCQKIVG  621
            +TCQKI+G
Sbjct  180  ETCQKILG  187



>ref|XP_002891481.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67740.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            +  L  F SRKLLL  P   N+      A S           NV+M+LS+L+C +IC LG
Sbjct  16   EQSLGGFVSRKLLLHNPFDHNTQRAFAVAPSPLMTHENNLSGNVLMLLSILICGIICCLG  75

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA R        ++        G S     +N GIKKKAL+ FPV+SY+ +  +
Sbjct  76   LHYIIRCAFR------RTSSFMISEPISGLSTPCGSSNKGIKKKALRMFPVVSYSPEMNL  129

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            PGL  +C ICLS+F +G+++R+LPKC+HGFHVRCIDKWL    +CP CRHCL++TCQKI+
Sbjct  130  PGLGEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQRLTCPKCRHCLVETCQKIL  189

Query  619  G  621
            G
Sbjct  190  G  190



>emb|CDY61981.1| BnaC03g73800D [Brassica napus]
Length=221

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 115/178 (65%), Gaps = 6/178 (3%)
 Frame = +1

Query  94   QDF-LETFRSRKLLLSAPAPAN-SSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            Q++ + +F SRKLL   P   N            T    N++++LS+L+C +ICSLG++ 
Sbjct  12   QEYSINSFLSRKLLQQLPFHHNIQQQQQAQGPDKTNLSGNILLLLSILVCGIICSLGMHY  71

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            II+CA R     +     ++  S   +   +  AN GIKKK LK FPV++Y+ +  + G+
Sbjct  72   IIRCAFR----RSTSFMISDPISIPSTPRGSAAANRGIKKKVLKMFPVVTYSPEMNLSGV  127

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
              +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL+ TCQKI+G
Sbjct  128  GEECVICLSDFVAGEQIRLLPKCNHGFHVRCIDKWLTQHMTCPKCRHCLVDTCQKILG  185



>emb|CDX95504.1| BnaC01g33960D [Brassica napus]
Length=209

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +1

Query  85   LLGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            +  + F E F SRKLL   P   N                NV+MVLS+L+C +I SLG++
Sbjct  1    MYSEVFQEHFISRKLLQQLPFDHNMHQQEAHIPDKNNLSGNVLMVLSILVCGIIGSLGLH  60

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
             +I C  R     +     A+  SS  +   +  AN G+KKKALK FPVI Y+ +  + G
Sbjct  61   YVIGCIFR----RSSSFMIADPISSPSTPRGSATANKGVKKKALKMFPVIKYSREMNLLG  116

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            L  +C ICLS+F AG++VRLLPKCNHGFHVRCIDKWL  H +CP CRH L++TC KI+G
Sbjct  117  LGEECVICLSDFVAGEQVRLLPKCNHGFHVRCIDKWLKQHVTCPKCRHSLVETCHKILG  175



>ref|XP_003630207.1| RING finger protein [Medicago truncatula]
 gb|AET04683.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=217

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 127/193 (66%), Gaps = 24/193 (12%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAP----APANSSFDTVAASSTTT------FDANVVMVL  222
            + S LL +  +E+  +R+LL   P    +P +S   T   +ST +      FD+NVVM++
Sbjct  7    LTSQLLHELLVES-HTRRLLFQNPIDFQSPTSSPVLTNNHNSTDSNFGAREFDSNVVMIV  65

Query  223  SVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKT  402
            +VLLCA ICSL +NSII+CALR              S+   ++ + +  N GIKKKALK 
Sbjct  66   AVLLCAFICSLALNSIIRCALR-------------VSNVAINNNSPQLVNKGIKKKALKK  112

Query  403  FPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTC  582
            FP +SY+ +  +P LDTDC ICLSEF  G+++R+LPKCNHGFHVRCIDKWL  HSSCP C
Sbjct  113  FPTMSYSTELNLPSLDTDCMICLSEFTKGEKLRILPKCNHGFHVRCIDKWLKEHSSCPKC  172

Query  583  RHCLIQTCQKIVG  621
            R CL++TC+KI G
Sbjct  173  RQCLLETCRKIGG  185



>emb|CDX99318.1| BnaC05g34330D [Brassica napus]
Length=212

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 117/186 (63%), Gaps = 11/186 (6%)
 Frame = +1

Query  73   MASDLL---GQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCAL  243
            M+SD L    Q F E F SRKLL   P           A        NV+++LSVL+C +
Sbjct  1    MSSDHLPSSSQVFQEHFISRKLLQQLPFSHTIQQQQAHAPEKNNLSGNVLLLLSVLVCGI  60

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG++ +I+C  R          ++   S   SS +   AN GIKKKALK FPV+ Y+
Sbjct  61   ICSLGLHYVIRCVFR--------RHSSFMISEPISSPSTLAANKGIKKKALKMFPVVKYS  112

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             +  + GL  DC ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+ H +CP CRHCL++T
Sbjct  113  REMNLSGLGEDCVICLSDFVAGEQIRLLPKCNHGFHVRCIDKWLTQHITCPKCRHCLVET  172

Query  604  CQKIVG  621
            CQKI+G
Sbjct  173  CQKILG  178



>ref|XP_006393288.1| hypothetical protein EUTSA_v10011758mg [Eutrema salsugineum]
 gb|ESQ30574.1| hypothetical protein EUTSA_v10011758mg [Eutrema salsugineum]
Length=225

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 11/180 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASS-----TTTFDANVVMVLSVLLCALICSLG  258
            +  L  F SRKLLL  P    +   T  + S           NV+++LSVL+C +IC +G
Sbjct  15   EKLLGGFVSRKLLLHNPFDQTTQRATAVSPSPLITHENNLSGNVLILLSVLVCGIICCIG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+C LR        +           S     +N GIKKKAL+ FPV+SY+ +  +
Sbjct  75   LHYIIRCTLR------RSSIFLISEPITSLSTPRGSSNKGIKKKALRMFPVVSYSPEMNL  128

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             GL  +C ICLS+F +G+R+RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  129  RGLGEECVICLSDFVSGERLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLVETCQKIL  188



>emb|CDX82327.1| BnaA03g34940D [Brassica napus]
Length=216

 Score =   162 bits (410),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPAN-SSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            + F+ +F SRKLL   P   N            +    N++++LS+L+C +ICSLG++ I
Sbjct  13   EHFINSFLSRKLLQQLPFHHNIQQQQQAQGQDKSNLSGNILLLLSILVCGIICSLGLHYI  72

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            I+CA R     +     ++  S   +   +  AN GIKKK LK FPV++Y+ +  + G+ 
Sbjct  73   IRCAFR----RSSSFLISDPISIPSTPRGSAAANKGIKKKVLKMFPVLTYSPEMNLSGVG  128

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
             +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+   +CP CRHCL+ TCQKI+G
Sbjct  129  EECVICLSDFVAGEQIRLLPKCNHGFHVRCIDKWLTQQMTCPKCRHCLVDTCQKILG  185



>ref|XP_009135597.1| PREDICTED: RING-H2 finger protein ATL77-like [Brassica rapa]
Length=217

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPAN-SSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            + F+ +F SRKLL   P   N            +    N++++LS+L+C +ICSLG++ I
Sbjct  14   EHFINSFLSRKLLQQLPFHHNIQQQQQAQGQDKSNLSGNILLLLSILVCGIICSLGLHYI  73

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            I+CA R     +     ++  S   +   +  AN GIKKK LK FPV++Y+ +  + G+ 
Sbjct  74   IRCAFR----RSSSFLISDPISIPSTPRGSAAANKGIKKKVLKMFPVLTYSPEMNLSGVG  129

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
             +C ICLS+F AG+++RLLPKCNHGFHVRCIDKWL+   +CP CRHCL+ TCQKI+G
Sbjct  130  EECVICLSDFVAGEQIRLLPKCNHGFHVRCIDKWLTQQMTCPKCRHCLVDTCQKILG  186



>gb|AAL33552.1|AF436851_1 RING-H2 zinc finger protein [Cucumis melo]
Length=170

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 109/169 (64%), Gaps = 10/169 (6%)
 Frame = +1

Query  127  LLLSAPAPANSSFDTVAASST-TTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssia  303
             LL +P  A S  +         +FD NVVMVLSVLLCALICSLG+N+I+KCALRCS++ 
Sbjct  1    FLLPSPTAAASPPELAQPRPGFGSFDMNVVMVLSVLLCALICSLGLNAILKCALRCSTLL  60

Query  304  agrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA-KMPGLDTDCAICLSEF  480
            A  +      +             G+++  LK FP + Y+ +  K+ G+D +C ICL EF
Sbjct  61   ATVSGGRGGGALVVHP-------KGVRRNVLKKFPTVEYSKEGNKLRGIDGECVICLLEF  113

Query  481  AAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKI-VGC  624
             AGDRVR+LPKC HGFHV CIDKWLSSH+SCP CR+CL  TC KI  GC
Sbjct  114  EAGDRVRVLPKCYHGFHVHCIDKWLSSHTSCPKCRNCLTDTCHKIAAGC  162



>ref|XP_006652278.1| PREDICTED: RING-H2 finger protein ATL78-like [Oryza brachyantha]
Length=202

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 124/215 (58%), Gaps = 26/215 (12%)
 Frame = +1

Query  118  SRKLLLSAP---------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            SR++LL  P          P +S+      S  T FDAN+VM+L+VLLCALIC+LG+NSI
Sbjct  3    SRRILLHTPFSGQPSGPSQPVSSATVVEGGSPGTNFDANIVMILAVLLCALICALGLNSI  62

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            ++CALRCSS           +             +G+++KAL++ P++ Y+A  K+  + 
Sbjct  63   VRCALRCSSQMVVDHEPNRVTRLA---------QSGLRRKALRSMPILLYSAGLKLNAVS  113

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCta  630
              CAICLS+F AG+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L    QK  GC+ 
Sbjct  114  PMCAICLSDFEAGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFGAPQKASGCSE  173

Query  631  aaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            +  +Q       P         + PL  EGL+  Y
Sbjct  174  SEGSQAEPVPALPV--------LVPLRPEGLVTTY  200



>gb|AFK33954.1| unknown [Lotus japonicus]
Length=229

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 136/202 (67%), Gaps = 13/202 (6%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
            S+P+  NS+ D+   +    FD+N +M+L+VLLCALICSLG+NSII+C LR         
Sbjct  38   SSPSIKNSTTDSYFGNRE--FDSNAIMILAVLLCALICSLGLNSIIRCGLR-----FSNI  90

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM--PGLDTDCAICLSEFAAG  489
               + S +  +S + R AN GIKKKALK FP+++Y  + K+  PGLDT+C ICLSEF  G
Sbjct  91   VINDYSGTNNNSPSPRLANKGIKKKALKKFPIVNYTPELKLKLPGLDTECVICLSEFTDG  150

Query  490  DRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpp  669
            ++VR+LPKCNHGFHVRCIDKWLSSHSSCP CR CL++T +K+VG   ++  QP       
Sbjct  151  EKVRVLPKCNHGFHVRCIDKWLSSHSSCPKCRQCLLET-KKVVG---SSQVQPQQQLEAV  206

Query  670  pvpatvvLQIEPLHREGLIPNY  735
                 +V+ IEPL  EG+  +Y
Sbjct  207  LPVPEIVIMIEPLAPEGVERSY  228



>ref|XP_010507128.1| PREDICTED: RING-H2 finger protein ATL77-like [Camelina sativa]
Length=228

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 118/183 (64%), Gaps = 15/183 (8%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALICS  252
              + F+++F SRKLL   P      FD   A      D      NV+++LSVLLC +ICS
Sbjct  18   FQEHFIDSFVSRKLLQQLP------FDHTTAQQAHDPDKNNLSGNVLLLLSVLLCGIICS  71

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADA  432
            LG++ II+CA       +     ++  SS  +  ++   N GIKKKALK FPV++Y+ D 
Sbjct  72   LGLHYIIRCAF----TRSRSFMISDPISSPSTPQSSEVVNKGIKKKALKMFPVVNYSPDT  127

Query  433  KMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
             + GL  +C ICLS+FA G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQK
Sbjct  128  NLSGLGEECVICLSDFATGEQLRLLPKCNHGFHVRCIDKWLKQHMTCPKCRHCLVETCQK  187

Query  613  IVG  621
            I+G
Sbjct  188  ILG  190



>ref|XP_008784248.1| PREDICTED: RING-H2 finger protein ATL78-like [Phoenix dactylifera]
Length=219

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 121/222 (55%), Gaps = 29/222 (13%)
 Frame = +1

Query  103  LETFRSRKLLL-----SAPAPANSSFDTVAASS------TTTFDANVVMVLSVLLCALIC  249
            +  F  R+LLL       P   N S+  +  S        ++ DANVVM+L+VLLCALIC
Sbjct  16   IRDFYYRRLLLHTPLYKQPTQLNPSWTGLGGSEPDSGRPVSSLDANVVMILAVLLCALIC  75

Query  250  SLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAAD  429
            +LG+NSI++CALRCS+  A        +             TG ++KAL+  P + Y+A 
Sbjct  76   ALGLNSIVRCALRCSNPMAVEPETDPVALRFA--------QTGKRRKALRDLPTLVYSAG  127

Query  430  AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQ  609
             K+ G +T+CAICLS+F  G+RVR LPKCNHGFHVRC+D+WL + SSCPTCR CL  +  
Sbjct  128  LKLDGANTECAICLSDFVPGERVRFLPKCNHGFHVRCVDRWLIARSSCPTCRQCLFCSNP  187

Query  610  KIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            K   C                        + PL  EGLI +Y
Sbjct  188  KTSDCAEVNQPGRAPVQEV----------LVPLEPEGLITSY  219



>ref|XP_009107314.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Brassica rapa]
Length=226

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANS-SFDTVAASSTTTFDAN----VVMVLSVLLCA  240
            ++ +  +  L  F SRKLL+  P   N+     V  S   T + N    V+M+LSVL+C 
Sbjct  9    SAQVFQEQLLGDFVSRKLLMHNPFDHNTLRALAVPPSPPVTHENNLSETVLMLLSVLICG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC L ++ II+CA R        ++     S+         +N GIKKKALK F V+SY
Sbjct  69   IICCLVLHYIIRCAFR------SCSSFMISESTSIFLTPHSSSNKGIKKKALKMFSVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
              +  + G+  +C ICLS+F  G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  THEMNLSGIGEECVICLSDFVCGEKLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>ref|XP_010931361.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=182

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 104/165 (63%), Gaps = 20/165 (12%)
 Frame = +1

Query  124  KLLLSAPAPAN------SSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            + L+ AP PAN      S +D   A     FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  2    RQLVEAPPPANGAKPHGSGYD---AGGDANFDTNMVIILAALLCALICALGLNSIVRCAL  58

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RC       T     +             TG+KK+AL+  PV  Y  +A +P   TDC I
Sbjct  59   RCGRRLDFETPEEAAARLAA---------TGLKKRALRRIPVAVYGPEANIPA--TDCPI  107

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL EFA G++VR+LPKC+HGFHVRCID WL+SHSSCPTCRH L+ 
Sbjct  108  CLGEFADGEKVRVLPKCHHGFHVRCIDTWLASHSSCPTCRHSLLD  152



>ref|XP_006854529.1| hypothetical protein AMTR_s00030p00032810 [Amborella trichopoda]
 gb|ERN15996.1| hypothetical protein AMTR_s00030p00032810 [Amborella trichopoda]
Length=191

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 111/178 (62%), Gaps = 17/178 (10%)
 Frame = +1

Query  112  FRSRKLLL---------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            F SRKLL          SAP   + S    + +  +TFDANV M+L+VLLCALIC+LG+N
Sbjct  2    FNSRKLLTFRLSGSNVASAPDIGSHSRTPDSYTGNSTFDANVAMILAVLLCALICALGLN  61

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SII+CALRCSS      A    +S             G+K+K L+ FP + +  D+K  G
Sbjct  62   SIIRCALRCSSRIGSDPARRIEASRLV--------TKGVKRKTLRRFPTVVFGDDSKPNG  113

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
              +DCAICL+EF AGD++R+LP C HGFH+RCID WL+ HSSCPTCR  +  TC K V
Sbjct  114  FGSDCAICLAEFQAGDKLRILPFCRHGFHIRCIDTWLAFHSSCPTCRCLMNDTCLKKV  171



>ref|XP_010930995.1| PREDICTED: RING-H2 finger protein ATL72-like [Elaeis guineensis]
Length=219

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 21/198 (11%)
 Frame = +1

Query  145  APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaa  324
             PA S  D+      T+FD NVVM+L+VLLCALIC+LG+ SI++CALRCS+  A      
Sbjct  42   GPAGSEPDS--GMPGTSFDGNVVMILAVLLCALICALGLKSIVRCALRCSTRMAVDAEPN  99

Query  325  ersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRL  504
              +             TG+++KAL+  P + Y+A  K+   + +CAICLS+F  G+RVR+
Sbjct  100  PVARFA---------QTGMRRKALRAMPTLVYSAGLKLHRANPECAICLSDFVPGERVRV  150

Query  505  LPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatpppvpat  684
            LPKCNHGFH+ CID+WL + SSCPTCR CL  +  K  GC A     P    +       
Sbjct  151  LPKCNHGFHIGCIDRWLMARSSCPTCRRCLFGSSPKSPGCAAMNRPAPVPVQSV------  204

Query  685  vvLQIEPLHREGLIPNYH  738
                + PL  EGL+ NY 
Sbjct  205  ----LVPLEPEGLVTNYE  218



>ref|XP_006299288.1| hypothetical protein CARUB_v10015442mg [Capsella rubella]
 gb|EOA32186.1| hypothetical protein CARUB_v10015442mg [Capsella rubella]
Length=215

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 10/186 (5%)
 Frame = +1

Query  73   MASDLL---GQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCAL  243
            M SD L    Q F E F SRKLL       +++              NV+++LS+LLC +
Sbjct  1    MFSDHLPSSSQVFQEHFISRKLLQQF---HHTTTQQAHVPDRNNLSGNVLLLLSILLCGI  57

Query  244  ICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYA  423
            ICSLG++ II+CA R     +     ++  SS  +   + + + GIKKKALK FPV++Y+
Sbjct  58   ICSLGLHYIIRCAFR----RSRSFMISDPISSPSTPRGSEEVSKGIKKKALKMFPVVNYS  113

Query  424  ADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQT  603
             +  + GL  +C ICLS+FAAG+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++T
Sbjct  114  PEINLSGLGEECVICLSDFAAGEQLRLLPKCNHGFHVRCIDKWLKQHMTCPKCRHCLVET  173

Query  604  CQKIVG  621
            CQKI+G
Sbjct  174  CQKILG  179



>ref|XP_010487798.1| PREDICTED: RING-H2 finger protein ATL77-like [Camelina sativa]
Length=236

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 117/181 (65%), Gaps = 14/181 (8%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALICSLG  258
            + F+ +F SRKLL   P      FD   A      D      NV+++LSVLLC +ICSLG
Sbjct  27   EHFINSFVSRKLLQQLP------FDHTTAQQAHDPDKNNLSGNVLLLLSVLLCGIICSLG  80

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA    + +     +   SS   +   +   N GIKKKALK FPV++Y+ +  +
Sbjct  81   LHYIIRCAF---TRSRSFMISDPISSPSSTPRGSEVTNKGIKKKALKMFPVVNYSPETNL  137

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             GL  +C ICLS+FAAG+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  138  SGLGDECVICLSDFAAGEQLRLLPKCNHGFHVRCIDKWLKQHMTCPKCRHCLVETCQKIL  197

Query  619  G  621
            G
Sbjct  198  G  198



>ref|XP_010489924.1| PREDICTED: RING-H2 finger protein ATL77-like [Camelina sativa]
Length=225

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 117/181 (65%), Gaps = 14/181 (8%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALICSLG  258
            + F+ +F SRKLL   P      FD   A      D      NV+++LSVLLC +ICSLG
Sbjct  28   EHFINSFVSRKLLQQLP------FDHTTAQQAHDPDKNNLSGNVLLLLSVLLCGIICSLG  81

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA    + +     +   SS   +   +   N GIKKKALK FPV++Y+ +  +
Sbjct  82   LHYIIRCAF---TRSRSFMISDPISSPSSTPRGSEVTNKGIKKKALKMFPVVNYSPETNL  138

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             GL  +C ICLS+FAAG+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  139  SGLGDECVICLSDFAAGEQLRLLPKCNHGFHVRCIDKWLKQHMTCPKCRHCLVETCQKIL  198

Query  619  G  621
            G
Sbjct  199  G  199



>ref|XP_010465990.1| PREDICTED: RING-H2 finger protein ATL77-like [Camelina sativa]
Length=229

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 118/181 (65%), Gaps = 14/181 (8%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFD-----ANVVMVLSVLLCALICSLG  258
            + F+++F SRKLL   P      FD   A      D      NV+++LSVLLC +ICSLG
Sbjct  21   EHFMDSFVSRKLLQQLP------FDHTTAQQAHDPDKNNLSGNVLLLLSVLLCGIICSLG  74

Query  259  VNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKM  438
            ++ II+CA    + +     +   SS   +   +   N GIKKKALK FPV++Y+ +  +
Sbjct  75   LHYIIRCAF---TRSRSFMISDPISSPSSTPRGSEVTNKGIKKKALKMFPVVNYSPEMNL  131

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             GL  +C ICLS+FA+G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++TCQKI+
Sbjct  132  SGLGEECVICLSDFASGEQLRLLPKCNHGFHVRCIDKWLKQHMTCPKCRHCLVETCQKIL  191

Query  619  G  621
            G
Sbjct  192  G  192



>ref|XP_008456776.1| PREDICTED: RING-H2 finger protein ATL74 [Cucumis melo]
Length=202

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 108/165 (65%), Gaps = 12/165 (7%)
 Frame = +1

Query  115  RSRKLLLSA---PAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            RS +LLL A    AP+N S    + ++   FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  11   RSHRLLLDADTTAAPSNGSRTRNSYNNEANFDTNMVIILAALLCALICALGLNSIVRCAL  70

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS   A  T     S             +G+KK AL+  PV  Y ++  +   +TDC I
Sbjct  71   RCSRRFAFETGGGTASRLTA---------SGLKKSALRQIPVAVYGSETGLEIRETDCPI  121

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL +F AG+++++LPKCNHGFHVRCID WL+SHSSCPTCR  L++
Sbjct  122  CLGDFIAGEKIKVLPKCNHGFHVRCIDTWLASHSSCPTCRQSLVE  166



>ref|XP_008663190.1| PREDICTED: RING-H2 finger protein ATL73-like isoform X2 [Zea 
mays]
 gb|AFW58219.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=204

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 108/173 (62%), Gaps = 14/173 (8%)
 Frame = +1

Query  121  RKLLLSAPAPANSS-----FDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R+ LL  P   + S      D   A+  + FDANVVM+L+VLLCALIC+LG+NSI++CAL
Sbjct  5    RRTLLHTPFSGHPSGPSQPIDGATATDGSNFDANVVMILAVLLCALICALGLNSIVRCAL  64

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCSS         + +             +G+++KAL+  PV+ Y+   ++   +  CAI
Sbjct  65   RCSSRVVVGPEPNQVTRLV---------QSGLRRKALRAMPVLVYSPGLRINAANPTCAI  115

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            CLS+F AG+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L    QK  GC
Sbjct  116  CLSDFEAGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFGVPQKASGC  168



>ref|XP_008663188.1| PREDICTED: RING-H2 finger protein ATL73-like isoform X1 [Zea 
mays]
 ref|XP_008663189.1| PREDICTED: RING-H2 finger protein ATL73-like isoform X1 [Zea 
mays]
Length=208

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 108/173 (62%), Gaps = 14/173 (8%)
 Frame = +1

Query  121  RKLLLSAPAPANSS-----FDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R+ LL  P   + S      D   A+  + FDANVVM+L+VLLCALIC+LG+NSI++CAL
Sbjct  9    RRTLLHTPFSGHPSGPSQPIDGATATDGSNFDANVVMILAVLLCALICALGLNSIVRCAL  68

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCSS         + +             +G+++KAL+  PV+ Y+   ++   +  CAI
Sbjct  69   RCSSRVVVGPEPNQVTRLV---------QSGLRRKALRAMPVLVYSPGLRINAANPTCAI  119

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            CLS+F AG+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L    QK  GC
Sbjct  120  CLSDFEAGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFGVPQKASGC  172



>ref|XP_010239893.1| PREDICTED: RING-H2 finger protein ATL78-like [Brachypodium distachyon]
Length=199

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSII  273
            +  L  F  +    S P  A S+ D  A  S   FDANVVM+L+VLLCALIC LG+NSI+
Sbjct  5    RTLLHAFSGQPSGPSQPVAATSATDDGAPGSN--FDANVVMILAVLLCALICVLGLNSIV  62

Query  274  KCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDT  453
            +CALRCSS     +     +              G+++KAL+  P++ Y+A  ++     
Sbjct  63   RCALRCSSRVVVDSEPNLVARLA---------KGGLRRKALRAMPILVYSARLRLSTASP  113

Query  454  DCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
             CAICLS+F  G+ VR+LPKCNHGFHVRCID+WL + SSCPTCR  L +  QK  GC
Sbjct  114  LCAICLSDFEPGEHVRVLPKCNHGFHVRCIDRWLLARSSCPTCRQSLFEAPQKTGGC  170



>ref|XP_008792228.1| PREDICTED: RING-H2 finger protein ATL74-like [Phoenix dactylifera]
Length=182

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 101/165 (61%), Gaps = 20/165 (12%)
 Frame = +1

Query  124  KLLLSAPAPAN------SSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            + LL AP P N      S +D         FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  2    RQLLGAPPPENGGKPQGSGYD---GGGDANFDTNMVIILAALLCALICALGLNSIVRCAL  58

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RC    A  T     +             TG+KK+AL+  PV  Y     +P   TDC I
Sbjct  59   RCGRRLAFETQEEAAARLAA---------TGLKKRALRRIPVAVYGPGVNIPA--TDCPI  107

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL EFA G++VR+LPKC+HGFHVRCID WL+SHSSCPTCRH L+ 
Sbjct  108  CLGEFADGEKVRVLPKCHHGFHVRCIDTWLASHSSCPTCRHSLLD  152



>ref|XP_010911967.1| PREDICTED: RING-H2 finger protein ATL78 [Elaeis guineensis]
Length=207

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 110/202 (54%), Gaps = 19/202 (9%)
 Frame = +1

Query  142  PAPANSSFDTVAAS---STTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagr  312
            P PA       AA    S T FDANV+M+L+  LCA+IC+L VN+I++C LR ++     
Sbjct  19   PNPAGPVATPAAAGPSRSFTQFDANVIMILAAFLCAMICALAVNTIVRCCLRFTNRVWVG  78

Query  313  taaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGD  492
               A           +       +K+ALK  P + Y+    +P   +DCAICLSEFA G+
Sbjct  79   PEPAGTLDQPAPVRVS-------RKEALKALPTLVYSTGLGLPLSGSDCAICLSEFAPGE  131

Query  493  RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCtaaaatqpptpatppp  672
            RVR+LPKCNHGFHVRCID+WL+S SSCP CR CL  +CQ I GC                
Sbjct  132  RVRVLPKCNHGFHVRCIDRWLASRSSCPMCRQCLFGSCQVIFGC---------REVALTG  182

Query  673  vpatvvLQIEPLHREGLIPNYH  738
               +  +Q+ P+  EG +  Y 
Sbjct  183  STQSAPVQMNPMDPEGFLVEYR  204



>ref|NP_001052775.2| Os04g0419500 [Oryza sativa Japonica Group]
 dbj|BAF14689.2| Os04g0419500 [Oryza sativa Japonica Group]
Length=202

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 122/215 (57%), Gaps = 26/215 (12%)
 Frame = +1

Query  118  SRKLLLSAP---------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            SR++LL  P          P + +      S  + FDAN+VM+L+VLLCALIC+LG+NSI
Sbjct  3    SRRILLHTPFSGQPSGPSQPVSGATIVEGGSPGSNFDANIVMILAVLLCALICALGLNSI  62

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            ++CALRCSS        +  +             +G+++KAL++ P++ Y+   K+  + 
Sbjct  63   VRCALRCSSRMVVDPEPSRVTRLA---------QSGLRRKALRSMPILLYSTGLKLNTVS  113

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGCta  630
              CAICLS+F  G+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L    QK  GC+ 
Sbjct  114  PMCAICLSDFEDGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFGAPQKASGCSE  173

Query  631  aaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            +  +Q       P         + PL  EGL+  Y
Sbjct  174  SEGSQAEPAPARPV--------LAPLRPEGLVTPY  200



>ref|XP_004975603.1| PREDICTED: RING-H2 finger protein ATL78-like [Setaria italica]
Length=201

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = +1

Query  148  PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaae  327
            P + +  T   +  + FDANVVM+L+VLLCALIC+LG+NSI++CALRCSS          
Sbjct  23   PLDGAAPTDGGAPGSNFDANVVMILAVLLCALICALGLNSIVRCALRCSSRTVVDPVPNP  82

Query  328  rsssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLL  507
             +             +G+K+KAL+  P++ Y+A  K+   +  CAICLS+F AG+ VR+L
Sbjct  83   VTRLA---------QSGLKRKALRAMPILVYSAGLKLNAANPMCAICLSDFEAGEHVRVL  133

Query  508  PKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
             KCNHGFHVRCID+WL + S+CPTCR  L    QK  GC
Sbjct  134  SKCNHGFHVRCIDRWLLARSTCPTCRQSLFGAPQKASGC  172



>gb|ABK25761.1| unknown [Picea sitchensis]
Length=222

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 116/183 (63%), Gaps = 23/183 (13%)
 Frame = +1

Query  94   QDFLE-TFRSRKLLLSAPAPANSSFDTVAAS------------STTTFDANVVMVLSVLL  234
            + FLE T  +R+LLL   +P++   D                   ++FD N+V++L+ LL
Sbjct  8    RKFLEWTETTRRLLLEPASPSSEGLDASPRQKPAEGSSRGPYMGESSFDTNMVVILAALL  67

Query  235  CALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVI  414
            CALIC+LG+NSI++CALRCS   A    +AE   +  +       NTG+K+KAL+  P  
Sbjct  68   CALICALGLNSIVRCALRCSRARAVLFESAEDVEARLA-------NTGMKRKALRALPTA  120

Query  415  SY-AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHC  591
             Y AA +K+P   TDC ICL+EF  GD VR+LPKCNHGFH+RCID WL+SHSSCPTCR  
Sbjct  121  VYGAAGSKLPC--TDCPICLAEFLEGDEVRILPKCNHGFHMRCIDTWLASHSSCPTCRQN  178

Query  592  LIQ  600
            L++
Sbjct  179  LLE  181



>emb|CDY16484.1| BnaA08g02830D [Brassica napus]
Length=226

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 112/187 (60%), Gaps = 11/187 (6%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAPAPANS-SFDTVAASSTTTFDAN----VVMVLSVLLCA  240
            ++    +  L  F SRKLL+      N+     V  S   T + N    V+M+LSVL+C 
Sbjct  9    SAQAFQEQLLGGFVSRKLLMHNLFDHNTLRALAVPPSPPVTHENNLSETVLMLLSVLICG  68

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            +IC L ++ II+CA R        ++     S+         +N GIKKKALK F V+SY
Sbjct  69   IICCLVLHYIIRCAFR------SCSSFMISESTSIFLTPHSSSNKGIKKKALKMFSVVSY  122

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
              +  + G+  +C ICLS+F  G+++RLLPKCNHGFHVRCIDKWL  H +CP CRHCL++
Sbjct  123  THEMNLSGIGEECVICLSDFVCGEKLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRHCLVE  182

Query  601  TCQKIVG  621
            TCQKI+G
Sbjct  183  TCQKILG  189



>ref|XP_010922739.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
 ref|XP_010922740.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=184

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 103/166 (62%), Gaps = 18/166 (11%)
 Frame = +1

Query  124  KLLLSAPAPANSS-------FDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            + LL AP PAN S           A +   +FD N+V++L+ LLCALIC+LG+NSI++CA
Sbjct  2    RQLLEAPPPANGSKPRSSAYGGGGAGAGNASFDTNMVIILAALLCALICALGLNSIVRCA  61

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
            LRC    A  T     +             TG+KK+AL+  PV  Y     +P   TDC 
Sbjct  62   LRCGRRLAFETPEEAAARLAA---------TGLKKRALRRLPVAVYGPGTNIPA--TDCP  110

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            ICL EFA G++VR+LPKC+HGFHVRCID WL+SHSSCPTCRH L+ 
Sbjct  111  ICLGEFADGEKVRVLPKCHHGFHVRCIDTWLASHSSCPTCRHSLLD  156



>ref|XP_009414837.1| PREDICTED: RING-H2 finger protein ATL78-like [Musa acuminata 
subsp. malaccensis]
Length=211

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 121/196 (62%), Gaps = 28/196 (14%)
 Frame = +1

Query  76   ASDLLGQDFLETFRSRKLLLSAP------AP-----ANSSF---DTVAASSTTTFDANVV  213
            AS ++G   L+ + SR+LLLSAP      AP     A S+F   D   +SST     N V
Sbjct  4    ASTVVGPIALDIY-SRRLLLSAPVFMQHPAPPSPWIAGSNFGLSDRPGSSST-----NAV  57

Query  214  MVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKA  393
            M+++VLLCAL C+LG+NS+++CALR         +    +    +   AR A TG+ KKA
Sbjct  58   MIVAVLLCALACALGLNSVVRCALR--------ASNQMAAEGVANHPVARLARTGLGKKA  109

Query  394  LKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSC  573
            L+  P++ Y+   K+ G   +CAICLSEF AG+ +R+LPKCNHGFH RCIDKWL + SSC
Sbjct  110  LQRLPMLVYSTGLKLTGSVPECAICLSEFEAGEEIRVLPKCNHGFHRRCIDKWLMARSSC  169

Query  574  PTCRHCLIQTCQKIVG  621
            PTCR CL   C+K  G
Sbjct  170  PTCRRCLFGACRKTSG  185



>gb|KGN45834.1| hypothetical protein Csa_6G014550 [Cucumis sativus]
Length=202

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 108/166 (65%), Gaps = 14/166 (8%)
 Frame = +1

Query  115  RSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            R  +LLL    +AP P+N S    + ++   FD N+V++L+ LLCALIC+LG+NSI++CA
Sbjct  11   RPPRLLLDPDTTAP-PSNGSRTRNSYNNEANFDTNMVIILAALLCALICALGLNSIVRCA  69

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
            LRCS   A  T     S             TG+KK AL+  PV  Y ++  +   +TDC 
Sbjct  70   LRCSRRFAFETGGGTASRLTA---------TGLKKSALRQIPVAVYGSETGLEIRETDCP  120

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            ICL +F AG+++++LPKCNHGFHVRCID WL+SHSSCPTCR  L++
Sbjct  121  ICLGDFMAGEKIKILPKCNHGFHVRCIDTWLASHSSCPTCRQSLLE  166



>ref|XP_010103646.1| RING-H2 finger protein ATL73 [Morus notabilis]
 gb|EXB96529.1| RING-H2 finger protein ATL73 [Morus notabilis]
Length=220

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  181  SSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaa  360
            +S   FD N+V++L+ LLCALIC+LG+NSI++CALRC+   A  T     +         
Sbjct  47   ASEANFDTNMVIILAALLCALICALGLNSIVRCALRCTRRFAFETPDEAAARLAA-----  101

Query  361  rqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRC  540
                TG+KK AL+  PV +Y + + +  LDTDC ICL EF  GD+VR+LPKC+HGFHVRC
Sbjct  102  ----TGLKKSALRKIPVTAYGSASGIKTLDTDCTICLGEFEEGDKVRVLPKCSHGFHVRC  157

Query  541  IDKWLSSHSSCPTCRHCLIQ  600
            ID WL SHSSCPTCR  L++
Sbjct  158  IDPWLVSHSSCPTCRQSLVE  177



>gb|EEE60987.1| hypothetical protein OsJ_14782 [Oryza sativa Japonica Group]
Length=253

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = +1

Query  118  SRKLLLSAP---------APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSI  270
            SR++LL  P          P + +      S  + FDAN+VM+L+VLLCALIC+LG+NSI
Sbjct  3    SRRILLHTPFSGQPSGPSQPVSGATIVEGGSPGSNFDANIVMILAVLLCALICALGLNSI  62

Query  271  IKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLD  450
            ++CALRCSS        +  +             +G+++KAL++ P++ Y+   K+  + 
Sbjct  63   VRCALRCSSRMVVDPEPSRVTRLA---------QSGLRRKALRSMPILLYSTGLKLNTVS  113

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
              CAICLS+F  G+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L    QK  GC
Sbjct  114  PMCAICLSDFEDGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFGAPQKASGC  171



>ref|XP_007218405.1| hypothetical protein PRUPE_ppa011446mg [Prunus persica]
 gb|EMJ19604.1| hypothetical protein PRUPE_ppa011446mg [Prunus persica]
Length=210

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 98/155 (63%), Gaps = 11/155 (7%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
            + P PAN S      ++   FD N+V++L+ LLCALI +LG+NSI++CALRCS   +  T
Sbjct  30   TTPDPANGSRTRGTYTNEANFDTNMVIILAALLCALIFALGLNSIVRCALRCSRRFSFET  89

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDR  495
                 +             TG+KK  L+  P+++Y + A +P   TDC ICL EF  G +
Sbjct  90   PDETAARLAA---------TGLKKSTLRQIPIVAYGSGANIPA--TDCPICLGEFQDGQK  138

Query  496  VRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            VRLLPKCNHGFHVRCID W  SHSSCPTCRH L++
Sbjct  139  VRLLPKCNHGFHVRCIDTWFLSHSSCPTCRHSLLE  173



>ref|XP_002319337.2| hypothetical protein POPTR_0013s09370g, partial [Populus trichocarpa]
 gb|EEE95260.2| hypothetical protein POPTR_0013s09370g, partial [Populus trichocarpa]
Length=220

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 104/166 (63%), Gaps = 14/166 (8%)
 Frame = +1

Query  115  RSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            R  +LLL    S    AN S      SS   FD+N+V++L+ LLCALIC+LG+NSI++CA
Sbjct  7    RPHRLLLDTESSTRPAANESRTRNTYSSDANFDSNMVIILAALLCALICALGLNSIVRCA  66

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
            LRCS   A  T     +             TG+KK AL+  PVI Y     +  + TDCA
Sbjct  67   LRCSRRFAFETPDQTAARLAA---------TGLKKSALRQIPVIIYGVSG-IHTIATDCA  116

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            ICL EF  G++VR+LPKCNHGFHVRCID WL SHSSCPTCRH L++
Sbjct  117  ICLGEFIDGEKVRVLPKCNHGFHVRCIDTWLVSHSSCPTCRHSLLE  162



>ref|XP_002446457.1| hypothetical protein SORBIDRAFT_06g016320 [Sorghum bicolor]
 gb|EES10785.1| hypothetical protein SORBIDRAFT_06g016320 [Sorghum bicolor]
Length=263

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 109/164 (66%), Gaps = 10/164 (6%)
 Frame = +1

Query  136  SAPA-PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagr  312
            S+P+ P + +  T + +  + FDAN+VM+L+VLLCALIC+LG+NSI++CALRCSS     
Sbjct  18   SSPSHPLDGAAATDSGAPGSNFDANIVMILAVLLCALICALGLNSIVRCALRCSSQIVVG  77

Query  313  taaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGD  492
                + +             +G+++KAL+  P++ Y+A  K+   +  CAICLS+F AG+
Sbjct  78   PEPNQATRLA---------QSGMRRKALRAMPILVYSAGLKLNAANPMCAICLSDFEAGE  128

Query  493  RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
             VR+LPKC HGFHVRCID+WL + S+CPTCR  L +  QK  GC
Sbjct  129  HVRVLPKCKHGFHVRCIDRWLLARSTCPTCRQSLSRVQQKASGC  172



>gb|AET04685.2| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=231

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 135/232 (58%), Gaps = 25/232 (11%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPA-----PANSSFDTVAASSTTT------FDANVVMV  219
              S LL +  +E+  +R+LL+  P        NS   T + +ST +      FD+NVVM+
Sbjct  7    FTSPLLHELLVES-HTRRLLIQNPVDHQSLKINSRIFTNSHNSTDSYFRAPEFDSNVVMI  65

Query  220  LSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALK  399
            L+V+LCA I  L +N II+ AL    I        + SSS  ++ + +  N GIKKKALK
Sbjct  66   LAVVLCAFIGPLALNFIIRRAL----IFLNVALNNDSSSSSSNNNSPQLVNKGIKKKALK  121

Query  400  TFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPT  579
             FP +SY+ +  +P LDTDC ICLSEF  G+++R+LPKCNHGFHVRCIDKWL  HSSCP 
Sbjct  122  KFPTMSYSTELNLPSLDTDCMICLSEFTKGEKLRILPKCNHGFHVRCIDKWLKEHSSCPK  181

Query  580  CRHCLIQTCQKIVGCtaaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            CR CL++TC+KI G                      +++IEPL  E L  NY
Sbjct  182  CRQCLLETCRKIGG---------SQVQPILLPVPETIIRIEPLEHEALERNY  224



>ref|XP_008809453.1| PREDICTED: RING-H2 finger protein ATL74-like isoform X2 [Phoenix 
dactylifera]
Length=181

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 103/165 (62%), Gaps = 17/165 (10%)
 Frame = +1

Query  121  RKLL---LSAPAPANSS---FDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            R+LL   L AP PAN S           + +FD N+V++L+ LLCALIC+LG+NSI++CA
Sbjct  2    RQLLGAALEAPPPANGSKPQGSAYGGGGSASFDTNMVIILAALLCALICALGLNSIVRCA  61

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
            LRC    A  T     +             TG+KK+AL+  PV  Y     +P   TDC 
Sbjct  62   LRCGRRLAFETPEEAAARLAA---------TGLKKRALRRIPVAVYGPGTNIPA--TDCP  110

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            ICL EFA G++VR+LP+C+HGFHV CID WL+SHSSCPTCRH L+
Sbjct  111  ICLGEFADGEKVRVLPRCHHGFHVSCIDTWLASHSSCPTCRHSLL  155



>gb|ABK22591.1| unknown [Picea sitchensis]
Length=204

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 113/177 (64%), Gaps = 17/177 (10%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPA-------PANSSFDTVAASSTTTFDANVVMVLSVLLCALICS  252
            +  LE   S + ++  PA       P   + DT     T+ F+ N++++L+ LLCALIC+
Sbjct  5    RKVLELMESTRRIVLEPASEGFNSNPGQKAADTPYIGETS-FNTNMLVILAALLCALICA  63

Query  253  LGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY-AAD  429
            +G+NSI++CALRC+        +A+ + +          NTG+K+KAL+  P   Y AA+
Sbjct  64   MGLNSIVRCALRCTRARTVLFVSAQDAEAARVV------NTGMKRKALRALPTAVYGAAE  117

Query  430  AKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +K+P   TDC ICL+EF  G+ VR+LPKCNHGFH+RCID WL++HSSCPTCR  L++
Sbjct  118  SKLPS--TDCPICLAEFVVGEEVRILPKCNHGFHMRCIDTWLAAHSSCPTCRQNLLE  172



>dbj|BAK06500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 121/217 (56%), Gaps = 27/217 (12%)
 Frame = +1

Query  109  TFRSRKLLLSAPA--------PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            +  SR+ LL  P+        P     D   A  +++FDANVVM+L+VLLCALIC+LG+N
Sbjct  14   SMYSRRTLLHTPSFSGGQPSGPIQPVTDG-GAPGSSSFDANVVMILAVLLCALICALGLN  72

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SI++CALRCSS        +   +             G+++KA++  P++ Y+A  K+  
Sbjct  73   SIVRCALRCSSRVVADAEPSRVVARLA--------KGGLRRKAVRAMPIMVYSAGLKLNT  124

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
                CAICLS+F AG+ V++LPKCNHGFHVRCID+WL + S+CPTCR CL    ++  GC
Sbjct  125  ACPMCAICLSDFEAGEHVKVLPKCNHGFHVRCIDRWLLARSTCPTCRQCLFAEPKRACGC  184

Query  625  taaaatqpptpatpppvpatvvLQIEPLHREGLIPNY  735
            +           +           + PL  EGLI  Y
Sbjct  185  SEPGQPDQARVHSV----------LVPLRPEGLITTY  211



>ref|XP_002325483.2| hypothetical protein POPTR_0019s08600g [Populus trichocarpa]
 gb|EEE99864.2| hypothetical protein POPTR_0019s08600g [Populus trichocarpa]
Length=192

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 14/171 (8%)
 Frame = +1

Query  100  FLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            F    R  +LLL    S  + AN S      +S   FD N+V++L+ LLCALIC+LG+NS
Sbjct  2    FAVHHRPHRLLLETESSTQSAANGSRTRNTYNSEANFDTNMVIILAALLCALICALGLNS  61

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            I++CA+RCS      T     +             TG+KK AL+  PVI Y   A +  +
Sbjct  62   IVRCAIRCSRRFTFETRDQTAAHMAA---------TGLKKSALRRIPVIIYGV-AGIHLI  111

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             TDCAICL EF  G++VR+LP CNHGFHVRCID WL SHSSCPTCR  L++
Sbjct  112  ATDCAICLGEFIGGEKVRVLPNCNHGFHVRCIDTWLVSHSSCPTCRQSLLE  162



>ref|XP_010658180.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
 emb|CAN70348.1| hypothetical protein VITISV_012580 [Vitis vinifera]
 emb|CBI25365.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 104/165 (63%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPAPANSSFDTVAASSTTT---FDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL     A+ +  +   SS T    FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  7    RPHRLLLDTDPGASPNVGSRMRSSYTNEANFDTNMVIILAALLCALICALGLNSIVRCAL  66

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS   A  TA    +             TG+KK AL+  PV  Y +   +P   TDC I
Sbjct  67   RCSRRLAFETADETAARLAA---------TGLKKSALRQIPVAVYGSGTNIPA--TDCPI  115

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL EF  GD+VR+LPKC+HGFH++CID WL SHSSCPTCRH L++
Sbjct  116  CLGEFEQGDKVRVLPKCHHGFHMKCIDTWLVSHSSCPTCRHSLLE  160



>ref|XP_002520866.1| RING-H2 finger protein ATL3C, putative [Ricinus communis]
 gb|EEF41575.1| RING-H2 finger protein ATL3C, putative [Ricinus communis]
Length=208

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA---PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL+  +   P N S    + ++   FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  10   RPHRLLLNTESNTPPINGS-RIRSYTNEANFDTNMVIILAALLCALICALGLNSIVRCAL  68

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS   A  T     +             TG+KK AL+  PV+ Y A A +  + TDCAI
Sbjct  69   RCSRRFAFETPDEAAARLAA---------TGLKKSALRQIPVVIYGA-AGIQIIATDCAI  118

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL EF+ G++VR+LPKCNHGFHVRCID WL SHSSCPTCR  L++
Sbjct  119  CLGEFSDGEKVRVLPKCNHGFHVRCIDTWLGSHSSCPTCRQSLLE  163



>ref|XP_010036001.1| PREDICTED: RING-H2 finger protein ATL74 [Eucalyptus grandis]
Length=179

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 101/163 (62%), Gaps = 18/163 (11%)
 Frame = +1

Query  133  LSAPAPANSSFDTVAAS-----STTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCss  297
            L  P P  S  +  AA+     S T FD N+V++L+ LLCALIC+LG+NSI++CALRCS 
Sbjct  15   LGGPPPDASGENGTAAATDSYISETNFDTNMVIILAALLCALICALGLNSIVRCALRCSR  74

Query  298  iaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY--AADAKMPGLDTDCAICL  471
                 T     +             TG+K++ L+  PV  Y  AA AK+P   T+C ICL
Sbjct  75   RFGAETPEQAAARLA---------TTGLKRRDLRQIPVAVYGSAAAAKIPA--TECPICL  123

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L+ 
Sbjct  124  GEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLD  166



>ref|XP_004302621.1| PREDICTED: RING-H2 finger protein ATL72-like [Fragaria vesca 
subsp. vesca]
Length=201

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 102/165 (62%), Gaps = 13/165 (8%)
 Frame = +1

Query  121  RKLLLSAPA-PANSSFDTVAAS-STTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            R+LL +A   P N+   T  +  S T FD N+V++L+ LLCALIC+LG+NSI++CALRCS
Sbjct  3    RRLLGNATELPYNNGNRTADSYVSETNFDTNMVIILAALLCALICALGLNSIVRCALRCS  62

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
               A  T     +             TG+KK  L+  PV  Y     +P   T+C ICL 
Sbjct  63   HRFALETPEQAAARLAA---------TGLKKSHLRQLPVAVYGEGTHIPA--TECPICLG  111

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQ  609
            EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L++  Q
Sbjct  112  EFEEGEKVRVLPKCNHGFHVRCIDTWLVSHSSCPNCRHSLLEHQQ  156



>ref|XP_008233881.1| PREDICTED: RING-H2 finger protein ATL74-like [Prunus mume]
Length=215

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 97/155 (63%), Gaps = 11/155 (7%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
            + P  AN S      ++   FD N+V++L+ LLCALI +LG+NSI++CALRCS   +  T
Sbjct  35   TTPDAANGSRTRGTYTNEANFDTNMVIILAALLCALIFALGLNSIVRCALRCSRRFSFET  94

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDR  495
                 +             TG+KK  L+  P+++Y + A +P   TDC ICL EF  G +
Sbjct  95   PDETAARLAA---------TGLKKSTLRQIPIVAYGSGANIPA--TDCPICLGEFQDGQK  143

Query  496  VRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            VRLLPKCNHGFHVRCID W  SHSSCPTCRH L++
Sbjct  144  VRLLPKCNHGFHVRCIDTWFLSHSSCPTCRHSLLE  178



>ref|XP_002531843.1| ring finger protein, putative [Ricinus communis]
 gb|EEF30541.1| ring finger protein, putative [Ricinus communis]
Length=205

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = +1

Query  73   MASDLLGQDFLETFRSRKLLLSAPAPANSSFDT--VAASSTTTFDANVVMVLSVLLCALI  246
            M S +  Q     F  ++   +A  P N    T    AS +T FD+N+V+VL+ LLCALI
Sbjct  1    MESSVYHQHHHRLFLEKEAAAAAVPPYNHGERTSEYYASESTNFDSNMVIVLAALLCALI  60

Query  247  CSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAA  426
            C+LG+NSI++CALR    +   ++    +    +    +  + GIKK++L   P + Y +
Sbjct  61   CALGLNSIVRCALR---FSYRFSSNTPSAVQAANLNPEQAIDRGIKKQSLSQIPEVKYES  117

Query  427  DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
               +P   TDC ICL EFA G++VR+LPKCNHGFHV+CIDKW+ SHSSCP CR  L++
Sbjct  118  GLNIP--VTDCPICLGEFAEGEKVRVLPKCNHGFHVKCIDKWILSHSSCPLCRQPLLE  173



>emb|CAE02923.1| OSJNBb0108J11.16 [Oryza sativa Japonica Group]
Length=431

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 113/188 (60%), Gaps = 22/188 (12%)
 Frame = +1

Query  100  FLETFR----SRKLLLSAP---------APANSSFDTVAASSTTTFDANVVMVLSVLLCA  240
            F+ T R    SR++LL  P          P + +      S  + FDAN+VM+L+VLLCA
Sbjct  114  FVHTPRVEMYSRRILLHTPFSGQPSGPSQPVSGATIVEGGSPGSNFDANIVMILAVLLCA  173

Query  241  LICSLGVNSIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY  420
            LIC+LG+NSI++CALRCSS        +  +             +G+++KAL++ P++ Y
Sbjct  174  LICALGLNSIVRCALRCSSRMVVDPEPSRVTRLA---------QSGLRRKALRSMPILLY  224

Query  421  AADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +   K+  +   CAICLS+F  G+ VR+LPKCNHGFHVRCID+WL + S+CPTCR  L  
Sbjct  225  STGLKLNTVSPMCAICLSDFEDGEHVRVLPKCNHGFHVRCIDRWLLARSTCPTCRQSLFG  284

Query  601  TCQKIVGC  624
              QK  GC
Sbjct  285  APQKASGC  292



>ref|XP_004952687.1| PREDICTED: RING-H2 finger protein ATL78-like isoform X1 [Setaria 
italica]
 ref|XP_004952688.1| PREDICTED: RING-H2 finger protein ATL78-like isoform X2 [Setaria 
italica]
Length=225

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +1

Query  178  ASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaa  357
             S   +FDANVVM+L+VLLCALIC+LG+NSI++CALRCS+       +A R         
Sbjct  43   GSGGNSFDANVVMILAVLLCALICALGLNSIVRCALRCSTRMPSSPGSARRQQPAMGEPG  102

Query  358  arqaNTGIKKKALKTFPVISYAA-----DAKMPGLDTDCAICLSEFAAGDRVRLLPKCNH  522
             R A  G ++KAL+  P + Y+A      A   G    CAICL+E   G+RVR+LPKCNH
Sbjct  103  LRLAQAGARRKALRAMPTLVYSAGLLPLQAAGGGGGPVCAICLAELEPGERVRVLPKCNH  162

Query  523  GFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            GFHVRC+D+WL + S+CPTCR  L    QK   C
Sbjct  163  GFHVRCVDRWLLARSTCPTCRQSLFAAPQKGSSC  196



>ref|XP_008809452.1| PREDICTED: RING-H2 finger protein ATL74-like isoform X1 [Phoenix 
dactylifera]
Length=220

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 103/165 (62%), Gaps = 17/165 (10%)
 Frame = +1

Query  121  RKLL---LSAPAPANSS---FDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            R+LL   L AP PAN S           + +FD N+V++L+ LLCALIC+LG+NSI++CA
Sbjct  41   RQLLGAALEAPPPANGSKPQGSAYGGGGSASFDTNMVIILAALLCALICALGLNSIVRCA  100

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
            LRC    A  T     +             TG+KK+AL+  PV  Y     +P   TDC 
Sbjct  101  LRCGRRLAFETPEEAAARLAA---------TGLKKRALRRIPVAVYGPGTNIPA--TDCP  149

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            ICL EFA G++VR+LP+C+HGFHV CID WL+SHSSCPTCRH L+
Sbjct  150  ICLGEFADGEKVRVLPRCHHGFHVSCIDTWLASHSSCPTCRHSLL  194



>ref|XP_011001401.1| PREDICTED: RING-H2 finger protein ATL74 [Populus euphratica]
 ref|XP_011001402.1| PREDICTED: RING-H2 finger protein ATL74 [Populus euphratica]
Length=192

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 14/171 (8%)
 Frame = +1

Query  100  FLETFRSRKLLL----SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            F    R  +LLL    S  + AN S      +S   FD N+V++L+ LLCALIC+LG+NS
Sbjct  2    FALHHRPHRLLLETESSTQSAANGSRTRNTYNSEANFDTNMVIILAALLCALICALGLNS  61

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            I++CA+RCS      T     +             TG+KK AL+  PVI Y   A +  +
Sbjct  62   IVRCAIRCSRRFIFETPDQTAAHMAA---------TGLKKSALRRIPVIIYGV-AGIHLI  111

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             TDCAICL EF  G++VR+LP CNHGFHVRCID WL SHSSCPTCR  L++
Sbjct  112  ATDCAICLGEFIGGEKVRVLPNCNHGFHVRCIDTWLVSHSSCPTCRQSLLE  162



>ref|XP_008785904.1| PREDICTED: RING-H2 finger protein ATL72-like [Phoenix dactylifera]
Length=203

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 106/177 (60%), Gaps = 14/177 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA-----PANSSFDTVA--ASSTTTFDANVVMVLSVLLCALICSLGVNSII  273
            +SR+L++ APA     PA S     A    S T+FDANV+MVL+V LCA+IC+L VN ++
Sbjct  4    QSRRLVIHAPAGPVAGPALSKPKAAAEPGGSFTSFDANVIMVLAVFLCAVICALVVNGVV  63

Query  274  KCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDT  453
            +C LR ++ A               +          +K+AL   P + Y+A   +P   +
Sbjct  64   RCILRLTNRAWVGPEPPGALDRPAPTRVG-------RKEALMALPTLVYSAGLGLPLAGS  116

Query  454  DCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVGC  624
            DCAICLSEF  G+RVR+LPKCNHGFHVRCID+WL+S  SCP CR  L  +C  I GC
Sbjct  117  DCAICLSEFLPGERVRVLPKCNHGFHVRCIDRWLASRLSCPMCRQGLFGSCPVIFGC  173



>gb|KHG05103.1| RING-H2 finger ATL74 -like protein [Gossypium arboreum]
Length=202

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 103/172 (60%), Gaps = 17/172 (10%)
 Frame = +1

Query  97   DFLETFRSRKLLLSA----PAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            D L     R+LL +     P   N + D+    S T FD N+V++L+ LLCALIC++G+N
Sbjct  8    DRLSVNMHRRLLGTEVSLPPENGNKTHDSYL--SETNFDTNLVVILAALLCALICAVGLN  65

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SI++CALRCS   +  T     +             TG+KK+ L+  PV  Y     +P 
Sbjct  66   SIVRCALRCSRRFSTETPEQAAARLAT---------TGLKKRDLRQIPVAVYGEGVSLPS  116

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            ++  C ICL EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L++
Sbjct  117  ME--CPICLGEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLE  166



>emb|CDP13909.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA---PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL       P N S      +S T FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  6    RPHRLLLGTQPDSPPRNESRTHNGYTSETKFDTNMVIILAALLCALICALGLNSIVRCAL  65

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS   A  +     +             TG+KK  L+  PV  Y     +P   TDC I
Sbjct  66   RCSRRFALESPDETAARLAA---------TGLKKSMLRRIPVAEYGTGVVLPA--TDCPI  114

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL EF  G++VR+LP+C+HGFHVRCID WL+SHSSCPTCR  L++
Sbjct  115  CLGEFEDGEKVRVLPRCHHGFHVRCIDIWLASHSSCPTCRQSLLE  159



>ref|XP_008244900.1| PREDICTED: RING-H2 finger protein ATL74-like [Prunus mume]
Length=206

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 101/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  121  RKLLLSAPAPANSSFDTVAAS--STTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            R LL + P  A S  +  A S  S   FD N+V++L+ LLCALIC+LG+NSI++CALRCS
Sbjct  3    RLLLGTEPNTAPSFRNRTADSYISEANFDTNMVIILAALLCALICALGLNSIVRCALRCS  62

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
               A  T     +             TG+KK  L+  PV  Y +  ++P   T+C ICL 
Sbjct  63   HRFALETPEQAAARLAA---------TGLKKSHLRQIPVAVYGSGVEIPA--TECPICLG  111

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            EF  G++VR+LP+CNHGFHVRCID WL SHSSCP CRH L++
Sbjct  112  EFEDGEKVRVLPECNHGFHVRCIDTWLLSHSSCPNCRHSLLE  153



>ref|XP_002271473.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
Length=195

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 16/150 (11%)
 Frame = +1

Query  151  ANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaer  330
            +N +    A  + T FD N+V++L+ LLCALI +LG+NSI++CA+RCS   +  +     
Sbjct  27   SNGNSTHEAYVNETNFDTNMVIILAALLCALIGALGLNSIVRCAMRCSRRLSPESQGQAA  86

Query  331  sssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLP  510
                          TG+KK+AL+  PV  Y    ++P   T+C ICL EF  G++VR+LP
Sbjct  87   --------------TGLKKRALRQIPVAVYGPGVEIPA--TECPICLGEFVQGEKVRVLP  130

Query  511  KCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            KCNHGFHVRCID WL SHSSCP CRH L++
Sbjct  131  KCNHGFHVRCIDTWLVSHSSCPNCRHSLLE  160



>gb|KCW50353.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=201

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA---PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL       P N +    +  +   FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  16   RPHRLLLDKEPNSVPNNGTPTRGSYGNEANFDTNMVIILAALLCALICALGLNSIVRCAL  75

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS      T     +             TG+KK AL+  PV  Y A   +P   TDC I
Sbjct  76   RCSRRFTFETPDQTAARLAA---------TGLKKSALRQIPVAVYGAGINIPA--TDCPI  124

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL+EF  G++VR+LPKC+HGFHVRCID WL SHSSCPTCR  L++
Sbjct  125  CLAEFMDGEKVRVLPKCHHGFHVRCIDTWLVSHSSCPTCRQSLLE  169



>ref|XP_010031086.1| PREDICTED: RING-H2 finger protein ATL72 isoform X2 [Eucalyptus 
grandis]
 gb|KCW50351.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=205

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA---PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL       P N +    +  +   FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  16   RPHRLLLDKEPNSVPNNGTPTRGSYGNEANFDTNMVIILAALLCALICALGLNSIVRCAL  75

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS      T     +             TG+KK AL+  PV  Y A   +P   TDC I
Sbjct  76   RCSRRFTFETPDQTAARLAA---------TGLKKSALRQIPVAVYGAGINIPA--TDCPI  124

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL+EF  G++VR+LPKC+HGFHVRCID WL SHSSCPTCR  L++
Sbjct  125  CLAEFMDGEKVRVLPKCHHGFHVRCIDTWLVSHSSCPTCRQSLLE  169



>ref|XP_010031085.1| PREDICTED: RING-H2 finger protein ATL72 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50352.1| hypothetical protein EUGRSUZ_J00118 [Eucalyptus grandis]
Length=206

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = +1

Query  115  RSRKLLLSAPA---PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCAL  285
            R  +LLL       P N +    +  +   FD N+V++L+ LLCALIC+LG+NSI++CAL
Sbjct  16   RPHRLLLDKEPNSVPNNGTPTRGSYGNEANFDTNMVIILAALLCALICALGLNSIVRCAL  75

Query  286  RCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAI  465
            RCS      T     +             TG+KK AL+  PV  Y A   +P   TDC I
Sbjct  76   RCSRRFTFETPDQTAARLAA---------TGLKKSALRQIPVAVYGAGINIPA--TDCPI  124

Query  466  CLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            CL+EF  G++VR+LPKC+HGFHVRCID WL SHSSCPTCR  L++
Sbjct  125  CLAEFMDGEKVRVLPKCHHGFHVRCIDTWLVSHSSCPTCRQSLLE  169



>ref|XP_006429572.1| hypothetical protein CICLE_v10013579mg, partial [Citrus clementina]
 gb|ESR42812.1| hypothetical protein CICLE_v10013579mg, partial [Citrus clementina]
Length=188

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 18/176 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP-APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            + +  LET    +L +S P A  N + D+    +   FD N+V++L+ LLCALIC+LG+N
Sbjct  1    MHRRLLET----ELSVSPPTASGNRTHDSFV--NEANFDTNMVIILAALLCALICALGLN  54

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SI++CALRCS   A  T     +             TG+KK+ L+  PV  Y     +P 
Sbjct  55   SIVRCALRCSHRLAIETPEQAAARLAV---------TGLKKRDLRRIPVAVYGEGVDIPA  105

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
              T+C ICL EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L+   ++
Sbjct  106  --TECPICLGEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLNNNER  159



>ref|XP_003552318.1| PREDICTED: RING-H2 finger protein ATL74-like [Glycine max]
Length=180

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 97/171 (57%), Gaps = 15/171 (9%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNS  267
            + + FLET       LS P        +    S   FD N+V++L+ LLCALIC+LG+NS
Sbjct  1    MQRRFLET------ELSMPPSYGGGNTSDTFISDANFDTNMVIILAALLCALICALGLNS  54

Query  268  IIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGL  447
            I +CALRC       TA    +             TG+K++ L   PV  Y A  +    
Sbjct  55   IARCALRCGRPFGNETAEQAAARLA---------GTGLKRRELSRIPVAVYGAAGENTIP  105

Query  448  DTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             T+C ICL EF  GDRVR+LPKCNHGFHVRCID WL SHSSCP CRH L++
Sbjct  106  ATECPICLGEFEKGDRVRMLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLE  156



>ref|XP_007033540.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007033541.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY04466.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY04467.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=198

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = +1

Query  142  PAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaa  321
            PA  N + D+    S   FD N+V++L+ LLCALIC+LG+NSI++CALRCS   A  T  
Sbjct  21   PANGNKTHDSYI--SEANFDTNMVIILAALLCALICALGLNSIVRCALRCSRRFALETPE  78

Query  322  aersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVR  501
               +             TG+KK+ LK  PV  Y      P   T+C ICL +F  G++VR
Sbjct  79   QAATRLA---------TTGLKKRDLKQIPVAVYGTGVNFPS--TECPICLGDFVDGEKVR  127

Query  502  LLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +LPKCNHGFHVRCID WL SHSSCP CRH L+ 
Sbjct  128  VLPKCNHGFHVRCIDTWLVSHSSCPNCRHSLLD  160



>gb|KDO64081.1| hypothetical protein CISIN_1g043554mg [Citrus sinensis]
Length=192

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 18/176 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP-APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            + +  LET    +L +S P A  N + D+    +   FD N+V++L+ LLCALIC+LG+N
Sbjct  1    MHRRLLET----ELSVSPPTASGNRTHDSFV--NEANFDTNMVIILAALLCALICALGLN  54

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SI++CALRCS   A  T     +             TG+KK+ L+  PV  Y     +P 
Sbjct  55   SIVRCALRCSHRLAIETPEQAAARLAV---------TGLKKRDLRRIPVAVYGEGVDIPA  105

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
              T+C ICL EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L+   ++
Sbjct  106  --TECPICLGEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLNNNER  159



>ref|XP_006481185.1| PREDICTED: RING-H2 finger protein ATL74-like [Citrus sinensis]
Length=192

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 18/176 (10%)
 Frame = +1

Query  88   LGQDFLETFRSRKLLLSAP-APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVN  264
            + +  LET    +L +S P A  N + D+    +   FD N+V++L+ LLCALIC+LG+N
Sbjct  1    MHRRLLET----ELSVSPPTASGNRTHDSFV--NEANFDTNMVIILAALLCALICALGLN  54

Query  265  SIIKCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPG  444
            SI++CALRCS   A  T     +             TG+KK+ L+  PV  Y     +P 
Sbjct  55   SIVRCALRCSHRLAIETPEQAAARLAV---------TGLKKRDLRRIPVAVYGEGVDIPA  105

Query  445  LDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQK  612
              T+C ICL EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L+   ++
Sbjct  106  --TECPICLGEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLNNNER  159



>ref|XP_002323073.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF04834.2| zinc finger family protein [Populus trichocarpa]
Length=189

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 14/163 (9%)
 Frame = +1

Query  121  RKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRC  291
            R++L + P   APAN +    +  + T FD N+V++L+ LLCALI +LG+NSI++C LRC
Sbjct  6    RRMLDTVPLDVAPANGNRTHDSYINETNFDTNMVIILAALLCALIGALGLNSIVRCLLRC  65

Query  292  ssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICL  471
            SS  A  T     +             TG+KK+ L+  PV  Y A   +    T+C ICL
Sbjct  66   SSRFALETTEEAAARLAA---------TGLKKRDLRQIPVAIYGAGGSISA--TECPICL  114

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L++
Sbjct  115  GEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLE  157



>ref|XP_009395164.1| PREDICTED: RING-H2 finger protein ATL74-like [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 94/141 (67%), Gaps = 11/141 (8%)
 Frame = +1

Query  178  ASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaaaersssggssaa  357
             S    FD N+V++L+ LLCALI +LG+NSI++CALRC    A  T     +        
Sbjct  27   GSGNADFDTNMVIILAALLCALIFALGLNSIVRCALRCGRRLAFETPEEAATRLAA----  82

Query  358  arqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVR  537
                 TG++K+AL+  PV  Y + A +P   TDC ICL+EFA G++VR+LP+C+HGFHVR
Sbjct  83   -----TGLEKRALRRIPVAVYGSGADIPA--TDCPICLTEFADGEKVRVLPRCHHGFHVR  135

Query  538  CIDKWLSSHSSCPTCRHCLIQ  600
            CIDKWL+SHSSCPTCR  L+ 
Sbjct  136  CIDKWLASHSSCPTCRQSLLD  156



>ref|XP_007011313.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY20123.1| RING/U-box superfamily protein [Theobroma cacao]
Length=260

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = +1

Query  124  KLLL---SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            +LLL   S+ +P N +    + S+   FD N+V++L+ LLCALIC+LG+NSI++CALRCS
Sbjct  10   RLLLDTQSSASPTNGNRTRSSFSNEANFDTNMVIILAALLCALICALGLNSIVRCALRCS  69

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
               A  T     +             TG+KK+AL+  PV  Y++   +    TDC ICL 
Sbjct  70   RRFAFETPDETAARLAA---------TGLKKRALRQIPVAIYSSGINIKA--TDCPICLG  118

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            EF  G+RVR+LPKC+HGFHVRCID WL SHSSCPTCR  L++
Sbjct  119  EFIDGERVRVLPKCHHGFHVRCIDTWLLSHSSCPTCRQSLLE  160



>gb|KDP21873.1| hypothetical protein JCGZ_00660 [Jatropha curcas]
Length=189

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 100/163 (61%), Gaps = 14/163 (9%)
 Frame = +1

Query  121  RKLL---LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRC  291
            R+LL    S P P  +   T    + + FDAN+V++L+ LLCALI +LG+NSI++CALRC
Sbjct  6    RRLLETEFSVPVPPPNGNRTREIYNESNFDANMVIILAALLCALIGALGLNSIVRCALRC  65

Query  292  ssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICL  471
            +   A  T     +             TG+KK+ LK  PV  Y     +P   T+C ICL
Sbjct  66   TRRFATETPEQAAARLAA---------TGLKKRDLKQIPVAIYGTGMNIPA--TECPICL  114

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             +FA G++VR+LPKCNHGFHVRCID WL SHSSCP CR  L++
Sbjct  115  GDFANGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRLSLLE  157



>ref|XP_010252063.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252064.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252065.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
Length=198

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 95/155 (61%), Gaps = 11/155 (7%)
 Frame = +1

Query  136  SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrt  315
             AP    S     + +S   FD N+V++L+ LLCALIC+LG+NSI++CALRC    A  T
Sbjct  20   GAPPTNGSRPSRESYTSEANFDTNMVIILAALLCALICALGLNSIVRCALRCGRRFAFET  79

Query  316  aaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDR  495
                 +             TG+KKKAL+  PV  Y +   +    TDC ICL EF  G++
Sbjct  80   PEGTAARLSA---------TGLKKKALRQIPVAVYGSGVSIQA--TDCPICLGEFMDGEK  128

Query  496  VRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            VR+LPKCNHGFHV+CID WL SHSSCPTCRH L+ 
Sbjct  129  VRVLPKCNHGFHVKCIDIWLLSHSSCPTCRHSLLD  163



>ref|XP_009147914.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Brassica rapa]
Length=220

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 105/176 (60%), Gaps = 6/176 (3%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSII  273
            +  L  F SRKLLL     A++   T   S        V+++LSVL+C +I  LG++ +I
Sbjct  15   EQVLSAFISRKLLLHNTQRAHAVAPTPPISHENNVSGAVLVLLSVLICGIIFCLGLHYLI  74

Query  274  KCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDT  453
              A R        ++          S     ++ GIKKKAL+ FPV+SY+ +  + G+  
Sbjct  75   CLAFR------RHSSFMISEPVSSLSTQRDPSHKGIKKKALRMFPVVSYSHELNLSGIGE  128

Query  454  DCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIVG  621
            +C ICLS+F +G+++RLLPKCNHGFHV CIDKWL  H +CP CRH L+ TCQKI+G
Sbjct  129  ECVICLSDFVSGEKLRLLPKCNHGFHVCCIDKWLQQHLTCPKCRHSLVDTCQKILG  184



>ref|XP_007140087.1| hypothetical protein PHAVU_008G083200g [Phaseolus vulgaris]
 gb|ESW12081.1| hypothetical protein PHAVU_008G083200g [Phaseolus vulgaris]
Length=178

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 102/170 (60%), Gaps = 19/170 (11%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSII  273
            + FLET      L   P+  N++ DT    S   FD N+V++L+ LLCALIC+LG+NSI 
Sbjct  4    RRFLET-----ELSMPPSYGNNTRDTFI--SDANFDTNMVIILAALLCALICALGLNSIA  56

Query  274  KCALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAK-MPGLD  450
            +CALRC       TA  E +             TG+K++ L   PV  Y A  + +P   
Sbjct  57   RCALRCGRRFGDETAEQEAARLA---------GTGLKRRQLSRIPVAVYGASGETVPA--  105

Query  451  TDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            T+C ICL EF  GDRVR+LPKCNHGFHV CID WL SHSSCP CRH L++
Sbjct  106  TECPICLGEFEKGDRVRMLPKCNHGFHVHCIDTWLLSHSSCPNCRHSLLE  155



>ref|XP_008645765.1| PREDICTED: RING-H2 finger protein ATL72-like [Zea mays]
 gb|AFW71720.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=226

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 114/182 (63%), Gaps = 8/182 (4%)
 Frame = +1

Query  94   QDFLETFRSRKLLLSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSII  273
              + E   + +++    APA    D V +SS+++FDANVVM+L+VLLCALIC+LG+NSI+
Sbjct  18   HSYGENAAASQVVAGQEAPAG---DGVRSSSSSSFDANVVMILAVLLCALICALGLNSIV  74

Query  274  KCALRCssiaagrtaaaersssggssaaarq-aNTGIKKKALKTFPVISYAAD----AKM  438
            +CALRCSS  +   A  +  +  G+     + A  G ++KAL+  P + Y+A        
Sbjct  75   RCALRCSSRTSPGGAQRQPGAGAGAGEPVARLAQAGARRKALRAMPTLVYSAGLLPLQAA  134

Query  439  PGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
             G    CAICL+E   G+RVR+LPKCNHGFHVRC+D+WL + S+CPTCR  L     K  
Sbjct  135  GGGGPVCAICLAELEPGERVRVLPKCNHGFHVRCVDRWLLARSTCPTCRQPLFGAPHKGS  194

Query  619  GC  624
            GC
Sbjct  195  GC  196



>gb|KDP21651.1| hypothetical protein JCGZ_03322 [Jatropha curcas]
Length=226

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 107/169 (63%), Gaps = 16/169 (9%)
 Frame = +1

Query  115  RSRKLLL------SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIK  276
            R  +LLL      +AP    S   + + ++   FD N+V++L+ LLCALIC+LG+NSI++
Sbjct  9    RPHRLLLDTQSSSTAPTSDGSRARSGSYTNEANFDTNMVIILAALLCALICALGLNSIVR  68

Query  277  CALRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISY-AADAKMPGLDT  453
            CALRCS   +  TA    +             TG+KK AL+  PV+ Y +A   +  + T
Sbjct  69   CALRCSRRFSFETADEAAARLA---------ATGLKKSALRQIPVVIYGSAGDGIQIIAT  119

Query  454  DCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            DCAICL EF  G+++R+LPKC+HGFHVRCID WL SHSSCPTCR  LI+
Sbjct  120  DCAICLGEFMDGEKIRVLPKCSHGFHVRCIDTWLVSHSSCPTCRQSLIE  168



>gb|KDO42949.1| hypothetical protein CISIN_1g029206mg [Citrus sinensis]
Length=197

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 100/162 (62%), Gaps = 12/162 (7%)
 Frame = +1

Query  121  RKLLLSAPA--PANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            R LL + P+  P N S      S+   FD N+V++L+ LLCALIC+LG+NSI++CALRCS
Sbjct  10   RLLLDTEPSTPPTNGSRTRSTVSNEANFDTNMVIILAALLCALICALGLNSIVRCALRCS  69

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
               A  T     +              G+KK AL+  PV  Y A A +    TDCAICL 
Sbjct  70   RRFAFETPNETAARLAAR---------GLKKSALRQIPVAVYGA-AGVKIKATDCAICLV  119

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +F  G++VR+LPKCNHGFHVRCID WL SHSSCPTCR  L+ 
Sbjct  120  DFMDGEKVRVLPKCNHGFHVRCIDTWLMSHSSCPTCRRSLLD  161



>ref|XP_009622929.1| PREDICTED: RING-H2 finger protein ATL74-like [Nicotiana tomentosiformis]
 ref|XP_009622930.1| PREDICTED: RING-H2 finger protein ATL74-like [Nicotiana tomentosiformis]
Length=192

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 103/166 (62%), Gaps = 14/166 (8%)
 Frame = +1

Query  112  FRSRKLL---LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCA  282
            +R+ +L+    S P  +N S      S   +FD N++++L+ LLCALIC+LG+NSII+CA
Sbjct  5    YRTERLIPNTHSVPPTSNESNSFHGYSKEASFDTNMIIILAALLCALICALGLNSIIRCA  64

Query  283  LRCssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCA  462
             RCS   +  +A A                TG+KK  L+  PV  Y +   +  L TDC 
Sbjct  65   FRCSRRFSFESANARAERLAA---------TGLKKSTLRRIPVAVYGSGVHI--LATDCP  113

Query  463  ICLSEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            ICL EF  G++VR+LP+C+HGFHVRCID WL+SHSSCPTCR  L++
Sbjct  114  ICLGEFMDGEKVRVLPRCHHGFHVRCIDIWLASHSSCPTCRQSLLE  159



>ref|XP_009411192.1| PREDICTED: RING-H2 finger protein ATL73, partial [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 14/161 (9%)
 Frame = +1

Query  124  KLLLSAPAPANSSFDTVA---ASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCs  294
            + L + P  AN +           T +FD N+V +L+ LLCAL+ +LG+NS+++CALRC 
Sbjct  52   EFLGTPPTAANGTRQHATRNNGGGTASFDTNMVFILAALLCALVFALGLNSVVRCALRCG  111

Query  295  siaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLS  474
                        S             TG+KK++L+  PV  Y + A  P   T+C ICL 
Sbjct  112  RRVVFENPEEVSSRLAA---------TGLKKRSLRRIPVAVYGSGADFPA--TECPICLG  160

Query  475  EFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLI  597
            EFA G++VR+LP+C+HGFHVRCIDKWL+SHSSCPTCR  L+
Sbjct  161  EFADGEKVRVLPRCHHGFHVRCIDKWLASHSSCPTCRQSLL  201



>ref|XP_002266740.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
 ref|XP_010650817.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
 ref|XP_010650818.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
Length=177

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 103/163 (63%), Gaps = 13/163 (8%)
 Frame = +1

Query  121  RKLLL---SAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRC  291
            R+LLL   +A  P N S  + + ++   FD+N+V++L+ LLCALIC+LG+NSI++CALRC
Sbjct  10   RRLLLDTETAMPPMNGSRGSSSYANDANFDSNMVIILAALLCALICALGLNSIVRCALRC  69

Query  292  ssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICL  471
            S+  +  T     +             TG++K  L   PV+ Y +   +    TDC ICL
Sbjct  70   SNRFSLETPDQVAAHLA---------TTGLEKGTLSQIPVVVYGSSG-LTTPATDCPICL  119

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             EF  GD+VR+LPKCNHGFHV+CID WL S SSCPTCR  L++
Sbjct  120  GEFTEGDKVRILPKCNHGFHVKCIDTWLMSRSSCPTCRQPLLE  162



>ref|XP_007033539.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04465.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=285

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = +1

Query  142  PAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagrtaa  321
            PA  N + D+    S   FD N+V++L+ LLCALIC+LG+NSI++CALRCS   A  T  
Sbjct  108  PANGNKTHDSYI--SEANFDTNMVIILAALLCALICALGLNSIVRCALRCSRRFALETPE  165

Query  322  aersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVR  501
               +             TG+KK+ LK  PV  Y      P   T+C ICL +F  G++VR
Sbjct  166  QAATRLAT---------TGLKKRDLKQIPVAVYGTGVNFPS--TECPICLGDFVDGEKVR  214

Query  502  LLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
            +LPKCNHGFHVRCID WL SHSSCP CRH L+ 
Sbjct  215  VLPKCNHGFHVRCIDTWLVSHSSCPNCRHSLLD  247



>ref|XP_010680476.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  373  TGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGDRVRLLPKCNHGFHVRCIDKW  552
            +G+ K+ALKTFP++ Y+ D ++ GL ++C ICLSEF  G++VR+LPKCNHGFHV+CIDKW
Sbjct  13   SGLDKRALKTFPIVKYSKDVQIQGLGSECVICLSEFNGGEKVRILPKCNHGFHVKCIDKW  72

Query  553  LSSHSSCPTCRHCLIQTCQKIVGC  624
            LSSHSSCPTCR  L++TCQKI+GC
Sbjct  73   LSSHSSCPTCRQSLVETCQKIIGC  96



>ref|XP_009346909.1| PREDICTED: RING-H2 finger protein ATL74-like [Pyrus x bretschneideri]
Length=198

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 98/162 (60%), Gaps = 11/162 (7%)
 Frame = +1

Query  133  LSAPAPANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRCssiaagr  312
            ++  AP ++     +  S   FD N+V++L+ LLCALIC+LG+NS ++CALRCS   A  
Sbjct  10   VNTAAPLSNGRAADSYVSEAKFDTNMVIILAALLCALICALGLNSFVRCALRCSRRFALE  69

Query  313  taaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICLSEFAAGD  492
            T                   TG+KKK L+  P+  Y +   +P   T+C ICL+EF  G+
Sbjct  70   TPEQVAEQLAA---------TGLKKKHLRQIPIAVYGSGVNIPA--TECPICLAEFEDGE  118

Query  493  RVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQTCQKIV  618
            +VR+LPKC+HGFHVRCID WL SHSSCP CRH L+ T   + 
Sbjct  119  KVRVLPKCHHGFHVRCIDTWLLSHSSCPNCRHSLLSTSSAVA  160



>ref|XP_011002606.1| PREDICTED: RING-H2 finger protein ATL74 [Populus euphratica]
Length=186

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 101/163 (62%), Gaps = 14/163 (9%)
 Frame = +1

Query  121  RKLLLSAP---APANSSFDTVAASSTTTFDANVVMVLSVLLCALICSLGVNSIIKCALRC  291
            R++L + P    PAN +    +  + T FD N+V++L+ LLCALI +LG+NSI++C LRC
Sbjct  3    RRMLDTVPLDVPPANGNRTHDSYINETNFDTNMVIILAALLCALIGALGLNSIVRCLLRC  62

Query  292  ssiaagrtaaaersssggssaaarqaNTGIKKKALKTFPVISYAADAKMPGLDTDCAICL  471
            SS  A  T     +             TG+KK+ L+  PV  Y A   +    T+C ICL
Sbjct  63   SSRFALETTEVAAARLAA---------TGLKKRDLRQIPVAIYGAGGSIAA--TECPICL  111

Query  472  SEFAAGDRVRLLPKCNHGFHVRCIDKWLSSHSSCPTCRHCLIQ  600
             EF  G++VR+LPKCNHGFHVRCID WL SHSSCP CRH L++
Sbjct  112  GEFVDGEKVRVLPKCNHGFHVRCIDTWLLSHSSCPNCRHSLLE  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1725262341894