BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21575_g1_i2 len=4437 path=[373:0-948 257:949-995 1367:996-1439
22:1440-1530 113:1531-1648 5012:1649-2949 371:2950-2950
372:2951-3655 1927:3656-3714 334:3715-4436]

Length=4437
                                                                      Score     E

emb|CDP05041.1|  unnamed protein product                                258   3e-74   
ref|XP_006441172.1|  hypothetical protein CICLE_v10022008mg             254   8e-73   
ref|XP_011084540.1|  PREDICTED: uncharacterized protein LOC105166...    250   8e-72   
gb|KDO59660.1|  hypothetical protein CISIN_1g0266482mg                  250   2e-71   
ref|XP_007039131.1|  RNA-binding family protein isoform 2               249   3e-71   
ref|XP_011084538.1|  PREDICTED: uncharacterized protein LOC105166...    249   3e-71   
ref|XP_006491965.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    249   4e-71   
gb|AFY26894.1|  RNA-binding protein with multiple splicing              249   4e-71   
gb|KDO59663.1|  hypothetical protein CISIN_1g0266482mg                  248   5e-71   
ref|XP_006491964.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    249   5e-71   
ref|XP_006441170.1|  hypothetical protein CICLE_v10022008mg             249   6e-71   
ref|XP_007039130.1|  RNA-binding family protein isoform 1               249   7e-71   
gb|KDP42156.1|  hypothetical protein JCGZ_03023                         246   8e-70   
ref|XP_009351956.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    242   5e-69   
ref|XP_010662906.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    240   2e-68   
ref|XP_010662904.1|  PREDICTED: uncharacterized protein LOC100265...    241   3e-68   
ref|XP_002317797.1|  hypothetical protein POPTR_0012s02630g             241   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002515833.1|  nucleic acid binding protein, putative             241   4e-68   Ricinus communis
ref|XP_008343802.1|  PREDICTED: uncharacterized protein LOC103406591    239   1e-67   
ref|XP_009351955.1|  PREDICTED: uncharacterized protein LOC103943...    239   1e-67   
ref|XP_007218305.1|  hypothetical protein PRUPE_ppa010843mg             239   2e-67   
ref|XP_008234694.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    238   4e-67   
ref|XP_002275189.2|  PREDICTED: uncharacterized protein LOC100265...    236   1e-66   Vitis vinifera
ref|XP_006374094.1|  hypothetical protein POPTR_0015s01130g             234   7e-66   
ref|XP_008376783.1|  PREDICTED: uncharacterized protein LOC103439918    234   7e-66   
ref|XP_011075938.1|  PREDICTED: uncharacterized protein LOC105160...    233   1e-65   
ref|XP_008790543.1|  PREDICTED: uncharacterized protein LOC103707...    232   2e-65   
ref|XP_011075936.1|  PREDICTED: uncharacterized protein LOC105160...    233   2e-65   
ref|XP_009775997.1|  PREDICTED: uncharacterized protein LOC104225...    233   2e-65   
ref|XP_008790542.1|  PREDICTED: uncharacterized protein LOC103707...    232   3e-65   
ref|XP_009776008.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    231   4e-65   
ref|XP_009361324.1|  PREDICTED: uncharacterized protein LOC103951620    232   5e-65   
ref|XP_010109223.1|  hypothetical protein L484_011845                   232   5e-65   
ref|XP_009776011.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    230   7e-65   
ref|XP_009599059.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    231   1e-64   
ref|XP_009776019.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    229   1e-64   
ref|XP_008790540.1|  PREDICTED: uncharacterized protein LOC103707...    231   1e-64   
ref|XP_009776002.1|  PREDICTED: uncharacterized protein LOC104225...    229   2e-64   
ref|XP_009775991.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    230   2e-64   
ref|XP_009599057.1|  PREDICTED: uncharacterized protein LOC104094...    230   3e-64   
ref|XP_008790544.1|  PREDICTED: uncharacterized protein LOC103707...    228   4e-64   
ref|XP_009599060.1|  PREDICTED: uncharacterized protein LOC104094...    228   6e-64   
ref|XP_009599058.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    228   1e-63   
ref|XP_011075937.1|  PREDICTED: uncharacterized protein LOC105160...    228   1e-63   
ref|XP_009601733.1|  PREDICTED: uncharacterized protein LOC104096...    229   1e-63   
ref|XP_009801972.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    226   2e-63   
ref|XP_009801966.1|  PREDICTED: uncharacterized protein LOC104247...    227   3e-63   
ref|XP_008790541.1|  PREDICTED: uncharacterized protein LOC103707...    227   3e-63   
ref|XP_009601734.1|  PREDICTED: uncharacterized protein LOC104096...    226   6e-63   
ref|XP_009601743.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    225   9e-63   
ref|XP_010933806.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    224   1e-62   
gb|KHF97932.1|  RNA-binding with multiple splicing                      223   2e-62   
ref|XP_004307948.1|  PREDICTED: uncharacterized protein LOC101301247    224   2e-62   
ref|XP_011043764.1|  PREDICTED: uncharacterized protein LOC105139128    224   3e-62   
ref|XP_009601735.1|  PREDICTED: uncharacterized protein LOC104096...    224   3e-62   
ref|XP_006577823.1|  PREDICTED: uncharacterized protein LOC100800...    225   5e-62   
ref|XP_002321981.1|  hypothetical protein POPTR_0015s01130g             223   6e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009601744.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    222   6e-62   
ref|XP_006577824.1|  PREDICTED: uncharacterized protein LOC100800...    223   9e-62   
ref|XP_010933805.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    222   1e-61   
ref|XP_009601737.1|  PREDICTED: uncharacterized protein LOC104096...    223   1e-61   
ref|XP_009601742.1|  PREDICTED: uncharacterized protein LOC104096...    221   2e-61   
ref|XP_003602288.1|  RNA-binding protein with multiple splicing         221   5e-61   
ref|XP_010252587.1|  PREDICTED: uncharacterized protein LOC104594...    219   6e-61   
ref|XP_010252574.1|  PREDICTED: uncharacterized protein LOC104594...    219   2e-60   
ref|NP_001242627.1|  uncharacterized protein LOC100800440               219   2e-60   
ref|XP_010933804.1|  PREDICTED: uncharacterized protein LOC105054...    219   2e-60   
ref|NP_001241926.1|  uncharacterized protein LOC100786188               218   3e-60   
ref|XP_011044690.1|  PREDICTED: uncharacterized protein LOC105139...    218   4e-60   
ref|XP_006360157.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    216   1e-59   
ref|XP_006360156.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    216   1e-59   
ref|XP_006360155.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    216   3e-59   
gb|AFK41044.1|  unknown                                                 215   4e-59   
ref|XP_004240963.1|  PREDICTED: U1 small nuclear ribonucleoprotein A    215   5e-59   
ref|XP_011044691.1|  PREDICTED: protein WHI3-like isoform X2            211   8e-58   
ref|XP_006851878.1|  hypothetical protein AMTR_s00041p00116460          211   3e-57   
gb|AES72538.2|  RNA-binding protein with multiple splicing protein      209   4e-57   
gb|AFK40378.1|  unknown                                                 209   4e-57   
ref|XP_010919314.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    207   7e-57   
ref|XP_010919312.1|  PREDICTED: uncharacterized protein LOC105043...    208   9e-57   
ref|XP_007136468.1|  hypothetical protein PHAVU_009G047700g             208   1e-56   
ref|XP_010919313.1|  PREDICTED: uncharacterized protein LOC105043...    207   1e-56   
ref|XP_008803056.1|  PREDICTED: uncharacterized protein LOC103716...    208   2e-56   
ref|XP_008806956.1|  PREDICTED: uncharacterized protein LOC103719472    207   2e-56   
ref|XP_010919309.1|  PREDICTED: uncharacterized protein LOC105043...    207   3e-56   
ref|XP_010919308.1|  PREDICTED: uncharacterized protein LOC105043...    206   6e-56   
ref|XP_004146235.1|  PREDICTED: uncharacterized protein LOC101218789    206   9e-56   
gb|KHN23341.1|  Oligopeptide transporter 6                              220   1e-55   
gb|AEZ00900.1|  putative RNA recognition motif-containing protein       207   1e-55   
ref|XP_006350504.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    205   2e-55   
ref|XP_008803057.1|  PREDICTED: uncharacterized protein LOC103716...    204   3e-55   
ref|XP_008455998.1|  PREDICTED: uncharacterized protein LOC103496...    203   5e-55   
ref|XP_009801971.1|  PREDICTED: uncharacterized protein LOC104247...    203   5e-55   
ref|XP_008455996.1|  PREDICTED: uncharacterized protein LOC103496...    203   7e-55   
ref|XP_004502691.1|  PREDICTED: uncharacterized protein LOC101494...    203   7e-55   
ref|XP_004502693.1|  PREDICTED: uncharacterized protein LOC101494...    202   1e-54   
ref|XP_008455994.1|  PREDICTED: uncharacterized protein LOC103496...    203   1e-54   
ref|XP_008455997.1|  PREDICTED: uncharacterized protein LOC103496...    202   2e-54   
ref|XP_004234996.1|  PREDICTED: uncharacterized protein LOC101267497    202   2e-54   
gb|KDO59665.1|  hypothetical protein CISIN_1g0266482mg                  198   7e-54   
ref|XP_003602287.1|  RNA-binding protein with multiple splicing         201   9e-54   
ref|XP_009391960.1|  PREDICTED: uncharacterized protein LOC103977994    197   1e-52   
ref|XP_010671379.1|  PREDICTED: uncharacterized protein LOC104888185    197   3e-52   
ref|XP_009383507.1|  PREDICTED: uncharacterized protein LOC103971252    195   4e-52   
gb|EYU45284.1|  hypothetical protein MIMGU_mgv1a013839mg                186   3e-49   
gb|EYU45285.1|  hypothetical protein MIMGU_mgv1a013839mg                184   1e-48   
ref|XP_009412673.1|  PREDICTED: uncharacterized protein LOC103994...    176   5e-46   
ref|XP_007019456.1|  Nucleotide binding,nucleic acid binding            179   5e-46   
ref|XP_009412656.1|  PREDICTED: uncharacterized protein LOC103994...    177   6e-46   
ref|XP_009412664.1|  PREDICTED: uncharacterized protein LOC103994...    175   4e-45   
ref|XP_010048822.1|  PREDICTED: uncharacterized protein LOC104437550    173   2e-44   
ref|XP_004496491.1|  PREDICTED: uncharacterized protein LOC101500740    172   4e-44   
gb|KCW89114.1|  hypothetical protein EUGRSUZ_A01436                     174   8e-44   
gb|ACN31031.1|  unknown                                                 169   3e-43   Zea mays [maize]
ref|XP_010108658.1|  RNA-binding protein with multiple splicing         171   3e-43   
ref|XP_002436388.1|  hypothetical protein SORBIDRAFT_10g001660          169   9e-43   Sorghum bicolor [broomcorn]
ref|XP_008658343.1|  PREDICTED: uncharacterized protein LOC100274...    169   1e-42   
gb|KHG30705.1|  RNA-binding with multiple splicing                      167   3e-42   
ref|XP_006472956.1|  PREDICTED: uncharacterized protein LOC102627431    166   7e-42   
ref|XP_004964400.1|  PREDICTED: protein WHI3-like                       166   8e-42   
gb|KDP43016.1|  hypothetical protein JCGZ_25202                         166   1e-41   
ref|XP_007152059.1|  hypothetical protein PHAVU_004G098400g             165   2e-41   
gb|KDO83671.1|  hypothetical protein CISIN_1g023903mg                   165   2e-41   
gb|AGV54255.1|  RNA-binding protein with multiple splicing              165   2e-41   
ref|XP_007199630.1|  hypothetical protein PRUPE_ppa010374mg             164   4e-41   
ref|XP_008243626.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    163   7e-41   
gb|ACU19073.1|  unknown                                                 163   8e-41   Glycine max [soybeans]
ref|NP_001062425.1|  Os08g0547000                                       164   9e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008243624.1|  PREDICTED: U1 small nuclear ribonucleoprotei...    163   9e-41   
emb|CDY61067.1|  BnaA07g37330D                                          162   1e-40   
gb|ACU23298.1|  unknown                                                 162   2e-40   Glycine max [soybeans]
ref|XP_010062133.1|  PREDICTED: cell wall integrity protein scw1-...    162   2e-40   
gb|KHN17000.1|  RNA-binding protein with multiple splicing              162   2e-40   
ref|XP_003536434.1|  PREDICTED: uncharacterized protein LOC100815...    162   2e-40   
ref|XP_006434433.1|  hypothetical protein CICLE_v10002251mg             162   3e-40   
gb|AFK44959.1|  unknown                                                 161   4e-40   
ref|XP_003556143.1|  PREDICTED: uncharacterized protein LOC100812...    161   4e-40   
gb|EEE65013.1|  hypothetical protein OsJ_19964                          161   5e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656587.1|  PREDICTED: uncharacterized protein LOC102703405    162   6e-40   
emb|CDP18267.1|  unnamed protein product                                160   7e-40   
gb|KHG27974.1|  RNA-binding with multiple splicing                      161   1e-39   
ref|XP_004515123.1|  PREDICTED: uncharacterized protein LOC101512...    160   2e-39   
ref|XP_004515122.1|  PREDICTED: uncharacterized protein LOC101512...    160   2e-39   
ref|XP_006589496.1|  PREDICTED: uncharacterized protein LOC100815...    159   3e-39   
gb|KHN46427.1|  RNA-binding protein with multiple splicing              158   3e-39   
ref|XP_006599497.1|  PREDICTED: uncharacterized protein LOC100813167    158   3e-39   
ref|XP_003556145.1|  PREDICTED: uncharacterized protein LOC100813...    159   4e-39   
ref|XP_007143521.1|  hypothetical protein PHAVU_007G078500g             157   4e-39   
ref|XP_006606160.1|  PREDICTED: uncharacterized protein LOC100812...    158   5e-39   
ref|XP_003556144.1|  PREDICTED: uncharacterized protein LOC100812...    157   9e-39   
ref|XP_009368481.1|  PREDICTED: uncharacterized protein LOC103957982    157   1e-38   
ref|XP_003536435.1|  PREDICTED: uncharacterized protein LOC100816...    157   1e-38   
gb|KDO83670.1|  hypothetical protein CISIN_1g023903mg                   157   1e-38   
dbj|BAJ89959.1|  predicted protein                                      159   2e-38   
ref|XP_010260912.1|  PREDICTED: uncharacterized protein LOC104599...    156   3e-38   
ref|XP_008339125.1|  PREDICTED: uncharacterized protein LOC103402165    156   3e-38   
gb|EEC83987.1|  hypothetical protein OsI_30140                          154   4e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006660358.1|  PREDICTED: uncharacterized protein LOC102722699    154   4e-38   
ref|XP_004290545.1|  PREDICTED: uncharacterized protein LOC101304343    155   5e-38   
ref|XP_008347759.1|  PREDICTED: protein WHI4-like                       155   5e-38   
ref|XP_008441534.1|  PREDICTED: uncharacterized protein LOC103485638    155   6e-38   
ref|XP_006606159.1|  PREDICTED: uncharacterized protein LOC100813...    155   6e-38   
emb|CDY00368.1|  BnaC07g14580D                                          154   9e-38   
ref|XP_002302187.1|  RNA-binding family protein                         154   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011042823.1|  PREDICTED: uncharacterized protein LOC105138...    154   1e-37   
dbj|BAJ90751.1|  predicted protein                                      155   1e-37   
ref|XP_010245283.1|  PREDICTED: uncharacterized protein LOC104588859    154   2e-37   
gb|AFK38418.1|  unknown                                                 154   2e-37   
ref|XP_004148806.1|  PREDICTED: uncharacterized protein LOC101222...    154   2e-37   
ref|XP_006589497.1|  PREDICTED: uncharacterized protein LOC100816...    154   2e-37   
ref|XP_003592142.1|  RNA-binding protein with multiple splicing         154   2e-37   
ref|XP_009368250.1|  PREDICTED: protein WHI3-like                       153   2e-37   
gb|EEE69106.1|  hypothetical protein OsJ_28175                          154   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010260913.1|  PREDICTED: uncharacterized protein LOC104599...    152   2e-37   
gb|KDO83677.1|  hypothetical protein CISIN_1g023903mg                   153   3e-37   
ref|XP_010537288.1|  PREDICTED: uncharacterized protein LOC104812049    152   4e-37   
ref|XP_004162895.1|  PREDICTED: uncharacterized LOC101222348 isof...    152   5e-37   
ref|XP_010260909.1|  PREDICTED: uncharacterized protein LOC104599...    152   6e-37   
ref|XP_010539724.1|  PREDICTED: uncharacterized protein LOC104813704    151   9e-37   
ref|XP_009767371.1|  PREDICTED: uncharacterized protein LOC104218542    152   9e-37   
ref|XP_009591634.1|  PREDICTED: protein WHI3                            151   2e-36   
emb|CDY04617.1|  BnaC05g16550D                                          150   2e-36   
gb|KHN24241.1|  RNA-binding protein with multiple splicing              149   3e-36   
gb|KHG04462.1|  RNA-binding with multiple splicing 2                    150   4e-36   
ref|XP_006416317.1|  hypothetical protein EUTSA_v10008603mg             149   5e-36   
ref|XP_010477393.1|  PREDICTED: uncharacterized protein LOC104756...    149   6e-36   
ref|XP_003574884.1|  PREDICTED: protein elav-like                       150   6e-36   
ref|XP_006606161.1|  PREDICTED: uncharacterized protein LOC100812...    149   7e-36   
emb|CDY29463.1|  BnaA06g15070D                                          149   8e-36   
gb|KHN16999.1|  RNA-binding protein with multiple splicing              150   8e-36   
ref|XP_003636759.1|  RNA-binding protein with multiple splicing         149   1e-35   
ref|XP_004974117.1|  PREDICTED: CUGBP Elav-like family member 4-l...    150   1e-35   
ref|XP_009149608.1|  PREDICTED: uncharacterized protein LOC103872923    147   2e-35   
gb|ABK22075.1|  unknown                                                 147   3e-35   Picea sitchensis
emb|CDP05024.1|  unnamed protein product                                148   3e-35   
ref|XP_009103299.1|  PREDICTED: uncharacterized protein LOC103829381    146   4e-35   
ref|XP_010498582.1|  PREDICTED: uncharacterized protein LOC104776...    147   5e-35   
ref|NP_001168957.1|  uncharacterized protein LOC100382777               147   7e-35   Zea mays [maize]
ref|XP_010459838.1|  PREDICTED: uncharacterized protein LOC104740830    146   8e-35   
ref|XP_004974118.1|  PREDICTED: CUGBP Elav-like family member 4-l...    146   1e-34   
ref|XP_006589498.1|  PREDICTED: uncharacterized protein LOC100816...    145   2e-34   
ref|XP_006589499.1|  PREDICTED: uncharacterized protein LOC100816...    144   2e-34   
ref|XP_003557104.1|  PREDICTED: uncharacterized protein LOC100821534    144   5e-34   
ref|XP_010498581.1|  PREDICTED: uncharacterized protein LOC104776...    144   5e-34   
ref|NP_001154354.1|  nucleic acid/nucleotide binding protein            143   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889109.1|  RNA recognition motif-containing protein           143   7e-34   
gb|KFK42088.1|  hypothetical protein AALP_AA2G209400                    142   7e-34   
ref|XP_010416620.1|  PREDICTED: uncharacterized protein LOC104702460    143   8e-34   
ref|XP_010477395.1|  PREDICTED: uncharacterized protein LOC104756...    142   1e-33   
ref|XP_010320067.1|  PREDICTED: uncharacterized protein LOC101249...    143   1e-33   
ref|XP_006362816.1|  PREDICTED: uncharacterized protein LOC102604...    143   1e-33   
ref|XP_010471856.1|  PREDICTED: uncharacterized protein LOC104751...    142   2e-33   
ref|NP_001056664.1|  Os06g0127500                                       143   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99488.1|  hypothetical protein OsI_21456                          141   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006362815.1|  PREDICTED: uncharacterized protein LOC102604...    142   3e-33   
ref|XP_010320066.1|  PREDICTED: uncharacterized protein LOC101249...    142   3e-33   
gb|KGN47470.1|  hypothetical protein Csa_6G338020                       145   9e-33   
dbj|BAK05404.1|  predicted protein                                      138   4e-32   
emb|CDX88323.1|  BnaC06g37670D                                          136   1e-31   
ref|NP_177820.2|  RNA recognition motif-containing protein              136   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428762.1|  PREDICTED: RNA-binding protein FUS-like isof...    136   2e-31   
ref|XP_010428760.1|  PREDICTED: uncharacterized protein LOC104713...    136   2e-31   
ref|XP_006302760.1|  hypothetical protein CARUB_v10020882mg             135   2e-31   
sp|Q6JB11.1|MEG5_MAIZE  RecName: Full=Protein MATERNALLY EXPRESSE...    132   5e-31   Zea mays [maize]
emb|CDX87560.1|  BnaA07g33130D                                          133   8e-31   
ref|XP_009106356.1|  PREDICTED: uncharacterized protein LOC103832149    133   9e-31   
ref|XP_010680428.1|  PREDICTED: uncharacterized protein LOC104895572    133   2e-30   
ref|XP_006390140.1|  hypothetical protein EUTSA_v10019060mg             133   2e-30   
ref|XP_002533013.1|  conserved hypothetical protein                     141   2e-30   Ricinus communis
ref|NP_173554.3|  nucleic acid/nucleotide binding protein               136   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519382.1|  PREDICTED: uncharacterized protein LOC104798866    131   2e-29   
gb|KDO83674.1|  hypothetical protein CISIN_1g023903mg                   128   3e-29   
gb|EMT00765.1|  hypothetical protein F775_20767                         126   1e-28   
ref|XP_002264314.2|  PREDICTED: uncharacterized protein LOC100242739    127   4e-28   Vitis vinifera
ref|XP_002445752.1|  hypothetical protein SORBIDRAFT_07g025090          124   8e-28   Sorghum bicolor [broomcorn]
emb|CBI35503.3|  unnamed protein product                                126   8e-28   
dbj|BAC42194.1|  unknown protein                                        122   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KDO83678.1|  hypothetical protein CISIN_1g023903mg                   122   2e-27   
gb|ABK22259.1|  unknown                                                 125   2e-27   Picea sitchensis
ref|NP_001185414.1|  RNA recognition motif-containing protein           121   4e-27   
gb|EYU19666.1|  hypothetical protein MIMGU_mgv1a014291mg                122   4e-27   
ref|XP_006367364.1|  PREDICTED: uncharacterized protein LOC102584276    122   5e-27   
gb|KDO83680.1|  hypothetical protein CISIN_1g023903mg                   120   5e-27   
ref|XP_006367960.1|  PREDICTED: uncharacterized protein LOC102590773    122   1e-26   
ref|XP_006661461.1|  PREDICTED: uncharacterized protein LOC102707521    121   1e-26   
gb|KHN15442.1|  RNA-binding protein with multiple splicing              120   2e-26   
ref|XP_010477394.1|  PREDICTED: uncharacterized protein LOC104756...    120   3e-26   
ref|XP_003592143.1|  RNA-binding protein with multiple splicing         117   5e-26   
ref|XP_002893157.1|  hypothetical protein ARALYDRAFT_472365             122   7e-26   
gb|EMT12949.1|  hypothetical protein F775_32109                         118   2e-25   
ref|XP_006386322.1|  hypothetical protein POPTR_0002s07090g             117   2e-25   
ref|XP_011042824.1|  PREDICTED: uncharacterized protein LOC105138...    117   2e-25   
ref|XP_010471857.1|  PREDICTED: uncharacterized protein LOC104751...    117   3e-25   
ref|XP_010322226.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    114   1e-24   
gb|EMS63560.1|  hypothetical protein TRIUR3_29274                       115   1e-24   
ref|XP_010322015.1|  PREDICTED: uncharacterized protein LOC101252189    114   2e-24   
ref|XP_010322225.1|  PREDICTED: uncharacterized protein LOC101247...    114   3e-24   
gb|KEH43662.1|  RNA-binding (RRM/RBD/RNP motif) family protein          113   4e-24   
ref|XP_010236866.1|  PREDICTED: LOW QUALITY PROTEIN: protein MATE...    110   2e-23   
ref|XP_010322224.1|  PREDICTED: uncharacterized protein LOC101246...    111   2e-23   
ref|XP_010322016.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    107   3e-23   
ref|XP_002968962.1|  hypothetical protein SELMODRAFT_38126              106   4e-23   
ref|XP_010322018.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    106   7e-23   
ref|XP_001765014.1|  predicted protein                                  108   9e-23   
ref|XP_006343474.1|  PREDICTED: uncharacterized protein LOC102580696    108   1e-22   
ref|XP_002963648.1|  hypothetical protein SELMODRAFT_69289              105   1e-22   
ref|XP_010314975.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    108   1e-22   
ref|XP_002974737.1|  hypothetical protein SELMODRAFT_59352              105   1e-22   
ref|XP_010314974.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    108   1e-22   
ref|XP_010314973.1|  PREDICTED: U2 small nuclear ribonucleoprotei...    108   2e-22   
gb|ADR79706.1|  RNA binding protein U620                                106   2e-22   
ref|XP_010322017.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    105   2e-22   
ref|XP_010322223.1|  PREDICTED: uncharacterized protein LOC101246...    108   2e-22   
ref|XP_006367442.1|  PREDICTED: uncharacterized protein LOC102589014    110   3e-22   
emb|CAI84655.1|  hypothetical protein                                   107   4e-22   Nicotiana tabacum [American tobacco]
ref|XP_010322019.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    103   6e-22   
ref|XP_010322227.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    104   9e-22   
emb|CAN74250.1|  hypothetical protein VITISV_019089                     108   2e-21   Vitis vinifera
ref|XP_008347761.1|  PREDICTED: protein WHI4-like                       104   2e-21   
ref|XP_006362830.1|  PREDICTED: uncharacterized protein LOC102582033    107   3e-21   
ref|XP_004253475.2|  PREDICTED: circumsporozoite protein-like           105   5e-21   
ref|XP_004241132.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    102   7e-21   
ref|XP_011084057.1|  PREDICTED: protein MATERNALLY EXPRESSED GENE...    103   1e-20   
ref|XP_009334723.1|  PREDICTED: uncharacterized protein LOC103927516  97.8    2e-18   
gb|ACN40817.1|  unknown                                               98.2    2e-18   
ref|XP_006843189.1|  hypothetical protein AMTR_s00146p00086180        95.9    3e-18   
gb|EEC84915.1|  hypothetical protein OsI_32114                        94.0    3e-18   
dbj|BAG89080.1|  unnamed protein product                              93.6    4e-18   
dbj|BAG93487.1|  unnamed protein product                              94.0    4e-18   
ref|NP_001063729.1|  Os09g0527100                                     94.4    5e-18   
gb|KDO83675.1|  hypothetical protein CISIN_1g023903mg                 94.0    2e-17   
ref|XP_008220513.1|  PREDICTED: protein couch potato-like             94.4    3e-17   
ref|XP_004957419.1|  PREDICTED: basic salivary proline-rich prote...  95.5    4e-17   
ref|XP_008377702.1|  PREDICTED: uncharacterized protein LOC103440780  93.2    6e-17   
ref|XP_004303492.1|  PREDICTED: uncharacterized protein LOC101308481  93.6    8e-17   
ref|XP_010247370.1|  PREDICTED: uncharacterized protein LOC104590401  92.8    8e-17   
gb|ACN35967.1|  unknown                                               93.6    9e-17   
gb|KDO73529.1|  hypothetical protein CISIN_1g0261891mg                90.5    1e-16   
ref|XP_006474441.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  92.4    1e-16   
ref|XP_003603172.1|  RNA-binding protein with multiple splicing       92.0    1e-16   
ref|XP_006474439.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  92.8    1e-16   
ref|NP_001063730.1|  Os09g0527500                                     92.0    1e-16   
ref|XP_002460551.1|  hypothetical protein SORBIDRAFT_02g030530        89.0    2e-16   
ref|XP_010915197.1|  PREDICTED: protein WHI3-like                     91.7    2e-16   
ref|XP_008668302.1|  PREDICTED: hypothetical protein isoform X2       94.0    2e-16   
ref|NP_001168219.1|  hypothetical protein                             94.0    2e-16   
ref|XP_008668301.1|  PREDICTED: hypothetical protein isoform X1       93.6    2e-16   
ref|XP_006453055.1|  hypothetical protein CICLE_v10009319mg           91.3    2e-16   
ref|XP_011019404.1|  PREDICTED: uncharacterized protein LOC105122162  91.3    3e-16   
tpg|DAA41945.1|  TPA: hypothetical protein ZEAMMB73_165038            93.6    3e-16   
gb|KDO73528.1|  hypothetical protein CISIN_1g0261891mg                90.1    3e-16   
ref|XP_009408841.1|  PREDICTED: uncharacterized protein LOC103991204  90.1    4e-16   
ref|XP_008393609.1|  PREDICTED: uncharacterized protein LOC103455800  90.9    4e-16   
ref|XP_004501453.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  90.5    4e-16   
gb|KEH35877.1|  RNA recognition motif                                 90.1    4e-16   
ref|XP_010674628.1|  PREDICTED: uncharacterized protein LOC104890746  89.7    6e-16   
gb|KCW69201.1|  hypothetical protein EUGRSUZ_F02718                   88.2    1e-15   
ref|XP_002516098.1|  conserved hypothetical protein                   89.0    1e-15   
ref|XP_010047367.1|  PREDICTED: uncharacterized protein LOC104436...  89.0    1e-15   
gb|KHG03931.1|  Coiled-coil domain-containing protein                 87.0    2e-15   
ref|XP_002308540.2|  hypothetical protein POPTR_0006s24130g           91.3    2e-15   
ref|XP_007136860.1|  hypothetical protein PHAVU_009G079800g           88.2    2e-15   
ref|XP_011100490.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  88.2    2e-15   
ref|XP_011100421.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  87.8    3e-15   
gb|ADE77166.1|  unknown                                               89.0    4e-15   
gb|ACJ85957.1|  unknown                                               84.7    4e-15   
ref|XP_008805799.1|  PREDICTED: protein WHI3-like isoform X2          86.3    6e-15   
ref|XP_009362281.1|  PREDICTED: uncharacterized protein LOC103952411  87.0    7e-15   
ref|XP_004141330.1|  PREDICTED: uncharacterized protein LOC101211987  87.0    7e-15   
ref|XP_008805798.1|  PREDICTED: uncharacterized protein LOC103718...  86.3    1e-14   
ref|XP_003526036.1|  PREDICTED: uncharacterized protein LOC100809186  86.3    1e-14   
gb|EEC80002.1|  hypothetical protein OsI_21654                        86.3    1e-14   
gb|KDP34068.1|  hypothetical protein JCGZ_07639                       85.9    1e-14   
ref|XP_008452749.1|  PREDICTED: protein couch potato-like isoform X2  85.5    2e-14   
ref|XP_008452748.1|  PREDICTED: protein couch potato-like isoform X1  85.5    2e-14   
gb|KHG05694.1|  RNA-binding with multiple splicing                    86.3    2e-14   
gb|AFK48970.1|  unknown                                               85.1    2e-14   
ref|XP_003557195.1|  PREDICTED: U2 small nuclear ribonucleoprotei...  84.3    3e-14   
gb|AAF81354.1|AC036104_3  Contains weak similarity to bab503 majo...  86.7    3e-14   
ref|XP_002280068.1|  PREDICTED: U2 small nuclear ribonucleoprotei...  84.3    4e-14   
ref|XP_008793263.1|  PREDICTED: uncharacterized protein LOC103709...  83.6    6e-14   
gb|KHN29696.1|  hypothetical protein glysoja_016318                   84.0    6e-14   
ref|XP_006656638.1|  PREDICTED: uncharacterized protein LOC102719305  83.6    6e-14   
ref|XP_005849537.1|  hypothetical protein CHLNCDRAFT_142904           86.7    7e-14   
ref|NP_001242381.1|  uncharacterized protein LOC100816255             83.6    7e-14   
ref|XP_008793264.1|  PREDICTED: protein WHI3-like isoform X3          83.2    7e-14   
ref|XP_008793262.1|  PREDICTED: uncharacterized protein LOC103709...  83.2    1e-13   
ref|XP_010925404.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  82.8    1e-13   
gb|EYU29339.1|  hypothetical protein MIMGU_mgv1a012896mg              82.8    1e-13   
ref|XP_007012343.1|  RNA-binding family protein isoform 1             83.6    3e-13   
gb|AES62394.2|  RNA-binding (RRM/RBD/RNP motif) family protein        80.9    3e-13   
emb|CDW88634.1|  rna-binding protein with multiple splicing           82.4    9e-13   
ref|NP_001131419.1|  uncharacterized protein LOC100192748             79.0    3e-12   
gb|EJY73094.1|  RRM domain containing protein                         80.1    5e-12   
ref|NP_001148276.1|  LOC100281884                                     76.6    2e-11   
ref|XP_005645165.1|  hypothetical protein COCSUDRAFT_83539            76.6    2e-11   
ref|XP_004964564.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  74.3    7e-11   
ref|XP_004964565.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  74.3    7e-11   
gb|ABG73445.1|  RNA recognition motif family protein                  73.9    1e-10   
emb|CAN75823.1|  hypothetical protein VITISV_004156                   75.9    1e-10   
ref|XP_001435855.1|  hypothetical protein                             71.2    2e-10   
gb|EAR96963.4|  RNA recognition motif protein                         75.5    2e-10   
ref|XP_001017208.3|  hypothetical protein TTHERM_00194550             75.1    3e-10   
ref|XP_003062365.1|  predicted protein                                70.1    4e-10   
ref|XP_001431996.1|  hypothetical protein                             69.7    6e-10   
ref|XP_004347094.1|  RNA recognition motif domain containing protein  70.5    3e-09   
gb|KCW79254.1|  hypothetical protein EUGRSUZ_C00672                   65.1    4e-08   
gb|EEE65085.1|  hypothetical protein OsJ_20124                        65.5    4e-08   
ref|XP_007224815.1|  hypothetical protein PRUPE_ppa023547mg           65.5    5e-08   
ref|XP_010047366.1|  PREDICTED: uncharacterized protein LOC104436...  65.1    6e-08   
gb|EJY72148.1|  hypothetical protein OXYTRI_06855                     65.9    2e-07   
gb|KEH35876.1|  RNA recognition motif                                 62.8    2e-07   
ref|XP_007012344.1|  RNA-binding family protein isoform 2             64.7    2e-07   
emb|CDP08296.1|  unnamed protein product                              61.2    6e-07   
ref|XP_002501283.1|  predicted protein                                63.2    7e-07   
ref|XP_007012345.1|  RNA-binding family protein isoform 3             63.2    8e-07   
emb|CDW87591.1|  rna-binding protein                                  63.5    9e-07   
ref|XP_002953951.1|  hypothetical protein VOLCADRAFT_106208           61.2    8e-06   
ref|XP_004964563.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  58.2    2e-05   
ref|XP_003292080.1|  hypothetical protein DICPUDRAFT_89664            57.4    5e-05   
gb|EEE65084.1|  hypothetical protein OsJ_20123                        55.5    5e-05   
gb|AFW85863.1|  nucleic acid binding protein                          56.2    6e-05   
ref|XP_002280083.1|  PREDICTED: uncharacterized protein LOC100257...  55.5    8e-05   
gb|EFA85620.1|  RNA-binding region RNP-1 domain-containing protein    56.6    1e-04   
dbj|GAM20329.1|  hypothetical protein SAMD00019534_035040             55.8    2e-04   
ref|XP_006474442.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  53.1    6e-04   
ref|XP_006474440.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  53.5    6e-04   



>emb|CDP05041.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   258 bits (660),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 166/204 (81%), Gaps = 4/204 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MA+AYWR+ D+RQQ P    +P    KRPRS+Y D  + H+L+ YYA +D R   HRVIR
Sbjct  1     MAEAYWRYSDIRQQAPATLQLPVA--KRPRSDYADVPSGHELSNYYAHEDERVS-HRVIR  57

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DTDPIGASYDRYL+S+++S+Y GGESAR ++ G+ GHP +DPR++G+GGSD   +     
Sbjct  58    DTDPIGASYDRYLRSSQLSSYSGGESARSMSNGLGGHPVDDPRIVGMGGSDLAMSTKSRS  117

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              GVGGGR+E+ LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLVTK+SR P G+
Sbjct  118   MGVGGGRSELPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVTKDSRHPGGE  177

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDFASPA+AATAMDALQG
Sbjct  178   PLVLCFVDFASPAYAATAMDALQG  201



>ref|XP_006441172.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 ref|XP_006441173.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 gb|ESR54412.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 gb|ESR54413.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 gb|KDO59661.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
 gb|KDO59662.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
Length=235

 Score =   254 bits (650),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLML  3636
             L+ CFVDF SPAHAATAMDALQG+   + L
Sbjct  177   LILCFVDFVSPAHAATAMDALQGQSNIICL  206



>ref|XP_011084540.1| PREDICTED: uncharacterized protein LOC105166763 isoform X2 [Sesamum 
indicum]
Length=208

 Score =   250 bits (639),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQQP           KRPRS+Y+  + HDL+GYYAR+D RGG+ RVIRD
Sbjct  1     MADAYWRYSDGRQQPAALTPHVV---KRPRSDYEIPSRHDLSGYYAREDDRGGL-RVIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHP-TEDPRVLGIGGSDPvgakgram  3909
             TD I ASYDRYL+S ++ +YGG +S R ++ G+ GH   +DPRV+ +GGS+P  +     
Sbjct  57    TDSINASYDRYLRSTQMPSYGG-DSGRSMSSGLGGHHHVDDPRVMAVGGSEPAASTKIRS  115

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              GV   + E+ LPPDASSTL+VEGLPANCTRREV HIFRPFVGYKEVRLVTKESR P GD
Sbjct  116   IGVEAVQPEISLPPDASSTLFVEGLPANCTRREVCHIFRPFVGYKEVRLVTKESRHPGGD  175

Query  3728  PLVFCFVDFASPAHAATAMDALQGEVTFLMLLI  3630
             PLV CFVDF SPAHAATAMDALQ  V  ++L  
Sbjct  176   PLVLCFVDFQSPAHAATAMDALQEFVKRVILCF  208



>gb|KDO59660.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
Length=223

 Score =   250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 162/211 (77%), Gaps = 4/211 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLMLL  3633
             L+ CFVDF SPAHAATAMDALQ  +T    L
Sbjct  177   LILCFVDFVSPAHAATAMDALQVMLTHQAFL  207



>ref|XP_007039131.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY23632.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=219

 Score =   249 bits (636),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 156/203 (77%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD+YWR+ D RQ PP +        KRPRS+YD +  H+L+ YY+R D RG V R IRD
Sbjct  1     MADSYWRYSDSRQPPPSSIPSLVG--KRPRSDYDVSGGHELSSYYSRGDDRGAV-RAIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IGASYDRYL+S ++S+Y G +SARP++GGM G   +DPR++GIGG DP         
Sbjct  58    SDSIGASYDRYLRSTQMSSYSGSQSARPMSGGMPGRSVDDPRIMGIGGVDPGQTVKDRTL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G GGGR E  LPPDASSTL+VEGLP++CTRREVSHIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GFGGGRPEAPLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDALQG
Sbjct  178   LILCFVDFVSPAHAATAMDALQG  200



>ref|XP_011084538.1| PREDICTED: uncharacterized protein LOC105166763 isoform X1 [Sesamum 
indicum]
 ref|XP_011084539.1| PREDICTED: uncharacterized protein LOC105166763 isoform X1 [Sesamum 
indicum]
Length=232

 Score =   249 bits (637),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 155/204 (76%), Gaps = 6/204 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQQP           KRPRS+Y+  + HDL+GYYAR+D RGG+ RVIRD
Sbjct  1     MADAYWRYSDGRQQPAALTPHVV---KRPRSDYEIPSRHDLSGYYAREDDRGGL-RVIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHP-TEDPRVLGIGGSDPvgakgram  3909
             TD I ASYDRYL+S ++ +YGG +S R ++ G+ GH   +DPRV+ +GGS+P  +     
Sbjct  57    TDSINASYDRYLRSTQMPSYGG-DSGRSMSSGLGGHHHVDDPRVMAVGGSEPAASTKIRS  115

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              GV   + E+ LPPDASSTL+VEGLPANCTRREV HIFRPFVGYKEVRLVTKESR P GD
Sbjct  116   IGVEAVQPEISLPPDASSTLFVEGLPANCTRREVCHIFRPFVGYKEVRLVTKESRHPGGD  175

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF SPAHAATAMDALQG
Sbjct  176   PLVLCFVDFQSPAHAATAMDALQG  199



>ref|XP_006491965.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Citrus sinensis]
Length=214

 Score =   249 bits (635),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ   P +A+PSL++KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQ---PQSALPSLVSKRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF SPAHAATAMDALQ
Sbjct  177   LILCFVDFVSPAHAATAMDALQ  198



>gb|AFY26894.1| RNA-binding protein with multiple splicing [Morella rubra]
Length=233

 Score =   249 bits (637),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 162/203 (80%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+GD RQ  PP  ++  ++ KR RS+YD  + H+L  Y++RDD RG + R +RD
Sbjct  1     MADAYWRYGDSRQ--PPPQSLTQIVGKRSRSDYDVPSGHELPSYFSRDDERGTL-RGMRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD IGASYDRYL+SA+VS+YGGG+SARP++GGM+    +DPR++G+G  +P         
Sbjct  58    TDSIGASYDRYLRSAQVSSYGGGQSARPISGGMSSRAVDDPRIVGMGSVEPATTVKDRTL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G GGGR EV LPPDASSTL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GYGGGRPEVPLPPDASSTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  178   LVLCFVDFLSPAHAATAMDALQG  200



>gb|KDO59663.1| hypothetical protein CISIN_1g0266482mg, partial [Citrus sinensis]
 gb|KDO59664.1| hypothetical protein CISIN_1g0266482mg, partial [Citrus sinensis]
Length=198

 Score =   248 bits (632),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF SPAHAATAMDALQ
Sbjct  177   LILCFVDFVSPAHAATAMDALQ  198



>ref|XP_006491964.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Citrus sinensis]
Length=231

 Score =   249 bits (635),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 159/202 (79%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF SPAHAATAMDALQ
Sbjct  177   LILCFVDFVSPAHAATAMDALQ  198



>ref|XP_006441170.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 ref|XP_006441171.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 ref|XP_006491963.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Citrus sinensis]
 gb|ESR54410.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 gb|ESR54411.1| hypothetical protein CICLE_v10022008mg [Citrus clementina]
 gb|KDO59658.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
 gb|KDO59659.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
Length=232

 Score =   249 bits (635),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 160/203 (79%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDALQG
Sbjct  177   LILCFVDFVSPAHAATAMDALQG  199



>ref|XP_007039130.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY23631.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=233

 Score =   249 bits (635),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 156/203 (77%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD+YWR+ D RQ PP +        KRPRS+YD +  H+L+ YY+R D RG V R IRD
Sbjct  1     MADSYWRYSDSRQPPPSSIPSLVG--KRPRSDYDVSGGHELSSYYSRGDDRGAV-RAIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IGASYDRYL+S ++S+Y G +SARP++GGM G   +DPR++GIGG DP         
Sbjct  58    SDSIGASYDRYLRSTQMSSYSGSQSARPMSGGMPGRSVDDPRIMGIGGVDPGQTVKDRTL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G GGGR E  LPPDASSTL+VEGLP++CTRREVSHIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GFGGGRPEAPLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDALQG
Sbjct  178   LILCFVDFVSPAHAATAMDALQG  200



>gb|KDP42156.1| hypothetical protein JCGZ_03023 [Jatropha curcas]
Length=232

 Score =   246 bits (627),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+GD RQQ            KRPRS+YD  + H++  YYARDD R  + R IRD
Sbjct  1     MADAYWRYGDARQQQQATIPALVG--KRPRSDYDVPSGHEIPSYYARDDDRAAL-RAIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             ++ IGASYDRYL+SA +S+Y GG+SAR ++G M     +DPRV+GIG  DP         
Sbjct  58    SESIGASYDRYLRSAPISSYSGGQSARAISG-MHSRTADDPRVVGIGSLDPGATVKERTL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR E  LPPDA+STL+VEGLP+NCTRREVSHIFRPFVGYKEVRLV+KESRRP GDP
Sbjct  117   GLGSGRPEAPLPPDATSTLFVEGLPSNCTRREVSHIFRPFVGYKEVRLVSKESRRPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  177   LVLCFVDFLSPAHAATAMDALQG  199



>ref|XP_009351956.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X2 
[Pyrus x bretschneideri]
Length=204

 Score =   242 bits (618),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ P  A        KRPRSEYD    HDL  YY ++D RG + R IRD
Sbjct  1     MADAYWRYSDGRQPPASAMNSVVG--KRPRSEYDAQGGHDLPNYYPQEDDRGSI-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++S+Y GG+SAR ++GG  G   +DPR++GIGG DP       + 
Sbjct  58    TDSINASYDRYLRSAQISSYSGGQSARNMSGGPPGRAVDDPRMMGIGGVDPGEPVKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR +  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPDAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTF  3645
             L+ CFVDF SPAHAATAMDALQG + +
Sbjct  178   LILCFVDFLSPAHAATAMDALQGLILY  204



>ref|XP_010662906.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5 isoform X3 [Vitis 
vinifera]
Length=197

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 152/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+G+VRQ PP  +       KRPRS+YD    HDL  Y++R+D R   HR IRD
Sbjct  1     MADPYWRYGEVRQPPPIPSLSA----KRPRSDYDVPGGHDLPSYFSREDERA-AHRSIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IGASYDRYL++A++ +YGG +S RPL+GG+  HP +DPRV+G+ G D          
Sbjct  56    SDSIGASYDRYLRNAQMPSYGG-DSGRPLSGGITSHPVDDPRVVGVRGVDQGATVKSQSL  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G  GGR E+ LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLV+KESR   GDP
Sbjct  115   GFSGGRPELPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVSKESRHSGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             LV CFVDF SPAHAATAMDALQ
Sbjct  175   LVLCFVDFVSPAHAATAMDALQ  196



>ref|XP_010662904.1| PREDICTED: uncharacterized protein LOC100265772 isoform X1 [Vitis 
vinifera]
 emb|CBI23047.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 153/203 (75%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+G+VRQ PP  +       KRPRS+YD    HDL  Y++R+D R   HR IRD
Sbjct  1     MADPYWRYGEVRQPPPIPSLSA----KRPRSDYDVPGGHDLPSYFSREDERA-AHRSIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IGASYDRYL++A++ +YGG +S RPL+GG+  HP +DPRV+G+ G D          
Sbjct  56    SDSIGASYDRYLRNAQMPSYGG-DSGRPLSGGITSHPVDDPRVVGVRGVDQGATVKSQSL  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G  GGR E+ LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLV+KESR   GDP
Sbjct  115   GFSGGRPELPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVSKESRHSGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  175   LVLCFVDFVSPAHAATAMDALQG  197



>ref|XP_002317797.1| hypothetical protein POPTR_0012s02630g [Populus trichocarpa]
 gb|EEE96017.1| hypothetical protein POPTR_0012s02630g [Populus trichocarpa]
Length=233

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 159/204 (78%), Gaps = 5/204 (2%)
 Frame = -2

Query  4265  MADAYWRF-GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD+YWR+ GD RQQPP + +  +   KRPR +YD  +  DL+ YY+RDD RG +H VIR
Sbjct  1     MADSYWRYAGDSRQQPPQSMSSLTG--KRPRIDYDIPSGRDLSSYYSRDDDRGALH-VIR  57

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             D+D IGASYDRYL+S  VS+YGGG+SAR ++G +  HP +D R++ +G  DP  +     
Sbjct  58    DSDSIGASYDRYLRSGTVSSYGGGQSARAMSG-VPSHPVDDTRMVSMGPMDPGASVKDRS  116

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
               +G GR+EV LPPDASSTL+VEGLP++CTRREVSHIFRPFVGYKEVRLV+KESR P GD
Sbjct  117   LRMGSGRSEVSLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGD  176

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF SPAHAATAMDALQG
Sbjct  177   PLVLCFVDFLSPAHAATAMDALQG  200



>ref|XP_002515833.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF46575.1| nucleic acid binding protein, putative [Ricinus communis]
Length=232

 Score =   241 bits (614),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 157/203 (77%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ  P    IP+L+ KR RS+YD  + H+L  YY RDD RG + R IRD
Sbjct  1     MADAYWRYSDARQ--PQQQPIPTLVGKRSRSDYDVTSGHELPNYYTRDDDRGAL-RAIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD IGASYDRYL+SA +S+Y GG+SARP++G +     +DPR++GIGG DP         
Sbjct  58    TDSIGASYDRYLRSAPISSYSGGQSARPISG-VPNRVADDPRIMGIGGLDPGPTVKDRTL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR E  LPPDA+STL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESRRP GDP
Sbjct  117   GLGSGRPETSLPPDATSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESRRPGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  177   LVLCFVDFLSPAHAATAMDALQG  199



>ref|XP_008343802.1| PREDICTED: uncharacterized protein LOC103406591 [Malus domestica]
Length=233

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ P           KRPRS+YD    HDL  YY ++D RG + R IRD
Sbjct  1     MADAYWRYSDGRQPPASTMNSVVG--KRPRSDYDAQGGHDLPNYYPQEDDRGSI-RAIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++S+Y GG+SAR ++GG  G   +DPR++GIGG DP       + 
Sbjct  58    TDSINASYDRYLRSAQISSYSGGQSARNMSGGPPGRAVDDPRMMGIGGVDPGAPVKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR +  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPDAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDALQG
Sbjct  178   LILCFVDFLSPAHAATAMDALQG  200



>ref|XP_009351955.1| PREDICTED: uncharacterized protein LOC103943385 isoform X1 [Pyrus 
x bretschneideri]
Length=233

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 158/203 (78%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ  PPA+A+ S++ KRPRSEYD    HDL  YY ++D RG + R IRD
Sbjct  1     MADAYWRYSDGRQ--PPASAMNSVVGKRPRSEYDAQGGHDLPNYYPQEDDRGSI-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++S+Y GG+SAR ++GG  G   +DPR++GIGG DP       + 
Sbjct  58    TDSINASYDRYLRSAQISSYSGGQSARNMSGGPPGRAVDDPRMMGIGGVDPGEPVKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR +  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPDAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDALQG
Sbjct  178   LILCFVDFLSPAHAATAMDALQG  200



>ref|XP_007218305.1| hypothetical protein PRUPE_ppa010843mg [Prunus persica]
 gb|EMJ19504.1| hypothetical protein PRUPE_ppa010843mg [Prunus persica]
Length=233

 Score =   239 bits (610),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 152/203 (75%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ PP A        KRPRS+YD    HDL  YY+ +D RG + R IRD
Sbjct  1     MADAYWRYSDARQPPPSAMNSVVG--KRPRSDYDAHGGHDLPSYYSHEDDRGSL-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++ +Y GG+SAR L+GG+ G   +DPR++G+GG DP       + 
Sbjct  58    TDSINASYDRYLRSAQMPSYSGGQSARTLSGGLPGRSVDDPRMMGMGGVDPGAPVKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR E  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPEAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  178   LVLCFVDFVSPAHAATAMDALQG  200



>ref|XP_008234694.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Prunus 
mume]
Length=233

 Score =   238 bits (607),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 151/203 (74%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ P  A        KRPRS+YD    HDL  YY+ +D RG + R IRD
Sbjct  1     MADAYWRYSDARQPPQSAMNSVVG--KRPRSDYDAHGGHDLPSYYSHEDDRGSL-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++ +Y GG+SAR L+GG+ G   +DPR++G+GG +P       + 
Sbjct  58    TDSINASYDRYLRSAQMPSYSGGQSARTLSGGLPGRSVDDPRMMGMGGVEPGAPVKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR E  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPEAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  178   LVLCFVDFVSPAHAATAMDALQG  200



>ref|XP_002275189.2| PREDICTED: uncharacterized protein LOC100265772 isoform X2 [Vitis 
vinifera]
Length=229

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+G+VRQ PP  +       KRPRS+YD    HDL  Y++R+D R   HR IRD
Sbjct  1     MADPYWRYGEVRQPPPIPSLSA----KRPRSDYDVPGGHDLPSYFSREDERA-AHRSIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IGASYDRYL++A  S   GG+S RPL+GG+  HP +DPRV+G+ G D          
Sbjct  56    SDSIGASYDRYLRNAMPSY--GGDSGRPLSGGITSHPVDDPRVVGVRGVDQGATVKSQSL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G  GGR E+ LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLV+KESR   GDP
Sbjct  114   GFSGGRPELPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVSKESRHSGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  174   LVLCFVDFVSPAHAATAMDALQG  196



>ref|XP_006374094.1| hypothetical protein POPTR_0015s01130g [Populus trichocarpa]
 gb|ERP51891.1| hypothetical protein POPTR_0015s01130g [Populus trichocarpa]
Length=233

 Score =   234 bits (598),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 154/204 (75%), Gaps = 5/204 (2%)
 Frame = -2

Query  4265  MADAYWRF-GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD+YWR+ GD RQ  P +    +   KRPRS+YD  +  DL+ YY+RDD RG + RVIR
Sbjct  1     MADSYWRYAGDSRQPQPQSMPSLTG--KRPRSDYDVPSGRDLSSYYSRDDDRGAL-RVIR  57

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             D+D IGASYDRYL S  +S+YGGG+SAR ++G +   P +D R++ +G  DP  +     
Sbjct  58    DSDSIGASYDRYLHSGTISSYGGGQSARAISG-VPVRPVDDLRMVSMGSMDPGSSVKDRS  116

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
                G GR+EV LPPDASSTL+VEGLP++CTRREVSHIFRPFVGYKEVRLV+KESR P GD
Sbjct  117   MRTGSGRSEVSLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGD  176

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF SPAHAAT+MDALQG
Sbjct  177   PLVLCFVDFLSPAHAATSMDALQG  200



>ref|XP_008376783.1| PREDICTED: uncharacterized protein LOC103439918 [Malus domestica]
Length=233

 Score =   234 bits (598),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ  PP +A+ S++ KRPRS+YD     DL  YY  +D RG + R IRD
Sbjct  1     MADAYWRYSDGRQ--PPPSAMNSVVGKRPRSDYDTQGGQDLPNYYPHEDDRGSM-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL++A++S+Y GG+SAR ++GG  G   EDPR++GIGG DP       + 
Sbjct  58    TDSINASYDRYLRNAQMSSYSGGQSARNMSGGPPGRAVEDPRMMGIGGVDPGAPAKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR +  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPDAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  178   LVLCFVDFVSPAHAATAMDALQG  200



>ref|XP_011075938.1| PREDICTED: uncharacterized protein LOC105160314 isoform X3 [Sesamum 
indicum]
Length=201

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 153/202 (76%), Gaps = 9/202 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M DAYWR+GD RQQP     +     KRPRS+++  ++HD+  YYAR++ R G  R+IRD
Sbjct  1     MGDAYWRYGDGRQQPATLPQVA----KRPRSDFEMPSAHDVPSYYAREEDRAGP-RIIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+S+++S+YGG E+ R L+GG   H  +DPR + IGGSDP         
Sbjct  56    TESVNASYERYLRSSQISSYGG-EAGRSLSGGH--HQVDDPRGIAIGGSDPAMPAKPRSI  112

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG   EV LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR P GDP
Sbjct  113   GMGGR-PEVPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRHPGGDP  171

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             LV CFVDF SPAHAATAMDALQ
Sbjct  172   LVLCFVDFESPAHAATAMDALQ  193



>ref|XP_008790543.1| PREDICTED: uncharacterized protein LOC103707719 isoform X4 [Phoenix 
dactylifera]
Length=207

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 151/214 (71%), Gaps = 10/214 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGRGGVHRVI  4092
             MAD YWR+GD R Q   A A P    KRPR +Y   PA S +  GYY R++GR G HRVI
Sbjct  1     MADGYWRYGDARHQAQAAMAPPQPPMKRPRPDYGDVPAGS-EYVGYYPREEGRAG-HRVI  58

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ I ASYDRYL+  ++ +YGGGES RP+ GGM GHP +D R++G+GG D        
Sbjct  59    RDTESISASYDRYLRDGQIVSYGGGESLRPVAGGMGGHPVDDLRMMGVGGMD------GR  112

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P G
Sbjct  113   SVGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGG  172

Query  3731  DPLVFCFVDFASPAHAATAMDALQGEVTFLMLLI  3630
             DPLV CFVDF++P+ AA A+DALQ +     LL+
Sbjct  173   DPLVLCFVDFSTPSQAAVALDALQDKKGTCQLLL  206



>ref|XP_011075936.1| PREDICTED: uncharacterized protein LOC105160314 isoform X1 [Sesamum 
indicum]
Length=227

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 9/203 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M DAYWR+GD RQQP     +     KRPRS+++  ++HD+  YYAR++ R G  R+IRD
Sbjct  1     MGDAYWRYGDGRQQPATLPQVA----KRPRSDFEMPSAHDVPSYYAREEDRAGP-RIIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+S+++S+YGG E+ R L+GG   H  +DPR + IGGSDP         
Sbjct  56    TESVNASYERYLRSSQISSYGG-EAGRSLSGGH--HQVDDPRGIAIGGSDPAMPAKPRSI  112

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG   EV LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR P GDP
Sbjct  113   GMGGR-PEVPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRHPGGDP  171

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  172   LVLCFVDFESPAHAATAMDALQG  194



>ref|XP_009775997.1| PREDICTED: uncharacterized protein LOC104225820 isoform X2 [Nicotiana 
sylvestris]
Length=231

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 153/217 (71%), Gaps = 4/217 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLMLLIM*CHI  3615
             L+ CFVDF +P HAA AMDALQ      M+ I  C +
Sbjct  177   LILCFVDFVTPLHAAAAMDALQDIAGCCMMGINICSV  213



>ref|XP_008790542.1| PREDICTED: uncharacterized protein LOC103707719 isoform X3 [Phoenix 
dactylifera]
Length=217

 Score =   232 bits (592),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGRGGVHRVI  4092
             MAD YWR+GD R Q   A A P    KRPR +Y   PA S +  GYY R++GR G HRVI
Sbjct  1     MADGYWRYGDARHQAQAAMAPPQPPMKRPRPDYGDVPAGS-EYVGYYPREEGRAG-HRVI  58

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ I ASYDRYL+  ++ +YGGGES RP+ GGM GHP +D R++G+GG D        
Sbjct  59    RDTESISASYDRYLRDGQIVSYGGGESLRPVAGGMGGHPVDDLRMMGVGGMD------GR  112

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P G
Sbjct  113   SVGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGG  172

Query  3731  DPLVFCFVDFASPAHAATAMDALQG  3657
             DPLV CFVDF++P+ AA A+DALQG
Sbjct  173   DPLVLCFVDFSTPSQAAVALDALQG  197



>ref|XP_009776008.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X4 
[Nicotiana sylvestris]
Length=203

 Score =   231 bits (590),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF +P HAA AMDALQG
Sbjct  177   LILCFVDFVTPLHAAAAMDALQG  199



>ref|XP_009361324.1| PREDICTED: uncharacterized protein LOC103951620 [Pyrus x bretschneideri]
Length=233

 Score =   232 bits (592),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ  PP +A+ S++ KRPRS+YD     DL  YY  +D RG + R IRD
Sbjct  1     MADAYWRYSDGRQ--PPPSAMNSVVGKRPRSDYDTQGGQDLPNYYPHEDDRGSM-RGIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL++A++S+Y GG+SAR ++GG  G   EDP ++GIGG DP       + 
Sbjct  58    TDSINASYDRYLRNAQMSSYSGGQSARNMSGGPPGRAVEDPHMMGIGGVDPGAPAKDRVL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+G GR +  LPP A+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR P GDP
Sbjct  118   GMGSGRPDAPLPPGATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRHPGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  178   LVLCFVDFVSPAHAATAMDALQG  200



>ref|XP_010109223.1| hypothetical protein L484_011845 [Morus notabilis]
 gb|EXC21403.1| hypothetical protein L484_011845 [Morus notabilis]
Length=239

 Score =   232 bits (592),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 148/209 (71%), Gaps = 9/209 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD+YWR+GD RQ P  A        KR RS+YD   SHDL  Y+ RDD RG + R  RD
Sbjct  1     MADSYWRYGDSRQPPSSAIPPIVG--KRSRSDYDGPGSHDLPSYFPRDDDRGAM-RGARD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ I ASYDRYL+S +VS+YG G+  RPL GGM G   +DPR++GIGG DP         
Sbjct  58    TESINASYDRYLRSTQVSSYGSGQPGRPLGGGMPGRTVDDPRLVGIGGIDPGTTVKDRPL  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREV------SHIFRPFVGYKEVRLVTKESR  3744
             G  GGR EV LPPDASSTL+VEGLPANCTRRE       + IFRPFVGYKEVRLV+KESR
Sbjct  118   GFSGGRPEVPLPPDASSTLFVEGLPANCTRREFVPSLVYTDIFRPFVGYKEVRLVSKESR  177

Query  3743  RPDGDPLVFCFVDFASPAHAATAMDALQG  3657
              P GDPLV CFVDF SPAHAATAMDALQG
Sbjct  178   HPGGDPLVLCFVDFLSPAHAATAMDALQG  206



>ref|XP_009776011.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X5 
[Nicotiana sylvestris]
Length=201

 Score =   230 bits (587),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 149/204 (73%), Gaps = 4/204 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGE  3654
             L+ CFVDF +P HAA AMDALQ E
Sbjct  177   LILCFVDFVTPLHAAAAMDALQEE  200



>ref|XP_009599059.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=220

 Score =   231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 156/221 (71%), Gaps = 5/221 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAAALPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+  ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRCGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLML-LIM*CHIKAH  3606
             L+ CFVDF +P HAA AMDALQG   F  + +++ C   +H
Sbjct  177   LILCFVDFVTPLHAAAAMDALQGLEDFARIGVLVICLCDSH  217



>ref|XP_009776019.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X6 
[Nicotiana sylvestris]
Length=200

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF +P HAA AMDALQ
Sbjct  177   LILCFVDFVTPLHAAAAMDALQ  198



>ref|XP_008790540.1| PREDICTED: uncharacterized protein LOC103707719 isoform X1 [Phoenix 
dactylifera]
Length=230

 Score =   231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGRGGVHRVI  4092
             MAD YWR+GD R Q   A A P    KRPR +Y   PA S +  GYY R++GR G HRVI
Sbjct  1     MADGYWRYGDARHQAQAAMAPPQPPMKRPRPDYGDVPAGS-EYVGYYPREEGRAG-HRVI  58

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ I ASYDRYL+  ++ +YGGGES RP+ GGM GHP +D R++G+GG D        
Sbjct  59    RDTESISASYDRYLRDGQIVSYGGGESLRPVAGGMGGHPVDDLRMMGVGGMD------GR  112

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P G
Sbjct  113   SVGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGG  172

Query  3731  DPLVFCFVDFASPAHAATAMDALQG  3657
             DPLV CFVDF++P+ AA A+DALQG
Sbjct  173   DPLVLCFVDFSTPSQAAVALDALQG  197



>ref|XP_009776002.1| PREDICTED: uncharacterized protein LOC104225820 isoform X3 [Nicotiana 
sylvestris]
Length=209

 Score =   229 bits (585),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF +P HAA AMDALQ
Sbjct  177   LILCFVDFVTPLHAAAAMDALQ  198



>ref|XP_009775991.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Nicotiana sylvestris]
Length=232

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAATLPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+S ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRSGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF +P HAA AMDALQG
Sbjct  177   LILCFVDFVTPLHAAAAMDALQG  199



>ref|XP_009599057.1| PREDICTED: uncharacterized protein LOC104094767 isoform X1 [Nicotiana 
tomentosiformis]
Length=237

 Score =   230 bits (586),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 152/217 (70%), Gaps = 4/217 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAAALPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+  ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRCGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLMLLIM*CHI  3615
             L+ CFVDF +P HAA AMDALQ      M+ I  C +
Sbjct  177   LILCFVDFVTPLHAAAAMDALQDISGCCMMGINICSV  213



>ref|XP_008790544.1| PREDICTED: uncharacterized protein LOC103707719 isoform X5 [Phoenix 
dactylifera]
Length=206

 Score =   228 bits (582),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 150/214 (70%), Gaps = 11/214 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGRGGVHRVI  4092
             MAD YWR+GD R Q   A A P    KRPR +Y   PA S +  GYY R++GR G HRVI
Sbjct  1     MADGYWRYGDARHQAQAAMAPPQPPMKRPRPDYGDVPAGS-EYVGYYPREEGRAG-HRVI  58

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ I ASYDRYL+   VS YGGGES RP+ GGM GHP +D R++G+GG D        
Sbjct  59    RDTESISASYDRYLRDGIVS-YGGGESLRPVAGGMGGHPVDDLRMMGVGGMD------GR  111

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P G
Sbjct  112   SVGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGG  171

Query  3731  DPLVFCFVDFASPAHAATAMDALQGEVTFLMLLI  3630
             DPLV CFVDF++P+ AA A+DALQ +     LL+
Sbjct  172   DPLVLCFVDFSTPSQAAVALDALQDKKGTCQLLL  205



>ref|XP_009599060.1| PREDICTED: uncharacterized protein LOC104094767 isoform X4 [Nicotiana 
tomentosiformis]
Length=209

 Score =   228 bits (581),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAAALPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+  ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRCGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF +P HAA AMDALQ
Sbjct  177   LILCFVDFVTPLHAAAAMDALQ  198



>ref|XP_009599058.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Nicotiana tomentosiformis]
Length=232

 Score =   228 bits (582),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 148/203 (73%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+    QQ            KRPR+EYD  +  +  GYY RDD RG + RVIRD
Sbjct  1     MADAYWRYTSGGQQAAALPPQLVA--KRPRTEYDVPSGPEFPGYYGRDDERG-MPRVIRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY+RYL+  ++S++   ESAR +  G++GHP EDPRV+GIGG DP+  K R +G
Sbjct  58    TDPIEASYERYLRCGQISSHVASESARSINSGISGHPIEDPRVMGIGGPDPLALKSRNVG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              VGG   E+ LPPDASSTL+VEGLPA+CTRREVSHIFRPFVGYKEVRLV K SR   GDP
Sbjct  118   MVGGR-PEISLPPDASSTLFVEGLPADCTRREVSHIFRPFVGYKEVRLVPKGSRHLGGDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF +P HAA AMDALQG
Sbjct  177   LILCFVDFVTPLHAAAAMDALQG  199



>ref|XP_011075937.1| PREDICTED: uncharacterized protein LOC105160314 isoform X2 [Sesamum 
indicum]
Length=226

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M DAYWR+GD RQQP     +     KRPRS+++  ++HD+  YYAR++ R G  R+IRD
Sbjct  1     MGDAYWRYGDGRQQPATLPQVA----KRPRSDFEMPSAHDVPSYYAREEDRAGP-RIIRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+S+ +S+YGG E+ R L+GG   H  +DPR + IGGSDP         
Sbjct  56    TESVNASYERYLRSS-ISSYGG-EAGRSLSGGH--HQVDDPRGIAIGGSDPAMPAKPRSI  111

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG   EV LPPDASSTL+VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR P GDP
Sbjct  112   GMGGR-PEVPLPPDASSTLFVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRHPGGDP  170

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  171   LVLCFVDFESPAHAATAMDALQG  193



>ref|XP_009601733.1| PREDICTED: uncharacterized protein LOC104096974 isoform X1 [Nicotiana 
tomentosiformis]
Length=260

 Score =   229 bits (584),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTF  3645
             LV CFVDF SPAHAATAMDALQGE++ 
Sbjct  176   LVLCFVDFVSPAHAATAMDALQGELSI  202



>ref|XP_009801972.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X3 
[Nicotiana sylvestris]
Length=202

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 5/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD ++  ++ GYY R+ G  G H  IRD
Sbjct  1     MADAYWRVSDGRIQPASLPPVAG---KRPRTEYDVSSRPEMPGYYGRN-GEQGTHHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY++YL+S + S+Y GGESAR +  G+  HP +DPRV+GI GS+   A      
Sbjct  57    TDPIEASYEQYLRSGQTSSYAGGESARSMGNGVTSHPIDDPRVMGIMGSE-AVAAKSRTI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R ++ LPP+AS+TL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV K+SR P G P
Sbjct  116   GMGGVRPQIPLPPNASNTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKDSRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             LV CFVDF SPAHAATAMDALQ
Sbjct  176   LVLCFVDFVSPAHAATAMDALQ  197



>ref|XP_009801966.1| PREDICTED: uncharacterized protein LOC104247612 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801967.1| PREDICTED: uncharacterized protein LOC104247612 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801969.1| PREDICTED: uncharacterized protein LOC104247612 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801970.1| PREDICTED: uncharacterized protein LOC104247612 isoform X1 [Nicotiana 
sylvestris]
Length=231

 Score =   227 bits (578),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 149/203 (73%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD ++  ++ GYY R+ G  G H  IRD
Sbjct  1     MADAYWRVSDGRIQPASLPPVAG---KRPRTEYDVSSRPEMPGYYGRN-GEQGTHHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI ASY++YL+S + S+Y GGESAR +  G+  HP +DPRV+GI GS+   A      
Sbjct  57    TDPIEASYEQYLRSGQTSSYAGGESARSMGNGVTSHPIDDPRVMGIMGSE-AVAAKSRTI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R ++ LPP+AS+TL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV K+SR P G P
Sbjct  116   GMGGVRPQIPLPPNASNTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKDSRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  176   LVLCFVDFVSPAHAATAMDALQG  198



>ref|XP_008790541.1| PREDICTED: uncharacterized protein LOC103707719 isoform X2 [Phoenix 
dactylifera]
Length=229

 Score =   227 bits (578),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 147/205 (72%), Gaps = 11/205 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGRGGVHRVI  4092
             MAD YWR+GD R Q   A A P    KRPR +Y   PA S +  GYY R++GR G HRVI
Sbjct  1     MADGYWRYGDARHQAQAAMAPPQPPMKRPRPDYGDVPAGS-EYVGYYPREEGRAG-HRVI  58

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ I ASYDRYL+   VS YGGGES RP+ GGM GHP +D R++G+GG D        
Sbjct  59    RDTESISASYDRYLRDGIVS-YGGGESLRPVAGGMGGHPVDDLRMMGVGGMD------GR  111

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P G
Sbjct  112   SVGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGG  171

Query  3731  DPLVFCFVDFASPAHAATAMDALQG  3657
             DPLV CFVDF++P+ AA A+DALQG
Sbjct  172   DPLVLCFVDFSTPSQAAVALDALQG  196



>ref|XP_009601734.1| PREDICTED: uncharacterized protein LOC104096974 isoform X2 [Nicotiana 
tomentosiformis]
Length=243

 Score =   226 bits (577),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 5/205 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQGEV  3651
             LV CFVDF SPAHAATAMDALQG V
Sbjct  176   LVLCFVDFVSPAHAATAMDALQGTV  200



>ref|XP_009601743.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X6 
[Nicotiana tomentosiformis]
Length=211

 Score =   225 bits (573),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQGEVT  3648
             LV CFVDF SPAHAATAMDALQG  T
Sbjct  176   LVLCFVDFVSPAHAATAMDALQGLAT  201



>ref|XP_010933806.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X3 
[Elaeis guineensis]
Length=198

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 144/204 (71%), Gaps = 8/204 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YWR+ D R Q P A A      KRPR++Y D     +  GYY R++GR G HRVIR
Sbjct  1     MADGYWRYSDARHQAPAAMAPTQPPVKRPRADYGDVPGGSEYGGYYPREEGRAG-HRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT+ I ASYDR+L+  ++ +YGGGES RP+  GM GHP +D R++G+GG D         
Sbjct  60    DTESISASYDRFLRDGQIISYGGGESLRPVASGMGGHPVDDLRMMGVGGMD------GRS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P GD
Sbjct  114   AGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGGD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF++ + AA A+DALQG
Sbjct  174   PLVLCFVDFSTSSQAAVALDALQG  197



>gb|KHF97932.1| RNA-binding with multiple splicing [Gossypium arboreum]
Length=200

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+D+YWR+ D RQ PP +        KRPRS+Y  +  H+L+GYY+RDD +    R  RD
Sbjct  1     MSDSYWRYTDPRQPPPSSIPPLVG--KRPRSDYVVSGGHELSGYYSRDDDKR-TMRATRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             +D IG SYDRY++S ++S+Y G +S RP++GGM G   +DPR++GIGG DP         
Sbjct  58    SDSIGESYDRYVRSTQLSSYSGSQSGRPMSGGMPGRAVDDPRMVGIGGLDPGQTIKDRTI  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G G GR E  LPPDASSTL+VEGLP +CTRREVSHIFRPFVGYKEVRLVTKE R   GDP
Sbjct  118   GFGSGRPEPPLPPDASSTLFVEGLPPDCTRREVSHIFRPFVGYKEVRLVTKEPRYAGGDP  177

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             +  CFVDF SP+HAAT+MDALQG
Sbjct  178   IKLCFVDFLSPSHAATSMDALQG  200



>ref|XP_004307948.1| PREDICTED: uncharacterized protein LOC101301247 [Fragaria vesca 
subsp. vesca]
Length=230

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 149/203 (73%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR+ D RQ PP          KRPR +YD  + HDL  YY  +D RG + R +RD
Sbjct  1     MADAYWRYSDGRQPPPSGMNSGMG--KRPRPDYDSHSGHDLPSYYPHEDDRGSL-RGMRD  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD I ASYDRYL+SA++S+Y GG+SAR ++GG+ G   +DPR++G+    PV  +   MG
Sbjct  58    TDSINASYDRYLRSAQMSSYSGGQSARNMSGGLPGRSVDDPRMMGMVEPGPVKERVLGMG  117

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G      EV LPP A+STL+VEGLPANCTRREV+HIFRPFVGYKEVRLV+KESR P G+P
Sbjct  118   GGR---PEVPLPPGATSTLFVEGLPANCTRREVAHIFRPFVGYKEVRLVSKESRHPGGEP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  175   LVLCFVDFMSPAHAATAMDALQG  197



>ref|XP_011043764.1| PREDICTED: uncharacterized protein LOC105139128, partial [Populus 
euphratica]
Length=225

 Score =   224 bits (570),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KRPR +YD  +  DL+ YY+RDD RG +H VIRD+D IGASYDRYL+S  VS+YGGG+SA
Sbjct  18    KRPRIDYDIPSGRDLSSYYSRDDDRGALH-VIRDSDSIGASYDRYLRSGTVSSYGGGQSA  76

Query  4007  RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPA  3828
             R ++G +  HP +D R++ +G  DP  +       +G GR+EV LPPDASSTL+VEGLP+
Sbjct  77    RAMSG-VPSHPVDDTRMVSMGPMDPGASVKDRSLRMGSGRSEVSLPPDASSTLFVEGLPS  135

Query  3827  NCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +CTRREVSHIFRPFV YKEVRLV+KESR P GDPLV CFVDF SPAHAATAMDALQG
Sbjct  136   DCTRREVSHIFRPFVCYKEVRLVSKESRHPGGDPLVLCFVDFLSPAHAATAMDALQG  192



>ref|XP_009601735.1| PREDICTED: uncharacterized protein LOC104096974 isoform X3 [Nicotiana 
tomentosiformis]
Length=238

 Score =   224 bits (571),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 147/208 (71%), Gaps = 5/208 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFL  3642
             LV CFVDF SPAHAATAMDALQ  +  L
Sbjct  176   LVLCFVDFVSPAHAATAMDALQEMIALL  203



>ref|XP_006577823.1| PREDICTED: uncharacterized protein LOC100800440 isoform X1 [Glycine 
max]
Length=276

 Score =   225 bits (574),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 148/204 (73%), Gaps = 6/204 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+    +Q P + A      KR RS+YD +  HDL GY+  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYAAESRQAPSSIAG-----KRSRSDYDVSGVHDLPGYFPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R ++G +     +D  V  IGG D        M 
Sbjct  55    TESLDASYERYLRSAQVSSYGSGQSTRTISGRIPNRAIDDSHVANIGGIDRGTNAKDKML  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GRT+  LPPDA+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRTDHSLPPDATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQGE  3654
             LV CFVDF SPAHAATAM+ALQG 
Sbjct  175   LVLCFVDFLSPAHAATAMEALQGN  198



>ref|XP_002321981.1| hypothetical protein POPTR_0015s01130g [Populus trichocarpa]
 gb|EEF06108.1| hypothetical protein POPTR_0015s01130g [Populus trichocarpa]
Length=220

 Score =   223 bits (568),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 146/204 (72%), Gaps = 18/204 (9%)
 Frame = -2

Query  4265  MADAYWRF-GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD+YWR+ GD RQ               P+   D  +  DL+ YY+RDD RG + RVIR
Sbjct  1     MADSYWRYAGDSRQ---------------PQPHLDVPSGRDLSSYYSRDDDRGAL-RVIR  44

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             D+D IGASYDRYL S  +S+YGGG+SAR ++G +   P +D R++ +G  DP  +     
Sbjct  45    DSDSIGASYDRYLHSGTISSYGGGQSARAISG-VPVRPVDDLRMVSMGSMDPGSSVKDRS  103

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
                G GR+EV LPPDASSTL+VEGLP++CTRREVSHIFRPFVGYKEVRLV+KESR P GD
Sbjct  104   MRTGSGRSEVSLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGD  163

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF SPAHAAT+MDALQG
Sbjct  164   PLVLCFVDFLSPAHAATSMDALQG  187



>ref|XP_009601744.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X7 
[Nicotiana tomentosiformis]
Length=199

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             LV CFVDF SPAHAATAMDALQ
Sbjct  176   LVLCFVDFVSPAHAATAMDALQ  197



>ref|XP_006577824.1| PREDICTED: uncharacterized protein LOC100800440 isoform X2 [Glycine 
max]
 gb|KHN19519.1| RNA-binding protein with multiple splicing 2 [Glycine soja]
Length=230

 Score =   223 bits (567),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 148/203 (73%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+    +Q P + A      KR RS+YD +  HDL GY+  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYAAESRQAPSSIAG-----KRSRSDYDVSGVHDLPGYFPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R ++G +     +D  V  IGG D        M 
Sbjct  55    TESLDASYERYLRSAQVSSYGSGQSTRTISGRIPNRAIDDSHVANIGGIDRGTNAKDKML  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GRT+  LPPDA+STL+VEGLP NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRTDHSLPPDATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAM+ALQG
Sbjct  175   LVLCFVDFLSPAHAATAMEALQG  197



>ref|XP_010933805.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X2 
[Elaeis guineensis]
Length=206

 Score =   222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 143/203 (70%), Gaps = 8/203 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YWR+ D R Q P A A      KRPR++Y D     +  GYY R++GR G HRVIR
Sbjct  1     MADGYWRYSDARHQAPAAMAPTQPPVKRPRADYGDVPGGSEYGGYYPREEGRAG-HRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT+ I ASYDR+L+  ++ +YGGGES RP+  GM GHP +D R++G+GG D         
Sbjct  60    DTESISASYDRFLRDGQIISYGGGESLRPVASGMGGHPVDDLRMMGVGGMD------GRS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P GD
Sbjct  114   AGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGGD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQ  3660
             PLV CFVDF++ + AA A+DALQ
Sbjct  174   PLVLCFVDFSTSSQAAVALDALQ  196



>ref|XP_009601737.1| PREDICTED: uncharacterized protein LOC104096974 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009601738.1| PREDICTED: uncharacterized protein LOC104096974 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009601739.1| PREDICTED: uncharacterized protein LOC104096974 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009601740.1| PREDICTED: uncharacterized protein LOC104096974 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009601741.1| PREDICTED: uncharacterized protein LOC104096974 isoform X4 [Nicotiana 
tomentosiformis]
Length=231

 Score =   223 bits (567),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 146/203 (72%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAMDALQG
Sbjct  176   LVLCFVDFVSPAHAATAMDALQG  198



>ref|XP_009601742.1| PREDICTED: uncharacterized protein LOC104096974 isoform X5 [Nicotiana 
tomentosiformis]
Length=218

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R QP     +     KRPR+EYD  +  ++ GYY R+D +G  H  IRD
Sbjct  1     MADAYWRVTDGRIQPASLPPVAG---KRPRTEYDIPSRPEMPGYYGRNDEQG-THHAIRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              DPI ASY++YL+S ++S++ G ESAR +  G+  HP +DPR +GI G++          
Sbjct  57    MDPIEASYEQYLRSGQISSFAGSESARSMGNGVTSHPIDDPRAMGIVGAE-AVVAKSRAI  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+GG R E+ LPP+ASSTL+VEGLPANCTRRE+SHIFRPFVGY+EVRLV KESR P G P
Sbjct  116   GMGGVRPEIPLPPNASSTLFVEGLPANCTRREMSHIFRPFVGYREVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             LV CFVDF SPAHAATAMDALQ
Sbjct  176   LVLCFVDFVSPAHAATAMDALQ  197



>ref|XP_003602288.1| RNA-binding protein with multiple splicing [Medicago truncatula]
 gb|AES72539.1| RNA-binding protein with multiple splicing protein [Medicago 
truncatula]
Length=243

 Score =   221 bits (563),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 153/213 (72%), Gaps = 7/213 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ + +Q  PP         KRPR+EYD +  H+LA Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAESQQHAPPTIPG-----KRPRTEYDVSGVHNLANYFPHDDDRGRL-QVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL++A +S++G G+S R + GG+  H  +D  V  +GG D        + 
Sbjct  55    TESLDASYERYLRNA-ISSHGSGQSTRTIDGGVPSHSIDDSHVTSMGGVDRRTNVKDQIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              + GGR +  LPP A++TL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  114   ELSGGRPDHSLPPGATNTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQGEVTFLMLLIM  3627
             L+ CFVDF SPAHAATAMDAL G ++F  +L+M
Sbjct  174   LLLCFVDFVSPAHAATAMDALHGNISFSFILVM  206



>ref|XP_010252587.1| PREDICTED: uncharacterized protein LOC104594116 isoform X2 [Nelumbo 
nucifera]
Length=199

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 143/203 (70%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D YWR+GD RQQ            KR RS+YD     D  GYY RDD RG  HRV+RD
Sbjct  1     MGDGYWRYGDGRQQSAMLPLASG---KRSRSDYDVPGGLDFPGYYPRDDERG-THRVVRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ I ASY+RYL+S ++S+Y  GES R + G ++  P +D R+LG+G  D   A      
Sbjct  57    TESIEASYERYLRSTQLSSYESGESGRSM-GAISSRPVDDQRILGVGSMDSTVAGKGRNM  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G GGGR E+ LPPDAS+TL+VEGLPANCTRREVSHIFRPFVGY+EVRLV KES+ P G+P
Sbjct  116   GFGGGRPEMPLPPDASNTLFVEGLPANCTRREVSHIFRPFVGYREVRLVNKESKHPGGEP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDFA+P+ AA A+DALQG
Sbjct  176   LILCFVDFATPSQAAIALDALQG  198



>ref|XP_010252574.1| PREDICTED: uncharacterized protein LOC104594116 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010252580.1| PREDICTED: uncharacterized protein LOC104594116 isoform X1 [Nelumbo 
nucifera]
Length=231

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 143/203 (70%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D YWR+GD RQQ            KR RS+YD     D  GYY RDD RG  HRV+RD
Sbjct  1     MGDGYWRYGDGRQQSAMLPLASG---KRSRSDYDVPGGLDFPGYYPRDDERG-THRVVRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ I ASY+RYL+S ++S+Y  GES R + G ++  P +D R+LG+G  D   A      
Sbjct  57    TESIEASYERYLRSTQLSSYESGESGRSM-GAISSRPVDDQRILGVGSMDSTVAGKGRNM  115

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G GGGR E+ LPPDAS+TL+VEGLPANCTRREVSHIFRPFVGY+EVRLV KES+ P G+P
Sbjct  116   GFGGGRPEMPLPPDASNTLFVEGLPANCTRREVSHIFRPFVGYREVRLVNKESKHPGGEP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDFA+P+ AA A+DALQG
Sbjct  176   LILCFVDFATPSQAAIALDALQG  198



>ref|NP_001242627.1| uncharacterized protein LOC100800440 [Glycine max]
 gb|ACU22853.1| unknown [Glycine max]
Length=230

 Score =   219 bits (558),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 147/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+    +Q P + A      KR RS+YD +  HDL GY+  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYAAESRQAPSSIAG-----KRSRSDYDVSGVHDLPGYFPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R ++G +     +D  V  IGG D        M 
Sbjct  55    TESLDASYERYLRSAQVSSYGSGQSTRTISGRIPNRAIDDSHVANIGGIDRGTNAKDKML  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GRT+  LPPDA+STL+VEGLP NCTRREV+HIF PFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRTDHSLPPDATSTLFVEGLPPNCTRREVAHIFPPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAM+ALQG
Sbjct  175   LVLCFVDFLSPAHAATAMEALQG  197



>ref|XP_010933804.1| PREDICTED: uncharacterized protein LOC105054094 isoform X1 [Elaeis 
guineensis]
Length=229

 Score =   219 bits (557),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 143/204 (70%), Gaps = 9/204 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YWR+ D R Q P A A      KRPR++Y D     +  GYY R++GR G HRVIR
Sbjct  1     MADGYWRYSDARHQAPAAMAPTQPPVKRPRADYGDVPGGSEYGGYYPREEGRAG-HRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT+ I ASYDR+L+   +S YGGGES RP+  GM GHP +D R++G+GG D         
Sbjct  60    DTESISASYDRFLRDGIIS-YGGGESLRPVASGMGGHPVDDLRMMGVGGMD------GRS  112

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR E  LPPDAS TL+VEGLPANCTRREVSHIFRPF G++EVRLV KESR P GD
Sbjct  113   AGYGSGRPETPLPPDASCTLFVEGLPANCTRREVSHIFRPFAGFREVRLVNKESRHPGGD  172

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF++ + AA A+DALQG
Sbjct  173   PLVLCFVDFSTSSQAAVALDALQG  196



>ref|NP_001241926.1| uncharacterized protein LOC100786188 [Glycine max]
 gb|ACU20480.1| unknown [Glycine max]
Length=230

 Score =   218 bits (556),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+    +Q P + A      KR RS+YD +  HDL  Y+  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYAAESRQAPSSIAG-----KRSRSDYDVSGVHDLPSYFPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R + G +     +D  V  IGG D        M 
Sbjct  55    TESLDASYERYLRSAQVSSYGSGQSTRTIDGRIPNRAIDDSHVANIGGVDRGTNAKDKMP  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GR +  LPPDA+STL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRADHSLPPDATSTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATAM+ALQG
Sbjct  175   LVLCFVDFMSPAHAATAMEALQG  197



>ref|XP_011044690.1| PREDICTED: uncharacterized protein LOC105139784 isoform X1 [Populus 
euphratica]
Length=217

 Score =   218 bits (554),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KRPRS+YD  +  DL+ YY+RDD RG + RVIRD+D IGASYDRYL S  +S+Y GG+SA
Sbjct  7     KRPRSDYDVPSGRDLSSYYSRDDDRGAL-RVIRDSDSIGASYDRYLHSGTISSYSGGQSA  65

Query  4007  RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPA  3828
             R ++G +   P +D R++ +G  D   +        G GR+E+ LPPDASSTL+VEGLP+
Sbjct  66    RAVSG-VPVRPVDDMRMVSMGSMDSGSSVKDRSMRTGSGRSEISLPPDASSTLFVEGLPS  124

Query  3827  NCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQGEVT  3648
             +CTRREVSHIFRPFVGYKEVRLV+KESR P GDPLV CFVDF SPAHAAT+MDALQGE+ 
Sbjct  125   DCTRREVSHIFRPFVGYKEVRLVSKESRHPGGDPLVLCFVDFLSPAHAATSMDALQGELN  184

Query  3647  FLML  3636
              L +
Sbjct  185   MLCI  188



>ref|XP_006360157.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X3 [Solanum tuberosum]
Length=206

 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -2

Query  4265  MADAYWRF---GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRV  4095
             MADAYWR+   G  +  P   A++   +AKRPRSEYD  +  +  GYY RD  RG + RV
Sbjct  1     MADAYWRYTSGGQQQAAPAAPASLAPFVAKRPRSEYDAPSGPEYPGYYGRDAERG-MPRV  59

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgr  3915
              RD DPI ASY+RYL+S ++S++   ES+R +  G++GHP +DPRV+GIGGSD   A   
Sbjct  60    GRDADPIEASYERYLRSGQISSHVASESSRSMHSGISGHPIDDPRVMGIGGSD-QLAFKS  118

Query  3914  amggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPD  3735
                G+ GGR E  LPPDASSTL+VEGLPA+CTRREVSH+FRPF+GYKEVRLV K SR   
Sbjct  119   RNVGMVGGRPEATLPPDASSTLFVEGLPADCTRREVSHLFRPFLGYKEVRLVPKGSRHAG  178

Query  3734  GDPLVFCFVDFASPAHAATAMDALQG  3657
             GDPL+ CFVDF SP HAATAMDALQG
Sbjct  179   GDPLILCFVDFVSPLHAATAMDALQG  204



>ref|XP_006360156.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Solanum tuberosum]
Length=211

 Score =   216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 152/212 (72%), Gaps = 5/212 (2%)
 Frame = -2

Query  4265  MADAYWRF---GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRV  4095
             MADAYWR+   G  +  P   A++   +AKRPRSEYD  +  +  GYY RD  RG + RV
Sbjct  1     MADAYWRYTSGGQQQAAPAAPASLAPFVAKRPRSEYDAPSGPEYPGYYGRDAERG-MPRV  59

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgr  3915
              RD DPI ASY+RYL+S ++S++   ES+R +  G++GHP +DPRV+GIGGSD   A   
Sbjct  60    GRDADPIEASYERYLRSGQISSHVASESSRSMHSGISGHPIDDPRVMGIGGSD-QLAFKS  118

Query  3914  amggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPD  3735
                G+ GGR E  LPPDASSTL+VEGLPA+CTRREVSH+FRPF+GYKEVRLV K SR   
Sbjct  119   RNVGMVGGRPEATLPPDASSTLFVEGLPADCTRREVSHLFRPFLGYKEVRLVPKGSRHAG  178

Query  3734  GDPLVFCFVDFASPAHAATAMDALQGEVTFLM  3639
             GDPL+ CFVDF SP HAATAMDALQ  + + +
Sbjct  179   GDPLILCFVDFVSPLHAATAMDALQEPIQYAL  210



>ref|XP_006360155.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Solanum tuberosum]
Length=237

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -2

Query  4265  MADAYWRF---GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRV  4095
             MADAYWR+   G  +  P   A++   +AKRPRSEYD  +  +  GYY RD  RG + RV
Sbjct  1     MADAYWRYTSGGQQQAAPAAPASLAPFVAKRPRSEYDAPSGPEYPGYYGRDAERG-MPRV  59

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgr  3915
              RD DPI ASY+RYL+S ++S++   ES+R +  G++GHP +DPRV+GIGGSD   A   
Sbjct  60    GRDADPIEASYERYLRSGQISSHVASESSRSMHSGISGHPIDDPRVMGIGGSD-QLAFKS  118

Query  3914  amggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPD  3735
                G+ GGR E  LPPDASSTL+VEGLPA+CTRREVSH+FRPF+GYKEVRLV K SR   
Sbjct  119   RNVGMVGGRPEATLPPDASSTLFVEGLPADCTRREVSHLFRPFLGYKEVRLVPKGSRHAG  178

Query  3734  GDPLVFCFVDFASPAHAATAMDALQG  3657
             GDPL+ CFVDF SP HAATAMDALQG
Sbjct  179   GDPLILCFVDFVSPLHAATAMDALQG  204



>gb|AFK41044.1| unknown [Lotus japonicus]
Length=232

 Score =   215 bits (548),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 144/203 (71%), Gaps = 6/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+              ++ AKR RS+YD +  HD+ GYY  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYA-----AESRHNPSAIAAKRARSDYDVSGVHDMPGYYPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS++G G+S R + G +  H  +D  V  IGG D   +    + 
Sbjct  55    TESLDASYERYLRSAQVSSFGEGQSTRTIRGRLPSHSFDDSHVTSIGGVDRGPSAKEKIL  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GR +  LPPDA+STL+VEGLP NC RREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRPDHSLPPDATSTLFVEGLPTNCPRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SPAHAATA DALQG
Sbjct  175   LVLCFVDFESPAHAATAKDALQG  197



>ref|XP_004240963.1| PREDICTED: U1 small nuclear ribonucleoprotein A [Solanum lycopersicum]
Length=238

 Score =   215 bits (547),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 153/207 (74%), Gaps = 6/207 (3%)
 Frame = -2

Query  4265  MADAYWRF---GDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRV  4095
             MADAYWR+   G  +  P  +AA+   +AKRPRSEYD  +  +  GYY RD  RG + RV
Sbjct  1     MADAYWRYTSGGQQQAAPAASAALAPFVAKRPRSEYDAPSGPEYPGYYGRDAERG-MPRV  59

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHP-TEDPRVLGIGGSDPvgakg  3918
              RD DPI ASY+RYL+S ++S++   ESAR L  G++GHP  +DPRV+GIGGSDP+  K 
Sbjct  60    GRDADPIEASYERYLRSGQISSHVASESARSLHSGISGHPPIDDPRVMGIGGSDPLAFKS  119

Query  3917  ramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRP  3738
             R +G V G   E  LPPDASSTL+VEGLPA+CTRREVSH+FRPF+GYKEVRLV K SR  
Sbjct  120   RNVGMVAGR-PEATLPPDASSTLFVEGLPADCTRREVSHLFRPFLGYKEVRLVPKGSRHA  178

Query  3737  DGDPLVFCFVDFASPAHAATAMDALQG  3657
              GDPL+ CFVDF SP HAATAMDALQG
Sbjct  179   GGDPLILCFVDFVSPLHAATAMDALQG  205



>ref|XP_011044691.1| PREDICTED: protein WHI3-like isoform X2 [Populus euphratica]
Length=214

 Score =   211 bits (537),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KRPRS+YD  +  DL+ YY+RDD RG + RVIRD+D IGASYDRYL S  +S+Y GG+SA
Sbjct  7     KRPRSDYDVPSGRDLSSYYSRDDDRGAL-RVIRDSDSIGASYDRYLHSGTISSYSGGQSA  65

Query  4007  RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPA  3828
             R ++G +   P +D R++ +G  D   +        G GR+E+ LPPDASSTL+VEGLP+
Sbjct  66    RAVSG-VPVRPVDDMRMVSMGSMDSGSSVKDRSMRTGSGRSEISLPPDASSTLFVEGLPS  124

Query  3827  NCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +CTRREVSHIFRPFVGYKEVRLV+KESR P GDPLV CFVDF SPAHAAT+MDALQG
Sbjct  125   DCTRREVSHIFRPFVGYKEVRLVSKESRHPGGDPLVLCFVDFLSPAHAATSMDALQG  181



>ref|XP_006851878.1| hypothetical protein AMTR_s00041p00116460 [Amborella trichopoda]
 gb|ERN13345.1| hypothetical protein AMTR_s00041p00116460 [Amborella trichopoda]
Length=249

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 151/218 (69%), Gaps = 24/218 (11%)
 Frame = -2

Query  4253  YWRFGDVRQQpppaaaipsllAKRPRSEYDP---ANSHDL--------AGYYARDDGRGG  4107
             +WRFGD RQQ   A A+P+   KR R+E+D       HDL        +GY  R++ RG 
Sbjct  4     FWRFGDGRQQAMMAPAMPT---KRSRTEFDAMPTVTRHDLGMPGGLEMSGYMQREEDRG-  59

Query  4106  VHRVIRDTDPIGASYDRYLQSAKVSAYGGGES--------ARPLTGGMAGHPTEDPRVLG  3951
               RVIRDT+ +GASYDRYL+S +++++G GE          RP+TGGM G P EDP ++G
Sbjct  60    -TRVIRDTESLGASYDRYLRSGQITSFGAGEPGNLGGGGMTRPVTGGMPGLPVEDPVMMG  118

Query  3950  IGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKE  3771
             +   DP           GGGR E+ LPPDAS+TL+VEGLP+NCTRREV+HIFRPFVG+KE
Sbjct  119   VPNMDPSLGAKGRSMPFGGGRPEMMLPPDASNTLFVEGLPSNCTRREVAHIFRPFVGFKE  178

Query  3770  VRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VRLV KESR+P GDPLV CFVDF SPA+AATA+DALQG
Sbjct  179   VRLVNKESRQPGGDPLVLCFVDFTSPAYAATALDALQG  216



>gb|AES72538.2| RNA-binding protein with multiple splicing protein [Medicago 
truncatula]
Length=228

 Score =   209 bits (533),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 146/203 (72%), Gaps = 7/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ + +Q  PP         KRPR+EYD +  H+LA Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAESQQHAPPTIPG-----KRPRTEYDVSGVHNLANYFPHDDDRGRL-QVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL++A +S++G G+S R + GG+  H  +D  V  +GG D        + 
Sbjct  55    TESLDASYERYLRNA-ISSHGSGQSTRTIDGGVPSHSIDDSHVTSMGGVDRRTNVKDQIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              + GGR +  LPP A++TL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  114   ELSGGRPDHSLPPGATNTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDAL G
Sbjct  174   LLLCFVDFVSPAHAATAMDALHG  196



>gb|AFK40378.1| unknown [Medicago truncatula]
Length=228

 Score =   209 bits (532),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 146/203 (72%), Gaps = 7/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ + +Q  PP         KRPR+EYD +  H+LA Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAESQQHAPPTIPG-----KRPRTEYDVSGVHNLANYFPHDDDRGRL-QVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL++A +S++G G+S R + GG+  H  +D  V  +GG D        + 
Sbjct  55    TESLDASYERYLRNA-ISSHGSGQSTRTIDGGVPSHSIDDSHVTSMGGVDRRTNVKGQIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              + GGR +  LPP A++TL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  114   ELSGGRPDHSLPPGATNTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDAL G
Sbjct  174   LLLCFVDFVSPAHAATAMDALHG  196



>ref|XP_010919314.1| PREDICTED: protein MATERNALLY EXPRESSED GENE 5-like isoform X5 
[Elaeis guineensis]
Length=202

 Score =   207 bits (528),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 142/204 (70%), Gaps = 8/204 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW+ GD  +Q   A A   +  KRPRS++ D +   +  GY+ R++GR G +RVIR
Sbjct  1     MADGYWKHGDALRQASAAQASLQVSMKRPRSDHGDVSGGLEYVGYHPREEGRMG-YRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I A+Y+RYL+  ++ +Y  GES RP+ GGM  HP +D  ++G+G  D         
Sbjct  60    DTKSIDAAYERYLRDRQIVSYSSGESLRPVAGGMGSHPVDDMHMMGVGVMD------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR+E+ LPPDASSTLYVEGLPANCTRREVSHIFRPF G++E+RLV K+SR P  D
Sbjct  114   VGYGTGRSEIPLPPDASSTLYVEGLPANCTRREVSHIFRPFAGFREIRLVNKDSRFPGAD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             P V CFVDF++P+ AA A+DALQG
Sbjct  174   PFVLCFVDFSNPSQAAVALDALQG  197



>ref|XP_010919312.1| PREDICTED: uncharacterized protein LOC105043458 isoform X3 [Elaeis 
guineensis]
Length=223

 Score =   208 bits (530),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 146/210 (70%), Gaps = 9/210 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW+ GD  +Q   A A   +  KRPRS++ D +   +  GY+ R++GR G +RVIR
Sbjct  1     MADGYWKHGDALRQASAAQASLQVSMKRPRSDHGDVSGGLEYVGYHPREEGRMG-YRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I A+Y+RYL+  ++ +Y  GES RP+ GGM  HP +D  ++G+G  D         
Sbjct  60    DTKSIDAAYERYLRDRQIVSYSSGESLRPVAGGMGSHPVDDMHMMGVGVMD------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR+E+ LPPDASSTLYVEGLPANCTRREVSHIFRPF G++E+RLV K+SR P  D
Sbjct  114   VGYGTGRSEIPLPPDASSTLYVEGLPANCTRREVSHIFRPFAGFREIRLVNKDSRFPGAD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQG-EVTFL  3642
             P V CFVDF++P+ AA A+DALQG ++ +L
Sbjct  174   PFVLCFVDFSNPSQAAVALDALQGWKINWL  203



>ref|XP_007136468.1| hypothetical protein PHAVU_009G047700g [Phaseolus vulgaris]
 gb|ESW08462.1| hypothetical protein PHAVU_009G047700g [Phaseolus vulgaris]
Length=229

 Score =   208 bits (530),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+D YWR+ + R       A  S+  KR RS+YD +  HDL  Y+  DD RGG HRVIRD
Sbjct  1     MSDGYWRYAESRH------APSSIAGKRSRSDYDVSGVHDLPNYFPHDDDRGG-HRVIRD  53

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              + + ASY+ YL+SA +S+YG G+S R + G +     +D  V  IGG D        + 
Sbjct  54    AESLDASYEHYLRSA-ISSYGSGQSNRTIGGRVPNRSIDDSHVANIGGVDRGTNAKDKIL  112

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G   GR +  LPPDA+STL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  113   GFSSGRADHSLPPDATSTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  172

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             LV CFVDF SP HAATAM+ALQG
Sbjct  173   LVLCFVDFLSPGHAATAMEALQG  195



>ref|XP_010919313.1| PREDICTED: uncharacterized protein LOC105043458 isoform X4 [Elaeis 
guineensis]
Length=210

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 142/204 (70%), Gaps = 8/204 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW+ GD  +Q   A A   +  KRPRS++ D +   +  GY+ R++GR G +RVIR
Sbjct  1     MADGYWKHGDALRQASAAQASLQVSMKRPRSDHGDVSGGLEYVGYHPREEGRMG-YRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I A+Y+RYL+  ++ +Y  GES RP+ GGM  HP +D  ++G+G  D         
Sbjct  60    DTKSIDAAYERYLRDRQIVSYSSGESLRPVAGGMGSHPVDDMHMMGVGVMD------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR+E+ LPPDASSTLYVEGLPANCTRREVSHIFRPF G++E+RLV K+SR P  D
Sbjct  114   VGYGTGRSEIPLPPDASSTLYVEGLPANCTRREVSHIFRPFAGFREIRLVNKDSRFPGAD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             P V CFVDF++P+ AA A+DALQG
Sbjct  174   PFVLCFVDFSNPSQAAVALDALQG  197



>ref|XP_008803056.1| PREDICTED: uncharacterized protein LOC103716719 isoform X1 [Phoenix 
dactylifera]
Length=245

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 151/222 (68%), Gaps = 17/222 (8%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YWR+ D R Q    AA  + L KR R +Y D     ++ GYY+RD+ R G HR IR
Sbjct  1     MADGYWRYSDPRHQAAAMAAPAAPL-KRARPDYADIPGGPEMLGYYSRDEERTG-HRAIR  58

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSD---------  3936
             DT+ I ASYDRYL++  VS++G GES R + GGM  HP +D R++G+GG D         
Sbjct  59    DTESIAASYDRYLRNG-VSSFGAGESVRTVAGGMTSHPVDDRRMMGVGGMDGRSVGYGGG  117

Query  3935  ----PvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEV  3768
                 P+G       G GGGR E  LP DAS+TL+VEGLPANCTRREVSHIFRPFVG++EV
Sbjct  118   RPEPPLGGMDGRSVGYGGGRPEPPLPQDASNTLFVEGLPANCTRREVSHIFRPFVGFREV  177

Query  3767  RLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQGEVTFL  3642
             RLV KESR P GDPLV CFVDF++PA AA A+DALQG + +L
Sbjct  178   RLVNKESRHPGGDPLVLCFVDFSTPAQAAVALDALQGNLIYL  219



>ref|XP_008806956.1| PREDICTED: uncharacterized protein LOC103719472 [Phoenix dactylifera]
Length=230

 Score =   207 bits (527),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 140/204 (69%), Gaps = 8/204 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD  WR+GD R Q     +   +  KRPRS++ D  +  +   YY R++G+ G  RVIR
Sbjct  1     MADGQWRYGDARHQVSAPLSPLQITVKRPRSDHGDVPSGLEYVDYYPREEGKVGC-RVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I ASY+RYL+  +  +YGGGES RP+ GGM  H  +D  ++G+GG D         
Sbjct  60    DTASINASYERYLRERRNVSYGGGESLRPVAGGMGSHSVDDMHMMGVGGID------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR E+ LPPDASSTL+VEGLPANCTRREVSHIFRPF G++E+RLV K SR P GD
Sbjct  114   DGYGSGRPEMPLPPDASSTLFVEGLPANCTRREVSHIFRPFAGFQEIRLVNKASRHPGGD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQG  3657
             PLV CFVDF++P+ AA A+DALQG
Sbjct  174   PLVLCFVDFSNPSQAAVALDALQG  197



>ref|XP_010919309.1| PREDICTED: uncharacterized protein LOC105043458 isoform X2 [Elaeis 
guineensis]
 ref|XP_010919310.1| PREDICTED: uncharacterized protein LOC105043458 isoform X2 [Elaeis 
guineensis]
 ref|XP_010919311.1| PREDICTED: uncharacterized protein LOC105043458 isoform X2 [Elaeis 
guineensis]
Length=230

 Score =   207 bits (527),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 145/211 (69%), Gaps = 9/211 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW+ GD  +Q   A A   +  KRPRS++ D +   +  GY+ R++GR G +RVIR
Sbjct  1     MADGYWKHGDALRQASAAQASLQVSMKRPRSDHGDVSGGLEYVGYHPREEGRMG-YRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I A+Y+RYL+  ++ +Y  GES RP+ GGM  HP +D  ++G+G  D         
Sbjct  60    DTKSIDAAYERYLRDRQIVSYSSGESLRPVAGGMGSHPVDDMHMMGVGVMD------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR+E+ LPPDASSTLYVEGLPANCTRREVSHIFRPF G++E+RLV K+SR P  D
Sbjct  114   VGYGTGRSEIPLPPDASSTLYVEGLPANCTRREVSHIFRPFAGFREIRLVNKDSRFPGAD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQGEVTFLML  3636
             P V CFVDF++P+ AA A+DALQG   F ML
Sbjct  174   PFVLCFVDFSNPSQAAVALDALQG-YKFDML  203



>ref|XP_010919308.1| PREDICTED: uncharacterized protein LOC105043458 isoform X1 [Elaeis 
guineensis]
Length=235

 Score =   206 bits (524),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW+ GD  +Q   A A   +  KRPRS++ D +   +  GY+ R++GR G +RVIR
Sbjct  1     MADGYWKHGDALRQASAAQASLQVSMKRPRSDHGDVSGGLEYVGYHPREEGRMG-YRVIR  59

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgram  3909
             DT  I A+Y+RYL+  ++ +Y  GES RP+ GGM  HP +D  ++G+G  D         
Sbjct  60    DTKSIDAAYERYLRDRQIVSYSSGESLRPVAGGMGSHPVDDMHMMGVGVMD------GQS  113

Query  3908  ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGD  3729
              G G GR+E+ LPPDASSTLYVEGLPANCTRREVSHIFRPF G++E+RLV K+SR P  D
Sbjct  114   VGYGTGRSEIPLPPDASSTLYVEGLPANCTRREVSHIFRPFAGFREIRLVNKDSRFPGAD  173

Query  3728  PLVFCFVDFASPAHAATAMDALQ  3660
             P V CFVDF++P+ AA A+DALQ
Sbjct  174   PFVLCFVDFSNPSQAAVALDALQ  196



>ref|XP_004146235.1| PREDICTED: uncharacterized protein LOC101218789 [Cucumis sativus]
 ref|XP_004171759.1| PREDICTED: uncharacterized protein LOC101224897 [Cucumis sativus]
 gb|KGN57648.1| hypothetical protein Csa_3G238140 [Cucumis sativus]
Length=232

 Score =   206 bits (523),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D +QQPP +        KRPR +YD +  H+L  YY R D R  V + I+ 
Sbjct  1     MSDAYWRYTDSQQQPPSSVPPVVG--KRPRVDYDTSGLHELPNYYPRQDDRP-VLQGIKS  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              D I  SY+RYL+++++S+YGG +SARP+ GG+ GHP  DP +LG+GG            
Sbjct  58    VDSINESYERYLRTSQISSYGG-QSARPVGGGVPGHPMNDPPILGLGGVVSGANVNDRST  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               GGGR  + LPPDAS+TL+VEGLP++CTRREV+HIFRPFVGYKEVRLV KESR    DP
Sbjct  117   SFGGGRPNMPLPPDASNTLFVEGLPSSCTRREVAHIFRPFVGYKEVRLVNKESRSAGRDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             +V  FVDF SPAHAATAMDALQG
Sbjct  177   VVLGFVDFVSPAHAATAMDALQG  199



>gb|KHN23341.1| Oligopeptide transporter 6 [Glycine soja]
Length=808

 Score =   220 bits (560),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+    +Q P + A      KR RS+YD +  HDL  Y+  DD RGG+ RVIRD
Sbjct  1     MSDAYWRYAAESRQAPSSIAG-----KRSRSDYDVSGVHDLPSYFPHDDDRGGL-RVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R + G +     +D  V  IGG D        M 
Sbjct  55    TESLDASYERYLRSAQVSSYGSGQSTRTIGGRIPNRAIDDSHVANIGGVDRGTNAKDKMP  114

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
             G+  GR +  LPPDA+STL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KESR+P GDP
Sbjct  115   GLSSGRADHSLPPDATSTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDP  174

Query  3725  LVFCFVDFASPAHAATAMDALQGE  3654
             LV CFVDF SPAHAATAM+ALQG 
Sbjct  175   LVLCFVDFMSPAHAATAMEALQGN  198



>gb|AEZ00900.1| putative RNA recognition motif-containing protein, partial [Elaeis 
guineensis]
Length=294

 Score =   207 bits (528),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 151/218 (69%), Gaps = 18/218 (8%)
 Frame = -2

Query  4268  KMADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVI  4092
             +MADAYWR+ D R Q    AA  + L KRPR++Y D     ++ GYY+RD+ R G HR I
Sbjct  34    RMADAYWRYSDPRHQAAAMAAPTAPL-KRPRADYADIPGGPEVLGYYSRDEERTG-HRTI  91

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSD--------  3936
             RDT+ I ASYDRYL++    ++G GES R + GGM GHP +D R++G+GG D        
Sbjct  92    RDTESIAASYDRYLRNG--VSFGAGESVRTVAGGMTGHPVDDRRMMGVGGMDGRTVGYGG  149

Query  3935  -----PvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKE  3771
                  P+G       G GGGR E  LP DAS+TL+VEGLPANCTRREVSHIFRPFVG++E
Sbjct  150   GRPEPPLGGMDGRSVGYGGGRPEPPLPQDASNTLFVEGLPANCTRREVSHIFRPFVGFRE  209

Query  3770  VRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VRLV KESR P GDPLV CFVDF++PA AA A+DALQG
Sbjct  210   VRLVNKESRHPGGDPLVLCFVDFSTPAQAAVALDALQG  247



>ref|XP_006350504.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350505.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform 
X2 [Solanum tuberosum]
Length=231

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 144/203 (71%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R  P     +PS   KRPR+E D  +  ++ G ++ +D +G +H  IR+
Sbjct  1     MADAYWRVTDGRIHPVSLPPVPS---KRPRTENDVPSGPEMPGSHSHNDVQG-MHHAIRE  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI  SY++YL+S + S+Y GG+SAR ++ G+  H  + PRV+G  GS+PV A+ R + 
Sbjct  57    TDPIETSYEQYLRSGQNSSYAGGDSARSMSNGVGSHSIDGPRVMGTVGSEPVAARNRTIE  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               G    EV LPP+ASSTL+VEGLPANCTRREVSHIFRPFVG+KEVRLV KESR P G P
Sbjct  117   FGGVR-PEVPLPPEASSTLFVEGLPANCTRREVSHIFRPFVGFKEVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
              V CFVDF SP HAATAMD LQG
Sbjct  176   FVLCFVDFMSPPHAATAMDTLQG  198



>ref|XP_008803057.1| PREDICTED: uncharacterized protein LOC103716719 isoform X2 [Phoenix 
dactylifera]
Length=219

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 149/219 (68%), Gaps = 17/219 (8%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YWR+ D R Q    AA  + L KR R +Y D     ++ GYY+RD+ R G HR IR
Sbjct  1     MADGYWRYSDPRHQAAAMAAPAAPL-KRARPDYADIPGGPEMLGYYSRDEERTG-HRAIR  58

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSD---------  3936
             DT+ I ASYDRYL++  VS++G GES R + GGM  HP +D R++G+GG D         
Sbjct  59    DTESIAASYDRYLRNG-VSSFGAGESVRTVAGGMTSHPVDDRRMMGVGGMDGRSVGYGGG  117

Query  3935  ----PvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEV  3768
                 P+G       G GGGR E  LP DAS+TL+VEGLPANCTRREVSHIFRPFVG++EV
Sbjct  118   RPEPPLGGMDGRSVGYGGGRPEPPLPQDASNTLFVEGLPANCTRREVSHIFRPFVGFREV  177

Query  3767  RLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQGEV  3651
             RLV KESR P GDPLV CFVDF++PA AA A+DALQG +
Sbjct  178   RLVNKESRHPGGDPLVLCFVDFSTPAQAAVALDALQGNM  216



>ref|XP_008455998.1| PREDICTED: uncharacterized protein LOC103496055 isoform X4 [Cucumis 
melo]
Length=213

 Score =   203 bits (516),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 140/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D +QQPP +        KRPR +YD    H+L  YY R D R  V + I+ 
Sbjct  1     MSDAYWRYTDSQQQPPSSVPPVVG--KRPRVDYDTTGLHELPNYYPRQDDRP-VLQGIKS  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              D I  SY+RYL+++++S+YGG +SARP+ GG+ GH   DP +LGIGG            
Sbjct  58    VDSINESYERYLRTSQISSYGG-QSARPVGGGVPGHLMNDPPILGIGGVVSGANVNDRST  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               GGGR  + LPPDAS+TL+VEGLP++CTRREV+HIFRPFVGYKEVRLV KESR    DP
Sbjct  117   SFGGGRPNIPLPPDASNTLFVEGLPSSCTRREVAHIFRPFVGYKEVRLVNKESRSAGRDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             +V  FVDF SPAHAATAMDALQ
Sbjct  177   VVLGFVDFVSPAHAATAMDALQ  198



>ref|XP_009801971.1| PREDICTED: uncharacterized protein LOC104247612 isoform X2 [Nicotiana 
sylvestris]
Length=227

 Score =   203 bits (517),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = -2

Query  4148  DLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTE  3969
             ++ GYY R+ G  G H  IRDTDPI ASY++YL+S + S+Y GGESAR +  G+  HP +
Sbjct  33    EMPGYYGRN-GEQGTHHAIRDTDPIEASYEQYLRSGQTSSYAGGESARSMGNGVTSHPID  91

Query  3968  DPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             DPRV+GI GS+   A      G+GG R ++ LPP+AS+TL+VEGLPANCTRRE+SHIFRP
Sbjct  92    DPRVMGIMGSE-AVAAKSRTIGMGGVRPQIPLPPNASNTLFVEGLPANCTRREMSHIFRP  150

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FVGY+EVRLV K+SR P G PLV CFVDF SPAHAATAMDALQG
Sbjct  151   FVGYREVRLVIKDSRHPGGHPLVLCFVDFVSPAHAATAMDALQG  194



>ref|XP_008455996.1| PREDICTED: uncharacterized protein LOC103496055 isoform X2 [Cucumis 
melo]
Length=232

 Score =   203 bits (517),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 141/203 (69%), Gaps = 4/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D +QQPP +        KRPR +YD    H+L  YY R D R  V + I+ 
Sbjct  1     MSDAYWRYTDSQQQPPSSVPPVVG--KRPRVDYDTTGLHELPNYYPRQDDRP-VLQGIKS  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              D I  SY+RYL+++++S+YGG +SARP+ GG+ GH   DP +LGIGG            
Sbjct  58    VDSINESYERYLRTSQISSYGG-QSARPVGGGVPGHLMNDPPILGIGGVVSGANVNDRST  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               GGGR  + LPPDAS+TL+VEGLP++CTRREV+HIFRPFVGYKEVRLV KESR    DP
Sbjct  117   SFGGGRPNIPLPPDASNTLFVEGLPSSCTRREVAHIFRPFVGYKEVRLVNKESRSAGRDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             +V  FVDF SPAHAATAMDALQG
Sbjct  177   VVLGFVDFVSPAHAATAMDALQG  199



>ref|XP_004502691.1| PREDICTED: uncharacterized protein LOC101494600 isoform X1 [Cicer 
arietinum]
 ref|XP_004502692.1| PREDICTED: uncharacterized protein LOC101494600 isoform X2 [Cicer 
arietinum]
Length=229

 Score =   203 bits (516),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 7/203 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ +      P  A  S+  KR RS++D +  H+L  Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAE------PHPAPSSIAGKRSRSDFDVSGVHNLPSYFPPDDDRGRL-QVIRD  53

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R + G +  H  +D  V  IGG D        + 
Sbjct  54    TESLDASYERYLRSAQVSSYGPGQSTRTIDGRVPSHSIDDSHVANIGGVDRRTDAKDRIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              +   R+E  LPP A++TL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KE R+P GDP
Sbjct  114   ELSSRRSEHSLPPGATNTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKEPRQPGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
             L+ CFVDF SPAHAATAMDAL G
Sbjct  174   LLLCFVDFLSPAHAATAMDALHG  196



>ref|XP_004502693.1| PREDICTED: uncharacterized protein LOC101494600 isoform X3 [Cicer 
arietinum]
Length=207

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 141/202 (70%), Gaps = 7/202 (3%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ +      P  A  S+  KR RS++D +  H+L  Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAE------PHPAPSSIAGKRSRSDFDVSGVHNLPSYFPPDDDRGRL-QVIRD  53

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL+SA+VS+YG G+S R + G +  H  +D  V  IGG D        + 
Sbjct  54    TESLDASYERYLRSAQVSSYGPGQSTRTIDGRVPSHSIDDSHVANIGGVDRRTDAKDRIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              +   R+E  LPP A++TL+VEGLP+NCTRREV+HIFRPFVGYKEVRLV+KE R+P GDP
Sbjct  114   ELSSRRSEHSLPPGATNTLFVEGLPSNCTRREVAHIFRPFVGYKEVRLVSKEPRQPGGDP  173

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             L+ CFVDF SPAHAATAMDAL 
Sbjct  174   LLLCFVDFLSPAHAATAMDALH  195



>ref|XP_008455994.1| PREDICTED: uncharacterized protein LOC103496055 isoform X1 [Cucumis 
melo]
 ref|XP_008455995.1| PREDICTED: uncharacterized protein LOC103496055 isoform X1 [Cucumis 
melo]
Length=258

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 148/220 (67%), Gaps = 9/220 (4%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D +QQPP +        KRPR +YD    H+L  YY R D R  V + I+ 
Sbjct  1     MSDAYWRYTDSQQQPPSSVPPVVG--KRPRVDYDTTGLHELPNYYPRQDDRP-VLQGIKS  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              D I  SY+RYL+++++S+YGG +SARP+ GG+ GH   DP +LGIGG            
Sbjct  58    VDSINESYERYLRTSQISSYGG-QSARPVGGGVPGHLMNDPPILGIGGVVSGANVNDRST  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               GGGR  + LPPDAS+TL+VEGLP++CTRREV+HIFRPFVGYKEVRLV KESR    DP
Sbjct  117   SFGGGRPNIPLPPDASNTLFVEGLPSSCTRREVAHIFRPFVGYKEVRLVNKESRSAGRDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ----GE-VTFLMLLIM*C  3621
             +V  FVDF SPAHAATAMDALQ    GE V  + + I+ C
Sbjct  177   VVLGFVDFVSPAHAATAMDALQEVAIGEFVPSIYIFILAC  216



>ref|XP_008455997.1| PREDICTED: uncharacterized protein LOC103496055 isoform X3 [Cucumis 
melo]
Length=222

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 140/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D +QQPP +        KRPR +YD    H+L  YY R D R  V + I+ 
Sbjct  1     MSDAYWRYTDSQQQPPSSVPPVVG--KRPRVDYDTTGLHELPNYYPRQDDRP-VLQGIKS  57

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
              D I  SY+RYL+++++S+YGG +SARP+ GG+ GH   DP +LGIGG            
Sbjct  58    VDSINESYERYLRTSQISSYGG-QSARPVGGGVPGHLMNDPPILGIGGVVSGANVNDRST  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               GGGR  + LPPDAS+TL+VEGLP++CTRREV+HIFRPFVGYKEVRLV KESR    DP
Sbjct  117   SFGGGRPNIPLPPDASNTLFVEGLPSSCTRREVAHIFRPFVGYKEVRLVNKESRSAGRDP  176

Query  3725  LVFCFVDFASPAHAATAMDALQ  3660
             +V  FVDF SPAHAATAMDALQ
Sbjct  177   VVLGFVDFVSPAHAATAMDALQ  198



>ref|XP_004234996.1| PREDICTED: uncharacterized protein LOC101267497 [Solanum lycopersicum]
Length=231

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 145/203 (71%), Gaps = 5/203 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MADAYWR  D R  P     +PS   KRPR+E D  +  ++ G ++ +D +G +H  IR+
Sbjct  1     MADAYWRVTDGRIHPVSLPPVPS---KRPRTENDVPSGPEMLGSHSHNDVQG-MHHAIRE  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TDPI  SY++YL+S + S+Y GG+SA  ++ G+  H  + PRV+G  GS+PV A+ R +G
Sbjct  57    TDPIETSYEQYLRSGQTSSYAGGDSANSMSNGVGSHSIDGPRVMGTVGSEPVAARSRTIG  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
               G    EV LPP+ASSTL+VEGLPA+CTRREVSHIFRPFVG+KEVRLV KESR P G P
Sbjct  117   FGGVR-PEVPLPPEASSTLFVEGLPAHCTRREVSHIFRPFVGFKEVRLVIKESRHPGGHP  175

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
              V CFVDF SP+HAATAMD LQG
Sbjct  176   FVLCFVDFMSPSHAATAMDTLQG  198



>gb|KDO59665.1| hypothetical protein CISIN_1g0266482mg [Citrus sinensis]
Length=179

 Score =   198 bits (504),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YWR+ D RQ      ++ S   KRPR++YD  + H+L+ YY RDD RG + R +RD
Sbjct  1     MADGYWRYSDARQPQSALPSLVS---KRPRTDYDVPSGHELSSYYTRDDDRGAL-RGMRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD +GASYDRYL+SA++S+Y GG+SAR ++GGM   P +DPR++GIGG DP  +      
Sbjct  57    TDSLGASYDRYLRSAQISSYSGGQSARHMSGGMPSRPVDDPRIVGIGGMDPGPSAKDRAL  116

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR  3744
             G+GGGR+EV LPPDASSTL+VEGLP++C+RREV+HIFRPFVGYKEVRLV+KESR
Sbjct  117   GLGGGRSEVPLPPDASSTLFVEGLPSDCSRREVAHIFRPFVGYKEVRLVSKESR  170



>ref|XP_003602287.1| RNA-binding protein with multiple splicing [Medicago truncatula]
Length=258

 Score =   201 bits (511),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 145/208 (70%), Gaps = 12/208 (6%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ + +Q  PP         KRPR+EYD +  H+LA Y+  DD RG + +VIRD
Sbjct  1     MSDAYWRYAESQQHAPPTIPG-----KRPRTEYDVSGVHNLANYFPHDDDRGRL-QVIRD  54

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             T+ + ASY+RYL++A +S++G G+S R + GG+  H  +D  V  +GG D        + 
Sbjct  55    TESLDASYERYLRNA-ISSHGSGQSTRTIDGGVPSHSIDDSHVTSMGGVDRRTNVKDQIL  113

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREV-----SHIFRPFVGYKEVRLVTKESRR  3741
              + GGR +  LPP A++TL+VEGLP+NCTRREV     S IFRPFVGYKEVRLV+KESR+
Sbjct  114   ELSGGRPDHSLPPGATNTLFVEGLPSNCTRREVARILSSDIFRPFVGYKEVRLVSKESRQ  173

Query  3740  PDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P GDPL+ CFVDF SPAHAATAMDAL G
Sbjct  174   PGGDPLLLCFVDFVSPAHAATAMDALHG  201



>ref|XP_009391960.1| PREDICTED: uncharacterized protein LOC103977994 [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 141/206 (68%), Gaps = 12/206 (6%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllA-KRPRSEYD--PANSHDLAGYYARDDGRGGVHRV  4095
             MADAYWR+GD R Q   AA  P     KRPR+EY   P+ S D+  YY R+D  G  H  
Sbjct  1     MADAYWRYGDARHQAAAAAMAPPPATLKRPRAEYQYVPSGS-DVFAYYPRED-EGTAHPT  58

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgr  3915
             +RDT+ +GASYDRYL++  +S+YG GES RP+ GG+   P +D R++ I   D       
Sbjct  59    VRDTESLGASYDRYLRNG-ISSYGAGESVRPVGGGINNQPIDDRRIISIESLD------G  111

Query  3914  amggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPD  3735
                G GG R E  LPPDAS+TL+VEGLPA+CTRREVSHIFRPFVG++EVRLV KESR P 
Sbjct  112   RSAGYGGRRPEPPLPPDASNTLFVEGLPADCTRREVSHIFRPFVGFQEVRLVNKESRHPG  171

Query  3734  GDPLVFCFVDFASPAHAATAMDALQG  3657
              DPLV CFVDF + A AA A++ALQG
Sbjct  172   ADPLVLCFVDFVTTAQAAIALEALQG  197



>ref|XP_010671379.1| PREDICTED: uncharacterized protein LOC104888185 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671380.1| PREDICTED: uncharacterized protein LOC104888185 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score =   197 bits (500),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 145/245 (59%), Gaps = 49/245 (20%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M+DAYWR+ D RQ P  ++ +     KRPR +YD     DLAGYY+RDD R   HR +RD
Sbjct  1     MSDAYWRYSDSRQPPNVSSLVG----KRPRPDYDVPPGQDLAGYYSRDDERL-THRAVRD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHP-----------------------  3975
             T+ I  SYDRYL+S +++   G +S R    GM+ H                        
Sbjct  56    TESINQSYDRYLRSGQLNP--GADSGRLPGYGMSSHAVDDPRMGSDPRMGSDPRMGNDPR  113

Query  3974  -------------------TEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASST  3852
                                + DPR+ GIG  DP  +       +G GR+EV LPPDASST
Sbjct  114   MGSDPRMGSDPRMVSDPRISNDPRMTGIGIMDPGVSVKGRGSNLGSGRSEVSLPPDASST  173

Query  3851  LYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAM  3672
             L+VEGLPANCTRREV+HIFRPFVGYKEVRLVTKE+R   GD +V CFVDF SPAHAATAM
Sbjct  174   LFVEGLPANCTRREVAHIFRPFVGYKEVRLVTKEARHSGGDAIVLCFVDFLSPAHAATAM  233

Query  3671  DALQG  3657
             DALQG
Sbjct  234   DALQG  238



>ref|XP_009383507.1| PREDICTED: uncharacterized protein LOC103971252 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 142/212 (67%), Gaps = 19/212 (9%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaip--------sllAKRPRSEY-DPANSHDLAGYYARDDGR  4113
             MADAYWR+ D R Q    AA              KRPRS+Y D     ++ GYY  D+ R
Sbjct  1     MADAYWRYADARHQAAAQAAAQAAVVVPTPQPALKRPRSDYPDMPGGSEMLGYYTHDEER  60

Query  4112  GGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDP  3933
              G +RVIRDT+ + ASYDRYL++  +S+YG GE  RP+ GG+   P +D RV+G+ G D 
Sbjct  61    TG-YRVIRDTETVEASYDRYLRNG-ISSYGAGEPVRPVAGGITARPVDDRRVMGVAGMD-  117

Query  3932  vgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTK  3753
                      G GGGR E  LPPDAS+TL+VEGLP++C RREVSHIFRPFVG++EVRLVTK
Sbjct  118   -------RSGYGGGRMEPPLPPDASNTLFVEGLPSDCMRREVSHIFRPFVGFQEVRLVTK  170

Query  3752  ESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +SR P  DPLV CFVDF +PA AA A++ALQG
Sbjct  171   DSRHPGQDPLVLCFVDFVTPAQAAVALEALQG  202



>gb|EYU45284.1| hypothetical protein MIMGU_mgv1a013839mg [Erythranthe guttata]
Length=198

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 133/204 (65%), Gaps = 27/204 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D YWRF D +QQPP      +   KRPRS ++  + HDL GYYAR++   G H++ RD
Sbjct  1     MGDPYWRFVDGKQQPPAVLPHMA---KRPRSNFETPSGHDLPGYYARENEMAG-HQITRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD + ASY+RYL+SA++S+YGG                 DPR + +GGSD       +  
Sbjct  57    TDSVNASYERYLRSAQISSYGG-----------------DPRGVAVGGSD-QVGAEISRS  98

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              V G R E+ LP DA+STL+VEGLPA+CTRREVSHIFRPF+GYKEVRLV K   R     
Sbjct  99    VVMGARPELQLPHDATSTLFVEGLPADCTRREVSHIFRPFLGYKEVRLVDKPQSR-----  153

Query  3725  LVFCFVDFASPAHAATAMDALQGE  3654
              V CFVDF SPAHAATAMDALQGE
Sbjct  154   HVLCFVDFLSPAHAATAMDALQGE  177



>gb|EYU45285.1| hypothetical protein MIMGU_mgv1a013839mg [Erythranthe guttata]
Length=209

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 27/203 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D YWRF D +QQPP      +   KRPRS ++  + HDL GYYAR++   G H++ RD
Sbjct  1     MGDPYWRFVDGKQQPPAVLPHMA---KRPRSNFETPSGHDLPGYYARENEMAG-HQITRD  56

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramg  3906
             TD + ASY+RYL+SA++S+YGG                 DPR + +GGSD       +  
Sbjct  57    TDSVNASYERYLRSAQISSYGG-----------------DPRGVAVGGSD-QVGAEISRS  98

Query  3905  gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDP  3726
              V G R E+ LP DA+STL+VEGLPA+CTRREVSHIFRPF+GYKEVRLV K   R     
Sbjct  99    VVMGARPELQLPHDATSTLFVEGLPADCTRREVSHIFRPFLGYKEVRLVDKPQSR-----  153

Query  3725  LVFCFVDFASPAHAATAMDALQG  3657
              V CFVDF SPAHAATAMDALQG
Sbjct  154   HVLCFVDFLSPAHAATAMDALQG  176



>ref|XP_009412673.1| PREDICTED: uncharacterized protein LOC103994089 isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009412681.1| PREDICTED: uncharacterized protein LOC103994089 isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009412690.1| PREDICTED: uncharacterized protein LOC103994089 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=202

 Score =   176 bits (447),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 144/212 (68%), Gaps = 14/212 (7%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsl-lAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVI  4092
             MADAYWR+GD RQQ   AA  P     KRPR +Y D  +  D+ GYY  +D R  V+  I
Sbjct  1     MADAYWRYGDARQQAVAAAMAPPAATLKRPRLDYHDVPSGSDMLGYYVLEDERT-VNHAI  59

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ +GASYDRYL+   +S+Y  G+  RP+ GG++  P +D R++ IG  D        
Sbjct  60    RDTESLGASYDRYLRDG-ISSYPAGQPVRPVGGGISSQPVDDRRMMTIGALD--------  110

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G GG R E  LPPDAS+TL+VEGLPA+CTRREVSHIFRPFVG++EVRLV KESR+P G
Sbjct  111   --GQGGRRPEPLLPPDASNTLFVEGLPADCTRREVSHIFRPFVGFEEVRLVNKESRQPRG  168

Query  3731  DPLVFCFVDFASPAHAATAMDALQGEVTFLML  3636
             DP++ CFVDF + A AA A++ALQG    L L
Sbjct  169   DPIILCFVDFTTAAQAAIALEALQGTQCGLRL  200



>ref|XP_007019456.1| Nucleotide binding,nucleic acid binding [Theobroma cacao]
 gb|EOY16681.1| Nucleotide binding,nucleic acid binding [Theobroma cacao]
Length=261

 Score =   179 bits (453),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 139/225 (62%), Gaps = 27/225 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PAN----SHDLAGYYARDDGRGGVH  4101
             MAD YW     R+Q  P       + KRPR ++D PA+    +H++  Y ARDD RGG H
Sbjct  1     MADGYWS----RRQATPPMLSSGGVLKRPRHDFDAPASGLHAAHEMHNYLARDDDRGG-H  55

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA------RPLTGGMAGHPTEDPRVLGIGGS  3939
               ++DT  IG++YDRYLQS ++S++  GE++      R + G M+  P  DP V+G  GS
Sbjct  56    LSLKDTKTIGSAYDRYLQSTQLSSFTSGEASTFGGMGRAVGGAMSARPVADPSVMGRSGS  115

Query  3938  DPvgakgramggvgggRTEVH-----------LPPDASSTLYVEGLPANCTRREVSHIFR  3792
               +            G+  V            LPPDAS+TLYVEGLP + T+REV+HIFR
Sbjct  116   AALDLAPNGRNVGYSGQLPVDGMTRPGQDTIPLPPDASNTLYVEGLPPDSTKREVAHIFR  175

Query  3791  PFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             PFVGYKEVRLV+KESR   GDP++ CFVDF++PA AATAM ALQG
Sbjct  176   PFVGYKEVRLVSKESRHRGGDPIILCFVDFSNPACAATAMSALQG  220



>ref|XP_009412656.1| PREDICTED: uncharacterized protein LOC103994089 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 147/217 (68%), Gaps = 16/217 (7%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsl-lAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVI  4092
             MADAYWR+GD RQQ   AA  P     KRPR +Y D  +  D+ GYY  +D R  V+  I
Sbjct  1     MADAYWRYGDARQQAVAAAMAPPAATLKRPRLDYHDVPSGSDMLGYYVLEDERT-VNHAI  59

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ +GASYDRYL+   +S+Y  G+  RP+ GG++  P +D R++ IG  D        
Sbjct  60    RDTESLGASYDRYLRDG-ISSYPAGQPVRPVGGGISSQPVDDRRMMTIGALD--------  110

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G GG R E  LPPDAS+TL+VEGLPA+CTRREVSHIFRPFVG++EVRLV KESR+P G
Sbjct  111   --GQGGRRPEPLLPPDASNTLFVEGLPADCTRREVSHIFRPFVGFEEVRLVNKESRQPRG  168

Query  3731  DPLVFCFVDFASPAHAATAMDALQ--GEVTFLMLLIM  3627
             DP++ CFVDF + A AA A++ALQ   EV F   L++
Sbjct  169   DPIILCFVDFTTAAQAAIALEALQVLHEVLFFSTLLL  205



>ref|XP_009412664.1| PREDICTED: uncharacterized protein LOC103994089 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=227

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 142/205 (69%), Gaps = 14/205 (7%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllA-KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVI  4092
             MADAYWR+GD RQQ   AA  P     KRPR +Y D  +  D+ GYY  +D R  V+  I
Sbjct  1     MADAYWRYGDARQQAVAAAMAPPAATLKRPRLDYHDVPSGSDMLGYYVLEDERT-VNHAI  59

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgra  3912
             RDT+ +GASYDRYL+   +S+Y  G+  RP+ GG++  P +D R++ IG  D        
Sbjct  60    RDTESLGASYDRYLRDG-ISSYPAGQPVRPVGGGISSQPVDDRRMMTIGALD--------  110

Query  3911  mggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDG  3732
               G GG R E  LPPDAS+TL+VEGLPA+CTRREVSHIFRPFVG++EVRLV KESR+P G
Sbjct  111   --GQGGRRPEPLLPPDASNTLFVEGLPADCTRREVSHIFRPFVGFEEVRLVNKESRQPRG  168

Query  3731  DPLVFCFVDFASPAHAATAMDALQG  3657
             DP++ CFVDF + A AA A++ALQG
Sbjct  169   DPIILCFVDFTTAAQAAIALEALQG  193



>ref|XP_010048822.1| PREDICTED: uncharacterized protein LOC104437550 [Eucalyptus grandis]
Length=239

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 130/209 (62%), Gaps = 5/209 (2%)
 Frame = -2

Query  4265  MADAYWR-FGDVRQQpppaaaipsllA-KRPRSEYD-PANS-HDLAGYYARDDGRGGVHR  4098
             MAD YWR FGD R  P       +    KRPR+E+D P  + HD+ GY   DD RG  + 
Sbjct  1     MADPYWRPFGDARPPPYQPPPAAAFPHAKRPRAEFDVPTGAVHDIQGYLPMDDNRG-AYP  59

Query  4097  VIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgakg  3918
              I DT+ +GASYD YL + ++S + G +    + GG + H  +D  + G  G   +    
Sbjct  60    GIHDTENLGASYDLYLHTTQMSPFSGAQPTGLVGGGSSAHSFDDLPMGGPAGLGQMTTMA  119

Query  3917  ramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRP  3738
                    G   +  LPPDAS+TL+VEGLP  C+RREVSHIFRPFVGYKEVRLV KESR+ 
Sbjct  120   ERTLPFEGWTGDAPLPPDASNTLFVEGLPPKCSRREVSHIFRPFVGYKEVRLVNKESRQT  179

Query  3737  DGDPLVFCFVDFASPAHAATAMDALQGEV  3651
               +P++ CFVDFASPAHAATA DALQG V
Sbjct  180   GKNPVMLCFVDFASPAHAATAKDALQGYV  208



>ref|XP_004496491.1| PREDICTED: uncharacterized protein LOC101500740 [Cicer arietinum]
Length=247

 Score =   172 bits (437),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 140/226 (62%), Gaps = 35/226 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             M D +W     RQQP   ++      KRPR+EYD + S     +++  + AR DG    H
Sbjct  1     MTDGFWN----RQQPFIPSSGML---KRPRTEYDISPSGLTSGNEIHNFIARGDG----H  49

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGES--------ARPLTGGMAGHPTEDPRVLGIG  3945
             ++++DT  IG++YDRYLQSA ++++  GE+        AR + GGM GH   DP V+   
Sbjct  50    QMVKDTKTIGSAYDRYLQSAGLTSFNSGEASVIGGVGLARGV-GGMPGHSLGDPTVMQHP  108

Query  3944  GSDPvgakgramggvgggR----------TEVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
             G  P  A+       GG              + LPPDASSTLYVEGLP++CTRREV+HIF
Sbjct  109   GGGPDLARNGRNANFGGQLPINAISRPGPETIPLPPDASSTLYVEGLPSDCTRREVAHIF  168

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLVTKES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  169   RPFVGYREVRLVTKESKHRGGDPLILCFVDFANPACAATALSALQG  214



>gb|KCW89114.1| hypothetical protein EUGRSUZ_A01436 [Eucalyptus grandis]
Length=324

 Score =   174 bits (442),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = -2

Query  4271  VKMADAYWR-FGDVRQQpppaaaipsllA-KRPRSEYD-PANS-HDLAGYYARDDGRGGV  4104
             + MAD YWR FGD R  P       +    KRPR+E+D P  + HD+ GY   DD RG  
Sbjct  84    LDMADPYWRPFGDARPPPYQPPPAAAFPHAKRPRAEFDVPTGAVHDIQGYLPMDDNRG-A  142

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvga  3924
             +  I DT+ +GASYD YL + ++S + G +    + GG + H  +D  + G  G   +  
Sbjct  143   YPGIHDTENLGASYDLYLHTTQMSPFSGAQPTGLVGGGSSAHSFDDLPMGGPAGLGQMTT  202

Query  3923  kgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR  3744
                      G   +  LPPDAS+TL+VEGLP  C+RREVSHIFRPFVGYKEVRLV KESR
Sbjct  203   MAERTLPFEGWTGDAPLPPDASNTLFVEGLPPKCSRREVSHIFRPFVGYKEVRLVNKESR  262

Query  3743  RPDGDPLVFCFVDFASPAHAATAMDALQGEV  3651
             +   +P++ CFVDFASPAHAATA DALQG V
Sbjct  263   QTGKNPVMLCFVDFASPAHAATAKDALQGYV  293



>gb|ACN31031.1| unknown [Zea mays]
Length=221

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 124/182 (68%), Gaps = 12/182 (7%)
 Frame = -2

Query  4187  KRPR-SEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG-  4017
             KRPR +E+ D   + D AGYY RD+ R G +R  RDT+ + ASY+R+L++ ++ ++GGG 
Sbjct  12    KRPRPTEFSDVPGAPDTAGYYPRDEERAG-YRAARDTESLNASYERFLRTGQIQSFGGGH  70

Query  4016  --ESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYV  3843
               E  RP  GG A +P +D  ++   G D          G  GG  E  LPPDAS+TLY+
Sbjct  71    AGEPIRPAVGGNAAYPVDDRSMMAARGMD------SRNIGFVGGMPEPPLPPDASNTLYI  124

Query  3842  EGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDAL  3663
             EG+P++CTRREVSHIFRPFVG++EVRLV KE + P GDP+V CFVDFA P  +A A+DAL
Sbjct  125   EGVPSDCTRREVSHIFRPFVGFREVRLVNKEPKHPGGDPIVLCFVDFAEPTQSAIALDAL  184

Query  3662  QG  3657
             QG
Sbjct  185   QG  186



>ref|XP_010108658.1| RNA-binding protein with multiple splicing [Morus notabilis]
 gb|EXC19914.1| RNA-binding protein with multiple splicing [Morus notabilis]
Length=253

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 132/228 (58%), Gaps = 33/228 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD +W     RQQP           KRPR+EYD + S     H++  Y+ R D   G  
Sbjct  1     MADGFWN----RQQPLLHPGGIL---KRPRTEYDLSTSGQPSGHEMHNYFRRGDEHDGP-  52

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA---------RPLTGGMAGHPTEDPRVLGI  3948
             R ++DT  IG++YDRYLQS+++S+   GE++         R   GGM G PT D  V+G 
Sbjct  53    RAVKDTKTIGSAYDRYLQSSQISSLNPGEASALGGVGIAGRAFVGGMPGLPTTDHAVMGR  112

Query  3947  GGSDPvgakgramggvgggRTEVH-----------LPPDASSTLYVEGLPANCTRREVSH  3801
              G+                   +            LPPDASSTLYVEGLP +C+RREV+H
Sbjct  113   HGAIVPDLARNGRSTSFEDHLPIDPRARPGREIAPLPPDASSTLYVEGLPPDCSRREVAH  172

Query  3800  IFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             IFRPFVGYKE RLV+KESR   GDP++ CFVDFA+PA AATAM+ALQG
Sbjct  173   IFRPFVGYKEARLVSKESRHRGGDPIILCFVDFANPACAATAMNALQG  220



>ref|XP_002436388.1| hypothetical protein SORBIDRAFT_10g001660 [Sorghum bicolor]
 gb|EER87755.1| hypothetical protein SORBIDRAFT_10g001660 [Sorghum bicolor]
Length=266

 Score =   169 bits (429),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 121/182 (66%), Gaps = 12/182 (7%)
 Frame = -2

Query  4187  KRPRSE--YDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG-  4017
             KRPR     D   + D+ GYY RD+ R G +R  RDT+ + ASY+R+L++ ++ ++GGG 
Sbjct  56    KRPRPADFSDVPGAPDMTGYYPRDEERAG-YRPARDTEALNASYERFLRTGQIQSFGGGP  114

Query  4016  --ESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYV  3843
               E  RP  GG AG+P +D  ++   G D          G GGG  E  LPPDAS+TLY+
Sbjct  115   AGEPIRPAVGGNAGYPVDDRSMMAARGMD------SRNIGFGGGMPEPPLPPDASNTLYI  168

Query  3842  EGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDAL  3663
             EG+P  CTRREVSHIFRPFVG++EVRLV KE + P GDP+V CFVDFA P  +A AM+AL
Sbjct  169   EGIPTGCTRREVSHIFRPFVGFREVRLVNKEPKHPGGDPIVLCFVDFAEPTQSAIAMEAL  228

Query  3662  QG  3657
             QG
Sbjct  229   QG  230



>ref|XP_008658343.1| PREDICTED: uncharacterized protein LOC100274945 isoform X1 [Zea 
mays]
 gb|AFW86079.1| hypothetical protein ZEAMMB73_802063 [Zea mays]
Length=262

 Score =   169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 131/234 (56%), Gaps = 38/234 (16%)
 Frame = -2

Query  4265  MADAYWRF----------------------------GDVRQQpppaaaipsllAKRPRSE  4170
             MADAYWR+                            G   Q  P       +   RP   
Sbjct  1     MADAYWRYAAAAPRQQQQQQQPPPSAGGGVAHPGMGGGAPQMAPAGGQQQPMKRPRPTEF  60

Query  4169  YDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG---ESARPL  3999
              D   + D AGYY RD+ R G +R  RDT+ + ASY+R+L++ ++ ++GGG   E  RP 
Sbjct  61    SDVPGAPDTAGYYPRDEERAG-YRAARDTESLNASYERFLRTGQIQSFGGGHAGEPIRPA  119

Query  3998  TGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCT  3819
              GG A +P +D  ++   G D          G  GG  E  LPPDAS+TLY+EG+P++CT
Sbjct  120   VGGNAAYPVDDRSMMAARGMD------SRNIGFVGGMPEPPLPPDASNTLYIEGVPSDCT  173

Query  3818  RREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RREVSHIFRPFVG++EVRLV KE + P GDP+V CFVDFA P  +A A+DALQG
Sbjct  174   RREVSHIFRPFVGFREVRLVNKEPKHPGGDPIVLCFVDFAEPTQSAIALDALQG  227



>gb|KHG30705.1| RNA-binding with multiple splicing [Gossypium arboreum]
Length=261

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 135/233 (58%), Gaps = 35/233 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PAN---SHDLAGYYARDDGRGGVH  4101
             MAD YW     R+QP P     S   KRPR+EYD  P+    SH++  Y ARD  RGG H
Sbjct  1     MADGYWN----RRQPTPPMLSSSGALKRPRTEYDGPPSGLHPSHEMHNYLARDGDRGG-H  55

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGES------ARPLTGGMAGHPTEDPRVLGIGGS  3939
               ++DT  IG++YDRYLQSA++S+   GE+       +P+ G M   P  DP V+G  GS
Sbjct  56    LPVKDTKTIGSAYDRYLQSAQISSLPSGEARTFGGLGKPVGGAMPARPIADPPVMGRPGS  115

Query  3938  DPvgakgramggvgggRT-----------EVHLPPDASSTLYVEGLPANCTRREVSHI--  3798
                           G +             V LPPDAS+TLYVEGLP++ TRREV+ I  
Sbjct  116   AAPDMVSNGRNVGYGNQLPLDAMSRLGRDTVPLPPDASNTLYVEGLPSDSTRREVARILF  175

Query  3797  ------FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
                   FRPFVGYKEVRLV+KE R   GDPL+ CFVDF +PA AATAM ALQG
Sbjct  176   HDALDIFRPFVGYKEVRLVSKEFRHRGGDPLILCFVDFTTPACAATAMSALQG  228



>ref|XP_006472956.1| PREDICTED: uncharacterized protein LOC102627431 [Citrus sinensis]
Length=253

 Score =   166 bits (421),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 134/227 (59%), Gaps = 31/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQ     +   L  KRPRS+YD   S     HD+  Y ++DD  G + 
Sbjct  1     MADGYWN----RQQASLLPSGGML--KRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQ  54

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVLGIG  3945
               ++DT  IG++YDRYLQSA+ S++  GE++        R + GG+A  P  DP V G  
Sbjct  55    -PLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVARLPVSDPSVTGRH  113

Query  3944  G-----------SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
             G           S  +  +         G   + LPPDASSTLYVEGLPA+ T+REV+HI
Sbjct  114   GATGPDLVPNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHI  173

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGYKEVRLV KES+   GDPL+ CFVDF +PA AATA+ ALQG
Sbjct  174   FRPFVGYKEVRLVIKESKLRGGDPLILCFVDFENPACAATALSALQG  220



>ref|XP_004964400.1| PREDICTED: protein WHI3-like [Setaria italica]
Length=260

 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 131/230 (57%), Gaps = 33/230 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQ------------------------QpppaaaipsllAKRPRSEYDPA  4158
             MADAYWR+                             Q   A     +   RP    D  
Sbjct  1     MADAYWRYAAADPRQQQQQPPSAAAGAGAHPGMGGAPQMAAAGGQQPMKRPRPTDFSDGP  60

Query  4157  NSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG---ESARPLTGGM  3987
              + D+ GYY RD+ R G +R  RDT+ + ASY+R+L++ ++ +YG G   E  RP  GG 
Sbjct  61    GAPDMTGYYPRDEERAG-YRAARDTEALNASYERFLRTGQIQSYGAGPAGEPIRPAVGGN  119

Query  3986  AGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREV  3807
             AG+P ++  ++   G D      R +GG GGG  E  LPPDAS+TLY+EG+P  CTRREV
Sbjct  120   AGYPVDERSMMAARGMD-----SRNIGGYGGGMPEPPLPPDASNTLYIEGIPTGCTRREV  174

Query  3806  SHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             SHIFRPFVG++EVRLV KE + P GDP+V CFVDFA    AA AMDALQG
Sbjct  175   SHIFRPFVGFREVRLVNKEPKHPGGDPIVLCFVDFAEATQAAIAMDALQG  224



>gb|KDP43016.1| hypothetical protein JCGZ_25202 [Jatropha curcas]
Length=254

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 137/241 (57%), Gaps = 36/241 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PAN----SHDLAGYYARDDGRGGVH  4101
             M D YW     RQQ P  ++      KRPR+EYD P +    SH++  YY RDD R   +
Sbjct  1     MTDGYWN----RQQHPLLSSGGGGNLKRPRTEYDLPTSGLPSSHEIHNYYPRDDERS-RY  55

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA-----------------RPLTGGMAGHPT  3972
             + ++DT  IG++YDRYLQ+A+++++  GE +                   L  GM G P 
Sbjct  56    QAVKDTKTIGSAYDRYLQNAQMASFSSGEPSGLSVGLGRAGGGGITGLPILDSGMTGRPR  115

Query  3971  EDPRVLGIGGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHIF  3795
                  L   G D       ++  +     E V LPPDASSTLYVEGLP + TRREV+HIF
Sbjct  116   ASIPDLAPNGRDIGFGSQSSLDAISRPVRETVPLPPDASSTLYVEGLPPDSTRREVAHIF  175

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG--------EVTFLM  3639
             RPFVGYKE RLV+KES+   GDP++ CFVDF +PA AATAM ALQG        E +FL 
Sbjct  176   RPFVGYKEARLVSKESKHRGGDPIILCFVDFENPACAATAMSALQGYKMDEHDRESSFLR  235

Query  3638  L  3636
             L
Sbjct  236   L  236



>ref|XP_007152059.1| hypothetical protein PHAVU_004G098400g [Phaseolus vulgaris]
 gb|ESW24053.1| hypothetical protein PHAVU_004G098400g [Phaseolus vulgaris]
Length=238

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 143/234 (61%), Gaps = 33/234 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PANS----HDLAGYYARDDGRGGVH  4101
             M D YW     RQQ     +      KRPRS+YD PA+     +++  Y ARDD R G H
Sbjct  1     MTDGYWN----RQQALLPHSGML---KRPRSDYDMPASGLSSGNEMHNYIARDDDRTG-H  52

Query  4100  RVIRDTDPIGASYDRYLQSA-KVSAYGGGESA--------RPLTGGMAGHPTEDPRVLG-  3951
             R+I+DT  IG +YDRYLQS  ++S++  GE++        R   GG++GH   DP  +G 
Sbjct  53    RMIKDTKTIGTAYDRYLQSGGQISSFASGEASTVGGLGLARGGGGGLSGHSLADPAAMGR  112

Query  3950  IGGSDPvgakgramggvgggR----------TEVHLPPDASSTLYVEGLPANCTRREVSH  3801
              GG  P  A    +   GG              V LPPDASSTLYVEGLP++ TRREV+H
Sbjct  113   HGGGGPDLAPNGRVVNYGGQLPVDAVSRPGPETVPLPPDASSTLYVEGLPSDSTRREVAH  172

Query  3800  IFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQGEVTFLM  3639
             IFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATAM ALQG +  L+
Sbjct  173   IFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATAMSALQGILYCLL  226



>gb|KDO83671.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
 gb|KDO83672.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
 gb|KDO83673.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=253

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 133/227 (59%), Gaps = 31/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQ     +   L  KRPRS+YD   S     HD+  Y ++DD  G + 
Sbjct  1     MADGYWN----RQQASLLPSGGML--KRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQ  54

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVLGIG  3945
               ++DT  IG++YDRYLQSA+ S++  GE++        R + GG+   P  DP V G  
Sbjct  55    -PLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRH  113

Query  3944  G-----------SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
             G           S  +  +         G   + LPPDASSTLYVEGLPA+ T+REV+HI
Sbjct  114   GATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHI  173

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGYKEVRLV KES+   GDPL+ CFVDF +PA AATA+ ALQG
Sbjct  174   FRPFVGYKEVRLVIKESKLRGGDPLILCFVDFENPACAATALSALQG  220



>gb|AGV54255.1| RNA-binding protein with multiple splicing [Phaseolus vulgaris]
Length=254

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 134/228 (59%), Gaps = 32/228 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D  W      +Q        S L KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGSWN-----RQQQQPLLPSSALLKRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  54

Query  4103  HRVIRDTDPIGASYDRYLQSA---------KVSAYGGGESARPLTGGMAGHPTEDPRVLG  3951
             HR+++DT  +G++YDRYLQ+A         + SA GG   AR + GG+ GH   DP V+G
Sbjct  55    HRMLKDTKTLGSAYDRYLQNAGQLTSFNSGEASAIGGVGLARSV-GGLPGHSLSDPSVMG  113

Query  3950  I--GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSH  3801
                GG D                      G   V LPPDASSTLYVEGLP++ TRREV+H
Sbjct  114   HPGGGHDLARNGRNVNYGGQLPVDTASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAH  173

Query  3800  IFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             IFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  174   IFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  221



>ref|XP_007199630.1| hypothetical protein PRUPE_ppa010374mg [Prunus persica]
 gb|EMJ00829.1| hypothetical protein PRUPE_ppa010374mg [Prunus persica]
Length=252

 Score =   164 bits (415),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 122/201 (61%), Gaps = 25/201 (12%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD A S     H++  Y ARDD  G   R +++T  IG+ YD YLQ+ ++S++ 
Sbjct  20    KRPRSDYDLAASGLYSGHEMHSYLARDDDFGDP-RALKNTKSIGSEYDNYLQNVQMSSHT  78

Query  4022  GGESA--------RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEV----  3879
              GE++        R + GGM G P  D  V+G  G                 +  V    
Sbjct  79    SGETSTFGGTGLGRAVGGGMVGLPMADHSVMGHPGPIASDLITNGRNMSFANQLPVDAMA  138

Query  3878  -------HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLV  3720
                    HLPPDAS+TLYVEGLP + T+REV+HIFRPFVGYKEVRLV+KES+   GDPL+
Sbjct  139   RPGRETAHLPPDASNTLYVEGLPPDSTKREVAHIFRPFVGYKEVRLVSKESKHRGGDPLI  198

Query  3719  FCFVDFASPAHAATAMDALQG  3657
              CFVDF SPA+AATA+ ALQG
Sbjct  199   LCFVDFESPAYAATALSALQG  219



>ref|XP_008243626.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X2 [Prunus 
mume]
Length=249

 Score =   163 bits (413),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 121/198 (61%), Gaps = 22/198 (11%)
 Frame = -2

Query  4187  KRPRSEYDPA--NSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE  4014
             KRPRS+Y P   + H++  Y ARDD  G   R +++T  IG+ YD YLQ+ ++S++  GE
Sbjct  20    KRPRSDYAPGLYSGHEMHSYLARDDDFGDP-RALKNTKSIGSEYDNYLQNVQMSSHTSGE  78

Query  4013  SA--------RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEV-------  3879
             ++        R + GGM G P  D  V+G  G                 +  V       
Sbjct  79    ASSFGGTGLGRAVGGGMVGLPMTDHSVMGHPGPIASDLITNGRNMSFANQLPVDAMARPG  138

Query  3878  ----HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCF  3711
                 HLPPDAS+TLYVEGLP + T+REV+HIFRPFVGYKEVRLV+KES+   GDPL+ CF
Sbjct  139   RETAHLPPDASNTLYVEGLPPDSTKREVAHIFRPFVGYKEVRLVSKESKHRGGDPLILCF  198

Query  3710  VDFASPAHAATAMDALQG  3657
             VDF SPA+AATA+ ALQG
Sbjct  199   VDFESPAYAATALSALQG  216



>gb|ACU19073.1| unknown [Glycine max]
Length=251

 Score =   163 bits (413),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 136/226 (60%), Gaps = 31/226 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D +W     RQQP   ++      KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGFWN----RQQPLHPSSTML---KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  52

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAG-------HPTEDPRVLGI-  3948
             HR+++DT  IG++YDRYLQSA+++++  GE++     G+         H   DP V+G  
Sbjct  53    HRMLKDTKTIGSAYDRYLQSARLTSFNSGEASAVGGVGLGRGAGGLPHHSLTDPAVMGHP  112

Query  3947  -GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
              GG D                      G   V LPPDASSTLYVEGLP++ TRREV+HIF
Sbjct  113   GGGHDHARNGRNVNYGGQLPLDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIF  172

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  173   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  218



>ref|NP_001062425.1| Os08g0547000 [Oryza sativa Japonica Group]
 dbj|BAD09242.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAD09930.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24339.1| Os08g0547000 [Oryza sativa Japonica Group]
 dbj|BAH00132.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score =   164 bits (416),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 129/208 (62%), Gaps = 17/208 (8%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     D+ GYY R+  R G H  +R+ + IGASYDRYL++   S     E+
Sbjct  62    KRARPDYGDVPAGQDMTGYYPRETDRTGYH-ALRENEAIGASYDRYLRNGMPSV-AATET  119

Query  4010  ARPLTGGMAG------HPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTL  3849
              RP+ GGM G      +P +D R++G+G          + G   G R E  LP DASSTL
Sbjct  120   NRPVVGGMGGMGGMGGYPVDDRRMIGVG--------MDSRGMGYGARPEPPLPADASSTL  171

Query  3848  YVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMD  3669
             YVEGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF +PA A  A++
Sbjct  172   YVEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATLALE  231

Query  3668  ALQGEVTFLMLLIM*CHIKAHNYSFESI  3585
             ALQGE T++    + C        FE++
Sbjct  232   ALQGEHTYICRYGLCCFTDNMTLHFENM  259



>ref|XP_008243624.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X1 [Prunus 
mume]
Length=252

 Score =   163 bits (413),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 122/201 (61%), Gaps = 25/201 (12%)
 Frame = -2

Query  4187  KRPRSEYDPA-----NSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD A     + H++  Y ARDD  G   R +++T  IG+ YD YLQ+ ++S++ 
Sbjct  20    KRPRSDYDLAAPGLYSGHEMHSYLARDDDFGDP-RALKNTKSIGSEYDNYLQNVQMSSHT  78

Query  4022  GGESA--------RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEV----  3879
              GE++        R + GGM G P  D  V+G  G                 +  V    
Sbjct  79    SGEASSFGGTGLGRAVGGGMVGLPMTDHSVMGHPGPIASDLITNGRNMSFANQLPVDAMA  138

Query  3878  -------HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLV  3720
                    HLPPDAS+TLYVEGLP + T+REV+HIFRPFVGYKEVRLV+KES+   GDPL+
Sbjct  139   RPGRETAHLPPDASNTLYVEGLPPDSTKREVAHIFRPFVGYKEVRLVSKESKHRGGDPLI  198

Query  3719  FCFVDFASPAHAATAMDALQG  3657
              CFVDF SPA+AATA+ ALQG
Sbjct  199   LCFVDFESPAYAATALSALQG  219



>emb|CDY61067.1| BnaA07g37330D [Brassica napus]
Length=231

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 129/213 (61%), Gaps = 24/213 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YW     + QPP ++       KRPRS++     HD+  Y +RD+ RGG    ++D
Sbjct  1     MADGYWN-QKRQHQPPMSSISHGGPPKRPRSDF----GHDMHSYVSRDEDRGGNPHAVKD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTG---------GMAGHPTED-PRVLGIGGSD  3936
             T  IG++YD YLQS + S+    E+ R   G         G+   P+ D  R LG G  D
Sbjct  56    TRTIGSAYDLYLQSVQTSSTPSEEAGRFNNGVGMGRRGGEGVMPSPSMDFGRGLGFGQQD  115

Query  3935  PvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVT  3756
                            R  + LPPDAS+TL+VEGLP+NC+RREVSHIFRPF+GYKEVRLVT
Sbjct  116   ---------LVGRPSRELLRLPPDASNTLFVEGLPSNCSRREVSHIFRPFLGYKEVRLVT  166

Query  3755  KESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             K+S++ +GDP+V CFVDF +PA AATA  ALQG
Sbjct  167   KDSKQRNGDPIVLCFVDFENPACAATARTALQG  199



>gb|ACU23298.1| unknown [Glycine max]
Length=242

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 134/221 (61%), Gaps = 30/221 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D YW     RQQ   + +      KRPRS+Y     +++   +ARDD R G HR+++D
Sbjct  1     MTDGYWN----RQQTLLSQSGML---KRPRSDY----GNEMHNNFARDDDRTG-HRMLKD  48

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESA-------RPLTGGMAGHPTEDPRVLG-IGGSDPv  3930
             T  IG++YDRYLQS ++S++  GE++           GG++ H   DP V+G  GG  P 
Sbjct  49    TKTIGSAYDRYLQSGQLSSFTSGEASTVGGLGLARGGGGLSDHSLADPSVMGRHGGGGPD  108

Query  3929  gakgramggvgggR----------TEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVG  3780
              A        GG              V LPPDASSTLYVEGLP++ TRREV+HIFRPFVG
Sbjct  109   LAPNGRGVNYGGQLPVDAVSRPGPETVSLPPDASSTLYVEGLPSDSTRREVAHIFRPFVG  168

Query  3779  YKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             Y+EVRLV+KES+   GDP   CFVDFA+PA AATAM ALQG
Sbjct  169   YREVRLVSKESKHRGGDPHYLCFVDFANPACAATAMSALQG  209



>ref|XP_010062133.1| PREDICTED: cell wall integrity protein scw1-like [Eucalyptus 
grandis]
 gb|KCW69200.1| hypothetical protein EUGRSUZ_F02718 [Eucalyptus grandis]
Length=252

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 134/234 (57%), Gaps = 46/234 (20%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD------PANSHDLAGYYARDDGRGGV  4104
             M D YW     RQQP   +       KRPR EYD      PA   ++  Y  RDD   G 
Sbjct  1     MGDNYWN----RQQPVVPSPGLL---KRPRLEYDIPPPGMPAGP-EMQNYLQRDDDPNGP  52

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVL--  3954
              R ++DT  IG++YDRYLQS+++S++  GE++        R + GGM G P  DP ++  
Sbjct  53    -RAVKDTKTIGSAYDRYLQSSQMSSHTPGEASAYGSVGMVRTIGGGMPGAPVADPSMMSR  111

Query  3953  ---------------GIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCT  3819
                            G GG  P+ A GR           V LPPDASSTLYVEGLP + T
Sbjct  112   PGPIAPEMAPNGRNAGFGGPHPMEAMGRPGRET------VPLPPDASSTLYVEGLPPDST  165

Query  3818  RREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +REV+HIFRPFVGYKEVRLV KES+   GDPL+ CFVDF +PA AATA+ ALQG
Sbjct  166   KREVAHIFRPFVGYKEVRLVIKESKHRGGDPLILCFVDFVNPACAATALSALQG  219



>gb|KHN17000.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=252

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 135/226 (60%), Gaps = 30/226 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D +W     RQQ P   +   L  KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGFWN----RQQQPFLPSSAML--KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  53

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAG-------HPTEDPRVLGI-  3948
             HR+++DT  IG++YDRYLQSA ++++  GE++     G+         H   DP V+G  
Sbjct  54    HRMLKDTKTIGSAYDRYLQSAGLTSFNSGEASAVGGVGLGRGAGGLPHHSLTDPAVMGHP  113

Query  3947  -GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
              GG D                      G   V LPPDASSTLYVEGLP++ TRREV+HIF
Sbjct  114   GGGHDHARNGRNVNYGGQLPLDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIF  173

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  174   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  219



>ref|XP_003536434.1| PREDICTED: uncharacterized protein LOC100815695 isoform X1 [Glycine 
max]
Length=251

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 135/226 (60%), Gaps = 31/226 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D +W     RQQP   ++      KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGFWN----RQQPLHPSSTML---KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  52

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAG-------HPTEDPRVLGI-  3948
             HR+++DT  IG++YDRYLQSA ++++  GE++     G+         H   DP V+G  
Sbjct  53    HRMLKDTKTIGSAYDRYLQSAGLTSFNSGEASAVGGVGLGRGAGGLPHHSLTDPAVMGHP  112

Query  3947  -GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
              GG D                      G   V LPPDASSTLYVEGLP++ TRREV+HIF
Sbjct  113   GGGHDHARNGRNVNYGGQLPLDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIF  172

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  173   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  218



>ref|XP_006434433.1| hypothetical protein CICLE_v10002251mg [Citrus clementina]
 gb|ESR47673.1| hypothetical protein CICLE_v10002251mg [Citrus clementina]
Length=253

 Score =   162 bits (409),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 132/227 (58%), Gaps = 31/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQ     +   L  KRPRS+YD   S     HD+  Y ++DD  G + 
Sbjct  1     MADGYWN----RQQASLLPSGGML--KRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGELQ  54

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVLGIG  3945
               ++DT  IG++YDRYLQSA+ S++  GE++        R + GG+   P  DP V G  
Sbjct  55    -PLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRH  113

Query  3944  G-----------SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
             G           S  +  +         G   + LPPDASSTLYVEGLPA+ T+REV+HI
Sbjct  114   GATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHI  173

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGYKEVRLV KES+   GD L+ CFVDF +PA AATA+ ALQG
Sbjct  174   FRPFVGYKEVRLVIKESKLRGGDRLILCFVDFENPACAATALSALQG  220



>gb|AFK44959.1| unknown [Lotus japonicus]
Length=239

 Score =   161 bits (407),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 125/200 (63%), Gaps = 24/200 (12%)
 Frame = -2

Query  4187  KRPRSEYD-PANS----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD PA+     +D+  Y  RDD R G  R++RDT  IG++YDRYLQS ++SAY 
Sbjct  8     KRPRSDYDMPASGLSSGNDINNYIVRDDDRTGP-RMLRDTKTIGSTYDRYLQSGQLSAYT  66

Query  4022  GGESAR-------PLTGGMAGHPTEDPRVLG-IGGSDPvgakgram----------ggvg  3897
              GE++           GG+ GH   D   +G  GG  P  A                   
Sbjct  67    SGEASTIGGLGYARGPGGLPGHSLADHAAMGRHGGGGPDIAPNGRGFNYGGQPPVDSVSR  126

Query  3896  ggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVF  3717
              G   V LPPDASSTLYVEGLP++ T+REV+HIFRPFVGY+EVRLVTKES+   GDPL+ 
Sbjct  127   PGHETVPLPPDASSTLYVEGLPSDSTKREVAHIFRPFVGYREVRLVTKESKHRGGDPLIL  186

Query  3716  CFVDFASPAHAATAMDALQG  3657
             CFVDF +PA AATA+ ALQG
Sbjct  187   CFVDFENPACAATALSALQG  206



>ref|XP_003556143.1| PREDICTED: uncharacterized protein LOC100812551 isoformX1 [Glycine 
max]
Length=252

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 135/226 (60%), Gaps = 30/226 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D  W     RQQ P   +   L  KRPR+EYD + S      +++  Y  R+D   G 
Sbjct  1     MTDGSWN----RQQQPFLPSSAML--KRPRTEYDISPSGLTSGGNEMHNYIGRNDDHTG-  53

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESA-------RPLTGGMAGHPTEDPRVLGI-  3948
             HR+++DT  +G+++DRYLQSA ++++  GE++           GG+  H   DP V+G  
Sbjct  54    HRILKDTKTLGSAFDRYLQSAGLTSFNSGEASAIGSVGLERGVGGLPRHSLTDPAVMGHP  113

Query  3947  --------GGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHIF  3795
                     GG +        +        E V LPPDASSTLYVEGLP++ TRREV+HIF
Sbjct  114   GGGHDLARGGRNVNYGDQLPVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIF  173

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  174   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  219



>gb|EEE65013.1| hypothetical protein OsJ_19964 [Oryza sativa Japonica Group]
Length=265

 Score =   161 bits (408),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 126/186 (68%), Gaps = 16/186 (9%)
 Frame = -2

Query  4187  KRPRSE--YDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG-  4017
             KRPR     D   + ++AGYY+RD+ R G +R  RDT+ + ASY+R+L++ ++ +YG G 
Sbjct  51    KRPRPADFSDVPGAPEMAGYYSRDEERPG-YRPARDTEALNASYERFLRTGQIQSYGAGA  109

Query  4016  ------ESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASS  3855
                   ES RP  GG AG+P ED  ++  GG +          G GGG  E  LPPDAS+
Sbjct  110   GAGPGAESIRPAAGGNAGYPVEDRPMMAGGGME------ARNIGFGGGMPEPPLPPDASN  163

Query  3854  TLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATA  3675
             TL++EG+P +C RREVSHIFRPFVG++EVRLV+KE+R P GDP++ CFVDF + + AA A
Sbjct  164   TLFIEGIPTDCARREVSHIFRPFVGFREVRLVSKEARHPGGDPILLCFVDFETASQAAIA  223

Query  3674  MDALQG  3657
             MDALQG
Sbjct  224   MDALQG  229



>ref|XP_006656587.1| PREDICTED: uncharacterized protein LOC102703405 [Oryza brachyantha]
Length=282

 Score =   162 bits (409),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 123/183 (67%), Gaps = 13/183 (7%)
 Frame = -2

Query  4187  KRPR-SEYD--PANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG  4017
             KRPR +++   P  + +++GYY+RD+ R   +R  RDT  +  SY+R+L++ ++ +YG G
Sbjct  71    KRPRPADFSDVPGGAPEMSGYYSRDEERA-EYRPARDTAALNDSYERFLRTGQIQSYGAG  129

Query  4016  ---ESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLY  3846
                ES RP  GG AG+P ED  ++  G  D          G GGG  E  LPPDAS+TL+
Sbjct  130   PAAESIRPAAGGNAGYPIEDRPIMAGGNMD------GRNIGFGGGMPEPALPPDASNTLF  183

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             +EG+P +C RREVSHIFRPFVG++EVRLV KE+R P GDP++ CFVDF +   AA AMDA
Sbjct  184   IEGIPTDCARREVSHIFRPFVGFREVRLVNKEARHPGGDPVLLCFVDFETATQAAIAMDA  243

Query  3665  LQG  3657
             LQG
Sbjct  244   LQG  246



>emb|CDP18267.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   160 bits (406),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 129/224 (58%), Gaps = 26/224 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             M D YW     RQ      A    + KR RS+YD   S     H++  Y A DD RGG  
Sbjct  1     MGDPYWN----RQSGMQPPAAGGGMLKRHRSDYDVPPSRMTLGHEMHNYLAPDDDRGGP-  55

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGG------GESARPLTGGMAGHPTEDPRVLG---I  3948
             R+++DT  +G++YDRYLQ++++S   G      G + R +  GM   P  DP   G    
Sbjct  56    RIVKDTKTLGSAYDRYLQNSQLSLNSGEGNNYGGAALRAVGSGMPTLPIRDPVSSGRPGT  115

Query  3947  GGSDPvgakgramggvgggRTEVH-------LPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             GG +   +  R          E+        LPPDASSTLY+EGLP + T+REV+HIFRP
Sbjct  116   GGPELAPSSRRVGYSGQLPVEEIPRTRETLPLPPDASSTLYIEGLPPDSTKREVAHIFRP  175

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FVGYKEVRLVTKES+   GDPL+ CFVDFA PA AATA+ ALQG
Sbjct  176   FVGYKEVRLVTKESKHRGGDPLILCFVDFADPACAATALSALQG  219



>gb|KHG27974.1| RNA-binding with multiple splicing [Gossypium arboreum]
Length=285

 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/257 (44%), Positives = 140/257 (54%), Gaps = 59/257 (23%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD----PANSH-----------------  4149
             MAD YW     R+QP P       + KRPR++YD    PA  H                 
Sbjct  1     MADGYWN----RRQPNPPMLSSGGMLKRPRTDYDVTGFPAGYHRCPAALLHLSEPETSSA  56

Query  4148  -------------DLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE--  4014
                          ++  Y ARDD  GG H  +RDT+ IG++YDRYLQSAK+S++  GE  
Sbjct  57    STNAPPFGPRSALEMPSYLARDDDHGG-HLSVRDTNSIGSAYDRYLQSAKLSSFTSGEAS  115

Query  4013  ----SARPLTGGMAGHPTEDPRVLG-IGGSDPvgakgramggvgggRT----------EV  3879
                 S R + G M  HP  DP ++G +G + P  +      G  G              V
Sbjct  116   AFGGSGRAVGGAMPVHPIADPPLMGRLGSAAPDLSPNGHNIGYSGQHPVDAIARPGRDTV  175

Query  3878  HLPPDASSTLYVEGLPANCTRREVS---HIFRPFVGYKEVRLVTKESRRPDGDPLVFCFV  3708
              LPPDAS+TLYVEG P + TRREV+   +IFRPFVGYKEVRLV+KE R+  GDP++ CFV
Sbjct  176   PLPPDASNTLYVEGFPPDSTRREVARILYIFRPFVGYKEVRLVSKEPRQRGGDPILLCFV  235

Query  3707  DFASPAHAATAMDALQG  3657
             DF+SPA AATAM ALQG
Sbjct  236   DFSSPACAATAMSALQG  252



>ref|XP_004515123.1| PREDICTED: uncharacterized protein LOC101512502 isoform X2 [Cicer 
arietinum]
Length=265

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 136/224 (61%), Gaps = 25/224 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD +W     +QQ   +    S   KRPRS+Y+ A S     +++  Y A DD R G H
Sbjct  1     MADGFWY--RQQQQQHHSLHPHSGQVKRPRSDYEMAASGMPTGNEMHNYLAHDDDRSG-H  57

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESAR-------PLTGGMAGHPTEDPRVLG-IG  3945
             + ++DT  IG++YDRYLQS ++S++  GE++           GG+  H   DP V+G  G
Sbjct  58    QAVKDTKTIGSAYDRYLQSGQLSSFTSGEASTIGGLGLPRGVGGLPNHSLGDPAVMGRHG  117

Query  3944  GSDPvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             G D          G       +         LPPDASSTLY+EGLP++CTRREV+HIFRP
Sbjct  118   GPDLAPNGRGINYGFQPPMDAMSRPGPETALLPPDASSTLYIEGLPSDCTRREVAHIFRP  177

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FVGY+EVRLV+KE++   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  178   FVGYREVRLVSKEAKH-RGDPLILCFVDFANPACAATALSALQG  220



>ref|XP_004515122.1| PREDICTED: uncharacterized protein LOC101512502 isoform X1 [Cicer 
arietinum]
Length=281

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 136/224 (61%), Gaps = 25/224 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD +W     +QQ   +    S   KRPRS+Y+ A S     +++  Y A DD R G H
Sbjct  1     MADGFWY--RQQQQQHHSLHPHSGQVKRPRSDYEMAASGMPTGNEMHNYLAHDDDRSG-H  57

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESAR-------PLTGGMAGHPTEDPRVLG-IG  3945
             + ++DT  IG++YDRYLQS ++S++  GE++           GG+  H   DP V+G  G
Sbjct  58    QAVKDTKTIGSAYDRYLQSGQLSSFTSGEASTIGGLGLPRGVGGLPNHSLGDPAVMGRHG  117

Query  3944  GSDPvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             G D          G       +         LPPDASSTLY+EGLP++CTRREV+HIFRP
Sbjct  118   GPDLAPNGRGINYGFQPPMDAMSRPGPETALLPPDASSTLYIEGLPSDCTRREVAHIFRP  177

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FVGY+EVRLV+KE++   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  178   FVGYREVRLVSKEAKH-RGDPLILCFVDFANPACAATALSALQG  220



>ref|XP_006589496.1| PREDICTED: uncharacterized protein LOC100815695 isoform X2 [Glycine 
max]
Length=252

 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 136/227 (60%), Gaps = 32/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D +W     RQQP   ++      KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGFWN----RQQPLHPSSTML---KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  52

Query  4103  HRVIRDTDPIGASYDRYLQSA-KVSAYGGGESARPLTGGMAG-------HPTEDPRVLGI  3948
             HR+++DT  IG++YDRYLQSA +++++  GE++     G+         H   DP V+G 
Sbjct  53    HRMLKDTKTIGSAYDRYLQSAGQLTSFNSGEASAVGGVGLGRGAGGLPHHSLTDPAVMGH  112

Query  3947  --GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
               GG D                      G   V LPPDASSTLYVEGLP++ TRREV+HI
Sbjct  113   PGGGHDHARNGRNVNYGGQLPLDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHI  172

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  173   FRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  219



>gb|KHN46427.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=233

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 127/199 (64%), Gaps = 23/199 (12%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPR+EYD + S     +++  Y AR+D   G HR+++DT  +G++YDRYLQSA ++++ 
Sbjct  3     KRPRTEYDMSPSGLTGGNEMHNYIARNDDHTG-HRMLKDTKTLGSAYDRYLQSAGLTSFN  61

Query  4022  GGESARPLTGGMAG-------HPTEDPRVLGIGGSDPvgakgramggvgggRT-------  3885
              GE++     G+         H   DP V+G  G     A+       GG  T       
Sbjct  62    SGEASAIGGVGLGRGVGGLPRHSLTDPAVMGHPGGGHDLARNGRNVNYGGQLTVDAASMP  121

Query  3884  ---EVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFC  3714
                 V LPPDASSTLYVEGLP++ TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ C
Sbjct  122   GPETVPLPPDASSTLYVEGLPSDSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILC  181

Query  3713  FVDFASPAHAATAMDALQG  3657
             FVDFA+PA AATA+ ALQG
Sbjct  182   FVDFANPACAATALSALQG  200



>ref|XP_006599497.1| PREDICTED: uncharacterized protein LOC100813167 [Glycine max]
Length=243

 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 133/222 (60%), Gaps = 31/222 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YW     RQQ     +      KRPRS+Y     +++  + ARDD R G HR+++D
Sbjct  1     MADGYWN----RQQAFLPHSGML---KRPRSDY----GNEMHNHVARDDDRTG-HRMLKD  48

Query  4085  TDPIGASYDRYLQSAKVSAYGGGE--------SARPLTGGMAGHPTEDPRVLGI---GGS  3939
             T  IG++YD YLQS ++S++  GE         AR   GG++GH   DP V+G    GGS
Sbjct  49    TQTIGSAYDHYLQSGQLSSFTSGEVSAVGGLGLARGGGGGLSGHSLADPAVMGRHGGGGS  108

Query  3938  DPvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
             D          G       V         LPPDASSTLYVEGLP++ TRREV+HIFRPFV
Sbjct  109   DLAPNGRGVNYGGQLPVDAVSRPGPETGSLPPDASSTLYVEGLPSDSTRREVAHIFRPFV  168

Query  3782  GYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             GY+EVRLV+KES+   GDP   CFVDFA+PA AATAM ALQG
Sbjct  169   GYREVRLVSKESKHRGGDPHYLCFVDFANPACAATAMSALQG  210



>ref|XP_003556145.1| PREDICTED: uncharacterized protein LOC100813445 isoformX1 [Glycine 
max]
Length=252

 Score =   159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 135/225 (60%), Gaps = 28/225 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             M D +W      +Q        S + KRPR+EYD + S     +++  Y AR+D   G H
Sbjct  1     MTDGFWN-----RQQQQPLQPSSAMLKRPRTEYDMSPSGLTGGNEMHNYIARNDDHTG-H  54

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAG-------HPTEDPRVLGIGG  3942
             R+++DT  +G++YDRYLQSA ++++  GE++     G+         H   DP V+G  G
Sbjct  55    RMLKDTKTLGSAYDRYLQSAGLTSFNSGEASAIGGVGLGRGVGGLPRHSLTDPAVMGHPG  114

Query  3941  SDPvgakgramggvgggRT----------EVHLPPDASSTLYVEGLPANCTRREVSHIFR  3792
                  A+       GG  T           V LPPDASSTLYVEGLP++ TRREV+HIFR
Sbjct  115   GGHDLARNGRNVNYGGQLTVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIFR  174

Query  3791  PFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             PFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  175   PFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  219



>ref|XP_007143521.1| hypothetical protein PHAVU_007G078500g [Phaseolus vulgaris]
 gb|ESW15515.1| hypothetical protein PHAVU_007G078500g [Phaseolus vulgaris]
Length=224

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 119/183 (65%), Gaps = 20/183 (11%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES--------ARPLT  3996
             +++  Y AR+D   G HR+++DT  +G++YDRYLQ+A ++++  GE+        AR + 
Sbjct  11    NEMHNYIARNDDHTG-HRMLKDTKTLGSAYDRYLQNAGLTSFNSGEASAIGGVGLARSV-  68

Query  3995  GGMAGHPTEDPRVLGI--GGSDPvgakgram--------ggvgggRTEVHLPPDASSTLY  3846
             GG+ GH   DP V+G   GG D                      G   V LPPDASSTLY
Sbjct  69    GGLPGHSLSDPSVMGHPGGGHDLARNGRNVNYGGQLPVDTASMPGPETVPLPPDASSTLY  128

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             VEGLP++ TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ A
Sbjct  129   VEGLPSDSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSA  188

Query  3665  LQG  3657
             LQG
Sbjct  189   LQG  191



>ref|XP_006606160.1| PREDICTED: uncharacterized protein LOC100812551 isoform X3 [Glycine 
max]
 gb|KHN46428.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=253

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 136/227 (60%), Gaps = 31/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D  W     RQQ P   +   L  KRPR+EYD + S      +++  Y  R+D   G 
Sbjct  1     MTDGSWN----RQQQPFLPSSAML--KRPRTEYDISPSGLTSGGNEMHNYIGRNDDHTG-  53

Query  4103  HRVIRDTDPIGASYDRYLQSA-KVSAYGGGESA-------RPLTGGMAGHPTEDPRVLGI  3948
             HR+++DT  +G+++DRYLQSA +++++  GE++           GG+  H   DP V+G 
Sbjct  54    HRILKDTKTLGSAFDRYLQSAGQLTSFNSGEASAIGSVGLERGVGGLPRHSLTDPAVMGH  113

Query  3947  ---------GGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHI  3798
                      GG +        +        E V LPPDASSTLYVEGLP++ TRREV+HI
Sbjct  114   PGGGHDLARGGRNVNYGDQLPVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHI  173

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  174   FRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  220



>ref|XP_003556144.1| PREDICTED: uncharacterized protein LOC100812551 isoformX2 [Glycine 
max]
Length=244

 Score =   157 bits (397),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 132/221 (60%), Gaps = 28/221 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D  W     RQQ P   +   L  KRPR+EY     H+   Y  R+D   G HR+++D
Sbjct  1     MTDGSWN----RQQQPFLPSSAML--KRPRTEYGGNEMHN---YIGRNDDHTG-HRILKD  50

Query  4085  TDPIGASYDRYLQSA-KVSAYGGGESA-------RPLTGGMAGHPTEDPRVLGI------  3948
             T  +G+++DRYLQSA +++++  GE++           GG+  H   DP V+G       
Sbjct  51    TKTLGSAFDRYLQSAGQLTSFNSGEASAIGSVGLERGVGGLPRHSLTDPAVMGHPGGGHD  110

Query  3947  ---GGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVG  3780
                GG +        +        E V LPPDASSTLYVEGLP++ TRREV+HIFRPFVG
Sbjct  111   LARGGRNVNYGDQLPVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIFRPFVG  170

Query  3779  YKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             Y+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  171   YREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  211



>ref|XP_009368481.1| PREDICTED: uncharacterized protein LOC103957982 [Pyrus x bretschneideri]
 ref|XP_009368482.1| PREDICTED: uncharacterized protein LOC103957982 [Pyrus x bretschneideri]
 ref|XP_009368483.1| PREDICTED: uncharacterized protein LOC103957982 [Pyrus x bretschneideri]
Length=249

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 126/222 (57%), Gaps = 24/222 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D  W     +QQP         + KRPRS+Y      ++ GY+AR+D  GG  R ++D
Sbjct  1     MGDGLWNRQQQQQQPQQQLGPSGGVHKRPRSDY----GQEMHGYFAREDDIGGP-RTVKD  55

Query  4085  TDPIGASYDRYLQSAK--------VSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPv  3930
             +  IG++YDRYLQ+A+        VS +GG    R + GGM+G P  D  + G  G+   
Sbjct  56    SRSIGSAYDRYLQNAEMPSYASGEVSTFGGAGMGRAVGGGMSGPPMADHSMRGRPGAMSS  115

Query  3929  gakgramggvgggRTEVH-----------LPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
                          +  V            LP DASSTLYVEGLP + TRREV+HIFRPFV
Sbjct  116   DLLTNGRNMNLANQLPVDATARPGRETVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFV  175

Query  3782  GYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             GYK VRLV+KES+   GDPL+ CFVDF +PA AATAM ALQG
Sbjct  176   GYKAVRLVSKESKHRGGDPLILCFVDFENPACAATAMSALQG  217



>ref|XP_003536435.1| PREDICTED: uncharacterized protein LOC100816230 isoformX1 [Glycine 
max]
Length=251

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 130/226 (58%), Gaps = 31/226 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D  W     RQQ     +      KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGSWN----RQQSFLPPSAML---KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  52

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESA-------RPLTGGMAGHPTEDPRVLGI-  3948
             HR+++DT  +G++YDRYLQSA ++++  GE++           GG+  H   DP V G  
Sbjct  53    HRILKDTKTLGSAYDRYLQSAGLTSFNSGEASAISSVGLGRGVGGLPHHSLTDPAVTGHP  112

Query  3947  -GGSDPvgakgramggvgggR--------TEVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
              GG D                          + LPPDASSTLYVEGLP+  TRREV+HIF
Sbjct  113   GGGHDLSRNGRNVNYASQLPVDAASMPGPETLPLPPDASSTLYVEGLPSGSTRREVAHIF  172

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  173   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  218



>gb|KDO83670.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=275

 Score =   157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 133/249 (53%), Gaps = 53/249 (21%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPA------------------------  4158
             MAD YW     RQQ     +   L  KRPRS+YD                          
Sbjct  1     MADGYWN----RQQASLLPSGGML--KRPRSDYDKGYDISILVEFGALTLCEEMQDLPPS  54

Query  4157  ---NSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA-------  4008
                + HD+  Y ++DD  G +   ++DT  IG++YDRYLQSA+ S++  GE++       
Sbjct  55    EVLSRHDMHNYLSQDDDLGELQ-PLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRL  113

Query  4007  -RPLTGGMAGHPTEDPRVLGIGG-----------SDPvgakgramggvgggRTEVHLPPD  3864
              R + GG+   P  DP V G  G           S  +  +         G   + LPPD
Sbjct  114   RRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPD  173

Query  3863  ASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHA  3684
             ASSTLYVEGLPA+ T+REV+HIFRPFVGYKEVRLV KES+   GDPL+ CFVDF +PA A
Sbjct  174   ASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLRGGDPLILCFVDFENPACA  233

Query  3683  ATAMDALQG  3657
             ATA+ ALQG
Sbjct  234   ATALSALQG  242



>dbj|BAJ89959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   159 bits (401),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 122/191 (64%), Gaps = 22/191 (12%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     ++AGYY R++   G H  +RD + IGASYDRYL++   S     E 
Sbjct  74    KRARPDYGDGPGGQEMAGYYPRENA--GYHS-LRDNEAIGASYDRYLRNGMPSV-AANEP  129

Query  4010  ARPLTGGM----------AGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDA  3861
             +R + G M          +G+P +D R++G+ G D       +     G R E  LPPDA
Sbjct  130   SRAVVGAMGGAAMVGGGMSGYPVDDRRMMGVVGMD-------SRAMGYGARPEPPLPPDA  182

Query  3860  SSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAA  3681
             S+TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF SPA A 
Sbjct  183   SNTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDSPAQAT  242

Query  3680  TAMDALQGEVT  3648
              A++ALQGE T
Sbjct  243   IALEALQGENT  253



>ref|XP_010260912.1| PREDICTED: uncharacterized protein LOC104599867 isoform X2 [Nelumbo 
nucifera]
Length=249

 Score =   156 bits (394),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 133/224 (59%), Gaps = 29/224 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-----PANSHDLAGYYARDDGRGGVH  4101
             MAD YW     RQ     +       KRPR +YD       + H++  Y  RD+ RGG  
Sbjct  1     MADGYWN----RQPSLNPSFGLP---KRPRPDYDFPPHQVPSGHEMLNYLPRDEDRGGT-  52

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESAR---------PLTGGMAGHPTEDPRVLG-  3951
             RV++DT  +G++YDRYLQSA++S++G GE++           +  G    P  +P ++G 
Sbjct  53    RVLKDTKTLGSAYDRYLQSAQLSSFGSGEASNFGGGTGFGRGVGAGTPSLPVGEPDMIGG  112

Query  3950  IGGSDPvgakgramggvgggRTE------VHLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
              G  +P  A      G GG + +        LPPDASSTL+VEGLP + TRREV HIFRP
Sbjct  113   RGPVNPDLAPNGRGMGFGGLQVDRPGREMPPLPPDASSTLFVEGLPPDSTRREVGHIFRP  172

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             F+G+KEVRLV KE R   GDPL+ CFVDF +PA AATA++ALQG
Sbjct  173   FLGFKEVRLVNKEPRHRGGDPLILCFVDFTTPACAATALNALQG  216



>ref|XP_008339125.1| PREDICTED: uncharacterized protein LOC103402165 [Malus domestica]
Length=246

 Score =   156 bits (394),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 120/196 (61%), Gaps = 24/196 (12%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KRPRS+Y      ++ GY+AR+D  GG  R ++D+  IG++YDRYLQ+A++ +Y  GE++
Sbjct  24    KRPRSDY----GQEMHGYFAREDDIGGP-RTVKDSRSIGSAYDRYLQNAEMPSYTSGEAS  78

Query  4007  --------RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH--------  3876
                     R + GGM+G P  D  + G  G+                +  V         
Sbjct  79    TFGGAGMGRAVGGGMSGPPMADHSMRGRPGAMSSDLLTNGRNMNLANQLPVDATARPGRE  138

Query  3875  ---LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVD  3705
                LP DASSTLYVEGLP + TRREV+HIFRPFVGYK VRLV+KES+   GDPL+ CFVD
Sbjct  139   TVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFVGYKAVRLVSKESKHRGGDPLILCFVD  198

Query  3704  FASPAHAATAMDALQG  3657
             F +PA AATAM ALQG
Sbjct  199   FENPACAATAMSALQG  214



>gb|EEC83987.1| hypothetical protein OsI_30140 [Oryza sativa Indica Group]
Length=218

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 119/184 (65%), Gaps = 17/184 (9%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     D+ GYY R+  R G H  +R+ + IGASYDRYL++   S     E+
Sbjct  12    KRARPDYGDVPAGQDMTGYYPRETDRTGYH-ALRENEAIGASYDRYLRNGMPSV-AATET  69

Query  4010  ARPLTGGMAG------HPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTL  3849
              RP+ GGM G      +P +D R++G+G          + G   G R E  LP DASSTL
Sbjct  70    NRPVVGGMGGMGGMGGYPVDDRRMIGVG--------MDSRGMGYGARPEPPLPADASSTL  121

Query  3848  YVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMD  3669
             YVEGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF +PA A  A++
Sbjct  122   YVEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATLALE  181

Query  3668  ALQG  3657
             ALQG
Sbjct  182   ALQG  185



>ref|XP_006660358.1| PREDICTED: uncharacterized protein LOC102722699 [Oryza brachyantha]
Length=225

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 16/184 (9%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     D+ GYY R+  R   +  +R+ + IGASYDRYL++   S     E+
Sbjct  18    KRARPDYGDVPAGQDMTGYYPRETDRAAGYHALRENEAIGASYDRYLRNGMPSV-AASET  76

Query  4010  ARPLTGGMAG------HPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTL  3849
              RP+  GM        +P +D R++G+G          + G   G R E  LP DASSTL
Sbjct  77    TRPVVAGMGAMGGMGGYPVDDRRMIGVG--------MDSRGMGYGARPEPPLPADASSTL  128

Query  3848  YVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMD  3669
             YVEGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF +PA A  A++
Sbjct  129   YVEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATLALE  188

Query  3668  ALQG  3657
             ALQG
Sbjct  189   ALQG  192



>ref|XP_004290545.1| PREDICTED: uncharacterized protein LOC101304343 [Fragaria vesca 
subsp. vesca]
Length=239

 Score =   155 bits (391),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 117/189 (62%), Gaps = 13/189 (7%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD   S     H++  Y A DD  GG  R ++DT  IG++YDRYLQ+ ++S+  
Sbjct  19    KRPRSDYDLPTSGLYSGHEMNNYLAHDDDFGGP-RAVKDTKSIGSAYDRYLQTGQMSSTT  77

Query  4022  --GGESARPLTGGMAGHPTEDPRVLG---IGGSDPvgakgramggvggg--RTEVHLPPD  3864
               G    RP+  GMA H    P  +    I G +   A+                 LPPD
Sbjct  78    MVGVGLGRPVGNGMADHLMGRPGAVASDLISGRNISLAQLPVDAISRLAPGHETAPLPPD  137

Query  3863  ASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHA  3684
             A++TLY+EGLP + TRREV+HIFRPFVGYKEVRLV+KES+   GDPL+ CFVDF +PA A
Sbjct  138   ATNTLYIEGLPPDSTRREVAHIFRPFVGYKEVRLVSKESKLRGGDPLILCFVDFVNPACA  197

Query  3683  ATAMDALQG  3657
             ATAM ALQG
Sbjct  198   ATAMSALQG  206



>ref|XP_008347759.1| PREDICTED: protein WHI4-like [Malus domestica]
 ref|XP_008347760.1| PREDICTED: protein WHI4-like [Malus domestica]
Length=248

 Score =   155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 119/196 (61%), Gaps = 24/196 (12%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KRPRS+Y      ++ GY+AR+D  GG  R ++D   IG++YDRYLQ+A++++Y  GE++
Sbjct  26    KRPRSDY----GQEMHGYFAREDDLGGP-RTVKDNRSIGSAYDRYLQNAEMASYTSGEAS  80

Query  4007  --------RPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH--------  3876
                     R + GGM G P  D  + G  G+                +  V         
Sbjct  81    TFGGAGMGRAVGGGMTGPPMADHSMRGRPGAMSSDVLTNGRNMNLANQLPVDSMPRPGRE  140

Query  3875  ---LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVD  3705
                LP DASSTLYVEGLP + TRREV+HIFRPFVGYK VRLV+KES+   GDPL+ CFVD
Sbjct  141   TVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFVGYKAVRLVSKESKHRGGDPLILCFVD  200

Query  3704  FASPAHAATAMDALQG  3657
             F +PA AATA+ ALQG
Sbjct  201   FENPACAATALSALQG  216



>ref|XP_008441534.1| PREDICTED: uncharacterized protein LOC103485638 [Cucumis melo]
 ref|XP_008441535.1| PREDICTED: uncharacterized protein LOC103485638 [Cucumis melo]
Length=257

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 134/233 (58%), Gaps = 39/233 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PANS----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQP   +       KRPR++Y+ PA+     HD+  Y A DD RGG  
Sbjct  1     MADDYWN----RQQPLLPSPAML---KRPRTDYELPASGLSTGHDMHNYLASDD-RGGP-  51

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGE--------------SARPLTGGMAGHPTEDP  3963
             R ++DT  IG++YDRYLQS ++S++  GE              +  P+   M G    DP
Sbjct  52    RSVKDTQTIGSAYDRYLQSVQLSSFTSGEVPTHGEMGMGRPVANRMPVGNRMPGPLLPDP  111

Query  3962  RV----------LGIGGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTR  3816
              V          L   G +        +  +     E V LPPDAS+TLYVEGLP + +R
Sbjct  112   IVMSRPPAVSPDLAPNGRNIEYGNHLPVDSMSRPGRETVPLPPDASNTLYVEGLPPDSSR  171

Query  3815  REVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             REV+HIFRPFVGYKE+RLV+KES+   GDPL+ CFVDFA+PA AATAM ALQG
Sbjct  172   REVAHIFRPFVGYKELRLVSKESKHRGGDPLILCFVDFANPACAATAMSALQG  224



>ref|XP_006606159.1| PREDICTED: uncharacterized protein LOC100813445 isoform X2 [Glycine 
max]
Length=253

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 136/226 (60%), Gaps = 29/226 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             M D +W      +Q        S + KRPR+EYD + S     +++  Y AR+D   G H
Sbjct  1     MTDGFWN-----RQQQQPLQPSSAMLKRPRTEYDMSPSGLTGGNEMHNYIARNDDHTG-H  54

Query  4100  RVIRDTDPIGASYDRYLQSA-KVSAYGGGESARPLTGGMAG-------HPTEDPRVLGIG  3945
             R+++DT  +G++YDRYLQSA +++++  GE++     G+         H   DP V+G  
Sbjct  55    RMLKDTKTLGSAYDRYLQSAGQLTSFNSGEASAIGGVGLGRGVGGLPRHSLTDPAVMGHP  114

Query  3944  GSDPvgakgramggvgggRT----------EVHLPPDASSTLYVEGLPANCTRREVSHIF  3795
             G     A+       GG  T           V LPPDASSTLYVEGLP++ TRREV+HIF
Sbjct  115   GGGHDLARNGRNVNYGGQLTVDAASMPGPETVPLPPDASSTLYVEGLPSDSTRREVAHIF  174

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  175   RPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  220



>emb|CDY00368.1| BnaC07g14580D [Brassica napus]
Length=227

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 125/218 (57%), Gaps = 38/218 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YW     + QPP ++       KRPRS++     HD+  Y +RD+ RGG    ++D
Sbjct  1     MADGYWN-QQRQHQPPMSSISHGGPPKRPRSDF----GHDMHSYVSRDEDRGGA---VKD  52

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESAR---------------PLTGGMAGHPTEDPRVLG  3951
             T  IG++YD YLQS + S+    E  R               P   G  G      R LG
Sbjct  53    TRTIGSAYDLYLQSVQTSSMPSEEVGRFNNGVGMGRRGGGMLPPDFGPNG------RGLG  106

Query  3950  IGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKE  3771
              G  D               R  + LPPDAS+TL+VEGLP+NC+RREVSHIFRPF+GYKE
Sbjct  107   FGQQD---------LVGRPSRELLRLPPDASNTLFVEGLPSNCSRREVSHIFRPFLGYKE  157

Query  3770  VRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VRLVTK+S++ +GDP+V CFVDF +PA AATA  ALQG
Sbjct  158   VRLVTKDSKQRNGDPIVLCFVDFENPACAATARTALQG  195



>ref|XP_002302187.1| RNA-binding family protein [Populus trichocarpa]
 gb|EEE81460.1| RNA-binding family protein [Populus trichocarpa]
Length=250

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 135/223 (61%), Gaps = 26/223 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARD-DGRGGVHRVIR  4089
             M D YW     RQQP    +   L  KRPRS+YD  +S+++  YY RD D     +  ++
Sbjct  1     MTDGYWN----RQQPSNVPSSGML--KRPRSDYDMPSSYEMQNYYPRDVDDDRTRYETVK  54

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTED------PRVLG  3951
             D+  IG++YDRYLQ+A+   +   E++        R + GGM+G P  D      PR  G
Sbjct  55    DSKSIGSAYDRYLQNAQAPTFASREASALGGAGFGRGIGGGMSGLPIADSAVMTRPRSAG  114

Query  3950  I----GGSDPvgakgramggvgggRTEV-HLPPDASSTLYVEGLPANCTRREVSHIFRPF  3786
             +     G D    + R    +     E+ HLPPDAS+TLYVEG P +C+RREV+HIFRPF
Sbjct  115   LDLASNGRDVGFVRQRPEDRIARSDREMAHLPPDASNTLYVEGFPPDCSRREVAHIFRPF  174

Query  3785  VGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VGYKEVRLV+KE+R+  GDP++ CFVDF +P  AATAM ALQG
Sbjct  175   VGYKEVRLVSKEARQRGGDPIILCFVDFVNPECAATAMSALQG  217



>ref|XP_011042823.1| PREDICTED: uncharacterized protein LOC105138451 isoform X1 [Populus 
euphratica]
Length=250

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 135/223 (61%), Gaps = 26/223 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARD-DGRGGVHRVIR  4089
             MAD YW     RQQP    +   L  KRPR +YD  +S+++  YY RD D     +  ++
Sbjct  1     MADGYWN----RQQPSNVPSSGML--KRPRPDYDMPSSYEMQNYYPRDVDDDRTRYETVK  54

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTED------PRVLG  3951
             D+  IG++YDRYLQ+A+   +   E++        R + GGM+G P  D      PR  G
Sbjct  55    DSKTIGSAYDRYLQNAQAPTFASREASALGGAGFGRGIGGGMSGLPIADSAVMTRPRSAG  114

Query  3950  I----GGSDPvgakgramggvgggRTEV-HLPPDASSTLYVEGLPANCTRREVSHIFRPF  3786
             +     G D    + R    +     E+ HLPPDAS+TLYVEG P +C+RREV+HIFRPF
Sbjct  115   LDLASNGRDVGFVRQRTEDRIARSDREMAHLPPDASNTLYVEGFPPDCSRREVAHIFRPF  174

Query  3785  VGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VGYKEVRLV+KE+R+  GDP++ CFVDF +P  AATAM ALQG
Sbjct  175   VGYKEVRLVSKEARQRGGDPIILCFVDFVNPECAATAMSALQG  217



>dbj|BAJ90751.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98854.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 120/188 (64%), Gaps = 22/188 (12%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     ++AGYY R++   G H  +RD + IGASYDRYL++   S     E 
Sbjct  74    KRARPDYGDGPGGQEMAGYYPRENA--GYH-SLRDNEAIGASYDRYLRNGMPSV-AANEP  129

Query  4010  ARPLTGGM----------AGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDA  3861
             +R + G M          +G+P +D R++G+ G D       +     G R E  LPPDA
Sbjct  130   SRAVVGAMGGAAMVGGGMSGYPVDDRRMMGVVGMD-------SRAMGYGARPEPPLPPDA  182

Query  3860  SSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAA  3681
             S+TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF SPA A 
Sbjct  183   SNTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDSPAQAT  242

Query  3680  TAMDALQG  3657
              A++ALQG
Sbjct  243   IALEALQG  250



>ref|XP_010245283.1| PREDICTED: uncharacterized protein LOC104588859 [Nelumbo nucifera]
Length=253

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 136/235 (58%), Gaps = 47/235 (20%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-----PANSHDLAGYYARDDGRGGVH  4101
             MAD YW     RQ   P     + L KRPR +YD       + H++  Y  RD+ RGG  
Sbjct  1     MADGYWN----RQ---PPMYPSAGLPKRPRPDYDFQPPVAPSGHEMLNYLPRDEDRGGT-  52

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESAR---------PLTGGMAGHPTEDP-----  3963
             RV++DT  +G++YDRYLQSA++S++G GE++           + GGM   P  +P     
Sbjct  53    RVLKDTKTLGSAYDRYLQSAQLSSFGSGEASNFGGGTGFGRGVGGGMPNLPVGEPTMVGG  112

Query  3962  ------------RVLGIGGSDPvgakgramggvgggRTEVH-LPPDASSTLYVEGLPANC  3822
                         R +G GG  PV +  R          EV  LPPDAS+TL+VEGLP + 
Sbjct  113   RSTVAPDLAPNGRGMGYGGQLPVDSMARPGR-------EVQPLPPDASNTLFVEGLPLDS  165

Query  3821  TRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             T REV+HIFRPF+GYKEVRLV KE +   GDPL+ CFVDF +PA AATA++ALQG
Sbjct  166   THREVAHIFRPFLGYKEVRLVNKEPKHRGGDPLILCFVDFTTPACAATALNALQG  220



>gb|AFK38418.1| unknown [Medicago truncatula]
Length=252

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 137/230 (60%), Gaps = 39/230 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD +W     RQQ         L  KRPR+EYD A S     +++  Y A+++G    H
Sbjct  1     MADGFWN----RQQQHLPPPGGML--KRPRTEYDTAPSGVTSGNEVHNYIAQNNG----H  50

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMA---------GHPTEDPRVLG-  3951
             +++ DT  +G++YDR+LQSA ++++  GE++  + GG+          GH   DP  +G 
Sbjct  51    QMLNDTKILGSAYDRFLQSAGLTSFNSGEAS--VIGGVGFARGVGELPGHSLGDPSAMGH  108

Query  3950  ---IGGSDPvgakgramggvgggRTE---------VHLPPDASSTLYVEGLPANCTRREV  3807
                +GG   +   GR     G    +         + LP DASSTLYVEGLP++ T+REV
Sbjct  109   LSGVGGGPDLSRNGRDANFGGQLPIDAVSRPGPETIPLPRDASSTLYVEGLPSDSTKREV  168

Query  3806  SHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +HIFRPFVGY+EVRLV KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  169   AHIFRPFVGYREVRLVAKESKHRGGDPLILCFVDFANPACAATALSALQG  218



>ref|XP_004148806.1| PREDICTED: uncharacterized protein LOC101222348 isoform 1 [Cucumis 
sativus]
 ref|XP_004148807.1| PREDICTED: uncharacterized protein LOC101222348 isoform 2 [Cucumis 
sativus]
Length=257

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 133/233 (57%), Gaps = 39/233 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PANS----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQP   +       KRPR++Y+ PA+     HD+  Y   DD RGG  
Sbjct  1     MADDYWN----RQQPLLPSPAML---KRPRTDYELPASGLSTGHDMHNYLTSDD-RGGP-  51

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGE--------------SARPLTGGMAGHPTEDP  3963
             R ++DT  IG++YDRYLQS ++S++  GE              +  P+   M G    DP
Sbjct  52    RSVKDTQTIGSAYDRYLQSVQLSSFTSGEVPTHGEMGMGRPVANRMPVGNRMPGPLLPDP  111

Query  3962  RV----------LGIGGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTR  3816
              V          L   G +        +  +     E V LPPDAS+TLYVEGLP + +R
Sbjct  112   IVMSRPPAVSPDLAPNGRNLEYGNHLPVDSMSRPGRETVPLPPDASNTLYVEGLPPDSSR  171

Query  3815  REVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             REV+HIFRPFVGYKE+RLV+KES+   GDPL+ CFVDFA+PA AATAM ALQG
Sbjct  172   REVAHIFRPFVGYKELRLVSKESKHRGGDPLILCFVDFANPACAATAMSALQG  224



>ref|XP_006589497.1| PREDICTED: uncharacterized protein LOC100816230 isoform X2 [Glycine 
max]
Length=252

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 131/227 (58%), Gaps = 32/227 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS------HDLAGYYARDDGRGGV  4104
             M D  W     RQQ     +      KRPR+EYD + S      +++  Y AR+D   G 
Sbjct  1     MTDGSWN----RQQSFLPPSAML---KRPRTEYDMSPSGLTSGGNEMHNYIARNDDHTG-  52

Query  4103  HRVIRDTDPIGASYDRYLQSA-KVSAYGGGESA-------RPLTGGMAGHPTEDPRVLGI  3948
             HR+++DT  +G++YDRYLQSA +++++  GE++           GG+  H   DP V G 
Sbjct  53    HRILKDTKTLGSAYDRYLQSAGQLTSFNSGEASAISSVGLGRGVGGLPHHSLTDPAVTGH  112

Query  3947  --GGSDPvgakgramggvgggR--------TEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
               GG D                          + LPPDASSTLYVEGLP+  TRREV+HI
Sbjct  113   PGGGHDLSRNGRNVNYASQLPVDAASMPGPETLPLPPDASSTLYVEGLPSGSTRREVAHI  172

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  173   FRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSALQG  219



>ref|XP_003592142.1| RNA-binding protein with multiple splicing [Medicago truncatula]
 gb|AES62393.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=252

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 138/230 (60%), Gaps = 39/230 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD +W     RQQ         L  KRPR+EYD A S     +++  Y A+++G    H
Sbjct  1     MADGFWN----RQQQHLPPPGGML--KRPRTEYDTAPSGVTSGNEVHNYIAQNNG----H  50

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMA---------GHPTEDPRVLG-  3951
             +++ DT  +G++YDR+LQSA ++++  GE++  + GG+          GH   DP  +G 
Sbjct  51    QMLNDTKILGSAYDRFLQSAGLTSFNSGEAS--VIGGVGFARGVGELPGHSLGDPSAMGH  108

Query  3950  ---IGGSDPvgakgramggvgggRTE---------VHLPPDASSTLYVEGLPANCTRREV  3807
                +GG   +   GR +   G    +         + LP DASSTLYVEGLP++ T+REV
Sbjct  109   LSGVGGGPDLSRNGRDVNFGGQLPIDAVSRPGPETIPLPRDASSTLYVEGLPSDSTKREV  168

Query  3806  SHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +HIFRPFVGY+EVRLV KES+   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  169   AHIFRPFVGYREVRLVAKESKHRGGDPLILCFVDFANPACAATALSALQG  218



>ref|XP_009368250.1| PREDICTED: protein WHI3-like [Pyrus x bretschneideri]
 ref|XP_009368251.1| PREDICTED: protein WHI3-like [Pyrus x bretschneideri]
Length=244

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 124/222 (56%), Gaps = 29/222 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             M D  W      +Q          + KRPRS+Y      ++ GY+AR+D  GG  R ++D
Sbjct  1     MGDGIWN-----RQQQQQLGPSGGVHKRPRSDY----GQEMHGYFAREDDLGGP-RTVKD  50

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVLGIGGSDPv  3930
                IG++YDRYLQ+A++++Y  GE++        R + GGM G    D  + G  G+   
Sbjct  51    NRSIGSAYDRYLQNAEMASYTSGEASTFGGAGMGRAVGGGMTGPTMADHSMRGRPGAMSS  110

Query  3929  gakgramggvgggRTEVH-----------LPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
                          +  V            LP DASSTLYVEGLP + TRREV+HIFRPFV
Sbjct  111   DVLTNGRNLNLANQLPVDSMPRPGRETVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFV  170

Query  3782  GYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             GYK VRLV+KES+   GDPL+ CFVDF +PA AATA+ ALQG
Sbjct  171   GYKAVRLVSKESKHRGGDPLILCFVDFENPACAATALSALQG  212



>gb|EEE69106.1| hypothetical protein OsJ_28175 [Oryza sativa Japonica Group]
Length=268

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 119/184 (65%), Gaps = 17/184 (9%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     D+ GYY R+  R G H  +R+ + IGASYDRYL++   S     E+
Sbjct  62    KRARPDYGDVPAGQDMTGYYPRETDRTGYH-ALRENEAIGASYDRYLRNGMPSV-AATET  119

Query  4010  ARPLTGGMAG------HPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTL  3849
              RP+ GGM G      +P +D R++G+G          + G   G R E  LP DASSTL
Sbjct  120   NRPVVGGMGGMGGMGGYPVDDRRMIGVG--------MDSRGMGYGARPEPPLPADASSTL  171

Query  3848  YVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMD  3669
             YVEGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF +PA A  A++
Sbjct  172   YVEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATLALE  231

Query  3668  ALQG  3657
             ALQG
Sbjct  232   ALQG  235



>ref|XP_010260913.1| PREDICTED: uncharacterized protein LOC104599867 isoform X3 [Nelumbo 
nucifera]
Length=223

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 132/229 (58%), Gaps = 34/229 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPA----------NSHDLAGYYARDDG  4116
             MAD YW     RQ     +       KRPR +Y             + H++  Y  RD+ 
Sbjct  1     MADGYWN----RQPSLNPSFGLP---KRPRPDYASTVADFPPHQVPSGHEMLNYLPRDED  53

Query  4115  RGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESAR---------PLTGGMAGHPTEDP  3963
             RGG  RV++DT  +G++YDRYLQSA++S++G GE++           +  G    P  +P
Sbjct  54    RGGT-RVLKDTKTLGSAYDRYLQSAQLSSFGSGEASNFGGGTGFGRGVGAGTPSLPVGEP  112

Query  3962  RVLG-IGGSDPvgakgramggvgggRTE------VHLPPDASSTLYVEGLPANCTRREVS  3804
              ++G  G  +P  A      G GG + +        LPPDASSTL+VEGLP + TRREV 
Sbjct  113   DMIGGRGPVNPDLAPNGRGMGFGGLQVDRPGREMPPLPPDASSTLFVEGLPPDSTRREVG  172

Query  3803  HIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             HIFRPF+G+KEVRLV KE R   GDPL+ CFVDF +PA AATA++ALQG
Sbjct  173   HIFRPFLGFKEVRLVNKEPRHRGGDPLILCFVDFTTPACAATALNALQG  221



>gb|KDO83677.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=249

 Score =   153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 115/184 (63%), Gaps = 20/184 (11%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLT  3996
             HD+  Y ++DD  G + + ++DT  IG++YDRYLQSA+ S++  GE++        R + 
Sbjct  34    HDMHNYLSQDDDLGEL-QPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVP  92

Query  3995  GGMAGHPTEDPRVLGIGG-----------SDPvgakgramggvgggRTEVHLPPDASSTL  3849
             GG+   P  DP V G  G           S  +  +         G   + LPPDASSTL
Sbjct  93    GGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTL  152

Query  3848  YVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMD  3669
             YVEGLPA+ T+REV+HIFRPFVGYKEVRLV KES+   GDPL+ CFVDF +PA AATA+ 
Sbjct  153   YVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLRGGDPLILCFVDFENPACAATALS  212

Query  3668  ALQG  3657
             ALQG
Sbjct  213   ALQG  216



>ref|XP_010537288.1| PREDICTED: uncharacterized protein LOC104812049 [Tarenaya hassleriana]
Length=246

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 130/227 (57%), Gaps = 36/227 (16%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     +QQ  P A       KRPR E++   S     H + GY  RDD RG + 
Sbjct  1     MADGYWN----QQQHLPRAP------KRPRPEFEALPSAMPSGHGMHGYMPRDDDRG-IF  49

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGES--------ARPLTGGMAGHPTEDPRVLGIG  3945
             + ++DT+ I ++YDRYLQS ++ +   GE+         R     M G    DP ++G G
Sbjct  50    QSVKDTETIDSAYDRYLQSVQMPSVPSGEAVPYNGVGLGRARGNAMPGPSMGDP-LMGRG  108

Query  3944  GSDPvgakgramggvgggRTE-----------VHLPPDASSTLYVEGLPANCTRREVSHI  3798
             G  P            G +             + LP DAS+TLYVEGLP+NC+RREV+HI
Sbjct  109   GVLPPDFGPNGRPTGYGKQPPFDGVGRHDHDALPLPRDASNTLYVEGLPSNCSRREVAHI  168

Query  3797  FRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FRPFVGYKEVRLVTKES+  +GDP+V CFVDF +PA AATA+ ALQG
Sbjct  169   FRPFVGYKEVRLVTKESKHRNGDPVVLCFVDFINPACAATALSALQG  215



>ref|XP_004162895.1| PREDICTED: uncharacterized LOC101222348 isoform 1 [Cucumis sativus]
 ref|XP_004162896.1| PREDICTED: uncharacterized LOC101222348 isoform 2 [Cucumis sativus]
Length=257

 Score =   152 bits (385),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 132/233 (57%), Gaps = 39/233 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PANS----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQP   +       KRPR++Y+ PA+     HD+  Y   DD RGG  
Sbjct  1     MADDYWN----RQQPLLPSPAML---KRPRTDYELPASGLSTGHDMHNYLTSDD-RGGP-  51

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGE--------------SARPLTGGMAGHPTEDP  3963
             R ++DT  IG++YDRYLQS ++S++  GE              +  P+   M G    DP
Sbjct  52    RSVKDTQTIGSAYDRYLQSVQLSSFTSGEVPTHGEMGMGRPVANRMPVRNRMPGPLLPDP  111

Query  3962  RV----------LGIGGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTR  3816
              V          L   G +        +  +     E V LPPDAS+TLYVEGLP + +R
Sbjct  112   IVMSRPPAVSPDLAPNGRNLEYGNHLPVDSMSRPGRETVPLPPDASNTLYVEGLPPDSSR  171

Query  3815  REVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             REV+HIFRPFVGYKE+R V+KES+   GDPL+ CFVDFA+PA AATAM ALQG
Sbjct  172   REVAHIFRPFVGYKELRFVSKESKHRGGDPLILCFVDFANPACAATAMSALQG  224



>ref|XP_010260909.1| PREDICTED: uncharacterized protein LOC104599867 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010260910.1| PREDICTED: uncharacterized protein LOC104599867 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010260911.1| PREDICTED: uncharacterized protein LOC104599867 isoform X1 [Nelumbo 
nucifera]
Length=254

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 132/229 (58%), Gaps = 34/229 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEY----------DPANSHDLAGYYARDDG  4116
             MAD YW     RQ     +       KRPR +Y             + H++  Y  RD+ 
Sbjct  1     MADGYWN----RQPSLNPSFGLP---KRPRPDYASTVADFPPHQVPSGHEMLNYLPRDED  53

Query  4115  RGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESAR---------PLTGGMAGHPTEDP  3963
             RGG  RV++DT  +G++YDRYLQSA++S++G GE++           +  G    P  +P
Sbjct  54    RGGT-RVLKDTKTLGSAYDRYLQSAQLSSFGSGEASNFGGGTGFGRGVGAGTPSLPVGEP  112

Query  3962  RVLG-IGGSDPvgakgramggvgggRTE------VHLPPDASSTLYVEGLPANCTRREVS  3804
              ++G  G  +P  A      G GG + +        LPPDASSTL+VEGLP + TRREV 
Sbjct  113   DMIGGRGPVNPDLAPNGRGMGFGGLQVDRPGREMPPLPPDASSTLFVEGLPPDSTRREVG  172

Query  3803  HIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             HIFRPF+G+KEVRLV KE R   GDPL+ CFVDF +PA AATA++ALQG
Sbjct  173   HIFRPFLGFKEVRLVNKEPRHRGGDPLILCFVDFTTPACAATALNALQG  221



>ref|XP_010539724.1| PREDICTED: uncharacterized protein LOC104813704 [Tarenaya hassleriana]
 ref|XP_010524183.1| PREDICTED: uncharacterized protein LOC104802330 [Tarenaya hassleriana]
Length=234

 Score =   151 bits (381),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 124/208 (60%), Gaps = 10/208 (5%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     ++Q PP    P    KRPRS ++   S      ++  Y  RD+      
Sbjct  1     MADGYWN-QQRQKQHPPPIIPPGGRLKRPRSGFETPGSAIPSGREIHNYLPRDEDHLSFQ  59

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvgak  3921
              V +D++ IG++YDRYLQS ++ +   GE A P  G   G P     V      +P   +
Sbjct  60    SV-KDSNTIGSAYDRYLQSMQMPSVPSGE-AGPFNGVGMGIPGRGNTVTDPSMGEPTMGQ  117

Query  3920  gramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRR  3741
                +         + LPPDAS+TLYVEGLP+NC+RREV+HIFRPFVGYKEVRLVTKES+ 
Sbjct  118   FNGVVRSSHDI--LPLPPDASNTLYVEGLPSNCSRREVAHIFRPFVGYKEVRLVTKESKL  175

Query  3740  PDGDPLVFCFVDFASPAHAATAMDALQG  3657
              +GDP+V CFVDF +PA AATA+ AL+G
Sbjct  176   RNGDPVVLCFVDFINPACAATALSALRG  203



>ref|XP_009767371.1| PREDICTED: uncharacterized protein LOC104218542 [Nicotiana sylvestris]
Length=251

 Score =   152 bits (383),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 130/231 (56%), Gaps = 42/231 (18%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP-------ANSHDLAGYYARDDGRGG  4107
             M DAYW      Q         + L KRPRSEY P       +++H++  Y  RDD RGG
Sbjct  1     MGDAYWN-----QHRQAPLPQSAGLLKRPRSEYVPDLPPSGMSSAHEMHHYLGRDDDRGG  55

Query  4106  VHRVIRDTDPIGASYDRYLQS--------AKVSAYGGGESARPLTGGMAGHPTEDP----  3963
               RV+ DT  IG++YDRYLQS         + + Y G   AR   GG++  P  DP    
Sbjct  56    P-RVV-DTQSIGSAYDRYLQSSQLSSLSVGEANNYKGVGLARAGAGGISSLPVRDPLPSA  113

Query  3962  ---------RVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRRE  3810
                      R + + G  PV +  R           + LPPDAS+TLY+EGLPA+ +RRE
Sbjct  114   RGPELAPNGRAMVLSGQMPVESLPRPR-------ETLPLPPDASNTLYIEGLPADSSRRE  166

Query  3809  VSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             V+HIFRPFVGYKEVRLV KES+   GDPL+ CFVDF  PA AATA+ ALQG
Sbjct  167   VAHIFRPFVGYKEVRLVRKESKHRGGDPLILCFVDFVDPACAATALSALQG  217



>ref|XP_009591634.1| PREDICTED: protein WHI3 [Nicotiana tomentosiformis]
Length=251

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 128/224 (57%), Gaps = 28/224 (13%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP-------ANSHDLAGYYARDDGRGG  4107
             M DAYW      Q         + L KRPRSEY P       +++H++  Y  RDD RGG
Sbjct  1     MGDAYWN-----QHREAPLPQSAGLLKRPRSEYVPDLPPSGMSSAHEMHHYLGRDDDRGG  55

Query  4106  VHRVIRDTDPIGASYDRYLQS--------AKVSAYGGGESARPLTGGMAGHPTEDPRV--  3957
               RV+ DT  IG++YDRYLQS         + + Y G   AR   GG++  P  DP    
Sbjct  56    P-RVV-DTQSIGSAYDRYLQSSQLSSLSVGEANNYKGVGLARAGAGGISSLPVRDPLPSA  113

Query  3956  ----LGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
                 L   G   V      +  +   R  + LPPDAS+TLY+EGLPA+ +RREV+HIFRP
Sbjct  114   RGPELAPNGRAMVLRGQMPVESLPRPRETLPLPPDASNTLYIEGLPADSSRREVAHIFRP  173

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             FVGYKEVRLV KES+   GDPL+ CFVDF  PA AATA+ ALQG
Sbjct  174   FVGYKEVRLVRKESKHRGGDPLILCFVDFVDPACAATALSALQG  217



>emb|CDY04617.1| BnaC05g16550D [Brassica napus]
Length=237

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 121/193 (63%), Gaps = 32/193 (17%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KR RS++D    HD   Y +RD+ RG  H V RDT  IG++YDRYLQSA+ S+    E+ 
Sbjct  29    KRHRSDFD----HD---YVSRDEDRGIPHSV-RDTRTIGSAYDRYLQSAQTSSMPSEEAG  80

Query  4007  R--------------PLTGGMAGHPTEDP--RVLGIGGSDPvgakgramggvgggRTEVH  3876
             R              P  GG+   P   P  R LG G  D        +     GR  + 
Sbjct  81    RFHVAGMGRRGGELMPGRGGVLMPPDFGPNGRDLGFGQQD--------LVVGRPGRELLR  132

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFAS  3696
             LPPDAS+TL+VEGLP+NC+RREVSHIFRPF+GYKEVRLVTK++++ +GDP+V CFVDF +
Sbjct  133   LPPDASNTLFVEGLPSNCSRREVSHIFRPFLGYKEVRLVTKDTKQRNGDPVVLCFVDFEN  192

Query  3695  PAHAATAMDALQG  3657
             PA AATA  ALQG
Sbjct  193   PACAATARTALQG  205



>gb|KHN24241.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=214

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 114/182 (63%), Gaps = 20/182 (11%)
 Frame = -2

Query  4145  LAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGM-------  3987
             +  + ARDD R G HR+++DT  IG++YDRYLQS ++S++  GE +  +  G+       
Sbjct  1     MHNHIARDDDRTG-HRMLKDTQTIGSAYDRYLQSGQLSSFTSGEVSTVVGLGLARGGGGG  59

Query  3986  -AGHPTEDPRVLGI---GGSDPvgakgramggvgggRTEVH--------LPPDASSTLYV  3843
              + H   DP V+G    GGSD          G       V         LPPDASSTLYV
Sbjct  60    LSDHSLADPAVMGRHGGGGSDLAPNGRGVNYGGQLPVDAVSRPGPETGSLPPDASSTLYV  119

Query  3842  EGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDAL  3663
             EGLP++ TRREV+HIFRPFVGY+EVRLV+KES+   GDP   CFVDFA+PA AATAM AL
Sbjct  120   EGLPSDSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPHYLCFVDFANPACAATAMSAL  179

Query  3662  QG  3657
             QG
Sbjct  180   QG  181



>gb|KHG04462.1| RNA-binding with multiple splicing 2 [Gossypium arboreum]
 gb|KHG07012.1| RNA-binding with multiple splicing 2 [Gossypium arboreum]
Length=280

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 108/252 (43%), Positives = 139/252 (55%), Gaps = 54/252 (21%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQP P       + KRPR++YD   S     H++    ARDD +GG H
Sbjct  1     MADNYWN----RQQPTPPMLSSGGMLKRPRTDYDAPPSGLHPAHEMHHNLARDDDQGG-H  55

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA------RPLTGGMAGHPTEDPRVLG----  3951
               ++DT  IG++YDRYLQSA++S++  GE++      R +   M   P  DP V+G    
Sbjct  56    LAVKDTKTIGSAYDRYLQSAQLSSFTSGEASTFGGLGRAVGVAMPARPMADPPVMGRPAS  115

Query  3950  -------IGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI--  3798
                     GG+   G +         GR  + LPPDAS+TL+VEGLP + TRREV+ I  
Sbjct  116   AAPDLALNGGNVSFGGQFPIDPMARLGRDILPLPPDASNTLFVEGLPPDSTRREVARILF  175

Query  3797  ------FRPFVGYKEVRLVTKESR------------RPD-------GDPLVFCFVDFASP  3693
                   FRPFVGYKEVRLV+KE +            +PD       GDP++ CFVDF+SP
Sbjct  176   NDALDIFRPFVGYKEVRLVSKEYKHLGNCHKCMLNAKPDALVMQRGGDPIILCFVDFSSP  235

Query  3692  AHAATAMDALQG  3657
             A AATAM ALQG
Sbjct  236   ACAATAMSALQG  247



>ref|XP_006416317.1| hypothetical protein EUTSA_v10008603mg [Eutrema salsugineum]
 gb|ESQ34670.1| hypothetical protein EUTSA_v10008603mg [Eutrema salsugineum]
Length=245

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 130/219 (59%), Gaps = 22/219 (10%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YW       QPP ++       KRPRS++D    +D+ GY +R++ RG  H V +D
Sbjct  1     MADGYWN-QQRHHQPPMSSIPHGGPPKRPRSDFD----NDMHGYLSREEDRGIPHSV-KD  54

Query  4085  TDPIGASYDRYLQSAKVSA--------YGGGESARPLTGGMAGHPTEDPRVLGIGGSDP-  3933
             T  IG++YDRYLQS +  +        + G    RP    +   P+ +  + G GG  P 
Sbjct  55    TRTIGSAYDRYLQSVQTPSVPSEEAGRFNGDGMGRPGGNSVMPSPSMNELMNGRGGILPP  114

Query  3932  -------vgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYK  3774
                        G+        R  + LPPDAS+TL+VEGLP+NC+RREV+HIFRPF+GY+
Sbjct  115   DFGPNGRALGFGQQDLAGRPSRELLRLPPDASNTLFVEGLPSNCSRREVAHIFRPFLGYR  174

Query  3773  EVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             EVRLVTK+S++ +GDP+V CFVDF + A AATA  ALQG
Sbjct  175   EVRLVTKDSKQRNGDPIVLCFVDFDNSACAATARTALQG  213



>ref|XP_010477393.1| PREDICTED: uncharacterized protein LOC104756489 isoform X1 [Camelina 
sativa]
Length=255

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 127/223 (57%), Gaps = 22/223 (10%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD---PA---NSHDLAGYYARDDGRGGV  4104
             MAD YW     + QPP ++       KR RS+++   P+   + HD   Y +RD+   G+
Sbjct  1     MADGYWNQQQRQYQPPTSSTHHGGPPKRHRSDFEGPPPSVMPSGHDRHSYMSRDEEDRGI  60

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPT-----EDPRVLGIGGS  3939
                + DT  IG++YDRYLQS +  +    E A P  G   G P        P + G GG 
Sbjct  61    PHSLNDTRTIGSAYDRYLQSMQTPSVPS-EEADPFNGVGMGRPAGTNMMPGPTMGGRGGL  119

Query  3938  DPvgakgramggvgggRTEV--------HLPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
              P   +        G    V         LPPD S+TLYVEGLP+NC+RREVSHIFRPFV
Sbjct  120   LPPDFRTNGRDMGHGQPDSVGRPSRKLNSLPPDVSNTLYVEGLPSNCSRREVSHIFRPFV  179

Query  3782  GYKEVRLVTKESR--RPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             GY+EVRLVTK+S+  R +GDP+V CFVDF SPA AATA+ ALQ
Sbjct  180   GYREVRLVTKDSKHVRRNGDPIVLCFVDFESPACAATALSALQ  222



>ref|XP_003574884.1| PREDICTED: protein elav-like [Brachypodium distachyon]
Length=296

 Score =   150 bits (380),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 123/193 (64%), Gaps = 27/193 (14%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R +Y D     D+AGYY R++   G H  +RD + +GASYDRYL++  V A    E 
Sbjct  82    KRARPDYVDGPGGQDMAGYYPRENA--GYH-SLRDNEVLGASYDRYLRNG-VPAVAVNEP  137

Query  4010  ARPLTGGM---------------AGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH  3876
             +R + GGM               +G+P ++ R++G+ G D       + G   G R E  
Sbjct  138   SRAVVGGMGGAGMGGAGMVGAGMSGYPGDERRMMGVVGMD-------SRGMGYGARPEPP  190

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFAS  3696
             LPPDAS+TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF S
Sbjct  191   LPPDASNTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDS  250

Query  3695  PAHAATAMDALQG  3657
             PA A  A++ALQG
Sbjct  251   PAQATIALEALQG  263



>ref|XP_006606161.1| PREDICTED: uncharacterized protein LOC100812551 isoform X4 [Glycine 
max]
Length=244

 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 118/186 (63%), Gaps = 19/186 (10%)
 Frame = -2

Query  4160  ANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSA-KVSAYGGGESA-------R  4005
             +  +++  Y  R+D   G HR+++DT  +G+++DRYLQSA +++++  GE++        
Sbjct  27    SGGNEMHNYIGRNDDHTG-HRILKDTKTLGSAFDRYLQSAGQLTSFNSGEASAIGSVGLE  85

Query  4004  PLTGGMAGHPTEDPRVLGI---------GGSDPvgakgramggvgggRTE-VHLPPDASS  3855
                GG+  H   DP V+G          GG +        +        E V LPPDASS
Sbjct  86    RGVGGLPRHSLTDPAVMGHPGGGHDLARGGRNVNYGDQLPVDAASMPGPETVPLPPDASS  145

Query  3854  TLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATA  3675
             TLYVEGLP++ TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA
Sbjct  146   TLYVEGLPSDSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATA  205

Query  3674  MDALQG  3657
             + ALQG
Sbjct  206   LSALQG  211



>emb|CDY29463.1| BnaA06g15070D [Brassica napus]
Length=239

 Score =   149 bits (375),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 134/224 (60%), Gaps = 38/224 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsll-AKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW       QPPP ++IP     KR RS++D    HD   Y +RD+ RG  H V R
Sbjct  1     MADGYWNQQQRHHQPPPMSSIPHGGPLKRHRSDFD----HD---YVSRDEDRGIPHSV-R  52

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESAR------------------PLTGGMAGHPTEDP  3963
             DT  IG++YDRYLQSA+ S+    E+ R                  P  GG+   P   P
Sbjct  53    DTRTIGSAYDRYLQSAQTSSMPSEEAGRFHGAGMGRRGGGDMGELMPGRGGVMP-PDFGP  111

Query  3962  --RVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
               R LG G  D        +     GR  + LPPDAS+TL+VEGLP+NC+RREVSHIFRP
Sbjct  112   NGRDLGFGQQD--------LVVARPGRELLRLPPDASNTLFVEGLPSNCSRREVSHIFRP  163

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             F+GYKEVRLVTK++++ +GDP+V CFVDF +PA AATA  ALQG
Sbjct  164   FLGYKEVRLVTKDTKQRNGDPVVLCFVDFENPACAATARTALQG  207



>gb|KHN16999.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=291

 Score =   150 bits (378),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAG---  3981
             +++  Y AR+D   G HR+++DT  +G++YDRYLQSA ++++  GE++   + G+     
Sbjct  78    NEMHNYIARNDDHTG-HRILKDTKTLGSAYDRYLQSAGLTSFNSGEASAISSVGLGRGVG  136

Query  3980  ----HPTEDPRVLGI--GGSDPvgakgramggvgggR--------TEVHLPPDASSTLYV  3843
                 H   DP V G   GG D                          + LPPDASSTLYV
Sbjct  137   GLPHHSLTDPAVTGHPGGGHDLSRNGRNVNYASQLPVDAASMPGPETLPLPPDASSTLYV  196

Query  3842  EGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDAL  3663
             EGLP+  TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ AL
Sbjct  197   EGLPSGSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSAL  256

Query  3662  QG  3657
             QG
Sbjct  257   QG  258



>ref|XP_003636759.1| RNA-binding protein with multiple splicing [Medicago truncatula]
 emb|CAD48198.1| RNA-binding protein [Medicago truncatula]
 gb|KEH25820.1| RNA recognition motif [Medicago truncatula]
Length=261

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 133/226 (59%), Gaps = 33/226 (15%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PAN---SHDLAGYYARDDGRGGVHR  4098
             MAD YW     RQQ     +      KRPR +Y+ PA+   S +   Y +R++ R G H 
Sbjct  1     MADGYWN----RQQSLLPHSGLH---KRPRPDYEMPASGLPSGNEMHYLSREEDRSG-HP  52

Query  4097  VIRDTDPIGASYDRYLQSAKVSAYGGGESA-------RPLTGGMAGHPTEDPRVL----G  3951
             +++D+  IG++YDRYLQ  +V ++  GE++       +   GG+  H   DP  +    G
Sbjct  53    MVKDSKTIGSAYDRYLQ-GQVPSFTSGEASTVGALGLQRGIGGLPNHSLSDPSAMIGRHG  111

Query  3950  IGGSD--PvgakgramggvgggRTEVH------LPPDASSTLYVEGLPANCTRREVSHIF  3795
              GG D  P G                H      LPPDAS TLY+EGLP++CTRREV+HIF
Sbjct  112   GGGPDLAPNGRGMNYGFQPPMDPVSRHGPEPALLPPDASPTLYIEGLPSDCTRREVAHIF  171

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGY+EVRLV+KE++   GDPL+ CFVDFA+PA AATA+ ALQG
Sbjct  172   RPFVGYREVRLVSKEAKH-RGDPLILCFVDFANPACAATALSALQG  216



>ref|XP_004974117.1| PREDICTED: CUGBP Elav-like family member 4-like isoform X1 [Setaria 
italica]
Length=326

 Score =   150 bits (379),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 121/200 (61%), Gaps = 28/200 (14%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R ++ D +   D+ GYY R+  R G H  +R+ + IGASYDRYL++   S  G  ++
Sbjct  66    KRARPDFGDVSGGQDMTGYYPRETDRAGYHS-LRENEAIGASYDRYLRNGMPSV-GANDT  123

Query  4010  ARPLTGGMAG------------------HPTEDPRVLGIGGSDPvgakgramggvgggRT  3885
             +R                          +  ++ R++G+ G D       + G   GGR 
Sbjct  124   SRAAGMAAGMAAGMGAGMAAGMGAGMAGYGVDERRMMGVVGMD-------SRGMGYGGRP  176

Query  3884  EVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVD  3705
             E  LPPDAS+TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVD
Sbjct  177   EPPLPPDASNTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVD  236

Query  3704  FASPAHAATAMDALQGEVTF  3645
             F +PA A  A++ALQG+ T+
Sbjct  237   FDNPAQATIALEALQGDDTY  256



>ref|XP_009149608.1| PREDICTED: uncharacterized protein LOC103872923 [Brassica rapa]
Length=239

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 134/224 (60%), Gaps = 38/224 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsll-AKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIR  4089
             MAD YW       QPPP ++IP     KR RS+++    HD   Y +RD+ RG  H V R
Sbjct  1     MADGYWNQQQRHHQPPPMSSIPHGGPLKRHRSDFE----HD---YVSRDEDRGIPHSV-R  52

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESAR------------------PLTGGMAGHPTEDP  3963
             DT  IG++YDRYLQSA+ S+    E+ R                  P  GG+   P   P
Sbjct  53    DTRTIGSAYDRYLQSAQTSSMPSEEAGRFHGAGMGRRGGGDMGELMPGRGGVMP-PDFGP  111

Query  3962  --RVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
               R LG G  D        +     GR  + LPPDAS+TL+VEGLP+NC+RREVSHIFRP
Sbjct  112   NGRDLGFGQQD--------LVVARPGRELLRLPPDASNTLFVEGLPSNCSRREVSHIFRP  163

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             F+GYKEVRLVTK++++ +GDP+V CFVDF +PA AATA  ALQG
Sbjct  164   FLGYKEVRLVTKDTKQRNGDPVVLCFVDFENPACAATARTALQG  207



>gb|ABK22075.1| unknown [Picea sitchensis]
Length=265

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 128/228 (56%), Gaps = 28/228 (12%)
 Frame = -2

Query  4265  MADAYW-RFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDLAGYYARDDGR--GGVH  4101
             M D YW RF   R      +A  +  AKRPR+EYD   + S D  GY  R+D R      
Sbjct  1     MGDTYWNRFAAERD---GRSAALASAAKRPRNEYDLLTSGSRDGPGYLPREDPRLDERSR  57

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA-----------RPLTGGMAGHPTEDPRVL  3954
             R++R+TDP+G +Y+RY ++   S    G +A           R    G+ G   +D  ++
Sbjct  58    RLLRETDPLGPAYERYARNGLPSYGSSGLNAGDLGGLGMGLGRSAGSGLGGSALDDQVLM  117

Query  3953  G---------IGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSH  3801
             G          G    +G K   +          HLPPDAS+TL+VEGLP  CTRRE +H
Sbjct  118   GRRLSMDAGLGGKGQGLGFKDSQLRDPLRRPDNDHLPPDASNTLFVEGLPPKCTRREAAH  177

Query  3800  IFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             IFRPFVG+KEVRLV KE+R P G+PLV CFVDFA+P  AATAM+ALQG
Sbjct  178   IFRPFVGFKEVRLVNKEARNPGGEPLVLCFVDFANPNCAATAMEALQG  225



>emb|CDP05024.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   148 bits (374),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 114/193 (59%), Gaps = 17/193 (9%)
 Frame = -2

Query  4187  KRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESA  4008
             KR R+++D  +    + +YAR DGRG   RVI DTDPIGASYD YLQ +K+S + GG SA
Sbjct  68    KRRRADFDDPSILSFSSFYARGDGRGET-RVIVDTDPIGASYDFYLQCSKMSPHIGGTSA  126

Query  4007  RPLTGGMAGHPTE----------------DPRVLGIGGSDPvgakgramggvgggRTEVH  3876
               + GG   H  +                +P  L + G++P   K      + GG     
Sbjct  127   PSVDGGFKDHHVDLSVTGSNPARLSFMGSNPAQLSVMGANPARRKDSQSMTLQGGIPTNP  186

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFAS  3696
             +P DAS TL+V GLP++C RREV+H+FR F GY+E+RL+ KE +   GDP V CFVDF S
Sbjct  187   VPSDASRTLFVLGLPSDCRRREVAHLFRCFEGYQELRLIRKEPKYHGGDPSVLCFVDFVS  246

Query  3695  PAHAATAMDALQG  3657
              AHAA   DALQG
Sbjct  247   RAHAAVVKDALQG  259



>ref|XP_009103299.1| PREDICTED: uncharacterized protein LOC103829381 [Brassica rapa]
Length=244

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 129/217 (59%), Gaps = 19/217 (9%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAGYYARDDGRGGVHRVIRD  4086
             MAD YW     + QPP ++       KRPRS++     HD+  Y +RD+ RGG    ++D
Sbjct  1     MADGYWN-QQRQHQPPMSSISHGDPPKRPRSDF----RHDMHSYVSRDEDRGGNPHAVKD  55

Query  4085  TDPIGASYDRYLQSAKVSAYGGGESARPLTG---------GMAGHPTEDPRVLGIGGSDP  3933
             T  IG++YD YLQS + S+    E+ R   G         G+   P+    + G GG  P
Sbjct  56    TRTIGSAYDLYLQSVQTSSTPSEEAGRFNNGVGMGRRGGDGVMPSPSMGELMAGRGGMLP  115

Query  3932  vgakgramggvgggRTE-----VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEV  3768
                      G            + LPPDAS+TL+VEGLP+NC+RREVSHIFRPF+GYKEV
Sbjct  116   PDFGRGLGFGQQDLVGRPSRELLRLPPDASNTLFVEGLPSNCSRREVSHIFRPFLGYKEV  175

Query  3767  RLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RLVTK+S++ +GDP+V CFVDF +PA AATA+ ALQG
Sbjct  176   RLVTKDSKQRNGDPIVLCFVDFENPACAATALTALQG  212



>ref|XP_010498582.1| PREDICTED: uncharacterized protein LOC104776249 isoform X2 [Camelina 
sativa]
Length=254

 Score =   147 bits (370),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 130/223 (58%), Gaps = 23/223 (10%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD---PA---NSHDLAGYYARDDGRGGV  4104
             MAD YW     + QPP ++     L KR RS+++   P+   + HD   Y +RD+   G+
Sbjct  1     MADGYWNQQQRQYQPPTSSTHHGGLPKRHRSDFEGPPPSVMPSGHDRHSYMSRDEEDRGI  60

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG--GMAGHPTED-----PRVLGIG  3945
                + DT  IG++YDRYLQS +  +    E A P  G  GM G P  +     P + G G
Sbjct  61    PHSLNDTRTIGSAYDRYLQSMQTPSVPS-EEADPFNGVVGM-GRPGGNNMMPGPTMGGRG  118

Query  3944  GSDPvgakgramggvgggRTEV--------HLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             G  P  ++        G    V         LP D S+TLYVEGLP+NC+RREVSHIFRP
Sbjct  119   GLLPPDSRPNGRDMSHGQPDSVGRPSRKLQSLPHDVSNTLYVEGLPSNCSRREVSHIFRP  178

Query  3788  FVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             FVGY+EVRLVTK+S+  +GDP+V CFVDF SPA AATA+ ALQ
Sbjct  179   FVGYREVRLVTKDSKHRNGDPIVLCFVDFESPACAATALSALQ  221



>ref|NP_001168957.1| uncharacterized protein LOC100382777 [Zea mays]
 gb|ACN31194.1| unknown [Zea mays]
 gb|AFW65643.2| hypothetical protein ZEAMMB73_475624 [Zea mays]
Length=287

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 117/196 (60%), Gaps = 28/196 (14%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R ++ D +   D+ GYY R+  R G H  +R+ D +GASYDRYL++   S  G  ++
Sbjct  68    KRARPDFGDVSGGQDMTGYYPRETDRSGYH-SLRENDTLGASYDRYLRNGMASV-GANDT  125

Query  4010  ARPLTGGMAGHP------------------TEDPRVLGIGGSDPvgakgramggvgggRT  3885
             +R    G                        +  R++G+ G D       + G   GGR 
Sbjct  126   SRAAGMGAGLAAGMTAGMGAGMAAGMAGYGVDGQRMMGVVGMD-------SRGMGYGGRP  178

Query  3884  EVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVD  3705
             E  LPPDASSTLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVD
Sbjct  179   EPPLPPDASSTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVD  238

Query  3704  FASPAHAATAMDALQG  3657
             F +PA A  A++ALQG
Sbjct  239   FDNPAQATIALEALQG  254



>ref|XP_010459838.1| PREDICTED: uncharacterized protein LOC104740830 [Camelina sativa]
Length=253

 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 127/221 (57%), Gaps = 20/221 (9%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD---PA---NSHDLAGYYARDDGRGGV  4104
             MAD YW     +  PP ++   S   KRPRS+++   P+   + HD   Y++R++   G+
Sbjct  1     MADGYWNQKQRQYLPPISSTHHSGPPKRPRSDFEGPPPSVMPSGHDRHSYFSRNEEDRGI  60

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTED-----PRVLGIGGS  3939
                + DT  IG++YDRYLQS +  +    E A P  G   G P  +     P + G  G 
Sbjct  61    PHSVTDTRTIGSAYDRYLQSMQTPSVPS-EEADPYNGVGMGRPGGNNMMPGPTMGGRSGL  119

Query  3938  DPvgakgramggvgggRTEV--------HLPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
              P   +        G    V         LP D S+TLYVEGLP+NC+RREVSHIFRPFV
Sbjct  120   LPPDFRPNGRDMGHGQLDSVGRPSRKLQSLPHDVSNTLYVEGLPSNCSRREVSHIFRPFV  179

Query  3782  GYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             GY+EVRLVTK+S+  +GDP+V CFVDF SPA AATA+ ALQ
Sbjct  180   GYREVRLVTKDSKHRNGDPIVLCFVDFESPACAATALSALQ  220



>ref|XP_004974118.1| PREDICTED: CUGBP Elav-like family member 4-like isoform X2 [Setaria 
italica]
Length=285

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 118/196 (60%), Gaps = 28/196 (14%)
 Frame = -2

Query  4187  KRPRSEY-DPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGES  4011
             KR R ++ D +   D+ GYY R+  R G H  +R+ + IGASYDRYL++   S  G  ++
Sbjct  66    KRARPDFGDVSGGQDMTGYYPRETDRAGYH-SLRENEAIGASYDRYLRNGMPSV-GANDT  123

Query  4010  ARPLTGGMAG------------------HPTEDPRVLGIGGSDPvgakgramggvgggRT  3885
             +R                          +  ++ R++G+ G D       + G   GGR 
Sbjct  124   SRAAGMAAGMAAGMGAGMAAGMGAGMAGYGVDERRMMGVVGMD-------SRGMGYGGRP  176

Query  3884  EVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVD  3705
             E  LPPDAS+TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVD
Sbjct  177   EPPLPPDASNTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVD  236

Query  3704  FASPAHAATAMDALQG  3657
             F +PA A  A++ALQG
Sbjct  237   FDNPAQATIALEALQG  252



>ref|XP_006589498.1| PREDICTED: uncharacterized protein LOC100816230 isoform X3 [Glycine 
max]
Length=244

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 114/183 (62%), Gaps = 19/183 (10%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSA-KVSAYGGGESARPLTGGMAG--  3981
             +++  Y AR+D   G HR+++DT  +G++YDRYLQSA +++++  GE++   + G+    
Sbjct  30    NEMHNYIARNDDHTG-HRILKDTKTLGSAYDRYLQSAGQLTSFNSGEASAISSVGLGRGV  88

Query  3980  -----HPTEDPRVLGI--GGSDPvgakgramggvgggR--------TEVHLPPDASSTLY  3846
                  H   DP V G   GG D                          + LPPDASSTLY
Sbjct  89    GGLPHHSLTDPAVTGHPGGGHDLSRNGRNVNYASQLPVDAASMPGPETLPLPPDASSTLY  148

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             VEGLP+  TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ A
Sbjct  149   VEGLPSGSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSA  208

Query  3665  LQG  3657
             LQG
Sbjct  209   LQG  211



>ref|XP_006589499.1| PREDICTED: uncharacterized protein LOC100816230 isoform X4 [Glycine 
max]
Length=225

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 114/183 (62%), Gaps = 19/183 (10%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSA-KVSAYGGGESARPLTGGMAG--  3981
             +++  Y AR+D   G HR+++DT  +G++YDRYLQSA +++++  GE++   + G+    
Sbjct  11    NEMHNYIARNDDHTG-HRILKDTKTLGSAYDRYLQSAGQLTSFNSGEASAISSVGLGRGV  69

Query  3980  -----HPTEDPRVLGI--GGSDPvgakgramggvgggR--------TEVHLPPDASSTLY  3846
                  H   DP V G   GG D                          + LPPDASSTLY
Sbjct  70    GGLPHHSLTDPAVTGHPGGGHDLSRNGRNVNYASQLPVDAASMPGPETLPLPPDASSTLY  129

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             VEGLP+  TRREV+HIFRPFVGY+EVRLV+KES+   GDPL+ CFVDFA+PA AATA+ A
Sbjct  130   VEGLPSGSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFANPACAATALSA  189

Query  3665  LQG  3657
             LQG
Sbjct  190   LQG  192



>ref|XP_003557104.1| PREDICTED: uncharacterized protein LOC100821534 [Brachypodium 
distachyon]
Length=261

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 131/231 (57%), Gaps = 36/231 (16%)
 Frame = -2

Query  4265  MADAYWRFG-DVRQQpppaaaip-----------------sllAKRPR-SEY-DPANSHD  4146
             MADAYWR+  D RQ                              KRPR +EY D   S +
Sbjct  1     MADAYWRYNADPRQLQQQQQQQMLPPSARAPNAAAPAAAGQQPLKRPRPAEYSDVPGSSE  60

Query  4145  LAGYYARDDGRGGVHRVI-----RDTDPIGASYDRYLQSAKVSAYGGGE---SARPLTGG  3990
             +AGYY RD+ R G          RDT  + ASY+RYL++ ++ ++G G    S RP  G 
Sbjct  61    MAGYYPRDEERAGYAAAAAAAAARDTQALNASYERYLRTGQIQSHGAGPAGGSIRPAAGA  120

Query  3989  MAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRRE  3810
              AG+  +D   + IGG +          G G G  E  LPPDAS+TL++EG+P +C RRE
Sbjct  121   NAGYQLDD--RVAIGGVE------GRNVGFGTGMPEPPLPPDASNTLFIEGIPNDCERRE  172

Query  3809  VSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VSHIFRPFVG+KEVRLVTKE R P GDP+V CFVDF + A AA AM+ALQG
Sbjct  173   VSHIFRPFVGFKEVRLVTKEPRHPGGDPIVLCFVDFTNAAQAAVAMEALQG  223



>ref|XP_010498581.1| PREDICTED: uncharacterized protein LOC104776249 isoform X1 [Camelina 
sativa]
Length=256

 Score =   144 bits (362),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 131/225 (58%), Gaps = 25/225 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD---PA---NSHDLAGYYARDDGRGGV  4104
             MAD YW     + QPP ++     L KR RS+++   P+   + HD   Y +RD+   G+
Sbjct  1     MADGYWNQQQRQYQPPTSSTHHGGLPKRHRSDFEGPPPSVMPSGHDRHSYMSRDEEDRGI  60

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG--GMAGHPTED-----PRVLGIG  3945
                + DT  IG++YDRYLQS +  +    E A P  G  GM G P  +     P + G G
Sbjct  61    PHSLNDTRTIGSAYDRYLQSMQTPSVPS-EEADPFNGVVGM-GRPGGNNMMPGPTMGGRG  118

Query  3944  GSDPvgakgramggvgggRTEV--------HLPPDASSTLYVEGLPANCTRREVSHIFRP  3789
             G  P  ++        G    V         LP D S+TLYVEGLP+NC+RREVSHIFRP
Sbjct  119   GLLPPDSRPNGRDMSHGQPDSVGRPSRKLQSLPHDVSNTLYVEGLPSNCSRREVSHIFRP  178

Query  3788  FVGYKEVRLVTKESR--RPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             FVGY+EVRLVTK+S+  R +GDP+V CFVDF SPA AATA+ ALQ
Sbjct  179   FVGYREVRLVTKDSKHVRRNGDPIVLCFVDFESPACAATALSALQ  223



>ref|NP_001154354.1| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
 gb|AEE30085.1| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
Length=253

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 126/224 (56%), Gaps = 26/224 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQ-QpppaaaipsllAKRPRSEYDPAN----SHDLAGYYARDDGRGGVH  4101
             MAD YW     RQ Q P ++    L  KRPRS++        S D+  Y ++D+ RG  H
Sbjct  1     MADEYW--NQQRQYQLPISSNPHVLPPKRPRSDFQGTPYLIPSGDMHSYLSQDEDRGIPH  58

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG---------GMAGHPTEDPRVLGI  3948
              V +DT  IG++YDRYLQS + + +   E A P  G          M   P+    + G 
Sbjct  59    SV-KDTRSIGSAYDRYLQSMQ-TFFVPSEEAGPFNGVGMVRQGGSNMMPGPSMGELMAGC  116

Query  3947  GGSDPvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFR  3792
             GGS P   +        G    V         LPPD S+TLYVEGLP+NC+RREVSHIFR
Sbjct  117   GGSLPSDFRPNGRDMGFGQLDSVGRPGREPHPLPPDVSNTLYVEGLPSNCSRREVSHIFR  176

Query  3791  PFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             PFVGY+EVRLVT++S+   GDP V CFVDF + A AATA+ ALQ
Sbjct  177   PFVGYREVRLVTQDSKHRSGDPTVLCFVDFENSACAATALSALQ  220



>ref|XP_002889109.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65368.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=240

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 124/221 (56%), Gaps = 30/221 (14%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP-----ANSHDLAGYYARDDGRGGVH  4101
             MAD YW       Q      +PS   KRPRS+++      A  H   GYY RD+      
Sbjct  1     MADGYW------NQQRQQHHLPSGPPKRPRSDFEAPPSTMATGHG-GGYYPRDEDLD---  50

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA-----RPLTGGMAGHPTEDPRVLGIGGSD  3936
               + DT  IG++YDRYLQS + S+   GE       RP  GG     T D  ++  GG  
Sbjct  51    --VPDTRTIGSAYDRYLQSVQTSSLQSGEGGSVSMGRPGGGGGGNGQTVDDFMMRRGGVL  108

Query  3935  PvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFRPFVG  3780
             P+                V         LPPDAS+TLYVEGLP+NC+RREV+HIFRPFVG
Sbjct  109   PLDYGPNGQAIGFDPPESVGRRNRETLPLPPDASNTLYVEGLPSNCSRREVAHIFRPFVG  168

Query  3779  YKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             Y+EVRLVTK+S+  +GDP+V CFVDF +PA AATA+ ALQG
Sbjct  169   YREVRLVTKDSKHRNGDPIVLCFVDFTNPACAATALSALQG  209



>gb|KFK42088.1| hypothetical protein AALP_AA2G209400 [Arabis alpina]
Length=237

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 117/222 (53%), Gaps = 35/222 (16%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP------ANSHDLAGYYARDDGRGGV  4104
             MAD YW                    KR RS+++       A  HD+ G Y         
Sbjct  1     MADGYW-------NQQRQQHQHPPPPKRHRSDFEAPPQSTMATGHDIHGGYD--------  45

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPT-----EDPRVLGIGGS  3939
             H  + DT  IG++YDRYLQS +  A G GES      GM G P       D  ++  GG 
Sbjct  46    HHDVPDTRTIGSAYDRYLQSVQTPAMGLGESGSRNGVGM-GRPGGNGQGMDEFMMRRGGV  104

Query  3938  DPvgakgramggvgggRTEVH--------LPPDASSTLYVEGLPANCTRREVSHIFRPFV  3783
              P        G        V         LPPDAS+TLYVEGLPANC+RREV+HIFRPFV
Sbjct  105   VPPDHGPNGRGMGFDPLESVDRRNREPLPLPPDASNTLYVEGLPANCSRREVAHIFRPFV  164

Query  3782  GYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             GY+EVRLVTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  165   GYREVRLVTKDSKHRNGDPIVLCFVDFTNPACAATALSTLQG  206



>ref|XP_010416620.1| PREDICTED: uncharacterized protein LOC104702460 [Camelina sativa]
Length=244

 Score =   143 bits (360),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 123/219 (56%), Gaps = 22/219 (10%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS--------HDLAGYYARDDGRG  4110
             MAD YW     +QQ       PS   KRPRS+++   S        H   GYY RD+   
Sbjct  1     MADGYWNQ-QRQQQQQQHQHPPSGPPKRPRSDFEAPPSTMTSGHEMHGGGGYYPRDE---  56

Query  4109  GVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE--SARPLTGGMAGHPTEDPRVLGIG---  3945
                  + DT  IG++YDRYLQS +  +   GE  S     GG  GH  +D  +   G   
Sbjct  57    --DLDVPDTRTIGSAYDRYLQSVQTPSMQSGEAGSVSMGRGGGNGHTIDDFMMRRGGVLP  114

Query  3944  ---GSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYK  3774
                G +           VG    E  LPPDAS+TLYVEGLP NC+RREV+HIFRPF+GY+
Sbjct  115   LEHGPNGHAMGFDPPESVGRRNRERPLPPDASNTLYVEGLPPNCSRREVAHIFRPFLGYR  174

Query  3773  EVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             EVRLVTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  175   EVRLVTKDSKHRNGDPIVLCFVDFTTPACAATALSTLQG  213



>ref|XP_010477395.1| PREDICTED: uncharacterized protein LOC104756489 isoform X3 [Camelina 
sativa]
Length=215

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 16/179 (9%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPT  3972
             HD   Y +RD+   G+   + DT  IG++YDRYLQS +  +    E A P  G   G P 
Sbjct  5     HDRHSYMSRDEEDRGIPHSLNDTRTIGSAYDRYLQSMQTPSVPS-EEADPFNGVGMGRPA  63

Query  3971  -----EDPRVLGIGGSDPvgakgramggvgggRTEV--------HLPPDASSTLYVEGLP  3831
                    P + G GG  P   +        G    V         LPPD S+TLYVEGLP
Sbjct  64    GTNMMPGPTMGGRGGLLPPDFRTNGRDMGHGQPDSVGRPSRKLNSLPPDVSNTLYVEGLP  123

Query  3830  ANCTRREVSHIFRPFVGYKEVRLVTKESR--RPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             +NC+RREVSHIFRPFVGY+EVRLVTK+S+  R +GDP+V CFVDF SPA AATA+ ALQ
Sbjct  124   SNCSRREVSHIFRPFVGYREVRLVTKDSKHVRRNGDPIVLCFVDFESPACAATALSALQ  182



>ref|XP_010320067.1| PREDICTED: uncharacterized protein LOC101249172 isoform X2 [Solanum 
lycopersicum]
Length=265

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 132/239 (55%), Gaps = 44/239 (18%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGG--  4107
             M DAYW     RQ   P     + L KRPR+EYD   S     H++  Y  R+D R G  
Sbjct  1     MGDAYWN----RQ---PQLPQSAGLLKRPRTEYDIPQSGMPSAHEVHHYLGRNDDREGPR  53

Query  4106  --------------VHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG------GM  3987
                           V RV+ DT+ IG++YDRYLQS+++S+   GE+     G      G 
Sbjct  54    VVDTQSFGSAYDRSVPRVV-DTESIGSAYDRYLQSSQLSSLPVGEANNNYKGVGLVRAGG  112

Query  3986  AGHPT---EDPR------VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGL  3834
              G PT    DP        L   G   V +    +  +   R  + LPPDAS+TLY+EGL
Sbjct  113   GGIPTLAVRDPLPSARGPELAPNGRAMVFSGQLPVEPMPRPRETLSLPPDASNTLYIEGL  172

Query  3833  PANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P++ +RREV+HIFRPFVGYKEVRLV KES+   GDP++ CFVDF  PA AATA+ ALQG
Sbjct  173   PSDSSRREVAHIFRPFVGYKEVRLVRKESKHRGGDPIILCFVDFVDPACAATALSALQG  231



>ref|XP_006362816.1| PREDICTED: uncharacterized protein LOC102604584 isoform X2 [Solanum 
tuberosum]
Length=265

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 132/239 (55%), Gaps = 44/239 (18%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGG--  4107
             M DAYW     RQ   P     + L KRPR+EYD   S     +++  Y  R+D R G  
Sbjct  1     MGDAYWN----RQ---PQLPQSAGLLKRPRTEYDIPQSGMPSAYEVHHYLGRNDDREGPR  53

Query  4106  --------------VHRVIRDTDPIGASYDRYLQSAKVSAYGGGES---------ARPLT  3996
                           V RV+ DT+ IG++YDRYLQS+++S+   GE+          R   
Sbjct  54    VVDTQSFGSAYDRGVPRVV-DTESIGSAYDRYLQSSQLSSLPVGEANNNYKGVGLVRAGG  112

Query  3995  GGMAGHPTEDPR------VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGL  3834
             GG+   P  DP        L   G   V +    +  +   R  + LPPDAS+TLY+EGL
Sbjct  113   GGIPALPVRDPLPSVRGPELAPNGRAMVFSGQLPVEPMPRPRETLSLPPDASNTLYIEGL  172

Query  3833  PANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P++ +RREV+HIFRPFVGYKEVRLV KES+   GDP++ CFVDF  PA AATA+ ALQG
Sbjct  173   PSDSSRREVAHIFRPFVGYKEVRLVRKESKHRGGDPIILCFVDFVDPACAATALSALQG  231



>ref|XP_010471856.1| PREDICTED: uncharacterized protein LOC104751586 isoform X1 [Camelina 
sativa]
Length=243

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 123/219 (56%), Gaps = 23/219 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS--------HDLAGYYARDDGRG  4110
             MAD YW     RQQ        S   KRPRS+++   S        H   GYY RD+   
Sbjct  1     MADGYWN--QQRQQQQQHQHPQSGPPKRPRSDFEAPPSTMTSGHEMHGGGGYYPRDE---  55

Query  4109  GVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGH-PTEDPRVLGIGGSDP  3933
                  + DT  IG++YDRYLQS +  +   GE+     G   G+  T D  ++  GG  P
Sbjct  56    --DLDVPDTRSIGSAYDRYLQSVQTPSMQSGEAGSVSMGRGGGNGQTIDEFMMRRGGVLP  113

Query  3932  vgakgramg-------gvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYK  3774
             +                VG    E  LPPDAS+TLYVEGLP NC+RREV+HIFRPF+GY+
Sbjct  114   LDHGPNGHAMGFDPPESVGRRNRERPLPPDASNTLYVEGLPPNCSRREVAHIFRPFLGYR  173

Query  3773  EVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             EVRLVTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  174   EVRLVTKDSKHRNGDPIVLCFVDFTTPACAATALSTLQG  212



>ref|NP_001056664.1| Os06g0127500 [Oryza sativa Japonica Group]
 dbj|BAC24834.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAD67747.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF18578.1| Os06g0127500 [Oryza sativa Japonica Group]
Length=293

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 125/214 (58%), Gaps = 44/214 (21%)
 Frame = -2

Query  4187  KRPRSE--YDPANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG-  4017
             KRPR     D   + ++AGYY+RD+ R G +R  RDT+ + ASY+R+L++ ++ +YG G 
Sbjct  51    KRPRPADFSDVPGAPEMAGYYSRDEERPG-YRPARDTEALNASYERFLRTGQIQSYGAGA  109

Query  4016  ------ESARPLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASS  3855
                   ES RP  GG AG+P ED  ++  GG +          G GGG  E  LPPDAS+
Sbjct  110   GAGPGAESIRPAAGGNAGYPVEDRPMMAGGGME------ARNIGFGGGMPEPPLPPDASN  163

Query  3854  TLYVEGLPANCTRREVSHI----------------------------FRPFVGYKEVRLV  3759
             TL++EG+P +C RREVS I                            FRPFVG++EVRLV
Sbjct  164   TLFIEGIPTDCARREVSRILKSHAFFCLSLIFHLHKFCWSFTFPQDIFRPFVGFREVRLV  223

Query  3758  TKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +KE+R P GDP++ CFVDF + + AA AMDALQG
Sbjct  224   SKEARHPGGDPILLCFVDFETASQAAIAMDALQG  257



>gb|EAY99488.1| hypothetical protein OsI_21456 [Oryza sativa Indica Group]
Length=227

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 115/208 (55%), Gaps = 62/208 (30%)
 Frame = -2

Query  4145  LAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGG-------ESARPLTGGM  3987
             +AGYY+RD+ R G +R  RDT+ + ASY+R+L++ ++ +YG G       ES RP  GG 
Sbjct  1     MAGYYSRDEERPG-YRPARDTEALNASYERFLRTGQIQSYGAGAGAGPGAESIRPAAGGN  59

Query  3986  AGHPTED----------PRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEG  3837
             AG+P ED           R +G GG  P                E  LPPDAS+TL++EG
Sbjct  60    AGYPVEDRPMMAGGGMEARNIGFGGGMP----------------EPPLPPDASNTLFIEG  103

Query  3836  LPANCTRREVSHI----------------------------FRPFVGYKEVRLVTKESRR  3741
             +P +C RREVS I                            FRPFVG++EVRLV+KE+R 
Sbjct  104   IPTDCARREVSRILKSHAFFCLSLIFHLHKFCWSFTFPQDIFRPFVGFREVRLVSKEARH  163

Query  3740  PDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P GDP++ CFVDF + + AA AMDALQG
Sbjct  164   PGGDPILLCFVDFETASQAAIAMDALQG  191



>ref|XP_006362815.1| PREDICTED: uncharacterized protein LOC102604584 isoform X1 [Solanum 
tuberosum]
Length=267

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 133/241 (55%), Gaps = 46/241 (19%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP-------ANSHDLAGYYARDDGRGG  4107
             M DAYW     RQ   P     + L KRPR+EY P        +++++  Y  R+D R G
Sbjct  1     MGDAYWN----RQ---PQLPQSAGLLKRPRTEYVPDIPQSGMPSAYEVHHYLGRNDDREG  53

Query  4106  ----------------VHRVIRDTDPIGASYDRYLQSAKVSAYGGGES---------ARP  4002
                             V RV+ DT+ IG++YDRYLQS+++S+   GE+          R 
Sbjct  54    PRVVDTQSFGSAYDRGVPRVV-DTESIGSAYDRYLQSSQLSSLPVGEANNNYKGVGLVRA  112

Query  4001  LTGGMAGHPTEDPRV------LGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVE  3840
               GG+   P  DP        L   G   V +    +  +   R  + LPPDAS+TLY+E
Sbjct  113   GGGGIPALPVRDPLPSVRGPELAPNGRAMVFSGQLPVEPMPRPRETLSLPPDASNTLYIE  172

Query  3839  GLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             GLP++ +RREV+HIFRPFVGYKEVRLV KES+   GDP++ CFVDF  PA AATA+ ALQ
Sbjct  173   GLPSDSSRREVAHIFRPFVGYKEVRLVRKESKHRGGDPIILCFVDFVDPACAATALSALQ  232

Query  3659  G  3657
             G
Sbjct  233   G  233



>ref|XP_010320066.1| PREDICTED: uncharacterized protein LOC101249172 isoform X1 [Solanum 
lycopersicum]
Length=267

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 133/241 (55%), Gaps = 46/241 (19%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDP-------ANSHDLAGYYARDDGRGG  4107
             M DAYW     RQ   P     + L KRPR+EY P        ++H++  Y  R+D R G
Sbjct  1     MGDAYWN----RQ---PQLPQSAGLLKRPRTEYVPDIPQSGMPSAHEVHHYLGRNDDREG  53

Query  4106  ----------------VHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG------  3993
                             V RV+ DT+ IG++YDRYLQS+++S+   GE+     G      
Sbjct  54    PRVVDTQSFGSAYDRSVPRVV-DTESIGSAYDRYLQSSQLSSLPVGEANNNYKGVGLVRA  112

Query  3992  GMAGHPT---EDPR------VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVE  3840
             G  G PT    DP        L   G   V +    +  +   R  + LPPDAS+TLY+E
Sbjct  113   GGGGIPTLAVRDPLPSARGPELAPNGRAMVFSGQLPVEPMPRPRETLSLPPDASNTLYIE  172

Query  3839  GLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQ  3660
             GLP++ +RREV+HIFRPFVGYKEVRLV KES+   GDP++ CFVDF  PA AATA+ ALQ
Sbjct  173   GLPSDSSRREVAHIFRPFVGYKEVRLVRKESKHRGGDPIILCFVDFVDPACAATALSALQ  232

Query  3659  G  3657
             G
Sbjct  233   G  233



>gb|KGN47470.1| hypothetical protein Csa_6G338020 [Cucumis sativus]
Length=506

 Score =   145 bits (366),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 112/190 (59%), Gaps = 27/190 (14%)
 Frame = -2

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE--------------  4014
             HD+  Y   DD RGG  R ++DT  IG++YDRYLQS ++S++  GE              
Sbjct  45    HDMHNYLTSDD-RGG-PRSVKDTQTIGSAYDRYLQSVQLSSFTSGEVPTHGEMGMGRPVA  102

Query  4013  SARPLTGGMAGHPTEDPRV----------LGIGGSDPvgakgramggvgggRTE-VHLPP  3867
             +  P+   M G    DP V          L   G +        +  +     E V LPP
Sbjct  103   NRMPVGNRMPGPLLPDPIVMSRPPAVSPDLAPNGRNLEYGNHLPVDSMSRPGRETVPLPP  162

Query  3866  DASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAH  3687
             DAS+TLYVEGLP + +RREV+HIFRPFVGYKE+RLV+KES+   GDPL+ CFVDFA+PA 
Sbjct  163   DASNTLYVEGLPPDSSRREVAHIFRPFVGYKELRLVSKESKHRGGDPLILCFVDFANPAC  222

Query  3686  AATAMDALQG  3657
             AATAM ALQG
Sbjct  223   AATAMSALQG  232



>dbj|BAK05404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 131/239 (55%), Gaps = 53/239 (22%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllA-------------------KRPRS---EYDPANS  4152
             MADAYWR+ D+++Q      + +  A                   KRPR      D   +
Sbjct  1     MADAYWRYADLQRQQQQQQQMRTPSAGAPQSLTAAAAAAAGQQPLKRPRPGDHSADGPGA  60

Query  4151  HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE---SARPLTGGMAG  3981
              ++AGYY RD+ R G +  +RDT  + ASY+R+L++ ++ ++G G    S RP  G  AG
Sbjct  61    PEMAGYYPRDEERPG-YAAVRDTQALNASYERFLRTGQIQSHGAGPAGGSVRPAAGVSAG  119

Query  3980  HPTEDP-----------RVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGL  3834
                 D            R +G GG  P                E  LPPDAS+TL++EG+
Sbjct  120   GYQADDRPGMAAGGMNGRNVGFGGGMP----------------EPPLPPDASNTLFIEGI  163

Query  3833  PANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P +C RREVSHIFRPFVG++EVRLV KE R P GDP+V CFVDFA+ A AA AM+ALQG
Sbjct  164   PTDCERREVSHIFRPFVGFQEVRLVNKEPRHPGGDPIVLCFVDFANAAQAAIAMEALQG  222



>emb|CDX88323.1| BnaC06g37670D [Brassica napus]
Length=226

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 120/211 (57%), Gaps = 24/211 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD--PANSHDL-----AGYYARDDGRGG  4107
             MAD YW                    KR RS+++  P+  H++      GY+ RD+    
Sbjct  1     MADGYW-------NQQQRHQQHGGPPKRRRSDFEAPPSAGHEMHGGGGGGYFPRDEDI--  51

Query  4106  VHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvg  3927
                   DT  IG++YDRYLQS + S+   G+   P   G+A       R  G+ G +   
Sbjct  52    ------DTRTIGSAYDRYLQSVQTSSMPMGDPG-PPRNGVAMDEFMMRRGGGVHGLNGRD  104

Query  3926  akgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKE  3750
                  +  V     E + LPPDAS+TLYVEGLP+NC+RREV+HIFRPFVGY+EVRLVTK+
Sbjct  105   MGFDPLDSVDRRNREPLPLPPDASNTLYVEGLPSNCSRREVAHIFRPFVGYREVRLVTKD  164

Query  3749  SRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  165   SKHRNGDPVVLCFVDFTNPACAATALTTLQG  195



>ref|NP_177820.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|ABL66782.1| At1g76940 [Arabidopsis thaliana]
 gb|AEE35906.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=233

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 122/213 (57%), Gaps = 21/213 (10%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD-PANSHDLA---GYYARDDGRGGVHR  4098
             MAD YW       Q       P    KRPRS+++ P+++  +    GYY RD+       
Sbjct  1     MADGYW------NQQRQQHHPPGGPMKRPRSDFEAPSSTMTIGHGGGYYPRDEDLD----  50

Query  4097  VIRDTDPIGASYDRYLQSAK---VSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvg  3927
              + DT  IG++YDRYLQS +     +   G S     GG     T D  +L  GG  P+ 
Sbjct  51    -VPDTRTIGSAYDRYLQSVQSGEGGSVSMGRSGGGGGGGGGNVQTIDDFMLRRGGVLPLD  109

Query  3926  akgramggvgggRTEV---HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVT  3756
                            V   +LP DAS+TLYVEGLP+NC+RREV+HIFRPFVGY+EVRLVT
Sbjct  110   HGPNGHTIGFDPPEPVGRRNLPSDASNTLYVEGLPSNCSRREVAHIFRPFVGYREVRLVT  169

Query  3755  KESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             K+S+  +GDP+V CFVDF +PA AATA+ ALQG
Sbjct  170   KDSKHRNGDPIVLCFVDFTNPACAATALSALQG  202



>ref|XP_010428762.1| PREDICTED: RNA-binding protein FUS-like isoform X2 [Camelina 
sativa]
Length=238

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 123/234 (53%), Gaps = 58/234 (25%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDL------AGYYARDDGRGGV  4104
             MAD YW     RQQ       PS   KRPRS++     H++       GYY RD+     
Sbjct  1     MADGYW--NQQRQQQQQHQHPPSGPPKRPRSDF----GHEMHGGSGGGGYYPRDEDLD--  52

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESAR-------------------------PL  3999
                + DT  IG++YDRYLQS +  +   GE+                           PL
Sbjct  53    ---VPDTRTIGSAYDRYLQSVQTPSMQSGEAGSVSMGRGGGGNGQTIDDFMMRRGGVLPL  109

Query  3998  TGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCT  3819
               G+ GH           G DP  + GR          E  LPPDAS+TLYVEGLP NC+
Sbjct  110   DHGLNGHAM---------GFDPPESVGRRNR-------ERPLPPDASNTLYVEGLPPNCS  153

Query  3818  RREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RREV+HIFRPF+GY+EVRLVTK+S+  +GDP+V CFVDF SPA AATA+  LQG
Sbjct  154   RREVAHIFRPFLGYREVRLVTKDSKHRNGDPIVLCFVDFTSPACAATALSTLQG  207



>ref|XP_010428760.1| PREDICTED: uncharacterized protein LOC104713359 isoform X1 [Camelina 
sativa]
Length=247

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 123/239 (51%), Gaps = 59/239 (25%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANSHDLAG-----------YYARDD  4119
             MAD YW     RQQ       PS   KRPRS+++   S   +G           YY RD+
Sbjct  1     MADGYW--NQQRQQQQQHQHPPSGPPKRPRSDFEAPPSIMTSGHEMHGGSGGGGYYPRDE  58

Query  4118  GRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESAR----------------------  4005
                     + DT  IG++YDRYLQS +  +   GE+                        
Sbjct  59    DLD-----VPDTRTIGSAYDRYLQSVQTPSMQSGEAGSVSMGRGGGGNGQTIDDFMMRRG  113

Query  4004  ---PLTGGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGL  3834
                PL  G+ GH           G DP  + GR          E  LPPDAS+TLYVEGL
Sbjct  114   GVLPLDHGLNGHAM---------GFDPPESVGRRNR-------ERPLPPDASNTLYVEGL  157

Query  3833  PANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             P NC+RREV+HIFRPF+GY+EVRLVTK+S+  +GDP+V CFVDF SPA AATA+  LQG
Sbjct  158   PPNCSRREVAHIFRPFLGYREVRLVTKDSKHRNGDPIVLCFVDFTSPACAATALSTLQG  216



>ref|XP_006302760.1| hypothetical protein CARUB_v10020882mg [Capsella rubella]
 gb|EOA35658.1| hypothetical protein CARUB_v10020882mg [Capsella rubella]
Length=234

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 121/215 (56%), Gaps = 24/215 (11%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS---HDLAGYYARDDGRGGVHRV  4095
             MAD YW     RQQ  P    P        S+Y+  +S       GYY RD+        
Sbjct  1     MADGYW--NQQRQQHHPPGGPPKRPR----SDYEAPSSTMPSGHGGYYPRDEDLD-----  49

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTE--DPRVLGIGGSD-----  3936
             + DT  IG++YDRYLQS +  +    E+  P++ G  G   +  D  ++  G S      
Sbjct  50    VPDTRTIGSAYDRYLQSVQTPSMQSAETG-PVSMGRPGGNGQVLDDFMMRRGNSGVLPLD  108

Query  3935  --PvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRL  3762
               P G           GR    LPPDAS+TLYVEGLP+NC+RREV+HIFRPF+GY+EVRL
Sbjct  109   HGPNGHTMGFDPPESVGRRNRELPPDASNTLYVEGLPSNCSRREVAHIFRPFLGYREVRL  168

Query  3761  VTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  169   VTKDSKHRNGDPIVLCFVDFTTPACAATALSTLQG  203



>sp|Q6JB11.1|MEG5_MAIZE RecName: Full=Protein MATERNALLY EXPRESSED GENE 5 [Zea mays]
 gb|AAT09814.1| MEG5 [Zea mays]
Length=163

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 7/114 (6%)
 Frame = -2

Query  3989  MAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRRE  3810
             MAG+  +  R++G+ G D       + G   GGR E  LPPDASSTLY+EGLPANCTRRE
Sbjct  1     MAGYGVDGQRMMGVVGMD-------SRGMGYGGRPEPPLPPDASSTLYIEGLPANCTRRE  53

Query  3809  VSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQGEVT  3648
             VSHIFRPFVG++EVRLV KESR P GDP V CFVDF +PA A  A++ALQG VT
Sbjct  54    VSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATIALEALQGHVT  107



>emb|CDX87560.1| BnaA07g33130D [Brassica napus]
Length=203

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 95/155 (61%), Gaps = 20/155 (13%)
 Frame = -2

Query  4088  DTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGH-----------PTEDPRVLGIGG  3942
             DT  IG++YDRYLQS + S+   G+S  P  G +                 + R +G   
Sbjct  27    DTRTIGSAYDRYLQSVQTSSMPLGDSGPPRNGVVMDEFMMRRGGGGGVHGLNGRDMGFDP  86

Query  3941  SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRL  3762
              D               R  + LPPDAS+TLYVEGLP+NC+RREV+HIFRPFVGY+EVRL
Sbjct  87    ID---------SVDRRNREPLPLPPDASNTLYVEGLPSNCSRREVAHIFRPFVGYREVRL  137

Query  3761  VTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             VTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  138   VTKDSKHRNGDPVVLCFVDFTNPACAATALSTLQG  172



>ref|XP_009106356.1| PREDICTED: uncharacterized protein LOC103832149 [Brassica rapa]
Length=230

 Score =   133 bits (335),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 122/220 (55%), Gaps = 38/220 (17%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS--HDL----AGYYARDDGRGGV  4104
             MAD +W     +QQ       P    KR RS+++  +S  H++     GY+ RD+     
Sbjct  1     MADGFWN----QQQRHQQHPPPGGPPKRRRSDFEAPSSAGHEMHGGGGGYFPRDEDI---  53

Query  4103  HRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGH-----------PTEDPRV  3957
                  DT  IG++YDRYLQS + S+   G+S  P  G +                 + R 
Sbjct  54    -----DTRTIGSAYDRYLQSVQTSSMPLGDSGPPRNGVVMDEFMMRRGGGGGVHGLNGRD  108

Query  3956  LGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGY  3777
             +G    D               R  + LPPDAS+TLYVEGLP+NC+RREV+HIFRPFVGY
Sbjct  109   MGFDPID---------SVDRRNREPLPLPPDASNTLYVEGLPSNCSRREVAHIFRPFVGY  159

Query  3776  KEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             +EVRLVTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  160   REVRLVTKDSKHRNGDPVVLCFVDFTNPACAATALSTLQG  199



>ref|XP_010680428.1| PREDICTED: uncharacterized protein LOC104895572 [Beta vulgaris 
subsp. vulgaris]
Length=244

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 115/195 (59%), Gaps = 21/195 (11%)
 Frame = -2

Query  4187  KRPRSEYD-----PANSHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPR++YD        + D+  Y  RDD RGG  RV +D+  +G++YDRYLQ  +V +Y 
Sbjct  20    KRPRNDYDLPPRVNPTALDMRDYIIRDDERGG-SRVAKDSKTLGSAYDRYLQRTEVPSYP  78

Query  4022  GGESARPLTGGMAGHPTE--DPRVLGIGGS----------DPvgakgramggvgggRTE-  3882
             G   A   +G   G      +P +LG  GS          D           +     E 
Sbjct  79    G--EATTFSGASLGRGISVGEPSLLGRPGSIVPDAAPHGRDVGYGGQMLADSMARPVRET  136

Query  3881  VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDF  3702
             V LP DAS+TLYVEGLP+N T+REV+HIFRPFVGYKEVRLVTKES+   GDPL+ CFVDF
Sbjct  137   VPLPSDASNTLYVEGLPSNSTKREVAHIFRPFVGYKEVRLVTKESKHRGGDPLILCFVDF  196

Query  3701  ASPAHAATAMDALQG  3657
                A AATA+ ALQG
Sbjct  197   VDAACAATALSALQG  211



>ref|XP_006390140.1| hypothetical protein EUTSA_v10019060mg [Eutrema salsugineum]
 gb|ESQ27426.1| hypothetical protein EUTSA_v10019060mg [Eutrema salsugineum]
Length=241

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 124/231 (54%), Gaps = 49/231 (21%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYD------PANSHDLAGYYARDDGRGGV  4104
             MAD YW     RQ PPP         KR RS+++      P+      GY+ RD+     
Sbjct  1     MADGYW--NQQRQHPPPGGPP-----KRRRSDFEALPSAMPSGHEMHGGYFPRDEDLD--  51

Query  4103  HRVIRDTDPIGASYDRYLQSA-KVSAYGGGES------ARPLTGGMAGHPTE--------  3969
                + DT  IG++YDRYLQS  +  +   GE+      A   TGG      E        
Sbjct  52    ---VPDTRTIGSAYDRYLQSVVQTPSMQSGEAGHRNGVAIGRTGGNGQSMGEFMMRRGGV  108

Query  3968  -------DPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRRE  3810
                    D R LG    DP  +  R           + LPPDAS+TLYVEGLP+NC+RRE
Sbjct  109   LPPDHGPDGRALGF---DPQESVDRRNR------EPLPLPPDASNTLYVEGLPSNCSRRE  159

Query  3809  VSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             V+HIFRPFVGY+EVRLVTK+S+  +GDP+V CFVDF +PA AATA+  LQG
Sbjct  160   VAHIFRPFVGYREVRLVTKDSKHRNGDPIVLCFVDFTNPACAATALSTLQG  210



>ref|XP_002533013.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29367.1| conserved hypothetical protein [Ricinus communis]
Length=1031

 Score =   141 bits (355),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 122/226 (54%), Gaps = 27/226 (12%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             M D YW   + R Q            KR R EYD A+S     H++  YY RDD R   +
Sbjct  776   MTDGYW---NHRHQQQHPLLQSGESLKRHRPEYDIASSGLPSSHEIHNYYPRDDDRER-Y  831

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA-------RPLTGGMAGHPTEDPRV-----  3957
             + ++D+  IG++YDRYLQ+A+++    GE++       R   GGM G P  D  +     
Sbjct  832   QAVKDSKTIGSAYDRYLQNAQIAPLSSGEASGLSVGFGRASGGGMTGLPILDSGMARRAR  891

Query  3956  -----LGIGGSDPvgakgramggvgggRTE-VHLPPDASSTLYVEGLPANCTRREVSHIF  3795
                  L   G D           +     E V LP DASSTLYVEGLP    RREV+HIF
Sbjct  892   PSGQDLASNGRDIGFVSQPPANKIARPVRETVPLPQDASSTLYVEGLPPGSKRREVAHIF  951

Query  3794  RPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RPFVGYKEVRLV+KES+    DP++ CFVDF   A AATAM ALQG
Sbjct  952   RPFVGYKEVRLVSKESKNRTRDPIILCFVDFDDAACAATAMSALQG  997



>ref|NP_173554.3| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
 gb|AEE30084.1| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
Length=421

 Score =   136 bits (343),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 107/182 (59%), Gaps = 19/182 (10%)
 Frame = -2

Query  4154  SHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTG------  3993
             S D+  Y ++D+ RG  H V +DT  IG++YDRYLQS + + +   E A P  G      
Sbjct  209   SGDMHSYLSQDEDRGIPHSV-KDTRSIGSAYDRYLQSMQ-TFFVPSEEAGPFNGVGMVRQ  266

Query  3992  ---GMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH--------LPPDASSTLY  3846
                 M   P+    + G GGS P   +        G    V         LPPD S+TLY
Sbjct  267   GGSNMMPGPSMGELMAGCGGSLPSDFRPNGRDMGFGQLDSVGRPGREPHPLPPDVSNTLY  326

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             VEGLP+NC+RREVSHIFRPFVGY+EVRLVT++S+   GDP V CFVDF + A AATA+ A
Sbjct  327   VEGLPSNCSRREVSHIFRPFVGYREVRLVTQDSKHRSGDPTVLCFVDFENSACAATALSA  386

Query  3665  LQ  3660
             LQ
Sbjct  387   LQ  388



>ref|XP_010519382.1| PREDICTED: uncharacterized protein LOC104798866 [Tarenaya hassleriana]
Length=263

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 118/207 (57%), Gaps = 36/207 (17%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKV----  4035
             KRPR++YD   S      ++ GY   DD  G V R ++DT  I ++YD YLQ+ K+    
Sbjct  29    KRPRNDYDLPPSAIPPGREVHGYMPHDDDHG-VLRPVKDTKSIDSAYDLYLQNTKLSSST  87

Query  4034  ----SAYGGGESAR----------PLTGGMAGHP-------TEDPRVLGIGGSDPvgakg  3918
                 +++GG  S R          P+   + G P         D   +G GG  P+ ++G
Sbjct  88    SSEANSFGGVSSGRPAGGGRPGIPPMADSVMGRPGFVSPDLAPDGPSVGFGGRSPMDSRG  147

Query  3917  ramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRP  3738
             R           + LPPDAS+TLYVEGLP +C RREV+HIFRPFVGY+EVRLV KE +  
Sbjct  148   RPGREGI-----LPLPPDASNTLYVEGLPPDCKRREVAHIFRPFVGYREVRLVNKEDKHR  202

Query  3737  DGDPLVFCFVDFASPAHAATAMDALQG  3657
              GD ++ CFVDF +PA AATAM AL+G
Sbjct  203   GGDTVLLCFVDFETPACAATAMSALRG  229



>gb|KDO83674.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=195

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 112/198 (57%), Gaps = 31/198 (16%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPANS-----HDLAGYYARDDGRGGVH  4101
             MAD YW     RQQ     +   L  KRPRS+YD   S     HD+  Y ++DD  G + 
Sbjct  1     MADGYWN----RQQASLLPSGGML--KRPRSDYDLPPSEVLSRHDMHNYLSQDDDLGEL-  53

Query  4100  RVIRDTDPIGASYDRYLQSAKVSAYGGGESA--------RPLTGGMAGHPTEDPRVLGIG  3945
             + ++DT  IG++YDRYLQSA+ S++  GE++        R + GG+   P  DP V G  
Sbjct  54    QPLKDTSTIGSAYDRYLQSAQYSSFTSGEASAFSGDRLRRAVPGGVTRLPVSDPSVTGRH  113

Query  3944  G-----------SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHI  3798
             G           S  +  +         G   + LPPDASSTLYVEGLPA+ T+REV+HI
Sbjct  114   GATGPDLVQNLRSSSIDDQLPFDAAARPGHETLPLPPDASSTLYVEGLPADSTKREVAHI  173

Query  3797  FRPFVGYKEVRLVTKESR  3744
             FRPFVGYKEVRLV KES+
Sbjct  174   FRPFVGYKEVRLVIKESK  191



>gb|EMT00765.1| hypothetical protein F775_20767 [Aegilops tauschii]
Length=211

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 107/186 (58%), Gaps = 40/186 (22%)
 Frame = -2

Query  4145  LAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGE---SARPLTGGMAGHP  3975
             +AGYY RD+ R G + V+RDT  + ASY+R+L++ ++ +YG G    S RP  G  AG  
Sbjct  1     MAGYYPRDEERPG-YAVVRDTQALNASYERFLRTGQIQSYGAGPAGGSIRPTAGASAGGY  59

Query  3974  TEDPR-----------VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPA  3828
               D R            +G GG  P                E  LPPDAS+TL++EG+P 
Sbjct  60    QADDRPGMAAGGMNGRNVGFGGGMP----------------EPPLPPDASNTLFIEGIPP  103

Query  3827  NCTRREVS---------HIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATA  3675
             +C RREVS          IFRPFVG++EVRLV KE R P GDP+V CFVDF + A AA A
Sbjct  104   DCERREVSPVGPSLFHPDIFRPFVGFQEVRLVNKEPRHPGGDPIVLCFVDFTNAAQAAIA  163

Query  3674  MDALQG  3657
             M+ALQG
Sbjct  164   MEALQG  169



>ref|XP_002264314.2| PREDICTED: uncharacterized protein LOC100242739 [Vitis vinifera]
Length=261

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 109/197 (55%), Gaps = 21/197 (11%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD   S     +++  Y  + D  GG  R ++D+  +G +YD+Y Q       G
Sbjct  15    KRPRSDYDLPYSGLPSGNEVHNYLVQGDDLGGP-RSVKDSKTVGLAYDQYFQDIPSFTSG  73

Query  4022  GGESARPLTGGMA-GHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH----------  3876
                  R +  G A G       + G    D + A    +   G GR   H          
Sbjct  74    AASDFRGVGLGTATGEAISGLSISGPAVMDHLEALDSDLPPSGQGRRFGHQLDAIIRPSR  133

Query  3875  ----LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFV  3708
                 LPPDASSTLYVEGLP + TRREV+HIFRPFVGYKEVRLV+KES+    DPLV CFV
Sbjct  134   ETAPLPPDASSTLYVEGLPPDSTRREVAHIFRPFVGYKEVRLVSKESKHRGRDPLVLCFV  193

Query  3707  DFASPAHAATAMDALQG  3657
             DF SPA AATA+ ALQG
Sbjct  194   DFTSPACAATALSALQG  210



>ref|XP_002445752.1| hypothetical protein SORBIDRAFT_07g025090 [Sorghum bicolor]
 gb|EES15247.1| hypothetical protein SORBIDRAFT_07g025090 [Sorghum bicolor]
Length=203

 Score =   124 bits (311),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFAS  3696
             LPPDAS TLY+EGLPANCTRREVSHIFRPFVG++EVRLV KESR P GDP V CFVDF +
Sbjct  98    LPPDASPTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDN  157

Query  3695  PAHAATAMDALQG  3657
             PA A  A++ALQG
Sbjct  158   PAQATIALEALQG  170



>emb|CBI35503.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   126 bits (317),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 109/197 (55%), Gaps = 21/197 (11%)
 Frame = -2

Query  4187  KRPRSEYDPANS-----HDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYG  4023
             KRPRS+YD   S     +++  Y  + D  GG  R ++D+  +G +YD+Y Q       G
Sbjct  46    KRPRSDYDLPYSGLPSGNEVHNYLVQGDDLGGP-RSVKDSKTVGLAYDQYFQDIPSFTSG  104

Query  4022  GGESARPLTGGMA-GHPTEDPRVLGIGGSDPvgakgramggvgggRTEVH----------  3876
                  R +  G A G       + G    D + A    +   G GR   H          
Sbjct  105   AASDFRGVGLGTATGEAISGLSISGPAVMDHLEALDSDLPPSGQGRRFGHQLDAIIRPSR  164

Query  3875  ----LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFV  3708
                 LPPDASSTLYVEGLP + TRREV+HIFRPFVGYKEVRLV+KES+    DPLV CFV
Sbjct  165   ETAPLPPDASSTLYVEGLPPDSTRREVAHIFRPFVGYKEVRLVSKESKHRGRDPLVLCFV  224

Query  3707  DFASPAHAATAMDALQG  3657
             DF SPA AATA+ ALQG
Sbjct  225   DFTSPACAATALSALQG  241



>dbj|BAC42194.1| unknown protein [Arabidopsis thaliana]
Length=156

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  3878  HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFA  3699
             +LP DAS+TLYVEGLP+NC+RREV+HIFRPFVGY+EVRLVTK+S+  +GDP+V CFVDF 
Sbjct  52    NLPSDASNTLYVEGLPSNCSRREVAHIFRPFVGYREVRLVTKDSKHRNGDPIVLCFVDFT  111

Query  3698  SPAHAATAMDALQG  3657
             +PA AATA+ ALQG
Sbjct  112   NPACAATALSALQG  125



>gb|KDO83678.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
 gb|KDO83679.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=177

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 85/140 (61%), Gaps = 11/140 (8%)
 Frame = -2

Query  4043  AKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGG-----------SDPvgakgramggvg  3897
             +K  A+ G    R + GG+   P  DP V G  G           S  +  +        
Sbjct  5     SKARAFSGDRLRRAVPGGVTRLPVSDPSVTGRHGATGPDLVQNLRSSSIDDQLPFDAAAR  64

Query  3896  ggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVF  3717
              G   + LPPDASSTLYVEGLPA+ T+REV+HIFRPFVGYKEVRLV KES+   GDPL+ 
Sbjct  65    PGHETLPLPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLRGGDPLIL  124

Query  3716  CFVDFASPAHAATAMDALQG  3657
             CFVDF +PA AATA+ ALQG
Sbjct  125   CFVDFENPACAATALSALQG  144



>gb|ABK22259.1| unknown [Picea sitchensis]
Length=274

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 122/239 (51%), Gaps = 51/239 (21%)
 Frame = -2

Query  4265  MADAYWRFGDVRQQpppaaaipsllAKRPRSEYDPAN---SHDLAGYYARDDGRGGVHRV  4095
             MADAYWR G         +      AKR R +  PA      D+ GY     GR      
Sbjct  1     MADAYWRDG--------RSLGIPTPAKRARGDLPPAGISGGRDIPGYLPDMAGRS----F  48

Query  4094  IRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGH-----------------PTED  3966
             +R+++P G S D + ++    + GG  SA    GG+ G                     D
Sbjct  49    MRESNPPG-SLDSHARNGLPYSAGGLSSAD--IGGLGGSLGTRLGGSGGYGGLSGSSLAD  105

Query  3965  PRVLG----IGGSDPvgakgramggvgggRTEV------------HLPPDASSTLYVEGL  3834
               ++G    IG +DP         G+G  R++             HLPPDAS+TL+VEGL
Sbjct  106   SVLMGQRPGIGNADPGYGGKLGSLGLGYQRSDAQGLRDPLRRPDEHLPPDASNTLFVEGL  165

Query  3833  PANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             PA+CTRRE +HIFRPF+G+KEVRLV KE RRP GDPLV CFVDF     AATA++ALQG
Sbjct  166   PADCTRREAAHIFRPFIGFKEVRLVQKEPRRPGGDPLVLCFVDFTDARCAATALEALQG  224



>ref|NP_001185414.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE35907.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=179

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  3878  HLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFA  3699
             +LP DAS+TLYVEGLP+NC+RREV+HIFRPFVGY+EVRLVTK+S+  +GDP+V CFVDF 
Sbjct  75    NLPSDASNTLYVEGLPSNCSRREVAHIFRPFVGYREVRLVTKDSKHRNGDPIVLCFVDFT  134

Query  3698  SPAHAATAMDALQG  3657
             +PA AATA+ ALQG
Sbjct  135   NPACAATALSALQG  148



>gb|EYU19666.1| hypothetical protein MIMGU_mgv1a014291mg [Erythranthe guttata]
 gb|EYU19667.1| hypothetical protein MIMGU_mgv1a014291mg [Erythranthe guttata]
Length=194

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = -2

Query  4019  GESARPLTGGMAGHPT--EDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLY  3846
             G+  R  + G+ GH    +DPR++  G       +   +    GG  E+ LP DAS+TLY
Sbjct  43    GDYIRSGSNGLGGHHLVDDDPRLMSKG----RPPQIIPVIRKMGGVPEISLPIDASNTLY  98

Query  3845  VEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDA  3666
             VEG P +C+RRE+SHIFRPFVGY+ VRLVT ES+   G+ LV CFVDF SPAHAATAMDA
Sbjct  99    VEGFPVSCSRREISHIFRPFVGYRGVRLVTTESKYSSGNMLVLCFVDFLSPAHAATAMDA  158

Query  3665  LQG  3657
             LQG
Sbjct  159   LQG  161



>ref|XP_006367364.1| PREDICTED: uncharacterized protein LOC102584276 [Solanum tuberosum]
Length=214

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 92/161 (57%), Gaps = 30/161 (19%)
 Frame = -2

Query  4139  GYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPR  3960
             GYY  DD RG    ++R T  I ASY+ YL++ ++       S   +  G+ G   ED  
Sbjct  51    GYYDGDDERG----MMRSTASIEASYEHYLRTGQIL------SHESMHSGIMG--IED--  96

Query  3959  VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVG  3780
              +G+ G  P                E  LPP+A+ TLYVEGLPA+CTRREV+HIFR F G
Sbjct  97    -VGMVGGRP---------------EEATLPPNANCTLYVEGLPADCTRREVAHIFRHFGG  140

Query  3779  YKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             YKEVRLV K S     + L+ CFVDF SP HAA AMD LQG
Sbjct  141   YKEVRLVPKPSIHAGANTLILCFVDFVSPLHAAAAMDTLQG  181



>gb|KDO83680.1| hypothetical protein CISIN_1g023903mg [Citrus sinensis]
Length=153

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFAS  3696
             LPPDASSTLYVEGLPA+ T+REV+HIFRPFVGYKEVRLV KES+   GDPL+ CFVDF +
Sbjct  48    LPPDASSTLYVEGLPADSTKREVAHIFRPFVGYKEVRLVIKESKLRGGDPLILCFVDFEN  107

Query  3695  PAHAATAMDALQG  3657
             PA AATA+ ALQG
Sbjct  108   PACAATALSALQG  120



>ref|XP_006367960.1| PREDICTED: uncharacterized protein LOC102590773 [Solanum tuberosum]
Length=233

 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 93/161 (58%), Gaps = 30/161 (19%)
 Frame = -2

Query  4139  GYYARDDGRGGVHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPR  3960
             GYY  DD RG    ++R T  I ASY+ YL++ ++ ++        +  G+ G   ED  
Sbjct  70    GYYDGDDERG----MMRSTASIEASYEHYLRTGQILSH------ESMHSGIMG--IED--  115

Query  3959  VLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVG  3780
              +G+ G  P                E  LPP+A+ TLYVEGLPA+CTRREV+HIFR F G
Sbjct  116   -VGMVGGRPE---------------EATLPPNANCTLYVEGLPADCTRREVAHIFRHFGG  159

Query  3779  YKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             YKEVRLV K S     + L+ CFVDF SP HAA AMD LQG
Sbjct  160   YKEVRLVPKPSIHAGANTLILCFVDFVSPLHAAAAMDTLQG  200



>ref|XP_006661461.1| PREDICTED: uncharacterized protein LOC102707521 [Oryza brachyantha]
Length=216

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 14/150 (9%)
 Frame = -2

Query  4106  VHRVIRDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGMAGHPTEDPRVLGIGGSDPvg  3927
             + ++ + + PI   Y  +L + K+   G  +SA PL GGM GHP  +  ++G  G D   
Sbjct  49    LEKMSQSSSPI---YGHHLNN-KIPYAGANQSAMPL-GGMVGHPMHNNHMMGTTGLD---  100

Query  3926  akgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKES  3747
                     +G  RT    P DASSTLYVEGLP+NCT+REVSHIFRPF G++EVRLV KES
Sbjct  101   -----NRNIGATRTNATSPRDASSTLYVEGLPSNCTKREVSHIFRPFSGFREVRLVNKES  155

Query  3746  RRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             R   G   + CFVDFA+P+ A +A++ LQG
Sbjct  156   RHA-GRYNLLCFVDFATPSEARSALETLQG  184



>gb|KHN15442.1| RNA-binding protein with multiple splicing [Glycine soja]
Length=212

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  3881  VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDF  3702
             V LPPDASSTLYVEGLP++ TRREV+HIFRPFVGY+EVRLV+KES+   GDP   CFVDF
Sbjct  105   VPLPPDASSTLYVEGLPSDSTRREVAHIFRPFVGYREVRLVSKESKHRGGDPHYLCFVDF  164

Query  3701  ASPAHAATAMDALQG  3657
             A+PA AATAM ALQG
Sbjct  165   ANPACAATAMSALQG  179



>ref|XP_010477394.1| PREDICTED: uncharacterized protein LOC104756489 isoform X2 [Camelina 
sativa]
Length=233

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -2

Query  3875  LPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESR--RPDGDPLVFCFVDF  3702
             LPPD S+TLYVEGLP+NC+RREVSHIFRPFVGY+EVRLVTK+S+  R +GDP+V CFVDF
Sbjct  127   LPPDVSNTLYVEGLPSNCSRREVSHIFRPFVGYREVRLVTKDSKHVRRNGDPIVLCFVDF  186

Query  3701  ASPAHAATAMDALQ  3660
              SPA AATA+ ALQ
Sbjct  187   ESPACAATALSALQ  200



>ref|XP_003592143.1| RNA-binding protein with multiple splicing [Medicago truncatula]
 gb|AFK46022.1| unknown [Medicago truncatula]
Length=147

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  3881  VHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDF  3702
             + LP DASSTLYVEGLP++ T+REV+HIFRPFVGY+EVRLV KES+   GDPL+ CFVDF
Sbjct  39    IPLPRDASSTLYVEGLPSDSTKREVAHIFRPFVGYREVRLVAKESKHRGGDPLILCFVDF  98

Query  3701  ASPAHAATAMDALQG  3657
             A+PA AATA+ ALQG
Sbjct  99    ANPACAATALSALQG  113



>ref|XP_002893157.1| hypothetical protein ARALYDRAFT_472365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69416.1| hypothetical protein ARALYDRAFT_472365 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   122 bits (307),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 99/180 (55%), Gaps = 20/180 (11%)
 Frame = -2

Query  4154  SHDLAGYYARDDGRGGVHRVIRDTDPIGASYDRYLQ-------SAKVSAYGGGESARPLT  3996
             S  +  Y +RD+ RG  H V +DT  IG++YD+YL        S +   + G    R   
Sbjct  206   SGGMHSYLSRDEDRGIPHSV-KDTRTIGSAYDQYLNNQTPSVPSEEAGPFNGAGMGRQGG  264

Query  3995  GGMAGHPTEDPRVLGIGGSDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTR  3816
               M   P     + G GGS P   +               LPPD S+TLYVEGLP+NC+R
Sbjct  265   NNMMPGPPMGELMAGRGGSFPSDFRPNGRAIGREP-----LPPDVSNTLYVEGLPSNCSR  319

Query  3815  REVS-------HIFRPFVGYKEVRLVTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             RE          +FRPFVGY+EVRLVTK+S+   GDP+V CFVDF +PA AATA+ ALQG
Sbjct  320   RENVLSCSLSLTVFRPFVGYREVRLVTKDSKHRSGDPVVLCFVDFENPACAATALSALQG  379



>gb|EMT12949.1| hypothetical protein F775_32109 [Aegilops tauschii]
Length=227

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 117/215 (54%), Gaps = 36/215 (17%)
 Frame = -2

Query  4262  ADAYWRFG--DVRQQpppaaaipsllAKRPRSEY-DPANSHDLAGYYARDDGRGGVHRVI  4092
             A+ YWR G  +  QQ        +   KR R +Y D     ++AGYY R++   G H  +
Sbjct  3     AENYWRGGWANQHQQQQQQQQAAAPSLKRARPDYGDGPGGQEMAGYYPRENA--GYH-SL  59

Query  4091  RDTDPIGASYDRYLQSAKVSAYGGGESARPLTGGM----------AGHPTEDPRVLGIGG  3942
             RD + IGASYDRYL++   S     E +R + G M          +G+P +D R++G+ G
Sbjct  60    RDNEAIGASYDRYLRNGMPSV-AANEPSRAVVGAMGGAAMVGGGMSGYPVDDRRMMGVVG  118

Query  3941  SDPvgakgramggvgggRTEVHLPPDASSTLYVEGLPANCTRREVSHIFRPFVGYKEVRL  3762
              D       +     G R E  LPPDAS+TLY+E             IFRPFVG++EVRL
Sbjct  119   MD-------SRAMGYGARPEPPLPPDASNTLYIE------------DIFRPFVGFREVRL  159

Query  3761  VTKESRRPDGDPLVFCFVDFASPAHAATAMDALQG  3657
             V KESR P GDP V CFVDF SPA A  A++ALQG
Sbjct  160   VNKESRHPGGDPHVLCFVDFDSPAQATIALEALQG  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14884336815544