BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21571_g1_i2 len=1930 path=[1967:0-240 2208:241-264 2232:265-770
2738:771-778 2746:779-806 2774:807-840 2808:841-926 2894:927-1929]

Length=1930
                                                                      Score     E

ref|XP_006358528.1|  PREDICTED: vetispiradiene synthase 1-like          686   0.0      
ref|XP_009764785.1|  PREDICTED: vetispiradiene synthase 3-like          681   0.0      
ref|XP_004230359.1|  PREDICTED: vetispiradiene synthase 1               679   0.0      
ref|XP_004230358.1|  PREDICTED: vetispiradiene synthase 1 isoform X1    676   0.0      
ref|XP_009773139.1|  PREDICTED: vetispiradiene synthase 3               676   0.0      
dbj|BAA82108.1|  vetispiradiene synthase                                676   0.0      Solanum tuberosum [potatoes]
ref|NP_001274950.1|  putative vetispiradiene synthase 3                 673   0.0      
ref|NP_001275083.1|  uncharacterized protein LOC102595695               671   0.0      
ref|XP_009794139.1|  PREDICTED: vetispiradiene synthase 2-like          670   0.0      
ref|NP_001239040.1|  viridiflorene synthase                             669   0.0      
sp|Q9XJ32.1|VTSS1_SOLTU  RecName: Full=Vetispiradiene synthase 1        669   0.0      Solanum tuberosum [potatoes]
ref|NP_001275171.1|  putative vetispiradiene synthase 5                 669   0.0      
ref|XP_006358531.1|  PREDICTED: viridiflorene synthase-like             668   0.0      
gb|AAD02223.1|  vetispiradiene synthase                                 667   0.0      Solanum tuberosum [potatoes]
ref|XP_004230360.1|  PREDICTED: vetispiradiene synthase 1               666   0.0      
dbj|BAN58139.1|  putative vetispiradiene synthase                       666   0.0      
ref|XP_006367961.1|  PREDICTED: viridiflorene synthase-like             666   0.0      
sp|Q39978.2|VTSS1_HYOMU  RecName: Full=Vetispiradiene synthase 1;...    665   0.0      Hyoscyamus muticus
gb|AAD02268.1|  putative vetispiradiene synthase 3                      664   0.0      Solanum tuberosum [potatoes]
gb|AAG09949.1|AF171216_1  vetispiradiene synthase                       664   0.0      Solanum lycopersicum
ref|XP_009589983.1|  PREDICTED: 5-epi-aristolochene synthase-like       662   0.0      
sp|Q84LF0.1|5EAS2_NICAT  RecName: Full=5-epi-aristolochene syntha...    649   0.0      Nicotiana attenuata
gb|AAK15641.1|AF326117_1  sesquiterpene cyclase                         649   0.0      Capsicum annuum
pdb|5EAS|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    646   0.0      
ref|XP_009762840.1|  PREDICTED: 5-epi-aristolochene synthase-like...    645   0.0      
pdb|5EAT|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    644   0.0      
pdb|5EAU|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    644   0.0      
pdb|3M01|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    642   0.0      
sp|Q40577.3|5EAS_TOBAC  RecName: Full=5-epi-aristolochene synthas...    642   0.0      Nicotiana tabacum [American tobacco]
pdb|1HXC|A  Chain A, Crystal Structure Of Teas C440w                    641   0.0      
sp|Q84LG0.1|5EAS4_NICAT  RecName: Full=Probable 5-epi-aristoloche...    641   0.0      Nicotiana attenuata
ref|XP_009595428.1|  PREDICTED: 5-epi-aristolochene synthase            641   0.0      
ref|XP_009779916.1|  PREDICTED: 5-epi-aristolochene synthase            640   0.0      
pdb|3LZ9|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    640   0.0      
ref|XP_009771989.1|  PREDICTED: 5-epi-aristolochene synthase-like       640   0.0      
pdb|4DI5|A  Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristoloche...    639   0.0      
gb|AAA19216.1|  5-epi-aristolochene synthase                            639   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009784555.1|  PREDICTED: 5-epi-aristolochene synthase 3          639   0.0      
sp|Q84LF2.1|5EAS3_NICAT  RecName: Full=5-epi-aristolochene syntha...    638   0.0      Nicotiana attenuata
pdb|1HX9|A  Chain A, Crystal Structure Of Teas W273s Form 1             638   0.0      
ref|XP_011082248.1|  PREDICTED: vetispiradiene synthase 3-like          638   0.0      
gb|AAA86337.1|  vetispiradiene synthase                                 636   0.0      Hyoscyamus muticus
sp|Q84LF1.1|5EAS1_NICAT  RecName: Full=5-epi-aristolochene syntha...    637   0.0      Nicotiana attenuata
pdb|1HXG|A  Chain A, Crystal Structure Of Teas W273sC440W               636   0.0      
ref|XP_010313902.1|  PREDICTED: vetispiradiene synthase 1 isoform X2    635   0.0      
ref|XP_011082247.1|  PREDICTED: vetispiradiene synthase 3-like          632   0.0      
gb|AHM10157.1|  sesquiterpene synthase                                  626   0.0      
sp|O65323.1|5EAS_CAPAN  RecName: Full=5-epiaristolochene synthase       625   0.0      Capsicum annuum
emb|CAA06614.1|  5-epi-aristolochene synthase                           617   0.0      Capsicum annuum var. annuum [chilli pepper]
ref|XP_011082260.1|  PREDICTED: vetispiradiene synthase 3-like          608   0.0      
gb|AAP79448.1|  epi-arisotolchene synthase 110                          604   0.0      Nicotiana tabacum [American tobacco]
gb|AAF21053.1|AF212433_1  UV-induced sesquiterpene cyclase              603   0.0      Capsicum annuum
ref|XP_009617319.1|  PREDICTED: LOW QUALITY PROTEIN: vetispiradie...    592   0.0      
ref|XP_011073749.1|  PREDICTED: vetispiradiene synthase 3-like          577   0.0      
gb|AAG09950.1|AF171218_1  vetispiradiene synthase                       565   0.0      Solanum lycopersicum
gb|EYU32629.1|  hypothetical protein MIMGU_mgv1a023948mg                562   0.0      
gb|EYU21979.1|  hypothetical protein MIMGU_mgv1a019334mg                553   0.0      
gb|AGN72800.1|  germacrene A                                            551   0.0      
emb|CAC83059.2|  putative terpenesynthase-1                             551   0.0      Marrubium vulgare
sp|Q49SP5.1|TPGAS_POGCB  RecName: Full=Germacrene A synthase; Alt...    551   0.0      Pogostemon cablin
gb|EYU21989.1|  hypothetical protein MIMGU_mgv1a023416mg                549   0.0      
gb|AAK15642.1|AF326118_1  sesquiterpene cyclase                         545   0.0      Capsicum annuum
gb|EYU21954.1|  hypothetical protein MIMGU_mgv1a023164mg                541   0.0      
gb|AGN72803.1|  germacrene A                                            538   0.0      
ref|XP_009764783.1|  PREDICTED: viridiflorene synthase-like             534   0.0      
gb|AGN72806.1|  germacrene A                                            534   5e-180   
gb|EYU21983.1|  hypothetical protein MIMGU_mgv1a023510mg                535   7e-180   
ref|XP_006354694.1|  PREDICTED: viridiflorene synthase-like             534   9e-180   
gb|AAX16076.1|  putative sesquiterpene synthase                         530   3e-178   Perilla frutescens var. frutescens
gb|AAG17667.1|AF272244_1  5-epi-aristolochene synthase                  523   4e-177   Nicotiana tabacum [American tobacco]
gb|EYU43546.1|  hypothetical protein MIMGU_mgv1a002915mg                525   3e-175   
gb|EYU32628.1|  hypothetical protein MIMGU_mgv1a005108mg                516   1e-173   
gb|AAX16077.1|  valencene synthase                                      514   6e-172   Perilla frutescens var. frutescens
ref|XP_004237611.1|  PREDICTED: vetispiradiene synthase 2               508   1e-169   
ref|XP_009599829.1|  PREDICTED: 5-epi-aristolochene synthase 3-like     504   1e-169   
ref|XP_010319920.1|  PREDICTED: vetispiradiene synthase 3-like          496   4e-165   
gb|EYU31456.1|  hypothetical protein MIMGU_mgv1a004071mg                490   8e-163   
gb|EYU31458.1|  hypothetical protein MIMGU_mgv1a004009mg                478   8e-158   
ref|XP_010644711.1|  PREDICTED: (-)-germacrene D synthase               472   1e-155   
gb|AII32471.1|  terpene synthase                                        470   6e-155   
sp|F6M8H4.1|SAST_SANAL  RecName: Full=Probable sesquiterpene synt...    470   1e-154   
sp|E3W208.1|SPISS_SANSP  RecName: Full=Sesquiterpene synthase; Sh...    469   1e-154   
emb|CDP20681.1|  unnamed protein product                                468   3e-154   
dbj|BAP74389.1|  delta-elemene synthase                                 469   4e-154   
ref|XP_006475286.1|  PREDICTED: (-)-germacrene D synthase-like is...    468   5e-154   
emb|CAA77191.1|  (+)-delta-cadinene synthase                            468   7e-154   Gossypium arboreum [tree cotton]
sp|E3W207.1|SAUSS_SANAS  RecName: Full=Sesquiterpene synthase; Sh...    468   8e-154   
sp|B5A435.1|STPS1_SANAL  RecName: Full=Sesquiterpene synthase; Sh...    467   1e-153   Santalum album
ref|XP_009762842.1|  PREDICTED: 5-epi-aristolochene synthase-like...    463   2e-153   
emb|CBI20483.3|  unnamed protein product                                466   2e-153   
gb|ADR66821.1|  germacrene A synthase                                   466   2e-153   
ref|NP_001268063.1|  uncharacterized protein LOC100267145               466   3e-153   
sp|Q43714.1|DCS3_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    466   5e-153   Gossypium arboreum [tree cotton]
emb|CAN68620.1|  hypothetical protein VITISV_013313                     465   8e-153   Vitis vinifera
ref|XP_006475285.1|  PREDICTED: (-)-germacrene D synthase-like is...    465   9e-153   
ref|XP_006472987.1|  PREDICTED: (-)-germacrene D synthase-like          466   2e-152   
gb|AFJ04408.1|  5-epi-aristolochene synthase                            460   3e-152   
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g             462   6e-152   Populus trichocarpa [western balsam poplar]
ref|XP_004288818.1|  PREDICTED: (-)-germacrene D synthase-like          462   7e-152   
emb|CAN83470.1|  hypothetical protein VITISV_030783                     462   7e-152   Vitis vinifera
sp|F6M8H5.1|SAUST_SANAS  RecName: Full=Probable sesquiterpene syn...    462   1e-151   
sp|F6M8H6.1|SPIST_SANSP  RecName: Full=Probable sesquiterpene syn...    462   1e-151   
ref|XP_004505471.1|  PREDICTED: (-)-germacrene D synthase-like          462   1e-151   
ref|XP_011015484.1|  PREDICTED: valencene synthase-like                 462   1e-151   
gb|AFR42419.1|  driminol synthase                                       462   1e-151   
gb|KHG04498.1|  (+)-delta-cadinene synthase isozyme A                   461   2e-151   
sp|F6M8H7.1|SMST_SANMU  RecName: Full=Probable sesquiterpene synt...    462   2e-151   
ref|XP_010247958.1|  PREDICTED: (-)-germacrene D synthase-like          461   2e-151   
ref|NP_001268028.1|  valencene synthase-like                            461   2e-151   
ref|NP_001268213.1|  (-)-germacrene D synthase                          461   3e-151   
emb|CDP07837.1|  unnamed protein product                                461   3e-151   
gb|AAF74977.1|AF270425_1  (+)-delta-cadinene synthase                   459   8e-151   Gossypium hirsutum [American cotton]
gb|AAX44033.1|  (+)-delta-cadinene synthase                             459   9e-151   Gossypium hirsutum [American cotton]
gb|AFE56211.1|  terpene synthase                                        460   1e-150   
sp|Q39760.1|DCS2_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    459   1e-150   Gossypium arboreum [tree cotton]
emb|CBI31274.3|  unnamed protein product                                465   2e-150   
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like          459   2e-150   
dbj|BAP75561.1|  linalool synthase                                      459   3e-150   
gb|KHG05331.1|  delta-cadinene synthase isozyme XC14                    458   3e-150   
emb|CDP18842.1|  unnamed protein product                                458   3e-150   
ref|XP_007021117.1|  Delta-cadinene synthase isozyme A                  458   3e-150   
gb|EYU31464.1|  hypothetical protein MIMGU_mgv1a003909mg                458   4e-150   
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1      457   6e-150   
ref|XP_007021123.1|  Delta-cadinene synthase isozyme A                  457   8e-150   
emb|CAN78342.1|  hypothetical protein VITISV_000109                     457   1e-149   Vitis vinifera
ref|XP_006475284.1|  PREDICTED: (-)-germacrene D synthase-like          457   1e-149   
sp|Q39761.1|DCS1_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    456   2e-149   Gossypium arboreum [tree cotton]
emb|CBI31262.3|  unnamed protein product                                458   2e-149   
ref|XP_009338863.1|  PREDICTED: (-)-germacrene D synthase-like          456   2e-149   
ref|NP_001268204.1|  uncharacterized protein LOC100257265               456   2e-149   
ref|XP_004301355.1|  PREDICTED: (-)-germacrene D synthase-like          455   4e-149   
ref|XP_011080335.1|  PREDICTED: gamma-cadinene synthase-like            454   8e-149   
gb|AAR99061.1|  (-)-germacrene D synthase                               454   1e-148   Populus trichocarpa x Populus deltoides
ref|XP_006478794.1|  PREDICTED: (-)-germacrene D synthase-like is...    454   1e-148   
ref|XP_006469889.1|  PREDICTED: (-)-germacrene D synthase-like          454   1e-148   
gb|AAV36464.1|  wound-inducible putative cytosolic terpene syntha...    454   2e-148   Medicago truncatula
sp|Q39980.1|VTSS3_HYOMU  RecName: Full=Vetispiradiene synthase 3;...    446   2e-148   Hyoscyamus muticus
sp|O49853.1|DCS4_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    454   2e-148   Gossypium arboreum [tree cotton]
emb|CDP16468.1|  unnamed protein product                                453   2e-148   
ref|XP_009358866.1|  PREDICTED: (-)-germacrene D synthase-like          453   3e-148   
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                         453   4e-148   
gb|KDO52415.1|  hypothetical protein CISIN_1g008620mg                   453   4e-148   
ref|NP_001268024.1|  valencene synthase-like                            453   6e-148   
ref|XP_007021120.1|  Delta-cadinene synthase isozyme A                  452   6e-148   
gb|KHG16315.1|  delta-cadinene synthase isozyme XC1                     452   7e-148   
ref|XP_011080337.1|  PREDICTED: gamma-cadinene synthase-like            452   9e-148   
gb|AAX44034.1|  (+)-delta-cadinene synthase                             452   1e-147   Gossypium hirsutum [American cotton]
ref|XP_011080424.1|  PREDICTED: gamma-cadinene synthase-like            452   1e-147   
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase               452   1e-147   Vitis vinifera
gb|KDO69460.1|  hypothetical protein CISIN_1g044370mg                   451   2e-147   
gb|KHG01539.1|  delta-cadinene synthase isozyme XC1                     452   2e-147   
ref|XP_006478792.1|  PREDICTED: (-)-germacrene D synthase-like          451   2e-147   
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...    451   2e-147   
emb|CBI31305.3|  unnamed protein product                                454   3e-147   
ref|XP_010241001.1|  PREDICTED: (-)-germacrene D synthase-like          451   3e-147   
gb|ADX01384.1|  germacrene D synthase                                   450   4e-147   
sp|P93665.1|DCS1_GOSHI  RecName: Full=(+)-delta-cadinene synthase...    450   5e-147   Gossypium hirsutum [American cotton]
ref|XP_008232170.1|  PREDICTED: (-)-germacrene D synthase-like          450   7e-147   
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...    450   7e-147   Vitis vinifera
ref|NP_001268215.1|  valencene synthase                                 449   8e-147   
gb|AEI52901.1|  terpene synthase 1                                      450   8e-147   
gb|ABB01625.1|  terpene synthase                                        449   9e-147   Medicago truncatula
ref|XP_002522812.1|  (+)-delta-cadinene synthase isozyme A, putative    449   9e-147   Ricinus communis
emb|CAD90835.1|  (+)-delta-cadinene synthase                            449   1e-146   Gossypium arboreum [tree cotton]
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g             449   1e-146   
ref|XP_011048258.1|  PREDICTED: (-)-germacrene D synthase-like          448   2e-146   
ref|XP_010057304.1|  PREDICTED: (-)-germacrene D synthase-like          449   2e-146   
dbj|BAJ46125.1|  sesquiterpene synthase                                 448   3e-146   
ref|XP_007133004.1|  hypothetical protein PHAVU_011G143100g             448   3e-146   
ref|XP_006476905.1|  PREDICTED: (-)-germacrene D synthase-like          447   4e-146   
gb|KHG14851.1|  (+)-delta-cadinene synthase isozyme C2                  448   4e-146   
ref|XP_006370591.1|  hypothetical protein POPTR_0001s44080g             447   6e-146   
ref|XP_009344725.1|  PREDICTED: (-)-germacrene D synthase-like          447   6e-146   
ref|XP_011080426.1|  PREDICTED: gamma-cadinene synthase-like            447   7e-146   
gb|AGB14625.1|  germacrene-D synthase                                   446   1e-145   
ref|XP_008347229.1|  PREDICTED: (-)-germacrene D synthase-like          446   1e-145   
dbj|BAM24405.1|  sesquiterpene synthase                                 446   1e-145   
gb|ADR74199.1|  gamma-cadinene synthase                                 446   3e-145   
gb|AGB14624.1|  beta-caryophyllene synthase                             445   3e-145   
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like          445   5e-145   
ref|XP_011030746.1|  PREDICTED: (-)-germacrene D synthase-like is...    444   8e-145   
gb|KDO45658.1|  hypothetical protein CISIN_1g039366mg                   444   1e-144   
gb|KHG04103.1|  (-)-germacrene D synthase                               443   1e-144   
gb|AII32473.1|  terpene synthase                                        444   1e-144   
gb|KCW52014.1|  hypothetical protein EUGRSUZ_J01453                     444   2e-144   
ref|XP_006592517.1|  PREDICTED: (-)-germacrene D synthase-like is...    444   2e-144   
ref|XP_006475307.1|  PREDICTED: (E)-beta-farnesene synthase-like ...    443   2e-144   
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like          457   2e-144   
ref|XP_002275408.3|  PREDICTED: valencene synthase                      443   2e-144   Vitis vinifera
dbj|BAJ53216.1|  JHL22C18.7                                             443   2e-144   
ref|XP_006592518.1|  PREDICTED: (-)-germacrene D synthase-like is...    443   2e-144   
ref|XP_009338867.1|  PREDICTED: (-)-germacrene D synthase-like          442   4e-144   
gb|AFQ23183.1|  sesquiterpene synthase                                  442   4e-144   
ref|XP_003541022.1|  PREDICTED: (-)-germacrene D synthase-like is...    442   5e-144   
ref|XP_002317018.2|  hypothetical protein POPTR_0011s14600g             442   6e-144   Populus trichocarpa [western balsam poplar]
ref|XP_007133006.1|  hypothetical protein PHAVU_011G143300g             442   8e-144   
gb|KHN11075.1|  (-)-germacrene D synthase                               442   1e-143   
ref|XP_010032599.1|  PREDICTED: (-)-germacrene D synthase-like          442   1e-143   
ref|XP_011080427.1|  PREDICTED: gamma-cadinene synthase-like            441   2e-143   
ref|XP_010248057.1|  PREDICTED: probable terpene synthase 2             444   2e-143   
ref|XP_011030745.1|  PREDICTED: (-)-germacrene D synthase-like is...    441   3e-143   
ref|XP_007021067.1|  Delta-cadinene synthase isozyme A, putative        440   5e-143   
ref|NP_001239041.1|  sesquiterpene synthase                             439   7e-143   
ref|XP_011015428.1|  PREDICTED: probable terpene synthase 6             439   8e-143   
emb|CAN81129.1|  hypothetical protein VITISV_002911                     439   9e-143   Vitis vinifera
ref|XP_011009446.1|  PREDICTED: probable terpene synthase 6             439   1e-142   
ref|XP_009334624.1|  PREDICTED: (-)-germacrene D synthase-like          439   1e-142   
ref|XP_006592519.1|  PREDICTED: (-)-germacrene D synthase-like is...    439   2e-142   
ref|XP_007021115.1|  Delta-cadinene synthase isozyme A, putative        438   2e-142   
ref|XP_002523635.1|  (+)-delta-cadinene synthase isozyme A, putative    438   2e-142   Ricinus communis
gb|KDP36230.1|  hypothetical protein JCGZ_09950                         438   3e-142   
ref|XP_011009447.1|  PREDICTED: probable terpene synthase 6             438   3e-142   
gb|ADK94034.1|  alpha-copaene synthase                                  438   3e-142   
ref|XP_006475306.1|  PREDICTED: (E)-beta-farnesene synthase-like        437   3e-142   
ref|XP_002513334.1|  Casbene synthase, chloroplast precursor, put...    439   4e-142   Ricinus communis
ref|XP_006365530.1|  PREDICTED: germacrene C synthase-like              438   5e-142   
gb|AGW18162.1|  terpene synthase 4-2                                    436   1e-141   
gb|AEM23828.1|  sesquiterpene synthase                                  436   1e-141   
emb|CBI20287.3|  unnamed protein product                                437   2e-141   
ref|XP_006370589.1|  hypothetical protein POPTR_0001s44080g             433   3e-141   
dbj|BAM34474.1|  casbene synthase                                       437   3e-141   
ref|XP_006358572.1|  PREDICTED: vetispiradiene synthase 1-like          428   4e-141   
ref|XP_011035527.1|  PREDICTED: (-)-germacrene D synthase-like          434   5e-141   
gb|KHG27356.1|  delta-cadinene synthase isozyme XC14                    434   5e-141   
ref|XP_010683546.1|  PREDICTED: (-)-germacrene D synthase-like is...    434   7e-141   
ref|XP_006592520.1|  PREDICTED: (-)-germacrene D synthase-like is...    435   7e-141   
emb|CDP07835.1|  unnamed protein product                                434   7e-141   
ref|XP_007028200.1|  Delta-cadinene synthase isozyme A, putative        434   8e-141   
gb|AGW18157.1|  terpene synthase 4                                      434   9e-141   
ref|XP_007133005.1|  hypothetical protein PHAVU_011G143200g             434   9e-141   
gb|AIM47562.1|  casbene synthase 1                                      435   1e-140   
ref|XP_009338866.1|  PREDICTED: (-)-germacrene D synthase-like          433   2e-140   
emb|CAN72015.1|  hypothetical protein VITISV_010524                     432   2e-140   Vitis vinifera
ref|XP_004308569.1|  PREDICTED: (-)-germacrene D synthase-like          433   2e-140   
emb|CAN82172.1|  hypothetical protein VITISV_040547                     433   2e-140   Vitis vinifera
ref|XP_011009443.1|  PREDICTED: probable terpene synthase 6 isofo...    433   3e-140   
ref|XP_003614996.1|  (+)-delta-cadinene synthase isozyme A              432   3e-140   
ref|XP_009346480.1|  PREDICTED: (-)-alpha-pinene synthase-like          433   3e-140   
gb|KDO74408.1|  hypothetical protein CISIN_1g008427mg                   433   3e-140   
ref|XP_011080334.1|  PREDICTED: gamma-cadinene synthase-like            432   3e-140   
ref|XP_011009444.1|  PREDICTED: probable terpene synthase 6 isofo...    432   3e-140   
ref|XP_002274445.2|  PREDICTED: valencene synthase-like                 432   4e-140   Vitis vinifera
ref|XP_002274781.1|  PREDICTED: valencene synthase                      432   4e-140   Vitis vinifera
ref|XP_002306399.2|  hypothetical protein POPTR_0005s09830g             432   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_002283070.1|  PREDICTED: (-)-germacrene D synthase               432   7e-140   Vitis vinifera
emb|CAN62603.1|  hypothetical protein VITISV_009665                     432   8e-140   Vitis vinifera
ref|XP_008388200.1|  PREDICTED: (-)-germacrene D synthase-like          431   9e-140   
emb|CBI31294.3|  unnamed protein product                                432   9e-140   
ref|XP_007021121.1|  Delta-cadinene synthase isozyme A                  432   1e-139   
emb|CBI20174.3|  unnamed protein product                                431   1e-139   
gb|AAG01339.1|  terpene synthase                                        431   1e-139   Citrus junos [kuzu]
gb|AAG41892.1|AF279456_1  sesquiterpene synthase 2                      430   2e-139   Solanum habrochaites
gb|AGR40502.1|  caryophyllene synthase                                  430   2e-139   
ref|XP_007021122.1|  Delta-cadinene synthase isozyme A, putative        436   2e-139   
sp|Q8SA63.1|CARS_ARTAN  RecName: Full=Beta-caryophyllene synthase       430   3e-139   Artemisia annua [sweet Annie]
gb|AII32469.1|  terpene synthase                                        430   3e-139   
ref|XP_002513340.1|  Casbene synthase, chloroplast precursor            432   3e-139   Ricinus communis
ref|XP_008371258.1|  PREDICTED: (-)-germacrene D synthase-like is...    430   3e-139   
gb|KDO41838.1|  hypothetical protein CISIN_1g041926mg                   427   4e-139   
ref|XP_008371257.1|  PREDICTED: (-)-germacrene D synthase-like is...    430   4e-139   
ref|XP_006370875.1|  terpene synthase/cyclase family protein            430   4e-139   
ref|XP_010644187.1|  PREDICTED: (-)-germacrene D synthase-like          429   4e-139   
ref|XP_009355680.1|  PREDICTED: (-)-alpha-pinene synthase-like          431   5e-139   
ref|XP_004242295.1|  PREDICTED: germacrene C synthase-like              431   5e-139   
ref|XP_008226803.1|  PREDICTED: (-)-alpha-pinene synthase-like          429   5e-139   
gb|AIC76495.1|  terpene synthase                                        428   5e-139   
ref|XP_006592521.1|  PREDICTED: (-)-germacrene D synthase-like is...    430   6e-139   
dbj|BAN81914.1|  beta-caryophyllene synthase                            429   6e-139   
ref|XP_002523475.1|  (+)-delta-cadinene synthase isozyme A, putative    429   8e-139   Ricinus communis
gb|AEM23826.1|  sesquiterpene synthase                                  428   1e-138   
ref|XP_006371082.1|  hypothetical protein POPTR_0019s03330g             428   1e-138   
ref|XP_006473872.1|  PREDICTED: (-)-germacrene D synthase-like          428   1e-138   
gb|AES74575.2|  sesquiterpene synthase                                  428   2e-138   
ref|XP_010092292.1|  (-)-germacrene D synthase                          429   2e-138   
gb|KCW70095.1|  hypothetical protein EUGRSUZ_F03400                     428   2e-138   
ref|NP_001289541.1|  germacrene C synthase-like                         429   2e-138   
ref|XP_002513343.1|  Casbene synthase, chloroplast precursor, put...    429   3e-138   Ricinus communis
gb|KDP31579.1|  hypothetical protein JCGZ_14804                         429   3e-138   
gb|KDO41091.1|  hypothetical protein CISIN_1g008817mg                   427   5e-138   
ref|NP_001289542.1|  germacrene C synthase-like                         428   5e-138   
emb|CBI20482.3|  unnamed protein product                                432   6e-138   
ref|XP_011102272.1|  PREDICTED: gamma-cadinene synthase-like            425   6e-138   
gb|KDP42347.1|  hypothetical protein JCGZ_02820                         428   9e-138   
ref|NP_001239042.1|  sesquiterpene synthase                             426   1e-137   
ref|XP_007022718.1|  Terpene synthase 21, putative                      426   1e-137   
ref|XP_010042602.1|  PREDICTED: (-)-germacrene D synthase-like          426   1e-137   
ref|XP_002283076.1|  PREDICTED: (-)-germacrene D synthase               426   1e-137   
ref|XP_003541032.1|  PREDICTED: probable terpene synthase 2-like        426   2e-137   
gb|KCW62335.1|  hypothetical protein EUGRSUZ_H04977                     426   2e-137   
ref|XP_010092286.1|  (-)-germacrene D synthase                          426   2e-137   
gb|AAS46038.1|  cyclase                                                 427   2e-137   
ref|XP_009349849.1|  PREDICTED: (-)-germacrene D synthase-like          425   2e-137   
ref|XP_010066141.1|  PREDICTED: (-)-germacrene D synthase-like          426   2e-137   
gb|ADR74194.1|  (E)-beta-caryophyllene synthase                         425   3e-137   
gb|AEP82781.1|  TPS16                                                   424   4e-137   
gb|AIC76497.1|  terpene synthase                                        425   4e-137   
gb|KDP42348.1|  hypothetical protein JCGZ_02821                         426   4e-137   
ref|XP_004298302.1|  PREDICTED: (-)-germacrene D synthase-like          424   5e-137   
gb|AAX16121.1|  germacrene-D synthase                                   424   5e-137   
ref|XP_006492721.1|  PREDICTED: casbene synthase, chloroplastic-like    425   5e-137   
ref|XP_006473871.1|  PREDICTED: (-)-germacrene D synthase-like          424   5e-137   
gb|KCW44164.1|  hypothetical protein EUGRSUZ_L02418                     423   6e-137   
gb|KCW70094.1|  hypothetical protein EUGRSUZ_F03400                     424   6e-137   
ref|XP_010062945.1|  PREDICTED: (-)-germacrene D synthase-like          424   6e-137   
ref|XP_009623875.1|  PREDICTED: (-)-germacrene D synthase-like          424   7e-137   
ref|XP_003618357.1|  (+)-delta-cadinene synthase isozyme A              424   9e-137   
ref|XP_009591578.1|  PREDICTED: (-)-germacrene D synthase-like          423   9e-137   
ref|XP_008452330.1|  PREDICTED: (+)-gamma-cadinene synthase-like        424   9e-137   
ref|XP_007132999.1|  hypothetical protein PHAVU_011G142700g             424   1e-136   
ref|XP_004294317.1|  PREDICTED: (-)-germacrene D synthase-like          423   1e-136   
emb|CBI20475.3|  unnamed protein product                                425   1e-136   
ref|XP_011022083.1|  PREDICTED: probable terpene synthase 3             423   1e-136   
gb|KDO83772.1|  hypothetical protein CISIN_1g035568mg                   422   2e-136   
gb|AAK95517.1|AF401234_1  cyclase                                       424   2e-136   
ref|XP_007132996.1|  hypothetical protein PHAVU_011G142500g             423   2e-136   
gb|AJD19682.1|  sesquiterpene synthase Tps1                             423   2e-136   
ref|XP_010042263.1|  PREDICTED: (-)-germacrene D synthase-like          423   2e-136   
ref|XP_009355684.1|  PREDICTED: (-)-alpha-pinene synthase-like          423   2e-136   
ref|XP_009338882.1|  PREDICTED: (-)-germacrene D synthase-like          421   2e-136   
gb|AGZ84810.1|  beta-caryophyllene synthase                             422   3e-136   
gb|AAV36467.1|  wound-inducible putative cytosolic terpene syntha...    422   3e-136   
gb|AEH41845.1|  E-beta-caryophyllene synthase                           421   5e-136   
ref|XP_006475262.1|  PREDICTED: (-)-germacrene D synthase-like          422   6e-136   
gb|AII32478.1|  terpene synthase                                        421   7e-136   
emb|CDP12281.1|  unnamed protein product                                422   7e-136   
ref|NP_001284382.1|  (+)-gamma-cadinene synthase                        422   7e-136   
gb|AII32475.1|  terpene synthase                                        421   8e-136   
ref|XP_006475314.1|  PREDICTED: (E)-beta-farnesene synthase-like        423   8e-136   
ref|XP_009793508.1|  PREDICTED: germacrene C synthase-like isofor...    422   9e-136   
gb|KEH34289.1|  sesquiterpene synthase                                  421   1e-135   
ref|XP_008371259.1|  PREDICTED: (-)-germacrene D synthase-like is...    419   1e-135   
gb|AGX84976.1|  terpene synthase                                        420   2e-135   
ref|XP_008245781.1|  PREDICTED: (-)-alpha-pinene synthase-like          420   2e-135   
dbj|BAJ53218.1|  JHL17M24.1                                             420   2e-135   
sp|Q9FQ27.1|TPSGB_SOLHA  RecName: Full=(E,E)-germacrene B synthase      419   3e-135   
ref|XP_008226738.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    420   3e-135   
gb|AIC76494.1|  terpene synthase                                        421   4e-135   
ref|XP_006365934.1|  PREDICTED: germacrene C synthase-like              419   4e-135   
ref|XP_010059288.1|  PREDICTED: (-)-germacrene D synthase-like          425   5e-135   
emb|CAC12732.1|  putative sesquiterpene cyclase                         419   5e-135   
sp|I6RAQ6.1|TPS1_MATCR  RecName: Full=(-)-beta-caryophyllene synt...    419   6e-135   
gb|AFQ98015.1|  casbene synthase                                        421   6e-135   
gb|ADR71055.1|  Tps2-1                                                  419   6e-135   
emb|CDP12283.1|  unnamed protein product                                419   7e-135   
gb|KCW44753.1|  hypothetical protein EUGRSUZ_L01686                     419   7e-135   
ref|NP_001234766.1|  caryophyllene/alpha-humulene synthase              418   8e-135   
emb|CBI31269.3|  unnamed protein product                                417   8e-135   
ref|XP_009803139.1|  PREDICTED: germacrene C synthase-like isofor...    417   8e-135   
ref|XP_010040951.1|  PREDICTED: (-)-germacrene D synthase-like          419   9e-135   
gb|KEH26009.1|  sesquiterpene synthase                                  418   1e-134   
ref|XP_006494713.1|  PREDICTED: (-)-germacrene D synthase-like is...    418   1e-134   
dbj|BAJ53219.1|  JHL17M24.3                                             418   1e-134   
gb|KDP39015.1|  hypothetical protein JCGZ_00772                         418   1e-134   
ref|XP_004295289.1|  PREDICTED: (-)-germacrene D synthase-like          418   1e-134   
ref|XP_010038257.1|  PREDICTED: (-)-germacrene D synthase-like          417   3e-134   
gb|AAL25826.1|  cyclase                                                 418   3e-134   
ref|XP_006364159.1|  PREDICTED: (-)-germacrene D synthase-like          417   3e-134   
ref|XP_010092295.1|  Pinene synthase                                    417   3e-134   
gb|KDO38264.1|  hypothetical protein CISIN_1g008206mg                   417   3e-134   
dbj|BAJ53220.1|  JHL17M24.4                                             417   3e-134   
ref|XP_006367561.1|  PREDICTED: germacrene C synthase-like              417   3e-134   
gb|AIC76500.1|  terpene synthase                                        417   5e-134   
ref|XP_009594549.1|  PREDICTED: germacrene C synthase-like              418   6e-134   
ref|XP_008226800.1|  PREDICTED: (-)-alpha-pinene synthase-like          417   6e-134   
dbj|BAJ53221.1|  JHL17M24.6                                             416   6e-134   
ref|XP_007133018.1|  hypothetical protein PHAVU_011G144200g             416   6e-134   
gb|AIK19226.1|  sesquiterpene synthase                                  417   6e-134   
gb|ACF94469.1|  germacrene B synthase                                   417   6e-134   
ref|XP_002275351.1|  PREDICTED: valencene synthase                      416   8e-134   
gb|AAU05952.1|  beta-caryophyllene synthase                             416   8e-134   
ref|XP_006353135.1|  PREDICTED: (-)-germacrene D synthase-like          416   9e-134   
ref|XP_004287071.1|  PREDICTED: (-)-alpha-pinene synthase-like          416   1e-133   
ref|XP_010046229.1|  PREDICTED: (-)-germacrene D synthase-like          415   1e-133   
gb|ACI32639.1|  STS1                                                    416   1e-133   
gb|AEM23825.1|  sesquiterpene synthase                                  415   1e-133   
ref|XP_009757910.1|  PREDICTED: 5-epi-aristolochene synthase 1-like     411   2e-133   
gb|AGN70884.1|  casbene synthase                                        416   3e-133   
ref|XP_010062943.1|  PREDICTED: (-)-germacrene D synthase-like is...    415   3e-133   
gb|AGV28055.1|  sesquiterpene synthase                                  414   3e-133   
ref|NP_001289493.1|  germacrene C synthase-like                         416   3e-133   
ref|XP_004302393.1|  PREDICTED: (-)-alpha-pinene synthase-like          415   3e-133   
gb|KHN47556.1|  (-)-germacrene D synthase                               414   4e-133   
emb|CBI31290.3|  unnamed protein product                                432   5e-133   
ref|XP_010055487.1|  PREDICTED: (-)-germacrene D synthase-like          415   5e-133   
gb|KGN56189.1|  hypothetical protein Csa_3G097040                       414   5e-133   
ref|XP_006364906.1|  PREDICTED: (-)-germacrene D synthase-like          414   6e-133   
gb|AIK19227.1|  sesquiterpene synthase                                  414   7e-133   
ref|XP_010062944.1|  PREDICTED: (-)-germacrene D synthase-like is...    414   8e-133   
ref|XP_006477783.1|  PREDICTED: (-)-germacrene D synthase-like          413   9e-133   
ref|XP_010055474.1|  PREDICTED: (-)-germacrene D synthase-like          414   1e-132   
ref|XP_004303538.1|  PREDICTED: (-)-alpha-pinene synthase-like          413   1e-132   
ref|XP_010055490.1|  PREDICTED: (-)-germacrene D synthase-like          414   1e-132   
ref|XP_006371083.1|  hypothetical protein POPTR_0019s03350g             412   1e-132   
gb|KCW71961.1|  hypothetical protein EUGRSUZ_E00415                     414   1e-132   
ref|XP_006469943.1|  PREDICTED: (-)-germacrene D synthase-like          410   1e-132   
gb|KDP35926.1|  hypothetical protein JCGZ_09898                         413   1e-132   
ref|XP_009342460.1|  PREDICTED: (-)-alpha-pinene synthase-like          413   1e-132   
ref|XP_008366487.1|  PREDICTED: (-)-alpha-pinene synthase-like          413   1e-132   
gb|KDP37851.1|  hypothetical protein JCGZ_06358                         412   1e-132   
ref|NP_001268015.1|  (-)-germacrene D synthase-like                     413   2e-132   
emb|CAN71873.1|  hypothetical protein VITISV_002877                     412   2e-132   
ref|XP_006371216.1|  hypothetical protein POPTR_0019s06190g             412   2e-132   
gb|KCW76745.1|  hypothetical protein EUGRSUZ_D01100                     413   2e-132   
ref|XP_004497487.1|  PREDICTED: (-)-germacrene D synthase-like          412   2e-132   
gb|KCW71948.1|  hypothetical protein EUGRSUZ_E00404                     413   2e-132   
ref|XP_008366777.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-germacre...    410   3e-132   
ref|XP_008227046.1|  PREDICTED: (-)-alpha-pinene synthase-like          413   3e-132   
ref|XP_004243482.2|  PREDICTED: (-)-germacrene D synthase               412   3e-132   
gb|KCW44806.1|  hypothetical protein EUGRSUZ_L01631                     412   4e-132   
sp|J9RLZ7.1|TPS1_VALOF  RecName: Full=Germacrene C/D synthase; Al...    412   4e-132   
gb|ADB90273.1|  casbene synthase                                        413   5e-132   
ref|XP_002283344.1|  PREDICTED: (-)-germacrene D synthase               411   5e-132   
emb|CDP10867.1|  unnamed protein product                                412   6e-132   
gb|AAX40666.1|  sesquiterpene synthase                                  410   6e-132   
ref|XP_010055485.1|  PREDICTED: (-)-germacrene D synthase-like          412   6e-132   
gb|AGB05616.1|  sesquiterpene synthase 7                                411   7e-132   
ref|XP_006494712.1|  PREDICTED: (-)-germacrene D synthase-like is...    412   7e-132   
ref|XP_004294324.1|  PREDICTED: (-)-alpha-pinene synthase-like          411   7e-132   
ref|XP_006478795.1|  PREDICTED: (-)-germacrene D synthase-like is...    409   8e-132   
ref|NP_001275785.1|  valencene synthase                                 410   8e-132   
ref|XP_006478796.1|  PREDICTED: (-)-germacrene D synthase-like is...    408   8e-132   
sp|O23945.2|PINS_FRAVE  RecName: Full=(-)-alpha-pinene synthase; ...    411   8e-132   
gb|KCW63955.1|  hypothetical protein EUGRSUZ_G01636                     411   1e-131   
gb|AGW18161.1|  terpene synthase 4-1                                    410   1e-131   
gb|KDO38269.1|  hypothetical protein CISIN_1g008206mg                   409   2e-131   
ref|XP_002275058.1|  PREDICTED: valencene synthase                      410   2e-131   
gb|KCW44424.1|  hypothetical protein EUGRSUZ_L02082                     411   2e-131   
gb|AAQ04608.1|AF441124_1  valencene synthase                            410   2e-131   
ref|XP_008226737.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    410   2e-131   
gb|KDO38263.1|  hypothetical protein CISIN_1g008206mg                   410   2e-131   
gb|KCW71959.1|  hypothetical protein EUGRSUZ_E00414                     412   2e-131   
ref|XP_008226801.1|  PREDICTED: (-)-alpha-pinene synthase-like          409   3e-131   
gb|ADB90272.1|  casbene synthase                                        411   3e-131   
dbj|BAJ53213.1|  JHL23C09.9                                             411   3e-131   
ref|XP_010041348.1|  PREDICTED: (-)-germacrene D synthase-like          412   3e-131   
ref|XP_011080428.1|  PREDICTED: gamma-cadinene synthase-like            407   4e-131   
ref|XP_011095305.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caryoph...    409   4e-131   
ref|XP_008226806.1|  PREDICTED: (-)-alpha-pinene synthase-like          407   6e-131   
emb|CDP05818.1|  unnamed protein product                                408   6e-131   
ref|XP_007133012.1|  hypothetical protein PHAVU_011G143700g             408   6e-131   
ref|NP_001281061.1|  (-)-alpha-pinene synthase-like                     408   1e-130   
gb|AAM00426.1|AF411120_1  putative terpene synthase                     407   1e-130   
gb|KDP31577.1|  hypothetical protein JCGZ_14802                         407   1e-130   
ref|XP_010049987.1|  PREDICTED: (-)-germacrene D synthase-like          408   1e-130   
ref|XP_004490338.1|  PREDICTED: (-)-germacrene D synthase-like          408   1e-130   
ref|XP_006367836.1|  PREDICTED: germacrene C synthase-like              407   2e-130   
ref|XP_010061274.1|  PREDICTED: (-)-germacrene D synthase-like          408   2e-130   
gb|KDP46461.1|  hypothetical protein JCGZ_12944                         406   2e-130   
ref|XP_009804030.1|  PREDICTED: (-)-germacrene D synthase-like          407   2e-130   
ref|XP_006365542.1|  PREDICTED: germacrene C synthase-like              405   3e-130   
gb|KCW71947.1|  hypothetical protein EUGRSUZ_E00404                     407   4e-130   
ref|XP_008374195.1|  PREDICTED: (-)-alpha-pinene synthase-like          406   4e-130   
sp|B3TPQ6.1|BCUSY_MAGGA  RecName: Full=Beta-cubebene synthase; Sh...    406   5e-130   
gb|AHF22834.1|  drimenol synthase                                       406   5e-130   
ref|XP_004308410.1|  PREDICTED: (-)-germacrene D synthase-like          406   6e-130   
gb|AET00670.2|  sesquiterpene synthase                                  405   6e-130   
ref|XP_006363765.1|  PREDICTED: (-)-germacrene D synthase-like          405   7e-130   
ref|XP_006370590.1|  hypothetical protein POPTR_0001s44080g             405   7e-130   
gb|AGS16741.1|  sesquiterpene synthase                                  406   8e-130   
gb|KCW85107.1|  hypothetical protein EUGRSUZ_B01942                     404   9e-130   
gb|KCW76750.1|  hypothetical protein EUGRSUZ_D01105                     406   9e-130   
ref|NP_001234481.1|  sesquiterpene synthase 1                           405   1e-129   
ref|XP_010027310.1|  PREDICTED: (-)-germacrene D synthase-like          408   1e-129   
gb|AAG41890.1|AF279454_1  sesquiterpene synthase 2                      405   1e-129   
ref|XP_010058977.1|  PREDICTED: (-)-germacrene D synthase-like          402   2e-129   
ref|XP_004516888.1|  PREDICTED: (-)-germacrene D synthase-like          404   3e-129   
gb|AES98818.2|  sesquiterpene synthase                                  404   3e-129   
gb|AEP82784.1|  terpene synthase                                        404   3e-129   
ref|XP_009609204.1|  PREDICTED: LOW QUALITY PROTEIN: germacrene C...    407   3e-129   
gb|ACI32640.1|  STS2                                                    404   3e-129   
ref|XP_006388008.1|  hypothetical protein POPTR_0408s00200g             403   4e-129   
sp|J9R5V4.1|TPS2_VALOF  RecName: Full=Valerena-4,7(11)-diene synt...    404   4e-129   
gb|AIK19228.1|  sesquiterpene synthase                                  405   5e-129   
gb|KHN27991.1|  (-)-germacrene D synthase                               404   6e-129   
ref|XP_009768421.1|  PREDICTED: (-)-germacrene D synthase-like is...    403   8e-129   
ref|XP_010045915.1|  PREDICTED: (-)-germacrene D synthase-like          405   1e-128   
ref|XP_004514757.1|  PREDICTED: (-)-germacrene D synthase-like          403   1e-128   
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like          403   1e-128   
ref|XP_010049989.1|  PREDICTED: (-)-germacrene D synthase-like          403   1e-128   
ref|XP_011002270.1|  PREDICTED: probable terpene synthase 6             402   1e-128   
ref|XP_011090538.1|  PREDICTED: germacrene-D synthase-like              402   1e-128   
ref|XP_003615860.1|  (+)-delta-cadinene synthase isozyme C2             402   2e-128   
emb|CAN66799.1|  hypothetical protein VITISV_037341                     401   2e-128   
emb|CAN60658.1|  hypothetical protein VITISV_029939                     401   2e-128   
gb|AGB05610.1|  sesquiterpene synthase 1                                402   2e-128   
ref|XP_006356724.1|  PREDICTED: (E,E)-germacrene B synthase-like        401   2e-128   
ref|XP_002513369.1|  Casbene synthase, chloroplast precursor, put...    402   3e-128   
ref|XP_011095786.1|  PREDICTED: germacrene-D synthase-like              401   3e-128   
ref|XP_010062946.1|  PREDICTED: (-)-germacrene D synthase-like          402   3e-128   
ref|XP_004298298.1|  PREDICTED: (-)-germacrene D synthase-like          402   3e-128   
ref|XP_007133009.1|  hypothetical protein PHAVU_011G143500g             403   4e-128   
ref|XP_004168174.1|  PREDICTED: (+)-gamma-cadinene synthase-like        402   4e-128   
ref|XP_010546417.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...    401   5e-128   
gb|KCW74591.1|  hypothetical protein EUGRSUZ_E03311                     399   7e-128   
ref|XP_009757762.1|  PREDICTED: (-)-germacrene D synthase-like is...    400   8e-128   
gb|KDP24704.1|  hypothetical protein JCGZ_25440                         405   1e-127   
ref|XP_008386098.1|  PREDICTED: (-)-alpha-pinene synthase-like          400   1e-127   
ref|XP_003617711.1|  (+)-delta-cadinene synthase isozyme A              399   2e-127   
ref|XP_007133011.1|  hypothetical protein PHAVU_011G143600g             400   2e-127   
ref|XP_004295781.1|  PREDICTED: (-)-alpha-pinene synthase-like          399   2e-127   



>ref|XP_006358528.1| PREDICTED: vetispiradiene synthase 1-like [Solanum tuberosum]
Length=558

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/547 (62%), Positives = 408/547 (75%), Gaps = 8/547 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVS-IRSAKLAEK  331
             E+VRP+  F  SPSLWGD F  F  DN+VAE YA EI+ LK Q  S+L        L EK
Sbjct  16    EIVRPIADF--SPSLWGDYFHSFSVDNQVAEEYAHEIETLKEQTRSILSDDAYGTTLTEK  73

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNIS  505
             LN IDT+ERLGI+YHF + ID ML+ IY A+P+F+  D  DLCT +L FRLLRQHGYNIS
Sbjct  74    LNLIDTVERLGIAYHFEKQIDGMLDQIYKADPDFEAHDYNDLCTLSLQFRLLRQHGYNIS  133

Query  506   SGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               +F  FQ+  GKF   LSND++GLLNLYEASH+  H +  L+EA  FS  HLE   P L
Sbjct  134   PKLFSRFQDAKGKFNEPLSNDIRGLLNLYEASHVSTHGEDILQEALVFSTAHLESAAPHL  193

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM HKQE
Sbjct  194   ESPLNKQVAHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDFNLLQMLHKQE  253

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT
Sbjct  254   LSEVSRWWKDLDFVTTLPYARDRAVECYFWTVGVYAEPQYSQARVMLAKTIAMISIVDDT  313

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELSK+GRS  VH
Sbjct  314   FDAYGIVKELEVYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYETELSKDGRSDVVH  373

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A ST YLL T S+LGMK   +E F
Sbjct  374   YAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALAISTYYLLTTTSYLGMKCANKEDF  433

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E AM+KF+EM
Sbjct  434   EWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMDKFQEM  493

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE IL+P P  VST+IL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++
Sbjct  494   AETAWKDVNEGILQPTP--VSTKILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIAL  551

Query  1763  LVNSFEI  1783
             LV+S EI
Sbjct  552   LVDSIEI  558



>ref|XP_009764785.1| PREDICTED: vetispiradiene synthase 3-like [Nicotiana sylvestris]
Length=554

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/553 (62%), Positives = 422/553 (76%), Gaps = 9/553 (2%)
 Frame = +2

Query  140   MVTNNE-VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVS-IRS  313
             ++ N+E +VRPV +F  SPSLWGD F  F  DN+VAE+Y QEI++LK +  SML +    
Sbjct  6     LINNDEQIVRPVANF--SPSLWGDSFHSFSVDNQVAEKYGQEIEILKEETRSMLAAACER  63

Query  314   AKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQ  487
               LAEKLN IDT+ERLG++YHF + ID+ML+ IY  +PNF+  +  DL T AL FR+LRQ
Sbjct  64    YSLAEKLNLIDTVERLGLAYHFEKQIDDMLDQIYKEDPNFEGHEYNDLYTCALQFRMLRQ  123

Query  488   HGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLE  664
             HGYNIS  IF  FQ+ NGKFK SLSND KGLL+LYEASH++ H +  L+EA  FS  HLE
Sbjct  124   HGYNISPKIFSRFQDANGKFKESLSNDAKGLLSLYEASHVRTHEEGILEEALVFSTAHLE  183

Query  665   VIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQ  844
                P L S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQ
Sbjct  184   SAAPHLKSPLNKQVTHALEQSLHKSIPRVETRYFISIYEEEELKNDVLLRFAKLDYNLLQ  243

Query  845   MHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMA  1024
             M HKQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M 
Sbjct  244   MLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMI  303

Query  1025  SIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEG  1204
             SI DDT+D++G   ELE++TDAIQ+WDI Q +RLP +MKI +K LIDL+E+++KELSK+G
Sbjct  304   SIVDDTFDAYGIVKELEVYTDAIQRWDISQIDRLPDYMKISFKALIDLYEDYEKELSKDG  363

Query  1205  RSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS  1384
             RS+ VHY KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMKS
Sbjct  364   RSYVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLNNALATSTYYLLTTTSYLGMKS  423

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
               +E FEW + NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DYGV+ + AM
Sbjct  424   AAQEDFEWLATNPKILEANVTLCRVVDDIATYEVEKGRGQIATGIECYMRDYGVSTQVAM  483

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
              KF+EM E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLK
Sbjct  484   EKFQEMAEIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLK  541

Query  1745  PCIFSVLVNSFEI  1783
             P I ++LV+S EI
Sbjct  542   PHIVALLVDSIEI  554



>ref|XP_004230359.1| PREDICTED: vetispiradiene synthase 1 [Solanum lycopersicum]
 gb|AEP82772.1| terpene synthase [Solanum lycopersicum]
Length=552

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/550 (63%), Positives = 417/550 (76%), Gaps = 7/550 (1%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             M    ++VRPV  F  SPSLWGD F YF  DN+VAE YAQEI+ LK Q  S+L       
Sbjct  8     MSNCQDIVRPVADF--SPSLWGDRFHYFSLDNQVAEEYAQEIETLKEQTRSLLSDAACGT  65

Query  320   -LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGY  496
              LAEKLN ID +ERLG++YHF   I++ML+ IY ++PNF+   DL T +L FR+LRQHGY
Sbjct  66    TLAEKLNLIDIVERLGLAYHFETQIEDMLDQIYKSDPNFE-AHDLNTLSLQFRILRQHGY  124

Query  497   NISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
             NIS  IF  FQ+ NGKFK SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   
Sbjct  125   NISPKIFCRFQDANGKFKESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAA  184

Query  674   PQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
             P L S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM H
Sbjct  185   PHLKSPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEQKNDVLLRFAKLDFNLLQMLH  244

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             KQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI 
Sbjct  245   KQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIV  304

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DDT+D++G  +ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+++++ ELSK+GRS 
Sbjct  305   DDTFDAYGIVEELEVYTDAIQRWDISQIDRLPDYMKISYKALLDLYDDYETELSKDGRSD  364

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTR  1393
              VHY KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS T+
Sbjct  365   VVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATK  424

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             E FEW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ + AM KF
Sbjct  425   EDFEWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTQVAMEKF  484

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
             +EM E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I
Sbjct  485   QEMAEIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHI  542

Query  1754  FSVLVNSFEI  1783
              ++LV+S EI
Sbjct  543   IALLVDSVEI  552



>ref|XP_004230358.1| PREDICTED: vetispiradiene synthase 1 isoform X1 [Solanum lycopersicum]
 gb|AEP82773.1| viridiflorene synthase [Solanum lycopersicum]
Length=548

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/547 (62%), Positives = 419/547 (77%), Gaps = 7/547 (1%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK-LA  325
              +E+VRPV +F  SPSLWGD F  F  DN+VA++YAQ+I+ LK Q  S+L        LA
Sbjct  7     QDEIVRPVANF--SPSLWGDRFHSFSLDNQVADKYAQQIETLKEQTRSLLSDAACGTTLA  64

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             EKLN ID +ERLG++YHF + I++ML+ IY A+PNF+   DL T +L FR+LRQHGYNIS
Sbjct  65    EKLNLIDIVERLGLAYHFEKQIEDMLDQIYKADPNFE-AHDLNTLSLQFRILRQHGYNIS  123

Query  506   SGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF  FQ+ NGKFK SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L
Sbjct  124   QKIFSRFQDANGKFKESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHL  183

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQM HKQE
Sbjct  184   KSPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDYNLLQMLHKQE  243

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT
Sbjct  244   LSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDT  303

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE++TDAIQ+WDI Q +RLP +MK+ +K L+DL+E+++KELSK+GRS  V 
Sbjct  304   FDAYGIVKELEVYTDAIQRWDISQMDRLPEYMKVSFKALLDLYEDYEKELSKDGRSDVVQ  363

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS T+E F
Sbjct  364   YAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDF  423

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DYGV+ + AM+KF+EM
Sbjct  424   EWLAKNPKILEANVTLCRVVDDIATYEVEKGRGQIATGIECYMRDYGVSTQVAMDKFQEM  483

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++
Sbjct  484   AEIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIAL  541

Query  1763  LVNSFEI  1783
             LV+S EI
Sbjct  542   LVDSIEI  548



>ref|XP_009773139.1| PREDICTED: vetispiradiene synthase 3 [Nicotiana sylvestris]
Length=560

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/562 (62%), Positives = 417/562 (74%), Gaps = 13/562 (2%)
 Frame = +2

Query  122   TSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLV  301
              + +L      E+VRPV  F  SPSLWGD F  F  DN+VA +YAQEI+ LK Q  SML+
Sbjct  4     AAAVLSNYEEEEIVRPVADF--SPSLWGDRFHSFSLDNQVAGKYAQEIETLKEQTRSMLM  61

Query  302   SIRSAK----LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG---DDLCTS  460
             S  S      LAEKLN ID +ERLGI+YHF + ID+ML+ IYNA+PNF+ G   +DLC  
Sbjct  62    SAASGTTTLTLAEKLNLIDIVERLGIAYHFEKQIDDMLDQIYNADPNFE-GLEYNDLCIL  120

Query  461   ALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEA  637
             +L FRLLRQHGYNIS  I   FQ  NGKFK SLS++V GLLNLYEASH++ H +  L+EA
Sbjct  121   SLQFRLLRQHGYNISPKILSRFQYANGKFKESLSDNVTGLLNLYEASHVRTHGEDILEEA  180

Query  638   YTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRF  817
               FS  HLE   P L S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E  ND+LLRF
Sbjct  181   LAFSTAHLESAAPHLKSPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEELNNDILLRF  240

Query  818   AKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARL  997
             AKLDFN+LQM HKQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+
Sbjct  241   AKLDFNVLQMLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTVGVYSEPQYSQARV  300

Query  998   MLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEE  1177
             MLAK I M SI DDT+D++G   ELE++TDAIQ+WD+ Q NRLP +MKI YK L+DL+ +
Sbjct  301   MLAKTIAMISIVDDTFDAYGIVKELEVYTDAIQRWDVSQINRLPDYMKISYKALLDLYND  360

Query  1178  FDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLI  1357
             ++KELS +GRS  VHY KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL 
Sbjct  361   YEKELSNDGRSSVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLT  420

Query  1358  TASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
             T S+LGMK   +E FEW  +NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM D
Sbjct  421   TTSYLGMKCANKEDFEWLDKNPKILEANVTLCRVIDDIATYEVEKSRGQIATGIECYMRD  480

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             YGV+ EEAM KF+EM E AWKD NE ILRP P  VST+IL  ILN ARI DV YK+ QDG
Sbjct  481   YGVSTEEAMEKFQEMAEIAWKDVNEGILRPTP--VSTKILTRILNLARIIDVTYKHNQDG  538

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+PEKVLKP I ++LV+S EI
Sbjct  539   YTHPEKVLKPHIIALLVDSIEI  560



>dbj|BAA82108.1| vetispiradiene synthase [Solanum tuberosum]
Length=549

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/546 (62%), Positives = 412/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F YF  DN+VA+ YAQEI+ LK Q  SML++     LAEKL
Sbjct  8     EIVRPVADF--SPSLWGDRFHYFSLDNQVAKEYAQEIETLKEQTRSMLLTASGMTLAEKL  65

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLG++YHF + I++ML+ IY A+PNF   +  DL T +L FRLLRQHGYNIS 
Sbjct  66    NLIDIVERLGLAYHFEKQIEDMLDQIYKAHPNFDSHEYSDLTTLSLQFRLLRQHGYNISP  125

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  +Q+  GKF   LSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  126   KIFSRYQDAKGKFNEPLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  185

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM HKQEL
Sbjct  186   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDFNLLQMLHKQEL  245

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  246   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  305

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELSK+GRS  VHY
Sbjct  306   DAYGIVKELEVYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYETELSKDGRSDVVHY  365

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS  +E FE
Sbjct  366   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDFE  425

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E AM KF+EM 
Sbjct  426   WLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMEKFQEMA  485

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  486   EIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  543

Query  1766  VNSFEI  1783
              +S EI
Sbjct  544   ADSIEI  549



>ref|NP_001274950.1| putative vetispiradiene synthase 3 [Solanum tuberosum]
 gb|AAD02269.1| putative vetispiradiene synthase 4 [Solanum tuberosum]
Length=556

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/546 (62%), Positives = 412/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F YF  DN+V + YAQEI+ LK Q  SML++     LAEKL
Sbjct  15    EIVRPVADF--SPSLWGDRFHYFSLDNQVEKEYAQEIETLKEQTRSMLLAASGMTLAEKL  72

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLG++YHF + I++ML+ IY A+PNF+  +  DL T ++ FRLLRQHGYNIS 
Sbjct  73    NLIDIVERLGLAYHFEKQIEDMLDQIYKAHPNFESHEYSDLTTLSVQFRLLRQHGYNISP  132

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  +Q+  GKF   LSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  133   KIFSRYQDAKGKFNEPLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  192

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM HKQEL
Sbjct  193   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEHKNDVLLRFAKLDFNLLQMLHKQEL  252

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  253   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  312

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELS +GRS  VHY
Sbjct  313   DAYGIVKELEVYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYETELSMDGRSDVVHY  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS  +E FE
Sbjct  373   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDFE  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E AM KF+EM 
Sbjct  433   WLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMEKFQEMA  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  +STEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  493   EIAWKDVNEGILRPTP--ISTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  550

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  551   VDSIEI  556



>ref|NP_001275083.1| uncharacterized protein LOC102595695 [Solanum tuberosum]
 dbj|BAA82141.1| vetispiradiene synthase [Solanum tuberosum]
Length=549

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/546 (62%), Positives = 412/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             ++VRPV  F  SPSLWGD F  F  DN++A +YAQEI  LK Q   +L +     LAEKL
Sbjct  8     DIVRPVADF--SPSLWGDRFHSFSLDNQIAGKYAQEIDTLKEQSRLILFASYIRTLAEKL  65

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             + ID +ERLGI+YHF + ID+ML+ IY A+PNF+  +  DL T ++ FRLLRQHGYNIS 
Sbjct  66    DLIDIVERLGIAYHFEKQIDDMLDQIYKADPNFEAHEYNDLQTLSVQFRLLRQHGYNISP  125

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F  FQ+  GKF  SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  126   KLFSRFQDAKGKFNESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  185

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HALDQSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM HKQEL
Sbjct  186   SPLSKQVTHALDQSLHKSIPRVETRYFISIYEEEEHKNDVLLRFAKLDFNLLQMLHKQEL  245

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  246   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  305

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELEI+TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELSK+GRS  VHY
Sbjct  306   DAYGIVKELEIYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYEMELSKDGRSDVVHY  365

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMKS  ++ FE
Sbjct  366   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSANKQDFE  425

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E+AM KF+EM 
Sbjct  426   WLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEKAMEKFQEMA  485

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  486   ETAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  543

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  544   VDSIEI  549



>ref|XP_009794139.1| PREDICTED: vetispiradiene synthase 2-like [Nicotiana sylvestris]
Length=555

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/547 (62%), Positives = 422/547 (77%), Gaps = 9/547 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV +F  SPSLW D+F  F FDN+VAE+YAQEI+VLK Q  SML++    KL E +
Sbjct  14    EIVRPVANF--SPSLWADQFHSFSFDNQVAEKYAQEIEVLKEQTRSMLLAT-GQKLDETM  70

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLGI YHF + IDE+LE+IYN N NF+  D  DLCTSAL FRL RQHGYNIS 
Sbjct  71    NLIDVIERLGIGYHFEKEIDEILEHIYNENTNFEGDDYNDLCTSALQFRLFRQHGYNISP  130

Query  509   GIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  FQ ENGKFK SL++DV GLL+LYEAS+++ H D  LK+A  FS  HLE + P   
Sbjct  131   EIFSKFQDENGKFKESLASDVLGLLSLYEASYVRTHADDILKDALAFSTIHLESVAPHFK  190

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
             S L +QV HAL+Q LH G+PR+E+ +FI+ +YE++ESKND+LLRFAKLDFNLLQM HKQE
Sbjct  191   SPLREQVTHALEQCLHKGVPRLETRFFISSIYEKEESKNDMLLRFAKLDFNLLQMLHKQE  250

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK+LDFVTTLPYARDRAVECYFW +GVYFE +YS+AR+MLAK I M SI DDT
Sbjct  251   LAEVSRWWKDLDFVTTLPYARDRAVECYFWTIGVYFEPQYSQARVMLAKTIAMISIVDDT  310

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D +G   EL+I+TDAIQ+WD+ + +RLP +MKI YK L++L+++++KELS  GRS  V+
Sbjct  311   FDVYGIVKELDIYTDAIQRWDVSEIDRLPDYMKISYKALLNLYDDYEKELSNYGRSNVVY  370

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +YN+E KW  E   PPV+EY+ N   +ST YLL T S+L MKSVT++ F
Sbjct  371   YAKERMKEIVRNYNVEAKWFIEGYMPPVSEYLSNALITSTYYLLTTTSYLAMKSVTKKDF  430

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ EEAMNKF+EM
Sbjct  431   EWLAKNPKILEANVTLCRVIDDIATYEVEKSRGQIATGIECYMRDYGVSTEEAMNKFQEM  490

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE ILRP P  VSTEIL  ILN +R+ DV YKN QDGYT+PEKV+KP I ++
Sbjct  491   AEIAWKDVNEGILRPTP--VSTEILTRILNLSRMIDVAYKNNQDGYTHPEKVVKPHIIAL  548

Query  1763  LVNSFEI  1783
             LV+S ++
Sbjct  549   LVDSIKV  555



>ref|NP_001239040.1| viridiflorene synthase [Solanum lycopersicum]
 sp|G5CV46.1|TPS31_SOLLC RecName: Full=Viridiflorene synthase; Short=SlTPS31 [Solanum 
lycopersicum]
 gb|AEM23833.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82774.1| viridiflorene synthase [Solanum lycopersicum]
Length=555

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/546 (61%), Positives = 415/546 (76%), Gaps = 9/546 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN+VAE+Y +EI+ LK Q  SML+S ++  LAEKL
Sbjct  16    EIVRPVADF--SPSLWGDRFHSFSLDNQVAEKYVEEIETLKEQTRSMLMSGKT--LAEKL  71

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLGI+YHF + ID+ML +I+N +PNF+  +  DLCT +L FR+LRQHGY IS 
Sbjct  72    NLIDIVERLGIAYHFEKQIDDMLNHIFNIDPNFEAHEYNDLCTLSLQFRILRQHGYYISP  131

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  FQ+ NGKFK SL +D++G+LNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  132   KIFSRFQDANGKFKESLCDDIRGILNLYEASHVRTHGEDTLEEALAFSTAHLESAAPHLK  191

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDV LRFAKLDFNLLQM HKQEL
Sbjct  192   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEELKNDVFLRFAKLDFNLLQMLHKQEL  251

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  252   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  311

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WD+ Q +RLP +MKI YK L+DL+ +++ ELS +GRS  V Y
Sbjct  312   DAYGIVKELEVYTDAIQRWDVSQIDRLPEYMKISYKALLDLYNDYETELSNDGRSDVVQY  371

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMKS T++ FE
Sbjct  372   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSATKKDFE  431

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ + AM+KF+EM 
Sbjct  432   WLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTQVAMDKFQEMA  491

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VS +IL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  492   ETAWKDVNEGILRPTP--VSAKILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  549

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  550   VDSIEI  555



>sp|Q9XJ32.1|VTSS1_SOLTU RecName: Full=Vetispiradiene synthase 1 [Solanum tuberosum]
 dbj|BAA82092.1| vetispiradiene synthase [Solanum tuberosum]
Length=556

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/546 (62%), Positives = 412/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRP+  F  SPSLWGD F  F  DN++A +YAQEI+ LK Q   +L +     LAEKL
Sbjct  15    EIVRPIADF--SPSLWGDRFHSFSLDNQIAGKYAQEIETLKEQSRIILSASSRRTLAEKL  72

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             + ID +ERLGI+YHF + ID+ML+  Y A+PNF+  +  DL T ++ FRLLRQHGYNIS 
Sbjct  73    DLIDIVERLGIAYHFEKQIDDMLDQFYKADPNFEAHEYNDLQTLSVQFRLLRQHGYNISP  132

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F  FQ+  GKFK SL ND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  133   KLFIRFQDAKGKFKESLCNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  192

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLL+FAKLDFNLLQM HKQEL
Sbjct  193   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEQKNDVLLQFAKLDFNLLQMLHKQEL  252

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  253   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  312

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELEI+TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELSK+GRS  VHY
Sbjct  313   DAYGIVKELEIYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYEMELSKDGRSDVVHY  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMKS  ++ FE
Sbjct  373   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSANKQDFE  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E+AM KF+EM 
Sbjct  433   WLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEKAMEKFQEMA  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  493   ETAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  550

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  551   VDSIEI  556



>ref|NP_001275171.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 gb|AAD02270.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 dbj|BAA82109.1| vetispiradiene synthase [Solanum tuberosum]
Length=551

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/545 (62%), Positives = 413/545 (76%), Gaps = 7/545 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSA-KLAEK  331
             E+VRPV +F  SPSLWGD F  F  DN+VAE+YAQEI+ LK Q  S+L +      LAEK
Sbjct  12    EIVRPVANF--SPSLWGDRFHSFSLDNQVAEKYAQEIETLKEQTRSLLSAAACGITLAEK  69

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             LN ID +ERLG++YHF + ID+ML+ IY A+PNF    DL T +L FR+LRQHGYNIS  
Sbjct  70    LNLIDIVERLGLAYHFEKQIDDMLDQIYKADPNFD-AHDLNTLSLQFRILRQHGYNISQK  128

Query  512   IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
              F  FQ+ NGKFK  LSND++GLLNLYEASH++ H +  L+EA  FS  HLE   P L S
Sbjct  129   FFSRFQDANGKFKECLSNDIRGLLNLYEASHVRTHGEDILEEALVFSTAHLESAAPHLES  188

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQM HK EL 
Sbjct  189   PLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDYNLLQMLHKHELS  248

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR++LAK I M SI DDT+D
Sbjct  249   EVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVILAKTIAMISIVDDTFD  308

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE++TDAIQ+WDI Q +RLP +MK+ +K L+DL+E+++KELSK+GRS  VHY 
Sbjct  309   AYGIVKELEVYTDAIQRWDISQIDRLPEYMKVSFKALLDLYEDYEKELSKDGRSDVVHYA  368

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
             KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS T+E FEW
Sbjct  369   KERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEW  428

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              + NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DY V+ E AM KF+EM E
Sbjct  429   LATNPKILEANVTLCRVVDDIATYEVEKGRGQIATGIECYMRDYDVSTEVAMEKFQEMAE  488

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++LV
Sbjct  489   IAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALLV  546

Query  1769  NSFEI  1783
             +S EI
Sbjct  547   DSIEI  551



>ref|XP_006358531.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=555

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/547 (62%), Positives = 418/547 (76%), Gaps = 10/547 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN+VAE+Y +EI+ LK Q  S+L+S ++  LAEKL
Sbjct  15    EIVRPVADF--SPSLWGDRFHSFSLDNKVAEKYVEEIETLKEQTRSILMSGKT--LAEKL  70

Query  335   NFIDTMERLGISYHFHEMIDEMLE-NIYNANPNFQLGD--DLCTSALLFRLLRQHGYNIS  505
             N ID +ERLGI+YHF + ID+ML+ +I+N +PNF+  +  +LCT +L FR+LRQHGYNIS
Sbjct  71    NLIDIVERLGIAYHFEKQIDDMLDLHIFNIDPNFEAHEYNNLCTLSLQFRILRQHGYNIS  130

Query  506   SGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF+ FQ+ NGKFK SL ND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L
Sbjct  131   PKIFNRFQDANGKFKESLCNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHL  190

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S LG QV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLDFNLLQM HKQE
Sbjct  191   KSPLGMQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDFNLLQMLHKQE  250

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK+LDFV TLPYARDRAVECYFW +GVY E +YS AR+MLAK I M SI DDT
Sbjct  251   LSEVSRWWKDLDFVKTLPYARDRAVECYFWTMGVYAEPQYSHARVMLAKTIAMISIVDDT  310

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELS +GRS  V 
Sbjct  311   FDAYGIVKELEVYTDAIQRWDISQIDRLPEYMKISYKALLDLYNDYETELSNDGRSDVVQ  370

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMKS T+E F
Sbjct  371   YAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSATKEDF  430

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E AM+KF+EM
Sbjct  431   EWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMDKFQEM  490

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE IL+P P  VST+IL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++
Sbjct  491   AETAWKDVNEGILQPTP--VSTKILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIAL  548

Query  1763  LVNSFEI  1783
             LV+S EI
Sbjct  549   LVDSIEI  555



>gb|AAD02223.1| vetispiradiene synthase [Solanum tuberosum]
Length=550

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/544 (62%), Positives = 411/544 (76%), Gaps = 6/544 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSA-KLAEK  331
             E+VRPV +F  SPSLWGD F  F  DN+VAE+YAQEI+ LK Q  S+L +      LAEK
Sbjct  12    EIVRPVANF--SPSLWGDRFHSFSLDNQVAEKYAQEIETLKEQTRSLLSAAACGITLAEK  69

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             LN ID +ERLG++YHF + ID+ML+ IY A+PNF  G DL T +L FR+LRQHGYNIS  
Sbjct  70    LNLIDIVERLGLAYHFEKQIDDMLDQIYKADPNFD-GHDLNTLSLQFRILRQHGYNISQK  128

Query  512   IFDNFQENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
              F  FQ+   FK  LSND++GLLNLYEASH++ H +  L+EA  FS  HLE   P L S 
Sbjct  129   FFSRFQDANGFKECLSNDIRGLLNLYEASHVRTHGEDILEEALVFSTAHLESAAPHLESP  188

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQM HK EL E
Sbjct  189   LSKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDYNLLQMLHKHELSE  248

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR++LAK I M SI DDT+D+
Sbjct  249   VSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVILAKTIAMISIVDDTFDA  308

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G   ELE++TDAIQ+WDI Q +RLP +MK+ +K L+DL+E+++KELSK+GRS  VHY K
Sbjct  309   YGIVKELEVYTDAIQRWDISQIDRLPEYMKVSFKALLDLYEDYEKELSKDGRSDVVHYAK  368

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWS  1411
             ER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS T+E FEW 
Sbjct  369   ERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWL  428

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DY V+ E AM KF+EM E 
Sbjct  429   ATNPKILEANVTLCRVVDDIATYEVEKGRGQIATGIECYMRDYDVSTEVAMEKFQEMAEI  488

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++LV+
Sbjct  489   AWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALLVD  546

Query  1772  SFEI  1783
             S EI
Sbjct  547   SIEI  550



>ref|XP_004230360.1| PREDICTED: vetispiradiene synthase 1 [Solanum lycopersicum]
 gb|AEP82771.1| terpene synthase [Solanum lycopersicum]
Length=556

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/546 (62%), Positives = 413/546 (76%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN++A +YAQEI+ LK Q   +L +     LA+KL
Sbjct  15    EIVRPVADF--SPSLWGDRFHSFSLDNKIAGKYAQEIETLKEQSRVILSASSGTTLAQKL  72

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPN--FQLGDDLCTSALLFRLLRQHGYNISS  508
             + ID +ERLG++YHF + ID++L+ IY A+PN   Q  +DL TS++ FRLLRQHGYNIS 
Sbjct  73    DLIDIVERLGLAYHFEKQIDDVLDQIYKADPNSEAQEYNDLQTSSIQFRLLRQHGYNISP  132

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F  FQ+  GKF  SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  133   KLFSRFQDAKGKFNESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  192

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KND+LLRFAKLDFNLLQM HKQEL
Sbjct  193   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEQKNDLLLRFAKLDFNLLQMLHKQEL  252

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  253   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  312

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI   +RLP +MKI YK L+DL+++++ ELSK+GRS  VHY
Sbjct  313   DAYGIVKELEVYTDAIQRWDISHIDRLPDYMKISYKALLDLYDDYETELSKDGRSDVVHY  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS  +E FE
Sbjct  373   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLCNALATSTYYLLTTTSYLGVKSANKEDFE  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+Y+ EK     ATGI+ YM DYGV+ EEAM KFEEM 
Sbjct  433   WLAKNPKILEANVTLCRVIDDIATYDVEKGRGQIATGIECYMRDYGVSTEEAMEKFEEMA  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  493   EIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  550

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  551   VDSIEI  556



>dbj|BAN58139.1| putative vetispiradiene synthase [Hyoscyamus albus]
Length=553

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/546 (62%), Positives = 411/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV +F  SPSLWGD F  F  DN+VAE+YAQEI+ LK Q  SML +     LAEKL
Sbjct  12    EIVRPVANF--SPSLWGDSFHSFSLDNQVAEKYAQEIETLKEQTRSMLSAACGTTLAEKL  69

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLGI+YHF + I++ML+ I+ A+PNF+  D  DL TS++ FR+LRQHGYNIS 
Sbjct  70    NLIDIVERLGIAYHFEKQIEDMLDQIHKADPNFEAQDYNDLNTSSVQFRILRQHGYNISP  129

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
               F  FQ+ NGKFK SL ND K LLNLYEASH++ H +  L+EA  FS  HLE   P+L 
Sbjct  130   KCFSRFQDANGKFKESLINDAKALLNLYEASHVRTHGEDILEEALAFSTAHLEAAAPRLK  189

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQM HK EL
Sbjct  190   SPLNKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDYNLLQMLHKHEL  249

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDR VECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  250   SEVSRWWKDLDFVTTLPYARDRVVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  309

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+++++KEL K+GRS  VHY
Sbjct  310   DAYGIVKELEVYTDAIQRWDINQIDRLPEYMKISYKALLDLYDDYEKELLKDGRSDVVHY  369

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y IE KW  E   P V EY+ N  A+ST YLL T S+LGMKS T+E FE
Sbjct  370   AKERMKEIVRNYFIEAKWFIEGYMPSVTEYLNNALATSTYYLLTTTSYLGMKSATKEDFE  429

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W + NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM D+ V+ E AM KF+EM 
Sbjct  430   WLAMNPKILEANATLCRVVDDIATYEVEKGRGQIATGIECYMRDHSVSTEVAMEKFQEMA  489

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE+ILRP P  VS EIL  ILN ARI DV YK+ QDGYT+PEKVLKP I +++
Sbjct  490   EIAWKDVNENILRPTP--VSVEILTPILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALV  547

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  548   VDSIEI  553



>ref|XP_006367961.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=560

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/548 (61%), Positives = 407/548 (74%), Gaps = 9/548 (2%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             +VRPV +F  SPSLWGD F  F  DN VA++YAQEI+ LK +  SML++I   KL EKLN
Sbjct  16    IVRPVANF--SPSLWGDRFLSFSIDNHVAQKYAQEIEALKEETRSMLLAITGRKLVEKLN  73

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISSG  511
              ID +ERLGI+YH+ + ID++L  IYN N NF+  D  DL T AL FRLLRQHGYNIS  
Sbjct  74    VIDVIERLGIAYHYEKEIDDILYGIYNENANFEGDDCSDLSTFALQFRLLRQHGYNISPE  133

Query  512   IFDNFQE-NGKFKSSLS--NDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
             IF  FQ+ NG FK S S  +DV G L+LYEASH++ H +  L+ A  FS THLE   P L
Sbjct  134   IFSKFQDGNGDFKVSRSSDDDVLGFLSLYEASHVRTHGEDILENALNFSTTHLESAAPHL  193

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             +S L +QV HAL+QSLH GIPRVE+ +FI+ +YE+DE KND LLRFAKLDFNLLQM HKQ
Sbjct  194   NSPLKEQVTHALEQSLHKGIPRVETRFFISSIYEKDELKNDALLRFAKLDFNLLQMLHKQ  253

Query  860   ELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             EL E  RWWKELDFVTTLPYARDR VECYFW +GVYFE +YS+AR+ML K I M SI DD
Sbjct  254   ELAEVSRWWKELDFVTTLPYARDRVVECYFWTIGVYFEPQYSQARVMLTKTIAMVSIVDD  313

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
             T+D++G   ELE +TDAIQ+WDI + +RLP +MKI YK L+DLF++++KELS +GRS  V
Sbjct  314   TFDAYGTVKELEKYTDAIQRWDINEIDRLPDYMKISYKALLDLFDDYEKELSSDGRSHVV  373

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREA  1399
             ++ KER+KE+V SYN+E KW  E   PPV+EY+ N   +ST YLL TA++LGMKS T + 
Sbjct  374   YHAKERMKEIVRSYNVEAKWFIEGHMPPVSEYLSNALVTSTYYLLTTAAYLGMKSATEQD  433

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             FEW S NP+I+EAN  L RV +DIA+YE EK     ATGI+ YM DYGV+ EEAMNKF+E
Sbjct  434   FEWLSTNPKILEANVTLCRVTDDIATYEVEKGRGQIATGIECYMRDYGVSTEEAMNKFQE  493

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
             M E AWKD NE +L P+   VS EIL  ILN  RI DV YK+ QDG T+PEKVLKP I +
Sbjct  494   MGETAWKDANEGMLSPV-RPVSIEILTRILNLVRIIDVTYKHNQDGCTHPEKVLKPHIIA  552

Query  1760  VLVNSFEI  1783
             +LVNS  I
Sbjct  553   LLVNSIAI  560



>sp|Q39978.2|VTSS1_HYOMU RecName: Full=Vetispiradiene synthase 1; Short=HVS1 [Hyoscyamus 
muticus]
 gb|AAA86340.1| vetispiradiene synthase [synthetic construct]
Length=555

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/546 (61%), Positives = 415/546 (76%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN+VAE+YAQEI+ LK Q  +ML +     L EKL
Sbjct  14    EIVRPVADF--SPSLWGDHFHSFSVDNQVAEKYAQEIETLKEQTSTMLSAACGTTLTEKL  71

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLGI+YHF + I++ML++IY A+P F+  +  DL TS++ FRLLRQHGYN+S 
Sbjct  72    NLIDIIERLGIAYHFEKQIEDMLDHIYRADPYFEAHEYNDLNTSSVQFRLLRQHGYNVSP  131

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  FQ+ NGKFK SL +D++GLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  132   NIFSRFQDANGKFKESLRSDIRGLLNLYEASHVRTHKEDILEEALVFSVGHLESAAPHLK  191

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE  YFI++YEE+E KND+LLRFAKLD+NLLQM HK EL
Sbjct  192   SPLSKQVTHALEQSLHKSIPRVEIRYFISIYEEEEFKNDLLLRFAKLDYNLLQMLHKHEL  251

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  252   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  311

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+++++KELSK+GRS  VHY
Sbjct  312   DAYGIVKELEVYTDAIQRWDISQIDRLPEYMKISYKALLDLYDDYEKELSKDGRSDVVHY  371

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y IE KW  E   P V+EY+ N  A+ST YLL T S+LGMKS T+E FE
Sbjct  372   AKERMKEIVGNYFIEGKWFIEGYMPSVSEYLSNALATSTYYLLTTTSYLGMKSATKEHFE  431

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W + NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DYGV+ E AM KF+EM 
Sbjct  432   WLATNPKILEANATLCRVVDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMEKFQEMA  491

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             + AWKD NE+ILRP P  VS+EIL  ILN ARI DV YK+ QDGYT+PEKVLKP I +++
Sbjct  492   DIAWKDVNEEILRPTP--VSSEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALV  549

Query  1766  VNSFEI  1783
             V+S +I
Sbjct  550   VDSIDI  555



>gb|AAD02268.1| putative vetispiradiene synthase 3 [Solanum tuberosum]
Length=557

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/547 (61%), Positives = 412/547 (75%), Gaps = 8/547 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F YF  DN+VA+ YAQEI+ LK Q  SML++     LAEKL
Sbjct  15    EIVRPVADF--SPSLWGDRFHYFSLDNQVAKEYAQEIETLKEQTRSMLLAASGMTLAEKL  72

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLG++YHF + I++ML+ IY A+PNF+  +  DL T +L FRLLRQHGYNIS 
Sbjct  73    NLIDIVERLGLAYHFDKQIEDMLDQIYKAHPNFESHEYSDLTTLSLQFRLLRQHGYNISP  132

Query  509   G-IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
                F  +Q+  GKF   LSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L
Sbjct  133   NRFFSRYQDAKGKFNEPLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHL  192

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S L KQV H+L+QSLH  IPRVE+ YFI++YE++E KNDVLLRFAKLDFNLLQM HKQE
Sbjct  193   KSPLSKQVTHSLEQSLHKSIPRVETRYFISIYEQEEFKNDVLLRFAKLDFNLLQMLHKQE  252

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT
Sbjct  253   LSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDT  312

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ ELSK+GRS  VH
Sbjct  313   FDAYGIVKELEVYTDAIQRWDISQIDRLPDYMKISYKALLDLYHDYETELSKDGRSDVVH  372

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS  +E F
Sbjct  373   YAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDF  432

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI+ YM DYGV+ E AM KF++M
Sbjct  433   EWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEVAMEKFQDM  492

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE IL P P  +STEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++
Sbjct  493   AEIAWKDVNEGILGPTP--ISTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIAL  550

Query  1763  LVNSFEI  1783
             LV+S EI
Sbjct  551   LVDSIEI  557



>gb|AAG09949.1|AF171216_1 vetispiradiene synthase [Solanum lycopersicum]
Length=556

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/546 (61%), Positives = 412/546 (75%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN++A +YAQEI+ LK Q   +L +     LA+KL
Sbjct  15    EIVRPVADF--SPSLWGDRFHSFSLDNKIAGKYAQEIETLKEQSRVILSASSGTTLAQKL  72

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPN--FQLGDDLCTSALLFRLLRQHGYNISS  508
             + ID +ERLG++YHF + ID++L+ IY A+PN   Q  +DL TS++ FRLLRQHGYNIS 
Sbjct  73    DLIDIVERLGLAYHFEKQIDDVLDQIYKADPNSEAQEYNDLQTSSIQFRLLRQHGYNISP  132

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F  FQ+  GKF  SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  133   KLFSRFQDAKGKFNESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  192

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KND+LLRFAKLDFNLLQM HKQEL
Sbjct  193   SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEQKNDLLLRFAKLDFNLLQMLHKQEL  252

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+
Sbjct  253   SEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTF  312

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE++TDAIQ+WDI   +RLP +MKI YK L+DL+++++ ELSK+GRS  VHY
Sbjct  313   DAYGIVKELEVYTDAIQRWDISHIDRLPDYMKISYKALLDLYDDYETELSKDGRSDVVHY  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS  +E FE
Sbjct  373   AKERMKEIVRNYFVEAKWFIEGYMPPVSEYLCNALATSTYYLLTTTSYLGVKSANKEDFE  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I+EAN  L RVI+DIA+Y+ EK     ATGI+ YM DYGV+ EEAM KFEEM 
Sbjct  433   WLAKNPKILEANVTLCRVIDDIATYDVEKGRGQIATGIECYMRDYGVSTEEAMEKFEEMA  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGY +PEKVLKP I ++L
Sbjct  493   EIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYRHPEKVLKPHIIALL  550

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  551   VDSIEI  556



>ref|XP_009589983.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana tomentosiformis]
Length=550

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/546 (62%), Positives = 412/546 (75%), Gaps = 11/546 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV +F  S SLWGD+F  F  DN+VAE YAQEI+ LK Q  SML++    KLA+ L
Sbjct  13    EIVRPVANF--SSSLWGDQFLSFSIDNQVAENYAQEIEPLKEQTRSMLLAT-GRKLADTL  69

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + ID++L+ IYN N NF   DDL TSAL FRLLRQ G+NIS  I
Sbjct  70    NLIDIIERLGISYHFEKEIDDILDQIYNQNSNF---DDLGTSALQFRLLRQRGFNISPEI  126

Query  515   FDNFQ-ENGKFKSSL-SNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             F  FQ ENGKFK SL S+DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S
Sbjct  127   FSKFQDENGKFKESLASDDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKS  186

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
              L +QV HAL+Q LH G+PR+E+ +FI+ +YE+++SK +VLL+FAKLDFNLLQM HK+EL
Sbjct  187   PLREQVTHALEQPLHKGVPRIETRFFISSIYEKEQSKINVLLQFAKLDFNLLQMLHKKEL  246

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK+LDFVTTLPYARDRAVECYFWALGVYFE +YS+AR+ML K I+M SI DDT+
Sbjct  247   AEISRWWKDLDFVTTLPYARDRAVECYFWALGVYFEPQYSQARIMLTKTISMISILDDTF  306

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   EL+I+T AI++WDI + +RLP +MKI YK L+DL E+++KELS +GRS  V++
Sbjct  307   DAYGIIKELDIYTHAIERWDISEIDRLPDYMKISYKALLDLHEDYEKELSSDGRSHVVYH  366

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KELV SYNIE KW  E   P  +EY+ NG A+ST Y   T  +LGMKS+T + FE
Sbjct  367   AKERVKELVRSYNIEAKWFIEGYKPHFSEYLSNGLATSTYYSCPTTCYLGMKSITEQDFE  426

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W ++NP+I EA+ LL RVI+DIA+YE EK     ATGI+ YM DYGV+ EEAM KF+EMV
Sbjct  427   WLAKNPKIFEASALLCRVIDDIATYEVEKSRGQIATGIECYMRDYGVSTEEAMTKFQEMV  486

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             + AWKD NE ILRP P  VS E+L  ILN ARI D  YKN QDGYTNPEKVLKP I ++L
Sbjct  487   DAAWKDVNEGILRPTP--VSMELLYRILNIARIVDFTYKNNQDGYTNPEKVLKPHIITLL  544

Query  1766  VNSFEI  1783
             V S +I
Sbjct  545   VESIKI  550



>sp|Q84LF0.1|5EAS2_NICAT RecName: Full=5-epi-aristolochene synthase 2; Short=NaEAS37 [Nicotiana 
attenuata]
 gb|AAP05762.1|AF484125_1 5-epi-aristolochene synthase 37 [Nicotiana attenuata]
Length=548

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/545 (60%), Positives = 412/545 (76%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN++AE+YAQEI+ LK Q  SML++  + KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQIAEKYAQEIEALKEQTRSMLLAT-ARKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGI+YHF + IDE+L+ IYN N  F   DDLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGIAYHFEKEIDEILDQIYNQNSTF---DDLCTSALQFRLLRQHGFNISPQI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P ++S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHTDNILEDALAFSTVHLESAAPYMNSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE++ESKND+LLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEESKNDMLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+L+FVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLNFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKSV  + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVAEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYGV+ +EAM+KF++M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGVSTKEAMDKFQKMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  +S E L  ILN ARI +V Y +  DGYT+PEKVLKP I  +LV
Sbjct  486   TAWKDLNEGLLRPTP--ISAEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIIDLLV  543

Query  1769  NSFEI  1783
              S +I
Sbjct  544   ESIQI  548



>gb|AAK15641.1|AF326117_1 sesquiterpene cyclase [Capsicum annuum]
Length=553

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/546 (60%), Positives = 406/546 (74%), Gaps = 7/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV +F  SPSLWGD F  F  DN+V E+Y QEI+ LK Q  SML +     L EKL
Sbjct  12    EIVRPVANF--SPSLWGDRFHSFSLDNQVVEKYGQEIETLKEQTRSMLSAACGKTLVEKL  69

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISS  508
             N ID +ERLG++YHF + I+ ML+ IY A+P F+  D  DL T ++ FRLLRQHGYNIS 
Sbjct  70    NLIDIVERLGLAYHFEKQIENMLDPIYKADPKFEAHDYNDLNTMSIPFRLLRQHGYNISP  129

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  F +  GKFK S+SND++GLLNLYEASH++ H +  L+EA  FS  HLE   P L 
Sbjct  130   KIFSRFPKCKGKFKESISNDMRGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHLK  189

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L KQV HAL+ SLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD NLLQM HKQ+L
Sbjct  190   SPLNKQVTHALEPSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDHNLLQMLHKQKL  249

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E   WWK+LDFVTTLPYAR RAVECYFW +GVY E +YS+AR+MLAK I M SI DDTY
Sbjct  250   SEVSGWWKDLDFVTTLPYARHRAVECYFWTVGVYAEPQYSQARVMLAKTIPMISIVDDTY  309

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G  +ELE++TDAIQ+WDI Q +RLP +MKI YK L+DL+++++KELSK+GR+  VHY
Sbjct  310   DAYGIVNELEVYTDAIQRWDISQIDRLPEYMKISYKALLDLYDDYEKELSKDGRADVVHY  369

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LGMK  T+E FE
Sbjct  370   AKERMKEIVRNYFVEAKWFIEGHMPPVSEYLSNALATSTYYLLTTTSYLGMKCATKEDFE  429

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W + NP+I+EAN  L RV++DIA+YE EK     ATG++ YM DY V+ E AM KF+EM 
Sbjct  430   WLATNPKILEANVTLCRVVDDIATYEVEKDRGQIATGVECYMRDYDVSTEVAMEKFQEMA  489

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE ILRP P  VST IL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++L
Sbjct  490   EIAWKDVNEGILRPTP--VSTGILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALL  547

Query  1766  VNSFEI  1783
             V+S +I
Sbjct  548   VDSIDI  553



>pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YAQEI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAQEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>ref|XP_009762840.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X1 [Nicotiana 
sylvestris]
Length=548

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 407/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  +N+ AE+YA+EI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIENQAAEKYAKEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+LE IYN   N    DDL TSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILEQIYNQTSN---CDDLSTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK  LSNDV GLLNLYEASH++ H D  L+ A  FS  HLE + P L S 
Sbjct  126   FSKFQDENGKFKECLSNDVLGLLNLYEASHVRTHADDILENALAFSTIHLEFVAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKNDVLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNDVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKSVT + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ EEAM KF+EM E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTEEAMTKFQEMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +L P P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   VAWKDLNEGLLSPTP--VSTEFLSRILNLARIVEVTYIHNLDGYTHPEKVLKPHIIALLV  543

Query  1769  NSFEI  1783
             +S E+
Sbjct  544   DSIEV  548



>pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 
With Substrate Analog Farnesyl Hydroxyphosphonate
Length=548

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/545 (60%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YAQEI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAQEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PE+VLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEEVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/545 (59%), Positives = 412/545 (76%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>pdb|3M01|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphosphate
 pdb|3M02|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/545 (59%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  14    EIVRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  70

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  71    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  127

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  128   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  187

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  188   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  247

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  248   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  307

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  308   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  367

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  368   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  427

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  428   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  487

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  488   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLV  545

Query  1769  NSFEI  1783
             +S +I
Sbjct  546   DSIKI  550



>sp|Q40577.3|5EAS_TOBAC RecName: Full=5-epi-aristolochene synthase; Short=EAS [Nicotiana 
tabacum]
Length=548

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/545 (59%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>pdb|1HXC|A Chain A, Crystal Structure Of Teas C440w
Length=548

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/545 (59%), Positives = 412/545 (76%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIIWRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PE+VLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEEVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>sp|Q84LG0.1|5EAS4_NICAT RecName: Full=Probable 5-epi-aristolochene synthase 4 [Nicotiana 
attenuata]
 gb|AAO85555.1| 5-epi-aristolochene synthase [Nicotiana attenuata]
Length=548

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 406/545 (74%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN VA++YAQEI+ LK Q  SMLV+    KL + L
Sbjct  12    EIVRPVADF--SPSLWGDHFLSFSIDNHVAQKYAQEIEPLKEQTRSMLVAT-GRKLVDTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + IDE+L+ IYN N N     DL TSALLFRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDEILDQIYNQNSN---SSDLFTSALLFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L+ A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVVGLLNLYEASHVRTHADDILEAALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKN+VLLRFA LDFNLLQM HKQEL 
Sbjct  186   LREQVAHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAILDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELETYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYGV+ +EAM+KF++M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGVSTKEAMDKFQQMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VS E+L  ILN ARI +V Y +  DGYT+PEKVLKP I  +LV
Sbjct  486   TAWKDLNEGLLRPTP--VSAELLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIIGLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIDI  548



>ref|XP_009595428.1| PREDICTED: 5-epi-aristolochene synthase [Nicotiana tomentosiformis]
Length=548

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 408/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML S    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNML-SATGMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    DDLC SAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CDDLCISALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L + V HAL+Q LH G+PRVE+ +FI+ +YE+++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREHVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSTGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKSVT + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG+T +EAM KF+EM E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGITTKEAMTKFQEMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  V+TE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   AAWKDLNEGLLRPTP--VATEFLSRILNLARIVEVTYIHNLDGYTHPEKVLKPHINALLV  543

Query  1769  NSFEI  1783
             +S EI
Sbjct  544   DSIEI  548



>ref|XP_009779916.1| PREDICTED: 5-epi-aristolochene synthase, partial [Nicotiana sylvestris]
Length=540

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/545 (60%), Positives = 408/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DNEVAE+YAQEI+ LK Q  SML++    KLA+ L
Sbjct  4     EIVRPVADF--SPSLWGDQFLSFSIDNEVAEKYAQEIEPLKEQTRSMLLTT-GRKLADTL  60

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  61    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  117

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  118   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLISP  177

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKN VLLRF+KLD+N+LQM HKQEL 
Sbjct  178   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNTVLLRFSKLDYNMLQMLHKQELA  237

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  238   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  297

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  298   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  357

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LG+KS T   FEW
Sbjct  358   IERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGIKSATEHDFEW  417

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYGV  +EAM+KF++M E
Sbjct  418   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGVATKEAMDKFQKMAE  477

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VS E L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  478   KAWKDLNEGLLRPTP--VSVEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIIALLV  535

Query  1769  NSFEI  1783
             +S EI
Sbjct  536   DSIEI  540



>pdb|3LZ9|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
M4 Mut Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphospha
 pdb|3M00|A Chain A, Crystal Structure Of 5-Epi-Aristolochene Synthase M4 
Mutant Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/545 (59%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  14    EIVRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  70

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  71    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  127

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  128   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  187

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  188   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  247

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFW LGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  248   QVSRWWKDLDFVTTLPYARDRVVECYFWTLGVYFEPQYSQARVMLVKTISMISIVDDTFD  307

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  308   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  367

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T YLL T S+LGMKS T + FEW
Sbjct  368   IERMKEIVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYLLATTSYLGMKSATEQDFEW  427

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  428   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  487

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  488   TAWKDINEGLLRPTP--VSTEFLTPILNLARIIEVTYIHNLDGYTHPEKVLKPHIINLLV  545

Query  1769  NSFEI  1783
             +S +I
Sbjct  546   DSIKI  550



>ref|XP_009771989.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana sylvestris]
Length=548

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/545 (60%), Positives = 410/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             ++VRPV  F  SPSLWGD+F  F  DN+VAE+YA+EI+  K Q  +ML++    KLA+ L
Sbjct  12    DIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAKEIEAPKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    DDL TSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CDDLSTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH + H D  L++A  FS  HLE + P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHARTHADDILQDALAFSTIHLEFVAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKN++LLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNMLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSVGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKSVT + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ EEAM KF+EM E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKTRGQIATGIECCMRDYGISTEEAMTKFQEMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I +++V
Sbjct  486   AAWKDLNEGLLRPTP--VSTEFLSRILNLARIVEVTYIHNLDGYTHPEKVLKPHINALVV  543

Query  1769  NSFEI  1783
             +S EI
Sbjct  544   DSIEI  548



>pdb|4DI5|A Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristolochene Synthase 
From Nicotiana Tobaccum With Geraniline
Length=535

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/543 (59%), Positives = 409/543 (75%), Gaps = 10/543 (2%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML++    KLA+ LN 
Sbjct  1     VRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTLNL  57

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFD  520
             IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  IF 
Sbjct  58    IDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEIFS  114

Query  521   NFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
              FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S L 
Sbjct  115   KFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSPLR  174

Query  698   KQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
             +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL + 
Sbjct  175   EQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELAQV  234

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D++
Sbjct  235   SRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFDAY  294

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V +  E
Sbjct  295   GTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHAIE  354

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSS  1414
             R+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW S
Sbjct  355   RMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLS  414

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
             +NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E A
Sbjct  415   KNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAETA  474

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV+S
Sbjct  475   WKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLVDS  532

Query  1775  FEI  1783
              +I
Sbjct  533   IKI  535



>gb|AAA19216.1| 5-epi-aristolochene synthase [Nicotiana tabacum]
Length=550

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/547 (59%), Positives = 410/547 (75%), Gaps = 12/547 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERY--AQEIQVLKGQVMSMLVSIRSAKLAE  328
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+Y  AQEI+ LK Q  SML++    KLA+
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYIYAQEIEALKEQTRSMLLAT-GRKLAD  68

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
              LN ID +ERLGISYHF + IDE+L+ IYN N N    +DLCTSAL FRLLRQHG+NIS 
Sbjct  69    TLNLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISP  125

Query  509   GIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L 
Sbjct  126   EIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLK  185

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
             S L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQE
Sbjct  186   SPLREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQE  245

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT
Sbjct  246   LAQVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDT  305

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V 
Sbjct  306   FDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVC  365

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             +  ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKS T + F
Sbjct  366   HAIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDF  425

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M
Sbjct  426   EWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNM  485

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++
Sbjct  486   AETAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINL  543

Query  1763  LVNSFEI  1783
             LV+S +I
Sbjct  544   LVDSIKI  550



>ref|XP_009784555.1| PREDICTED: 5-epi-aristolochene synthase 3 [Nicotiana sylvestris]
Length=548

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/545 (59%), Positives = 410/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YAQEI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAQEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENG FK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L+S 
Sbjct  126   FSKFQDENGNFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLNSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV  AL+Q LH G+PRVE+ +FI+ +YE++ESKND+LLRF+KLDFNLLQM HKQEL 
Sbjct  186   LREQVTRALEQCLHKGVPRVETRFFISSIYEKEESKNDMLLRFSKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR++L K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVILVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAI++WDI + +RLP +MKI YK ++DL+++++KELS  G+S  V + 
Sbjct  306   AYGTVKELETYTDAIRRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGKSHIVSHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQGMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE  LRP P  VSTEIL  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   AAWKDLNEGFLRPTP--VSTEILCRILNLARIVEVTYIHNLDGYTHPEKVLKPHINALLV  543

Query  1769  NSFEI  1783
             +S EI
Sbjct  544   DSIEI  548



>sp|Q84LF2.1|5EAS3_NICAT RecName: Full=5-epi-aristolochene synthase 3; Short=NaEAS12 [Nicotiana 
attenuata]
 gb|AAP05760.1|AF484123_1 5-epi-aristolochene synthase 12 [Nicotiana attenuata]
Length=548

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 407/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  +N+VAE+YAQEI+ LK Q  SML+     KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIENQVAEKYAQEIEALKEQTRSMLLE-NGRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
               ID +ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    YLIDIIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++D  GLLNLYEASH++ H D  L+EA  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDFLGLLNLYEASHVRTHADDILEEALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKNDVLLRFAKLDFNLLQ+ HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNDVLLRFAKLDFNLLQILHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR++L K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVILVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTIKELETYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVKNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYGV+ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGVSTKEAMAKFQGMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE  LRP P  VSTEIL  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   AAWKDLNEGFLRPTP--VSTEILFRILNLARIVEVTYIHNLDGYTHPEKVLKPHINALLV  543

Query  1769  NSFEI  1783
             +S EI
Sbjct  544   DSIEI  548



>pdb|1HX9|A Chain A, Crystal Structure Of Teas W273s Form 1
 pdb|1HXA|A Chain A, Crystal Structure Of Teas W273s Form 2
Length=548

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/545 (59%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYF ALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFSALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PE+VLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEEVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>ref|XP_011082248.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=560

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/546 (57%), Positives = 405/546 (74%), Gaps = 7/546 (1%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
               E+VRP+ +F  SPSLWGD F     DN+V E YAQEI++L+ +V  M+V+  +  +AE
Sbjct  14    QQEIVRPLANF--SPSLWGDLFTSVSIDNQVVEFYAQEIELLREKVRKMIVA-HNKNMAE  70

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             KLN ID++ERLGISYHF   I+E + N YNA  +F+  DDL T AL FRLLRQHG+ ISS
Sbjct  71    KLNLIDSIERLGISYHFETEIEEQILNFYNARSSFE-SDDLHTVALYFRLLRQHGHPISS  129

Query  509   GIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
             GIF+ F EN GKFK+SL  D KGLL+LYEA+HL+   +  L +A  F+  HLE I P LS
Sbjct  130   GIFEKFMENDGKFKNSLRADPKGLLSLYEAAHLQTREEDILDKALAFTTAHLESIAPHLS  189

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S   +QV HAL+Q L  GIPRVE+ ++I+VYEE ESKND LLR AKLDFNLLQM H++EL
Sbjct  190   SPFKEQVAHALEQCLQRGIPRVEARHYISVYEEYESKNDSLLRLAKLDFNLLQMLHRREL  249

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWKELD V+ L YARDR VECYFW LGVYFE +YS+AR+MLAK I M S+ DDTY
Sbjct  250   CELSRWWKELDLVSKLSYARDRVVECYFWTLGVYFEPQYSRARVMLAKTIAMISVIDDTY  309

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             DS+G  DELEIFTDAI++WDI++T+RLP +MKI Y  L+DL++++++EL ++GRSFAVHY
Sbjct  310   DSYGTIDELEIFTDAIERWDIKETDRLPDYMKICYTVLLDLYDQYEQELRQQGRSFAVHY  369

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              K  +KE+V SYNIE KW  E   PP A+Y+ NG  +ST YLL   SF+GM +VT+EAF+
Sbjct  370   AKATMKEIVRSYNIEAKWFIEGYMPPFADYMTNGFITSTYYLLAATSFIGMNAVTKEAFD  429

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W    P+I  AN  + R+++D+A+YE EK    +ATGI+ YM DYGV+ EEAM +F+ + 
Sbjct  430   WLVGKPKIQVANVTICRIVDDVATYEIEKKRGQSATGIECYMKDYGVSEEEAMEEFKNIA  489

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             ENAWKD NE+ ++    +VS E+L  ++N +R+ DVVYK+ QDGYT+PEKVLKP I  +L
Sbjct  490   ENAWKDMNEECVK--EKSVSMEVLKRVVNLSRLIDVVYKHNQDGYTHPEKVLKPLITGLL  547

Query  1766  VNSFEI  1783
             V+SF +
Sbjct  548   VDSFNV  553



>gb|AAA86337.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=520

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/521 (61%), Positives = 399/521 (77%), Gaps = 5/521 (1%)
 Frame = +2

Query  230   DNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLEN  409
             DN+VAE+YAQEI+ LK Q  +ML +     L EKLN ID +ERLGI+YHF + I++ML++
Sbjct  2     DNQVAEKYAQEIETLKEQTSTMLSAACGTTLTEKLNLIDIIERLGIAYHFEKQIEDMLDH  61

Query  410   IYNANPNFQLGD--DLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLL  580
             IY A+P F+  +  DL TS++ FRLLRQHGYN+S  IF  FQ+ NGKFK SL +D++GLL
Sbjct  62    IYRADPYFEAHEYNDLNTSSVQFRLLRQHGYNVSPNIFSRFQDANGKFKESLRSDIRGLL  121

Query  581   NLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESS  760
             NLYEASH++ H +  L+EA  FS  HLE   P L S L KQV HAL+QSLH  IPRVE  
Sbjct  122   NLYEASHVRTHKEDILEEALVFSVGHLESAAPHLKSPLSKQVTHALEQSLHKSIPRVEIR  181

Query  761   YFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVE  940
             YFI++YEE+E KND+LLRFAKLD+NLLQM HK EL E  RWWK+LDFVTTLPYARDRAVE
Sbjct  182   YFISIYEEEEFKNDLLLRFAKLDYNLLQMLHKHELSEVSRWWKDLDFVTTLPYARDRAVE  241

Query  941   CYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTN  1120
             CYFW +GVY E +YS+AR+MLAK I M SI DDT+D++G   ELE++TDAIQ+WDI Q +
Sbjct  242   CYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDTFDAYGIVKELEVYTDAIQRWDISQID  301

Query  1121  RLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTP  1300
             RLP +MKI YK L+DL+++++KELSK+GRS  VHY KER+KE+V +Y IE KW  E   P
Sbjct  302   RLPEYMKISYKALLDLYDDYEKELSKDGRSDVVHYAKERMKEIVGNYFIEGKWFIEGYMP  361

Query  1301  PVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASY  1480
              V+EY+ N  A+ST YLL T S+LGMKS T+E FEW + NP+I+EAN  L RV++DIA+Y
Sbjct  362   SVSEYLSNALATSTYYLLTTTSYLGMKSATKEHFEWLATNPKILEANATLCRVVDDIATY  421

Query  1481  EREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILL  1660
             E EK     ATGI+ YM DYGV+ E AM KF+EM + AWKD NE+ILRP P  VS+EIL 
Sbjct  422   EVEKGRGQIATGIECYMRDYGVSTEVAMEKFQEMADIAWKDVNEEILRPTP--VSSEILT  479

Query  1661  CILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              ILN ARI DV YK+ QDGYT+PEKVLKP I +++V+S +I
Sbjct  480   RILNLARIIDVTYKHNQDGYTHPEKVLKPHIIALVVDSIDI  520



>sp|Q84LF1.1|5EAS1_NICAT RecName: Full=5-epi-aristolochene synthase 1; Short=NaEAS34 [Nicotiana 
attenuata]
 gb|AAP05761.1|AF484124_1 5-epi-aristolochene synthase 34 [Nicotiana attenuata]
Length=548

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/545 (59%), Positives = 409/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD F  F  DN+VAE+YAQEI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDHFLSFSIDNQVAEKYAQEIEPLKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISY+F + IDE+L++IYN N N    +D CTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYYFEKEIDEILDHIYNQNSN---CNDFCTSALQFRLLRQHGFNISPQI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKF+ SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFRESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS   +S  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPHYMKISYKAILDLYKDYEKELSSAEKSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V  YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVGHYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ ++AM KF++M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKKAMAKFQKMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTLILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>pdb|1HXG|A Chain A, Crystal Structure Of Teas W273sC440W
Length=548

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/545 (59%), Positives = 411/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N IDT+ERLGISYHF + ID++L+ IYN N N    +DLCTSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDTIERLGISYHFEKEIDDILDQIYNQNSN---CNDLCTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYF ALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFSALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              ER+KE+V +YN+E  W  E  TPPV+EY+ N  A++T Y L T S+LGMKS T + FEW
Sbjct  366   IERMKEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M E
Sbjct  426   LSKNPKILEASVIIWRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  DGYT+PE+VLKP I ++LV
Sbjct  486   TAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNLDGYTHPEEVLKPHIINLLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIKI  548



>ref|XP_010313902.1| PREDICTED: vetispiradiene synthase 1 isoform X2 [Solanum lycopersicum]
Length=533

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/547 (59%), Positives = 405/547 (74%), Gaps = 22/547 (4%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK-LA  325
              +E+VRPV +F  SPSLWGD F  F  DN+VA++YAQ+I+ LK Q  S+L        LA
Sbjct  7     QDEIVRPVANF--SPSLWGDRFHSFSLDNQVADKYAQQIETLKEQTRSLLSDAACGTTLA  64

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             EKLN ID +ERLG++YHF + I++ML+ IY A+PNF+   DL T +L FR+LRQHGYNIS
Sbjct  65    EKLNLIDIVERLGLAYHFEKQIEDMLDQIYKADPNFE-AHDLNTLSLQFRILRQHGYNIS  123

Query  506   SGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF  FQ+ NGKFK SLSND+KGLLNLYEASH++ H +  L+EA  FS  HLE   P L
Sbjct  124   QKIFSRFQDANGKFKESLSNDIKGLLNLYEASHVRTHGEDILEEALAFSTAHLESAAPHL  183

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KNDVLLRFAKLD+NLLQM HKQE
Sbjct  184   KSPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEEFKNDVLLRFAKLDYNLLQMLHKQE  243

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E                +RDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT
Sbjct  244   LSE---------------VSRDRAVECYFWTMGVYAEPQYSQARVMLAKTIAMISIVDDT  288

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G   ELE++TDAIQ+WDI Q +RLP +MK+ +K L+DL+E+++KELSK+GRS  V 
Sbjct  289   FDAYGIVKELEVYTDAIQRWDISQMDRLPEYMKVSFKALLDLYEDYEKELSKDGRSDVVQ  348

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YLL T S+LG+KS T+E F
Sbjct  349   YAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDF  408

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW ++NP+I+EAN  L RV++DIA+YE EK     ATGI+ YM DYGV+ + AM+KF+EM
Sbjct  409   EWLAKNPKILEANVTLCRVVDDIATYEVEKGRGQIATGIECYMRDYGVSTQVAMDKFQEM  468

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
              E AWKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT+PEKVLKP I ++
Sbjct  469   AEIAWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYTHPEKVLKPHIIAL  526

Query  1763  LVNSFEI  1783
             LV+S EI
Sbjct  527   LVDSIEI  533



>ref|XP_011082247.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=555

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 402/546 (74%), Gaps = 7/546 (1%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
               E+VRP+ +F  SPSLWGD F     D +V E YAQEI+ LK +V  M+V+  +  +A 
Sbjct  13    QQEIVRPLANF--SPSLWGDLFTSVPIDTQVVESYAQEIESLKKEVRKMIVA-NNKNMAG  69

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             KLN ID++ERLGISYHF   I+E + N YNA  +F + DDL T AL FRLLRQHG+ ISS
Sbjct  70    KLNLIDSIERLGISYHFEREIEEQILNFYNACFSF-VSDDLHTVALYFRLLRQHGHPISS  128

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
             GIF  F E +GKFK+SL  D KGLL+LYEA++L+   +  L EA TF+  HLE I P LS
Sbjct  129   GIFHKFTESDGKFKNSLRGDAKGLLSLYEAANLRTRGEGILDEAITFATAHLESIAPHLS  188

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L +QV HAL+Q L  GIPRVE+  +I+VYEE ESKND LLR AK+DFNLLQM H++EL
Sbjct  189   SPLKEQVAHALEQCLQRGIPRVEARRYISVYEEYESKNDSLLRLAKMDFNLLQMLHREEL  248

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWKELD V+ L YARDR VECYFW LGVYFE +YS+AR+MLAK I M S+ DDTY
Sbjct  249   SELSRWWKELDLVSKLSYARDRVVECYFWTLGVYFEPQYSRARIMLAKTIAMISVIDDTY  308

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             DS+G  DELEIFTDA+++WDI++ +RLP +MK+ Y+ L+DL++++++EL ++GRSFAVHY
Sbjct  309   DSYGTVDELEIFTDAVERWDIKEIDRLPDYMKMCYRVLLDLYDQYEQELRQQGRSFAVHY  368

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              K  +KE+V SYNIE KW  E   PP A+Y+ NG  +ST YLL   SF+GM +VT+EAF+
Sbjct  369   AKATMKEIVRSYNIEAKWFIEGYMPPFADYMTNGFITSTYYLLAATSFIGMNAVTKEAFD  428

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W    P+I  AN  + R+++D+A+YE EK    +ATGI+ YM DYGV+ EEAM +F+ + 
Sbjct  429   WLVGKPKIQVANVTICRIVDDVATYEIEKKRGQSATGIECYMKDYGVSEEEAMEEFKNIA  488

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             ENAWKD NE+ ++    +VS E+L  ++N +R+ DVVYK+ QDGYT+PEKVLKP I  +L
Sbjct  489   ENAWKDMNEECVK--EKSVSMEVLKRVVNLSRLIDVVYKHNQDGYTHPEKVLKPLITGLL  546

Query  1766  VNSFEI  1783
             V+SF I
Sbjct  547   VDSFSI  552



>gb|AHM10157.1| sesquiterpene synthase [Nicotiana benthamiana]
Length=548

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/545 (58%), Positives = 408/545 (75%), Gaps = 10/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  DN+VA+ YAQEI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIDNQVAQMYAQEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + ID++L++I+N N NF   DD  TSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDDLLDHIFNQNSNF---DDFTTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L+S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDARAFSTIHLESATPHLNSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++S N++LLRFAKLDFNLLQM HKQEL 
Sbjct  186   LKEQVTHALEQCLHKGVPRVETRFFISSIYEKEKSMNNMLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK LDFVTTL YARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKGLDFVTTLSYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +T+AIQ+W I++ +RLP +MKI YK ++DL+ +++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTNAIQRWHIKEIDRLPDYMKISYKAILDLYNDYEKELSSAGRSHIVSHA  365

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              +R+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LG+KSVT + FEW
Sbjct  366   IQRMKEVVRNYNVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGIKSVTEQDFEW  425

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM+KF++M E
Sbjct  426   LSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGLSTKEAMDKFQKMAE  485

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE +LRP P  VS E L  ILN ARI +V Y +  DGYT+PEKVLKP I ++LV
Sbjct  486   TAWKDLNEGLLRPTP--VSAEFLNPILNLARIVEVTYIHNLDGYTHPEKVLKPHIVALLV  543

Query  1769  NSFEI  1783
             +S +I
Sbjct  544   DSIQI  548



>sp|O65323.1|5EAS_CAPAN RecName: Full=5-epiaristolochene synthase [Capsicum annuum]
 gb|AAC61260.1| sesquiterpene cyclase [Capsicum annuum]
Length=559

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 404/549 (74%), Gaps = 12/549 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E++RPV  F  SPSLWGD F  F  DN+V  +YAQEI+ LK Q  SML++    KL+E L
Sbjct  17    EIIRPVADF--SPSLWGDRFLSFSIDNQVETKYAQEIEPLKEQTRSMLLA-SGRKLSETL  73

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNI  502
             N ID +ERLGI+YHF + IDE+L+ IYN N NF+ GD    DLCT  L FRLLRQHGYNI
Sbjct  74    NLIDVIERLGIAYHFEKEIDEILDRIYNENSNFE-GDVYNEDLCTCRLQFRLLRQHGYNI  132

Query  503   SSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
             S  IF  F + NG+ K SL++DV GLL+LYEASH++ H +  L++A  FS THLE   P 
Sbjct  133   SLKIFSKFLDGNGRLKESLASDVLGLLSLYEASHVRSHGEDILEDALAFSTTHLESATPH  192

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHK  856
             L   L +QVRHAL+QSLH GIPR+E  +FI+ VY++   KNDVLLRFAKLD+N+LQM HK
Sbjct  193   LEYPLKEQVRHALEQSLHKGIPRIEIQFFISSVYDKQAIKNDVLLRFAKLDYNMLQMLHK  252

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             QEL E  RWWK+L+FV TLPYARDR VECYFWALGVY+E +YS+AR+ML K I M SI D
Sbjct  253   QELAEVSRWWKDLNFVNTLPYARDRVVECYFWALGVYYEPQYSQARVMLVKTIAMISIVD  312

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             DTYD++G  DEL I+TD IQ+WDI++ + LP +MKI YK L+DL+++++KE+S++GRS  
Sbjct  313   DTYDAYGTVDELAIYTDVIQRWDIKEIDSLPDYMKISYKALLDLYKDYEKEMSRDGRSHV  372

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
             V+Y KER+KELV SYNIE KW  E   PP +EY++N   ++T Y L T S+LGMK    +
Sbjct  373   VYYAKERLKELVKSYNIEAKWFIEGHMPPASEYLRNAFVTTTYYYLATTSYLGMKYAKEQ  432

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
              FEW S+NP+I+E    + RVI+DIA+YE EK     +TGI+ YM DY V+ +EAM KF+
Sbjct  433   QFEWLSKNPKILEGCVTICRVIDDIATYEVEKNRGQLSTGIECYMRDYSVSTKEAMAKFQ  492

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             EM E+ WKD NE +LRP P  +  E L  ILN AR+ DV YK+ +DGYT+PEKV+KP I 
Sbjct  493   EMGESGWKDINEGMLRPTP--IPMEFLSRILNLARLVDVTYKHNEDGYTHPEKVIKPHII  550

Query  1757  SVLVNSFEI  1783
             +++V+SF+I
Sbjct  551   AMVVDSFKI  559



>emb|CAA06614.1| 5-epi-aristolochene synthase [Capsicum annuum var. annuum]
Length=559

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/549 (56%), Positives = 404/549 (74%), Gaps = 12/549 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E++RPV  +  SPS+WGD F  F  DN+V ++YAQEI+  K Q  SML++    KL++ L
Sbjct  17    EIIRPVADY--SPSIWGDRFLSFSIDNQVEQKYAQEIEPPKEQTRSMLLA-SPRKLSDTL  73

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNI  502
             N ID +ERL I+YHF + IDE+L+ IYN N NF+ GD    DLCT AL FRLLRQHGYNI
Sbjct  74    NLIDVIERLAIAYHFEKEIDEILDRIYNENSNFE-GDVYNEDLCTCALQFRLLRQHGYNI  132

Query  503   SSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
             S  IF  F + NG+ K SL++DV GLL+LYEASH++ H +  L++A  FS THLE   P 
Sbjct  133   SLEIFSKFLDGNGRLKESLASDVLGLLSLYEASHVRSHGEDILEDALAFSTTHLESATPH  192

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHK  856
             L   L +QVRHAL+QSLH GIPR+E  +FI+ +Y++   KNDVLLRFAKLD+N+LQM HK
Sbjct  193   LEYPLKEQVRHALEQSLHKGIPRIEIQFFISSIYDKQAIKNDVLLRFAKLDYNMLQMLHK  252

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             QEL E  RWWK+L+FV TLPYARDR VECYFWALGVY+E +YS+AR+ML K I M SI D
Sbjct  253   QELAEVSRWWKDLNFVNTLPYARDRVVECYFWALGVYYEPQYSQARVMLVKTIAMISIVD  312

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             DTY+++G  DEL I+TD IQ+WDI++ + LP +MKI YK L+DL+++++KE+S++GRS  
Sbjct  313   DTYEAYGTVDELAIYTDVIQRWDIKRIDSLPDYMKISYKALLDLYKDYEKEMSRDGRSHV  372

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
             V+Y KER+KELV SYNIE KW  E   PP +EY++N   ++T Y L T S+LGMK    +
Sbjct  373   VYYAKERLKELVKSYNIEAKWFIEGHMPPASEYLRNAFVTTTYYYLATTSYLGMKYAKEQ  432

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
              FEW S+NP+I+E    + RVI+DIA+YE EK     +TGI+ YM DY V+ +EAM KF+
Sbjct  433   QFEWLSKNPKILEGCVTICRVIDDIATYEVEKNRGQLSTGIECYMRDYSVSTKEAMAKFQ  492

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             EM E+ WKD NE +LRP P  +  E L  ILN AR+ DV YK+ +DGYT+PEKV+KP I 
Sbjct  493   EMGESGWKDINEGMLRPTP--IPMEFLSRILNLARLVDVTYKHNEDGYTHPEKVIKPHII  550

Query  1757  SVLVNSFEI  1783
             +++V+SF+I
Sbjct  551   AMVVDSFKI  559



>ref|XP_011082260.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/544 (55%), Positives = 395/544 (73%), Gaps = 9/544 (2%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             +VRPV +F  SPSLWGD F     D +V+E YA+E++ LK +  S +V+    KL EKL 
Sbjct  18    IVRPVANF--SPSLWGDLFTSCCADTQVSEFYAKEVEELKEKARSSIVA-DGKKLHEKLI  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIF  517
              I+T++RLG+SYHF + I + LE I+      +  DDL  +AL FRLLRQHG+++SS +F
Sbjct  75    LIETVQRLGLSYHFEKEIQDQLELIFKLEN--EENDDLFITALQFRLLRQHGFDVSSCVF  132

Query  518   DNFQENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST--  691
             D F  NGKFK SL  D+KGLL+LYEA+HL+ H +  L EA TFS  HLE  G Q SS   
Sbjct  133   DKFTNNGKFKESLRVDIKGLLSLYEAAHLRYHGETVLDEALTFSTAHLESYGRQDSSNSM  192

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             +G++VRHAL+Q L  GIPR+E+ +FI  YEEDESK++ LLRFAKLDFNLLQM HK+ELYE
Sbjct  193   MGRKVRHALEQFLQRGIPRIEARHFIAFYEEDESKDESLLRFAKLDFNLLQMLHKKELYE  252

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELD ++ L YARDR VECYFW +GVYFE +YS+AR+MLAK I M S+ DDTYDS
Sbjct  253   VSRWWKELDLISKLSYARDRVVECYFWTMGVYFEPQYSRARVMLAKTIAMISVIDDTYDS  312

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  DEL IFTDAI++WDI + +RLP +MKI YK L+DL++++D+EL ++GRSFAVHY K
Sbjct  313   YGTVDELAIFTDAIERWDINEIDRLPDYMKICYKALLDLYDQYDEELRQQGRSFAVHYAK  372

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWS  1411
               +K++V SYNIE KW  E   PP A+Y+ NG  +ST YLL T SF+GM+S  +EAF+W 
Sbjct  373   ATMKDIVRSYNIEAKWFIEGYMPPFADYMANGFITSTYYLLATTSFIGMESAPKEAFDWL  432

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
              + P+I  AN  + RV++DIA+YE EK      TGI+ YMN+Y V  EEAM +   + EN
Sbjct  433   MKKPKIQVANVTICRVVDDIATYEIEKKRGQTVTGIECYMNEYEVCEEEAMRELSNIAEN  492

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW+D NE++ +    AVS E++  ++N AR+ DVVYK+ QDGYT+PEKVLKP I  +L++
Sbjct  493   AWRDINEELAK--EKAVSKEMIKRVVNLARLIDVVYKHNQDGYTHPEKVLKPHINGLLLD  550

Query  1772  SFEI  1783
              F+I
Sbjct  551   FFKI  554



>gb|AAP79448.1| epi-arisotolchene synthase 110 [Nicotiana tabacum]
Length=548

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/517 (59%), Positives = 389/517 (75%), Gaps = 8/517 (2%)
 Frame = +2

Query  239   VAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYN  418
             +AE+Y +EI+ LK Q  +ML++    KLA+ LN ID +ERLGISYHF + IDE+L+ IYN
Sbjct  38    IAEKYTKEIEGLKEQTRNMLLAT-GMKLADTLNLIDIIERLGISYHFEKEIDEILDQIYN  96

Query  419   ANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEA  595
              N N    DDLCTSAL FRLLRQHG+NIS GIF  FQ ENGK K SL++DV GLLNLYEA
Sbjct  97    QNSN---CDDLCTSALQFRLLRQHGFNISPGIFSKFQDENGKSKESLASDVLGLLNLYEA  153

Query  596   SHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFIT-  772
             SH++ H D  L++A  FS  HLE   P L S L +QV HAL+Q LH G+PRVE+ +FI+ 
Sbjct  154   SHVRTHADDILEDALAFSIIHLESAAPHLKSPLKQQVTHALEQCLHKGVPRVETRFFISS  213

Query  773   VYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFW  952
             +YE+++SKN+VLLRFAKLDFNLLQM HKQEL +  R WK+LDFVTTLPYARDR VECYFW
Sbjct  214   IYEKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVSRCWKDLDFVTTLPYARDRVVECYFW  273

Query  953   ALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPR  1132
             ALGVYFE +YS+AR+ML K I+M SI DDT+D++G   ELE +TDAIQ+WDI + +RLP 
Sbjct  274   ALGVYFEPQYSQARVMLVKTISMISIVDDTFDAYGTVKELEAYTDAIQRWDINEIDRLPD  333

Query  1133  FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAE  1312
             +MKI YK ++DL+++++KELS  GRS  V +  ER+KE+V +YN+E  W  E   PPV+E
Sbjct  334   YMKISYKAILDLYKDYEKELSSAGRSHIVCHAIERVKEVVRNYNVESTWFIEGYMPPVSE  393

Query  1313  YIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREK  1492
             Y+ N  A++T Y L T S+LGMKSVT + FEW S+NP+I+EA+ ++ RVI+D A+YE EK
Sbjct  394   YLSNALATTTYYYLATTSYLGMKSVTEKDFEWLSKNPKILEASVIICRVIDDTATYEVEK  453

Query  1493  YNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILN  1672
                  ATGI+  M DYG++  EAM KF+EM E AWKD NE +LRP P  V+TE L  ILN
Sbjct  454   SRGQIATGIECCMRDYGISTNEAMTKFQEMAEAAWKDLNEGLLRPTP--VATEFLSRILN  511

Query  1673  FARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              ARI +V Y +  DGYT+PEKVLKP I ++LV+S +I
Sbjct  512   LARIVEVTYIHNLDGYTHPEKVLKPHINALLVDSIKI  548



>gb|AAF21053.1|AF212433_1 UV-induced sesquiterpene cyclase [Capsicum annuum]
Length=560

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/544 (57%), Positives = 398/544 (73%), Gaps = 9/544 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFI  343
             RPV +F  +PSLWG+ F  F  +N V  +Y QEI+VLK Q  SML+     KL E LN I
Sbjct  22    RPVANF--APSLWGNSFLSFSINNHVETKYVQEIEVLKEQTRSMLLDT-GRKLVETLNLI  78

Query  344   DTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNISSGIF  517
             D +ERLGI+YH+ + ID++L+  +  N NF   D  DLCT AL FRLLRQHGY IS  IF
Sbjct  79    DVIERLGIAYHYEKEIDDILKKNFLDNSNFDEDDFNDLCTCALQFRLLRQHGYKISLKIF  138

Query  518   DNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
                Q ENGK K SL++DV GLL+LYEASH++ H D  L++A  FS THLE   P L+S L
Sbjct  139   SKLQDENGKLKESLASDVLGLLSLYEASHVRTHGDDILEDALAFSTTHLESAAPHLNSPL  198

Query  695   GKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
              +QV HAL+ SLH GIPR E+ +FI+ +YE+ E+KNDVLLRFAKLDFNLLQM HKQEL E
Sbjct  199   KEQVTHALELSLHKGIPRAETRFFISSIYEKQETKNDVLLRFAKLDFNLLQMLHKQELAE  258

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWK+L+F+ TLPYARDRAVECYFW LGVY+E +YS+AR+MLAK I M SI DDT+DS
Sbjct  259   VSRWWKDLNFMATLPYARDRAVECYFWTLGVYYEPQYSQARIMLAKTIAMISIVDDTFDS  318

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G   EL+ +T+AIQ+WDI + +RLP +MKI YK L+ L+E+++KELS  GRS  V++ K
Sbjct  319   YGTVKELDTYTNAIQRWDISEIDRLPDYMKISYKALLQLYEDYEKELSSNGRSHVVYHAK  378

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWS  1411
             +R+KE+V SYN+E +W  +   P V+EY+ N   +ST YLL T S+LGMKS T + FEW 
Sbjct  379   QRMKEIVRSYNVEARWFIKGHMPLVSEYLSNALITSTYYLLTTTSYLGMKSSTEQDFEWL  438

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             S+NP+I++AN  + RVI+DIA+YE EK     ATGI+ Y  +YGV+ EE M KF E+ E 
Sbjct  439   SKNPKILKANATICRVIDDIATYEVEKSRGEIATGIECYRREYGVSTEEGMIKFSEIREA  498

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AWKD NE +LR  PS+V+ E L  ILN  R+ DVVYK+ QDGYT+PEKVLKP I ++LV+
Sbjct  499   AWKDINEGMLR--PSSVTMEFLTPILNLVRLIDVVYKHNQDGYTHPEKVLKPHIVALLVD  556

Query  1772  SFEI  1783
             S +I
Sbjct  557   SIKI  560



>ref|XP_009617319.1| PREDICTED: LOW QUALITY PROTEIN: vetispiradiene synthase 3-like 
[Nicotiana tomentosiformis]
Length=551

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/564 (56%), Positives = 390/564 (69%), Gaps = 26/564 (5%)
 Frame = +2

Query  122   TSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLK------GQ  283
              + +L     +E+V PV+ F  SPSLWGD F  F  DN+ AE+YAQEI+ LK        
Sbjct  4     AAAVLSNYEKDEIVSPVSDF--SPSLWGDRFYSFSLDNQAAEKYAQEIETLKELTRSMXD  61

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG---DDLC  454
             VMS      +  LAEKLN ID +ERLGI+YHF + ID+ML+ IYN +PNF+ G   +DLC
Sbjct  62    VMSAASGTTTLTLAEKLNLIDIVERLGIAYHFEKQIDDMLDQIYNVDPNFE-GLEYNDLC  120

Query  455   TSALLFRLLRQHGYNISSGIFDNFQENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKE  634
               +L FRLL QHGYNIS      F         L      L+N   +++    +   L+E
Sbjct  121   ILSLQFRLLGQHGYNISPSNMHYF---------LICCYIYLINQSMSTYTSSXD--ILEE  169

Query  635   AYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLH-NGIPRVESSYFITVYEEDESKNDVLL  811
             A  FS  HLE   P L S L KQV HAL+QSLH   IPRVE+ YFI++YEE+E KND+LL
Sbjct  170   ALAFSTAHLESTAPHLKSPLSKQVTHALEQSLHIKSIPRVETRYFISIYEEEELKNDILL  229

Query  812   RFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKA  991
             RFAKLDFN+LQM HKQEL E  RWWK+LDFVTTLPY RDRAVECYFW +GVY E +YS+A
Sbjct  230   RFAKLDFNVLQMLHKQELSEVSRWWKDLDFVTTLPYTRDRAVECYFWTVGVYSEPQYSQA  289

Query  992   RLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLF  1171
             R+MLAK I M SI DDT+D++G   ELE++TDAIQ+WDI Q NRLP +MKI YK L+DL+
Sbjct  290   RVMLAKTIAMISIVDDTFDAYGIVKELEVYTDAIQRWDISQINRLPDYMKISYKALLDLY  349

Query  1172  EEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYL  1351
              +++KELS +GRS  VHY KER+KE+V +Y +E KW  E   PPV+EY+ N  A+ST YL
Sbjct  350   NDYEKELSNDGRSSVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATSTYYL  409

Query  1352  LITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYM  1531
             L T S+LGMK   +E FEW  +NP+I+EAN  L RVI+DIA+YE EK      TGI+ YM
Sbjct  410   LTTTSYLGMKCANKEDFEWLDKNPKILEANVTLCRVIDDIATYEVEKSRGQIETGIECYM  469

Query  1532  NDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQ  1711
              DY V+ EEAM KF+EM E AWKD NE ILRP P  VS +IL  ILN ARI D+ YK+ Q
Sbjct  470   RDYDVSTEEAMEKFQEMAEIAWKDVNEGILRPTP--VSAKILTRILNLARIIDITYKHNQ  527

Query  1712  DGYTNPEKVLKPCIFSVLVNSFEI  1783
             DGYT+PEKVLKP I ++LV+S  I
Sbjct  528   DGYTHPEKVLKPHIIALLVDSIVI  551



>ref|XP_011073749.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/547 (53%), Positives = 384/547 (70%), Gaps = 7/547 (1%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             N+E+VRPV +F  SPSLWGD+F  +  D +V E Y++ I+VLK +V SML +  S ++ E
Sbjct  13    NDEIVRPVANF--SPSLWGDQFIKYTSDTQVKEEYSKAIEVLKNEVRSMLTAAGS-EMVE  69

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNIS  505
              +N IDT+ERLGISYHF   I++ LE  ++ N N++    DL T +L FRL RQHG+ IS
Sbjct  70    SMNLIDTIERLGISYHFESEIEDKLERFFSLNTNYEDEAYDLYTVSLHFRLFRQHGHRIS  129

Query  506   SGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
             S I   F++ NGKF+ +L +D +GLL+LYEA+HL+ H +  L+E   F+  +L+ + P L
Sbjct  130   SEILSKFKDDNGKFQEALKSDARGLLSLYEAAHLRIHGEDILEEGLAFATANLKSMAPNL  189

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
              S L +QV HAL Q LH+G PR+E+  FI+ YEE ESKN+ LLRFAKLD+NLLQM HK+E
Sbjct  190   GSPLRQQVVHALVQPLHSGNPRIEARNFISSYEEHESKNETLLRFAKLDYNLLQMLHKEE  249

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L+E  RWWKELD V  LPYARDRAVEC+FWA+GVY E +YS+AR+ML K I M SI DDT
Sbjct  250   LHEISRWWKELDLVAKLPYARDRAVECFFWAMGVYHEPQYSRARIMLTKTIVMTSIIDDT  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD++G  +EL  FT+A ++WDI + +RLP ++K  Y+ L++L+E F++EL++EGRS+AV+
Sbjct  310   YDAYGTIEELNAFTEAFERWDISEIDRLPNYIKPFYRALLELYEHFEEELAQEGRSYAVY  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             Y KE +KELV SY++E KW  E   PP  EY+ N   + T     T S LG +S  RE F
Sbjct  370   YAKEALKELVRSYHVEAKWFIEGYLPPFTEYLNNALITCTYCYHTTTSLLGTESAKREEF  429

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             EW  Q P+++ A   + RVI+DIA+YE EK     ATGI+ YM +  VT EEA+NK  EM
Sbjct  430   EWLRQKPKMLVAGLTICRVIDDIATYEVEKERGQIATGIECYMKENRVTKEEAVNKLFEM  489

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
               NAWKD NE  LR  PS+ S ++L+ ILN  RI DV YKN +DGYT PEKVLKP I ++
Sbjct  490   ATNAWKDINEGCLR--PSSYSRDVLIRILNLERIIDVTYKNNEDGYTRPEKVLKPHIVAL  547

Query  1763  LVNSFEI  1783
              VN  EI
Sbjct  548   FVNPIEI  554



>gb|AAG09950.1|AF171218_1 vetispiradiene synthase [Solanum lycopersicum]
Length=453

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/448 (63%), Positives = 344/448 (77%), Gaps = 3/448 (1%)
 Frame = +2

Query  443   DDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHND  619
             +DLCT +L FR+LRQHGY IS  IF  FQ+ NGKFK SL +D++G+LNLYEASH++ H +
Sbjct  8     NDLCTLSLQFRILRQHGYYISPKIFSRFQDANGKFKESLCDDIRGILNLYEASHVRTHGE  67

Query  620   ANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKN  799
               L+EA  FS  HLE   P L S L KQV HAL+QSLH  IPRVE+ YFI++YEE+E KN
Sbjct  68    DTLEEALAFSTAHLESAAPHLKSPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEELKN  127

Query  800   DVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAK  979
             DV LRFAKLDFNLLQM HKQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +
Sbjct  128   DVFLRFAKLDFNLLQMLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVYAEPQ  187

Query  980   YSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTL  1159
             YS+AR+MLAK I M SI DDT+D++G   ELE++TDAIQ+WD+ Q +RLP +MKI YK L
Sbjct  188   YSQARVMLAKTIAMISIVDDTFDAYGIVKELEVYTDAIQRWDVSQIDRLPEYMKISYKAL  247

Query  1160  IDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASS  1339
             +DL+ +++ ELS +GRS  V Y KER+KE+V +Y +E KW  E   PPV+EY+ N  A+S
Sbjct  248   LDLYNDYETELSNDGRSDVVQYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNALATS  307

Query  1340  TLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGI  1519
             T YLL T S+LGMKS T++ FEW ++NP+I+EAN  L RVI+DIA+YE EK     ATGI
Sbjct  308   TYYLLTTTSYLGMKSATKKDFEWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQIATGI  367

Query  1520  DYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVY  1699
             + YM DYGV+ + AM+KF+EM E AWKD NE ILRP P  VS +IL  ILN ARI DV Y
Sbjct  368   ECYMRDYGVSTQVAMDKFQEMAETAWKDVNEGILRPTP--VSAKILTRILNLARIIDVTY  425

Query  1700  KNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             K+ QDGYT+PEKVLKP I ++LV+S EI
Sbjct  426   KHNQDGYTHPEKVLKPHIIALLVDSIEI  453



>gb|EYU32629.1| hypothetical protein MIMGU_mgv1a023948mg [Erythranthe guttata]
Length=549

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/546 (53%), Positives = 383/546 (70%), Gaps = 7/546 (1%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             NE+VRPV++F  SPSLWGD+F  +  D +V E Y++ IQVLK +V +ML +    K+ + 
Sbjct  9     NEIVRPVSNF--SPSLWGDQFINYTSDLQVREEYSERIQVLKNEVWTMLKA-NETKIFDG  65

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD-DLCTSALLFRLLRQHGYNISS  508
             LN IDT+ERLGISYHF   I+E LE  +N N N++    DL T +L FR+ RQHG+ ISS
Sbjct  66    LNLIDTIERLGISYHFENEIEEKLEQFFNLNTNYEDETYDLYTVSLHFRVFRQHGHRISS  125

Query  509   GIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  F++  GKFK  + +D KGLL+LYEAS+L+ H +  L++A  F+ ++L+ I P LS
Sbjct  126   DIFRKFKDGEGKFKEVIKSDAKGLLSLYEASYLRVHEEDILEDALAFATSNLKSIAPNLS  185

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L + V HAL Q LH G PR+E+  FI+ YE+DE+KN+ LL FAKLD+NLLQM +K EL
Sbjct  186   SPLREHVFHALVQPLHFGNPRIETRNFISFYEQDENKNETLLIFAKLDYNLLQMLYKDEL  245

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWKELD V+ LPYARDR VECYFWA+GVY E +YS+AR+ML K I M SI DDTY
Sbjct  246   REVSRWWKELDLVSKLPYARDRVVECYFWAVGVYHEPQYSRARVMLTKTIIMTSIIDDTY  305

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G  +EL IFTDAI+KWDI Q +RLP+++K  Y  L+DL+ +F+KEL +E RS+A+ Y
Sbjct  306   DAYGVIEELNIFTDAIEKWDISQIDRLPQYIKPFYSALLDLYVQFEKELEQERRSYAITY  365

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KE +KELV SY++E KW  E   PP  EY+ N   + T     T + LG KS     FE
Sbjct  366   AKESLKELVRSYHVEAKWFIEGYLPPFNEYLDNALITCTYCYHTTTALLGTKSANEPDFE  425

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W SQ P+++ A+  + R+I+DIA+YE EK     ATGI+ YM ++G T EEAM+KF E+ 
Sbjct  426   WLSQKPKMLVASLKICRLIDDIATYEVEKARGQIATGIESYMKEFGATKEEAMDKFFEIA  485

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              N+WKDTNE+ L+  PS+   ++L+ ILN  RI DV YKN +DGYT PEKVLKP I ++ 
Sbjct  486   TNSWKDTNEECLK--PSSHPRDVLMRILNLERIIDVTYKNNEDGYTQPEKVLKPHIVALF  543

Query  1766  VNSFEI  1783
             V+  +I
Sbjct  544   VDPIKI  549



>gb|EYU21979.1| hypothetical protein MIMGU_mgv1a019334mg [Erythranthe guttata]
Length=564

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/551 (51%), Positives = 382/551 (69%), Gaps = 11/551 (2%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             ++++VRPV +  F PSLW D F  F  D +++  YA+EI+VLK +  +ML S+   KL+E
Sbjct  19    SSDIVRPVIA-NFPPSLWDDRFTSFDMDIQLSSMYAEEIKVLKEEARNMLTSV-DIKLSE  76

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQL--GDDLCTSALLFRLLRQHGYNI  502
             KL  IDT+ERLG+SYHF   I E L   +N +   +L   +DL  ++L FRLLRQH  + 
Sbjct  77    KLVLIDTIERLGLSYHFENEIQEQLTLAFNGHLKLELDENNDLFITSLQFRLLRQHALDA  136

Query  503   SSGIFDNFQEN--GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
              S IF  F EN  G+FK +L  +++G+L+LYEA++L+   +  L +A++FSK +LE + P
Sbjct  137   PSSIFKRFTENKNGEFKKALCTEIEGVLSLYEATYLRRQGEEILDKAFSFSKAYLESVAP  196

Query  677   QLSS-TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
              L    L KQV HALDQSLH G PRVES  FI++YEE ESKN+ LLR AKLDFNLLQM H
Sbjct  197   NLPELPLKKQVLHALDQSLHRGTPRVESRRFISLYEEVESKNESLLRLAKLDFNLLQMLH  256

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             K EL E  RWWKE+D ++ L YARDR VECYFWALGVY E +YS AR+MLAK I + S+ 
Sbjct  257   KNELSELTRWWKEMDLISKLSYARDRVVECYFWALGVYHEPQYSSARVMLAKTIAIISVI  316

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DDTYD++G  +EL++FTDAIQKWDIR+ +RLP +MKI Y+ ++DL+E FD ELS +GRSF
Sbjct  317   DDTYDTYGTIEELKVFTDAIQKWDIREIDRLPDYMKICYRVVLDLYEAFDAELSPKGRSF  376

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPV-AEYIKNGQASSTLYLLITASFLGMKSVT  1390
             AVHY +E +KE+V+SY +E KW  E    P+  EY+   + ++  Y L   ++LGM + T
Sbjct  377   AVHYAREAMKEIVTSYYVEAKWFVEGDHLPLFDEYMSQAEITAGAYFLTITAYLGMDNAT  436

Query  1391  REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK  1570
              E F+W    P I++   ++ R+I+D+A+YE EK     ATGID YM ++GV+ + A+  
Sbjct  437   IEVFDWLLAKPNILKTCNVVVRIIDDVATYEDEKKRGQVATGIDCYMKEHGVSKQVAIQC  496

Query  1571  FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
              +E+VE  WKD NE IL    ++VS EI + + N+AR+ ++ YK KQDGYT PEK LKP 
Sbjct  497   LQEIVEVRWKDLNEGIL---DNSVSMEIRMRVFNWARVAEITYKRKQDGYTYPEKGLKPH  553

Query  1751  IFSVLVNSFEI  1783
             + ++L+ SFEI
Sbjct  554   VVALLLQSFEI  564



>gb|AGN72800.1| germacrene A [Lavandula pedunculata subsp. lusitanica]
Length=547

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/546 (51%), Positives = 377/546 (69%), Gaps = 8/546 (1%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E++RP+ +F  SPSLWGD+F     D +V ++ ++ I+VLK +V SML +    K+ + +
Sbjct  7     EIIRPLANF--SPSLWGDQFIKNDSDAKVEDKISKTIEVLKEEVKSMLTAT-GTKMVDTM  63

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSG  511
             N IDT+ERLG+SYHF   I+E+L+  +N N ++     DL T A  FRL RQHG+ I+  
Sbjct  64    NLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVATHFRLFRQHGHRITCA  123

Query  512   -IFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  ++ ENGKF   L +D KGLL+LYEAS+L+   +  L EA  F+   L+ I P L 
Sbjct  124   DIFGRWRDENGKFHEGLKDDAKGLLSLYEASYLRTRGETILDEALDFTTASLKSIAPNLE  183

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L +QV HAL Q LH G PR+E+  FI++YEE E K++ LLRFAKLD+NLLQM HK+EL
Sbjct  184   SPLRRQVEHALVQQLHWGNPRIEARNFISLYEEYEDKDESLLRFAKLDYNLLQMMHKEEL  243

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             +E  RWWKELD V  LPYARDR VEC+FWA+GVY E +YS+AR+ML K I M SI DDTY
Sbjct  244   HEVSRWWKELDLVAKLPYARDRVVECFFWAMGVYHEPQYSRARVMLTKTIAMTSIIDDTY  303

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G  +EL+IFT+AI++W++ +  RLP ++K  YK L++L+E+F++EL+KEGRS+A HY
Sbjct  304   DAYGTIEELDIFTEAIERWNVEEMKRLPEYIKPFYKALLELYEQFEEELAKEGRSYATHY  363

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
               E +KELV SY++E KW  +   PP  EY+KN   + T     T S LG++S  RE FE
Sbjct  364   AIESLKELVRSYHVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFE  423

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W S+ P+++ A  L+ RVI+DIA+YE EK     ATGI+ YM D G T EEA+ KF E+ 
Sbjct  424   WLSKKPKMLVAGLLICRVIDDIATYEVEKDRGQIATGIESYMRDNGATKEEAITKFFEIA  483

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ +RP P   S ++L+ ILN  RI DV YK  +DGYT PEKVLKP I ++ 
Sbjct  484   NDAWKDINEECMRPSPH--SRDVLMRILNLERIIDVTYKGNEDGYTQPEKVLKPHIIALF  541

Query  1766  VNSFEI  1783
             V+  +I
Sbjct  542   VDPIQI  547



>emb|CAC83059.2| putative terpenesynthase-1 [Marrubium vulgare]
Length=545

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/543 (50%), Positives = 379/543 (70%), Gaps = 6/543 (1%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
              RP  +F  SPSLWGD+F  +  D +V E+Y+++I+VLK +V SM V+ +  K+ + +NF
Sbjct  7     TRPFANFSPSPSLWGDQFTKYNSDPQVKEKYSKQIEVLKNEVKSM-VTAQGGKMVDTINF  65

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             IDTMERLGI+YHF + I+E ++  +N N N++    DL T AL FRL RQHG+ IS  IF
Sbjct  66    IDTMERLGIAYHFKDEIEETIQQFFNLNTNYEDEAYDLYTVALHFRLFRQHGHPISCDIF  125

Query  518   DNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
               + + NGKF+ SL +D KGLL+LYEAS+L+ H D  L EA  F+ T+L+ + P L S L
Sbjct  126   GKWIDGNGKFQESLKSDAKGLLSLYEASYLRIHGDTQLDEAIDFATTNLKSMAPNLGSPL  185

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              KQV +AL QSLH G+PRVE+ +FI++YEE++ KN  LLRFAKLDFNLLQ+ HK+EL E 
Sbjct  186   RKQVENALVQSLHFGLPRVEARHFISIYEEEQQKNHTLLRFAKLDFNLLQILHKEELCEL  245

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF++  PY RDR VEC+FW++G+Y E +YS+AR+MLAK + M +I DDT+DS+
Sbjct  246   SRWWKELDFISQFPYVRDRIVECFFWSVGMYHEPQYSRARIMLAKSLVMITILDDTFDSY  305

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G  +ELE+ T+A+Q+WD +  + LP ++K IYK ++ ++++F++EL+ +G+++A HY  E
Sbjct  306   GTIEELELLTEAMQRWDTKDIDGLPEYIKEIYKLMLKIYQQFEEELAMDGKAYATHYAIE  365

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSS  1414
               KEL   Y +E KW      PP  EY+ N   ++    L  +S LGMKS+ ++  EW S
Sbjct  366   AYKELTKGYYVEAKWFIRGYVPPFEEYLSNALVTAGSKYLHFSSLLGMKSIMKKDLEWLS  425

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
                ++I A   ++R++NDI+SY  EK     ATGI+ YM D GVT EEAM+KF EM  NA
Sbjct  426   TKRKMIVATQTISRLVNDISSY-VEKERGQPATGIECYMKDKGVTKEEAMDKFYEMATNA  484

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD+NE+ L    S  S ++ + +LNF RI DV YKNK+DGYT PEKVLKP I ++ V+ 
Sbjct  485   WKDSNEECLG--LSGNSRDVYIVVLNFNRIMDVTYKNKEDGYTQPEKVLKPHIIALFVDQ  542

Query  1775  FEI  1783
              +I
Sbjct  543   IDI  545



>sp|Q49SP5.1|TPGAS_POGCB RecName: Full=Germacrene A synthase; AltName: Full=PatTpsCF2 
[Pogostemon cablin]
 gb|AAS86321.1| germacrene A synthase [Pogostemon cablin]
Length=554

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/553 (50%), Positives = 379/553 (69%), Gaps = 7/553 (1%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             V  +E VRP  +F  +PSLWGD+F  +     +++  Y +EI+ LK +V  ML S    K
Sbjct  3     VQISETVRPFANFSPNPSLWGDQFINHKSKTQQISRIYLEEIEGLKNEVKCMLTSTPEGK  62

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQ  487
             +A+ +N IDT+ERLG+SYHF + I+E +++++N     N     G DL T AL FRL RQ
Sbjct  63    MADTVNLIDTLERLGVSYHFEKEIEEKMKHLFNLIKADNYKDHEGCDLYTDALHFRLFRQ  122

Query  488   HGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLE  664
             HGY ISSGIF+ + + NGKFK S+ +D KGLL+LYEA  L+ H D  L EA  F+   L+
Sbjct  123   HGYPISSGIFNKWMDGNGKFKESIKSDAKGLLSLYEACCLRTHGDTLLDEALVFATASLK  182

Query  665   VIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQ  844
              +   L+S L KQV HAL Q LH GIPRVE+ +FIT YEE+E KN++LLRFAKLDFN LQ
Sbjct  183   SMAANLASPLRKQVEHALFQHLHFGIPRVEARHFITFYEEEEHKNEMLLRFAKLDFNALQ  242

Query  845   MHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMA  1024
               HK+EL E  +WWK+LD ++ LPYARDR VE YFWA+GVY++ KYS+AR+ML K I M 
Sbjct  243   ALHKEELSEISKWWKDLDLISKLPYARDRVVESYFWAVGVYYQPKYSRARIMLTKTIAMT  302

Query  1025  SIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEG  1204
             +I DDTYDS+G  +EL++ T AI++WDI++ N LP ++K  YK ++ L+++ ++EL+KEG
Sbjct  303   AILDDTYDSYGTLEELDVLTKAIERWDIKEINGLPEYIKGFYKQVLKLYQQLEEELAKEG  362

Query  1205  RSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS  1384
             RS+AV+Y  E  KEL  SY +E KW  +   P   EY+ N   +ST   L   SF G++S
Sbjct  363   RSYAVYYAIEACKELARSYAVEAKWFKKGYLPGFEEYLINSLVTSTAGYLNIISFFGVES  422

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT+E FEW S+ PRI  A  ++ RVI+DIA+YE EK    +ATGID YM ++GV+ E+AM
Sbjct  423   VTKEDFEWFSKKPRIAVATQIITRVIDDIATYEVEKEKGQSATGIDCYMKEHGVSKEKAM  482

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
              +F EM  NAWKD NE+ L   PS+ S +I + + NF+R+ DV Y   +DGY+ PEK+LK
Sbjct  483   QRFYEMSTNAWKDINEEGL-SWPSSFSRDIFVQLRNFSRMVDVTYGKNEDGYSKPEKILK  541

Query  1745  PCIFSVLVNSFEI  1783
             P I ++ V+  ++
Sbjct  542   PLIIALFVDQIKL  554



>gb|EYU21989.1| hypothetical protein MIMGU_mgv1a023416mg [Erythranthe guttata]
Length=556

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/555 (50%), Positives = 383/555 (69%), Gaps = 14/555 (3%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKL  322
             V  NE+VRPV +F   PSLWGD F  +  D ++++ Y +EI+VLK +  +ML+S R +KL
Sbjct  8     VNKNEIVRPVANF--PPSLWGDVFNSYTMDIQLSDMYTEEIKVLKEEARNMLIS-RDSKL  64

Query  323   AEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQL--GDDLCTSALLFRLLRQHGY  496
             +EKL FIDT+ERLG+SYHF   I E L   +N +   +    DDL  ++L FRLLRQH  
Sbjct  65    SEKLAFIDTLERLGLSYHFENEIQEQLTLAFNGHLKLEPEENDDLFINSLQFRLLRQHAL  124

Query  497   NISSGIFDNFQEN-GKFK-SSLS---NDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL  661
             +  S +F+   EN G+FK SSL    +DVKGLL++YEAS+L+  ++  L +A++FSK HL
Sbjct  125   DAPSSVFERLVENNGEFKKSSLVRDIDDVKGLLSIYEASYLRRTDEEILDKAFSFSKAHL  184

Query  662   EVIGPQL-SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNL  838
             E + P L  S+L K V  AL QS   GIPRVE+  FI++Y E ESKN+ LLR AKLDFNL
Sbjct  185   ESVAPNLPESSLKKHVSRALYQSHVRGIPRVETHLFISLYGEFESKNESLLRLAKLDFNL  244

Query  839   LQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIIT  1018
             LQM HK EL E  RWWKE+D ++ L +ARDRAVECYFW +GVY E +Y  AR+MLAK I 
Sbjct  245   LQMQHKMELSEVTRWWKEVDLISKLSFARDRAVECYFWTVGVYSEPQYGIARIMLAKTIC  304

Query  1019  MASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSK  1198
             M S+ DDT+D++G  DEL +F DA+QKWDI + +RLP +M+I+Y+ L+DL+E FD ELS 
Sbjct  305   MISVIDDTFDAYGTIDELTVFNDAVQKWDISEIDRLPEYMQILYRVLLDLYESFDAELSP  364

Query  1199  EGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM  1378
             +GRS+AVH+ KE ++++V SY  E KW  +   P   EY+   + +ST Y+L T S +GM
Sbjct  365   KGRSYAVHHAKEAMQQIVGSYYTEAKWFIKGHLPTFDEYMSVAKITSTYYVLTTTSLIGM  424

Query  1379  KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
              + T + F+W    P+I+EAN  + RV++D+ +YE EK     ATGID YM ++G++ E 
Sbjct  425   DNATSQVFDWLLSKPKIVEANVTICRVVDDVGTYEVEKGRGQEATGIDCYMKEHGLSTEV  484

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
              ++ F EM ENAWK+ NE ++    ++V+ EI + I N AR+ DV Y +  DGYT+PEK+
Sbjct  485   TIDLFYEMAENAWKELNEGLM---DNSVTMEIRMRIFNLARLIDVTYTHNGDGYTHPEKL  541

Query  1739  LKPCIFSVLVNSFEI  1783
             LKP I ++LV+SFE+
Sbjct  542   LKPSIVALLVDSFEV  556



>gb|AAK15642.1|AF326118_1 sesquiterpene cyclase [Capsicum annuum]
Length=556

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/560 (52%), Positives = 374/560 (67%), Gaps = 35/560 (6%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFR------------YFVFDNEVAERYAQEIQVLKGQVMSML  298
             E+VRPV    FSPS+WGD                 +F  +++ +YA+  + LK       
Sbjct  15    EIVRPVA--DFSPSIWGDRISSERPVLISQIGCRSIFSVDISRKYARRDETLK-------  65

Query  299   VSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLF  472
              +   + L   +N ++ +  LG  YH  ++ D     IY A+P+ Q  D  DLCT ++ F
Sbjct  66    TTRYVSALGHDVNDLNLVSLLG--YHLRQIED--CGQIYKADPS-QAHDYNDLCTLSVQF  120

Query  473   RLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             R+LR HGYN+S  IF  FQ+ NGK ++  S+D++ LLNLYEASH++ H +  L+ A  FS
Sbjct  121   RILRLHGYNVSPKIFSRFQDANGKLRNPFSSDIRSLLNLYEASHVRTHGEDILEAALVFS  180

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
               HLE   P L S L K+V HALD+SLH  IPRVE +        +  +  VLLRF +LD
Sbjct  181   TAHLESAAPHLKSPLSKEVTHALDESLHKSIPRVEDALLHLCLGRN-LRVMVLLRFEQLD  239

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             FNLLQM HKQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY E +YS+AR+MLAK
Sbjct  240   FNLLQMLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTVGVYAEPQYSQARVMLAK  299

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
              I M SI DDT+D++G   EL+++TDAIQ+WDI Q +RLP +MKI YK L+DL+ +++ E
Sbjct  300   TIAMISIVDDTFDAYGIVKELDVYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYEME  359

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASS-TLYLLITAS  1366
             LSK+GRS  VH+ KER+KE+V +Y +E KW  E   PPV+EY+ N  A+S T YLL T S
Sbjct  360   LSKDGRSDVVHWAKERMKEIVRNYFVEAKWFIEDYMPPVSEYLSNALATSKTYYLLTTTS  419

Query  1367  FLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             +LGMK  T+E F+W + NP+I+EAN  L R I  +A+YE EK     ATGI+ YM DYGV
Sbjct  420   YLGMKCATKEDFDWLANNPKILEANVTLCRCIV-LATYEVEKGRGQVATGIECYMRDYGV  478

Query  1547  TAEEAMNK-FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYT  1723
             + E AM K FEEM E  WKD NE ILRP P  VSTEIL  ILN ARI DV YK+ QDGYT
Sbjct  479   STEVAMGKNFEEMAETGWKDVNEGILRPTP--VSTEILTRILNLARIIDVTYKHNQDGYT  536

Query  1724  NPEKVLKPCIFSVLVNSFEI  1783
             +PEKVLKP I ++LV+S EI
Sbjct  537   HPEKVLKPHIIALLVDSIEI  556



>gb|EYU21954.1| hypothetical protein MIMGU_mgv1a023164mg [Erythranthe guttata]
Length=550

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/560 (51%), Positives = 381/560 (68%), Gaps = 31/560 (6%)
 Frame = +2

Query  137   KMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSA  316
             K     E+VRP  +F  SPSLWGD F      + V+  Y Q    L  +V  ++  IR+ 
Sbjct  7     KTFQQEEIVRPAANF--SPSLWGDLF------SSVSTDYNQ---ALNDEVRGLI--IRNE  53

Query  317   KLA-EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHG  493
              LA EKLN ID++ERLGISYHF + I++ ++  Y +      GD L T AL FRLLRQHG
Sbjct  54    MLAAEKLNLIDSIERLGISYHFEKEIEQQIQ--YLSLEKIDDGD-LHTVALYFRLLRQHG  110

Query  494   YNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL---  661
             ++ISSGIF+ F E +GKFKS L ND +GLL+L+EA++L+ H +  L+EA +F+  HL   
Sbjct  111   HHISSGIFEKFTETDGKFKSCLENDTRGLLSLFEAANLRTHGEDILEEALSFTTCHLIKS  170

Query  662   -------EVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
                    +     +SS L +++ HAL+Q +  GIPRVE+  +I++YE+ ESKND LLR A
Sbjct  171   INNNNNNQHNSMIISSPLKEEIEHALEQCMQRGIPRVEAHRYISIYEQFESKNDSLLRLA  230

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFN +QM H++EL E  RWWKELD V+ L Y RDR VECYFW LGVY+E KYS+AR+M
Sbjct  231   KLDFNSVQMLHRKELCELSRWWKELDLVSKLSYVRDRVVECYFWTLGVYYEPKYSRARIM  290

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             LAK I M S+ DDTYDS+G  DEL+IFTDAI++WDI++  +LP +MKI YK ++DL+E++
Sbjct  291   LAKTIAMISVIDDTYDSYGTVDELQIFTDAIERWDIKEMQKLPDYMKICYKAVLDLYEQY  350

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCT-ERCTPPVAEYIKNGQASSTLYLLI  1357
             D+ELS + RSFAVHY K  +KE+V SYNIE KW   E   P  ++Y  NG  +ST YLL 
Sbjct  351   DEELSDQERSFAVHYAKATMKEIVRSYNIESKWFNMEGYMPSFSDYKTNGFITSTYYLLA  410

Query  1358  TASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
               SF+GM S ++EAF+W    P+I  AN  + R ++DIA+YE EK    + TGI+ YM +
Sbjct  411   ATSFIGMTSASKEAFDWLINKPKIQVANVTICRFVDDIATYEIEKKRGQSGTGIECYMKE  470

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             YGV+ EEAM +F  + E AWKD N +I      +VS EIL  I+N +R+ DVVYK+ QDG
Sbjct  471   YGVSEEEAMKEFNNIAEKAWKDINGEIFN--EKSVSVEILKRIVNLSRLIDVVYKHNQDG  528

Query  1718  YTNPEKVLKPCIFSVLVNSF  1777
             YTNPEK+LKP I ++L+  F
Sbjct  529   YTNPEKLLKPLITALLIVPF  548



>gb|AGN72803.1| germacrene A [Lavandula stoechas]
Length=542

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/545 (50%), Positives = 370/545 (68%), Gaps = 11/545 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E++RP+ +F  SPSLWGD+F     D++   RY      +    +SML +    K+ + +
Sbjct  7     EILRPLANF--SPSLWGDQF--IKNDSDAKVRYI--FHYVDYTNLSMLTAT-GTKMVDTM  59

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSG  511
             N IDT+ERLG+SYHF   I+E+L+  +N N ++     DL T A  FRL RQHG+ I+  
Sbjct  60    NLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVATHFRLFRQHGHRITCD  119

Query  512   IFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             IF  ++ ENGKF   L +D KGLL+LYEAS+L+   +  L EA  F+   L+ I P L S
Sbjct  120   IFGRWRDENGKFHEGLKDDAKGLLSLYEASYLRTRGETILDEALDFTTASLKSIAPNLES  179

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L +QV HAL Q LH G PR+E+  FI++YEE E K++ LLRFAKLD+NLLQM HK+EL+
Sbjct  180   PLRRQVEHALVQQLHWGNPRIEARNFISLYEEYEDKDESLLRFAKLDYNLLQMMHKEELH  239

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWKELD V  LPYARDR VEC+FWA+GVY E +YS+AR+ML K I M SI DDTYD
Sbjct  240   EVSRWWKELDLVAKLPYARDRVVECFFWAMGVYHEPQYSRARVMLTKTIAMTSIIDDTYD  299

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G  +EL+IFT+AI++W++ +  RLP ++K  YK L++L+E+F++EL+KEGRS+A HY 
Sbjct  300   AYGTIEELDIFTEAIERWNVEEMKRLPEYIKPFYKALLELYEQFEEELAKEGRSYATHYA  359

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              E +KELV SY++E KW  +   PP  EY+KN   + T     T S LG++S  RE FEW
Sbjct  360   IESLKELVRSYHVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFEW  419

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S+ P+++ A  L+ RVI+DIA+YE EK     ATGI+ YM D G T EEA+ KF E+  
Sbjct  420   LSKKPKMLVAGLLICRVIDDIATYEVEKDRGQIATGIESYMRDNGATKEEAITKFFEIAN  479

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             +AWKD NE+ +RP P   S ++L+ ILN  RI DV YK  +DGYT PEKVLKP I ++ V
Sbjct  480   DAWKDINEECMRPSPH--SRDVLMRILNLERIIDVTYKGNEDGYTQPEKVLKPHIIALFV  537

Query  1769  NSFEI  1783
             +  +I
Sbjct  538   DPIQI  542



>ref|XP_009764783.1| PREDICTED: viridiflorene synthase-like [Nicotiana sylvestris]
Length=488

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/488 (55%), Positives = 350/488 (72%), Gaps = 6/488 (1%)
 Frame = +2

Query  263   IQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG  442
             ++ +K +  SML++     + EKLN ID +ERLGI+YHF + ID ML +I+NA+P+F+  
Sbjct  1     METMKEKTRSMLLAC-GKTVYEKLNLIDIIERLGIAYHFEKQIDNMLYHIHNADPDFEGH  59

Query  443   D--DLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGH  613
             +  DL   AL FR+LRQHGYNIS G+F  FQ  NG+FK SLS DV G++ LYEASH++ H
Sbjct  60    EYNDLYICALQFRMLRQHGYNISPGVFRKFQYGNGQFKRSLSTDVLGMVCLYEASHVRTH  119

Query  614   NDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDES  793
              +  L EA  F+ THL+     L S L KQV HAL+QSL  GIPR E  Y+I+ Y+E ES
Sbjct  120   GEYILDEALAFTTTHLQSTVQHLKSALKKQVTHALEQSLQKGIPRAEIRYYISNYDEGES  179

Query  794   KNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFE  973
             KNDVLLRFAKLDFNLLQM +K EL E  RWWK+L+F+TTLPYA+DR +EC+FW +GVYFE
Sbjct  180   KNDVLLRFAKLDFNLLQMLYKNELGEISRWWKDLNFMTTLPYAKDRIIECHFWTVGVYFE  239

Query  974   AKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYK  1153
              +YS+AR+MLAK I M SI  DT+++     EL+I+TDAIQ+WDI Q + LP +MK+ YK
Sbjct  240   PQYSQARIMLAKTIAMISIVYDTFNASDILKELDIYTDAIQRWDINQIDELPNYMKLSYK  299

Query  1154  TLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQA  1333
              L+DL+E+++KEL+K+GRS  VHY KER+KE+V SY +E  W  +   P V++Y+ N  A
Sbjct  300   ALLDLYEDYEKELAKDGRSSVVHYAKERMKEVVRSYYVEKIWFIKGYMPHVSQYLNNALA  359

Query  1334  SSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNAT  1513
             +ST YLL T S LGMKS   E FEW S+NP+ +E N  L RV++DIASYE EK     AT
Sbjct  360   TSTYYLLATTSCLGMKSAIEEDFEWLSKNPKFLETNATLCRVVDDIASYEVEKGRGQIAT  419

Query  1514  GIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDV  1693
              I+ YM DYGV  EE M+KF+EM+E AWKD N+ IL+  P+ V  EIL  ILN AR+ DV
Sbjct  420   RIECYMRDYGVLTEELMDKFQEMIEIAWKDVNKGILK--PTHVPMEILNRILNLARVIDV  477

Query  1694  VYKNKQDG  1717
              YK+ Q+ 
Sbjct  478   TYKHNQNA  485



>gb|AGN72806.1| germacrene A [Lavandula viridis]
Length=543

 Score =   534 bits (1376),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 370/546 (68%), Gaps = 12/546 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E++RP+ +F  SPSLWGD+F     D++   RY      +    +SML +    K+ + +
Sbjct  7     EILRPLANF--SPSLWGDQF--IKNDSDAKVRYI--FHYVDYTNLSMLTAT-GTKMVDTM  59

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSG  511
             N IDT+ERLG+SYHF   I+E+L+  +N N ++     DL T A  FRL RQHG+ I+  
Sbjct  60    NLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVATHFRLFRQHGHRITCA  119

Query  512   -IFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF  ++ ENGKF   L +D KGLL+LYEAS+L+   +  L EA  F+   L+ I P L 
Sbjct  120   DIFGRWRDENGKFHEGLKDDAKGLLSLYEASYLRTRGETILDEALDFTTASLKSIAPNLE  179

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             S L +QV HAL Q LH G PR+E+  FI++YEE E K++ LLRFAKLD+NLLQM HK+EL
Sbjct  180   SPLRRQVEHALVQQLHWGNPRIEARNFISLYEEYEDKDESLLRFAKLDYNLLQMMHKEEL  239

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             +E  RWWKELD V  LPYARDR VEC+FWA+GVY E +YS+AR+ML K I M SI DDTY
Sbjct  240   HEVSRWWKELDLVAKLPYARDRVVECFFWAMGVYHEPQYSRARVMLTKTIAMTSIIDDTY  299

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G  +EL+IFT+AI++W++ +  RLP ++K  YK L++L+E+F++EL+KEGRS+A HY
Sbjct  300   DAYGTIEELDIFTEAIERWNVEEMKRLPEYIKPFYKALLELYEQFEEELAKEGRSYATHY  359

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
               E +KELV SY++E KW  +   PP  EY+KN   + T     T S LG++S  RE FE
Sbjct  360   AIESLKELVRSYHVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFE  419

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W S+ P+++ A  L+ RVI+DIA+YE EK     ATGI+ YM D G T EEA+ KF E+ 
Sbjct  420   WLSKKPKMLVAGLLICRVIDDIATYEVEKDRGQIATGIESYMRDNGATKEEAITKFFEIA  479

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ +RP P   S ++L+ ILN  RI DV YK  +DGYT PEKVLKP I ++ 
Sbjct  480   NDAWKDINEECMRPSPH--SRDVLMRILNLERIIDVTYKGNEDGYTQPEKVLKPHIIALF  537

Query  1766  VNSFEI  1783
             V+  +I
Sbjct  538   VDPIQI  543



>gb|EYU21983.1| hypothetical protein MIMGU_mgv1a023510mg [Erythranthe guttata]
Length=559

 Score =   535 bits (1377),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 387/567 (68%), Gaps = 23/567 (4%)
 Frame = +2

Query  122   TSEILKMVTN--NEVVRPVTSFQFSPSLWGDEFRYF-VFDNEVAERYAQEIQVLKGQVMS  292
             +SE+ +   N  N++VRPVT+  F PSLW   F  F + D ++++ Y +EI+VLK +  +
Sbjct  3     SSEVKRPTVNSENDIVRPVTA-NFPPSLWDGLFSSFNMEDFQLSDTYTEEIKVLKEETRN  61

Query  293   MLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG----DDLCTS  460
             M+VS  S KL+EKL  IDT+ERLG+SYHF   I + L   +N +  F+L     DDL   
Sbjct  62    MIVSGDS-KLSEKLVLIDTIERLGLSYHFENEIQQQLTLAFNGH--FKLDPEEEDDLFII  118

Query  461   ALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSL---SNDVKGLLNLYEASHLKGHNDANL  628
             AL FRLLRQ   +  S IF+ F EN G+FK SL   ++D KG+L+LYEAS+L+   +  L
Sbjct  119   ALQFRLLRQRALDAPSSIFNRFTENNGEFKKSLVDSNDDTKGVLSLYEASYLRRQGEEIL  178

Query  629   KEAYTFSKTHLEVIGPQLS-STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDV  805
              +A+TF K +LE I P L  S L KQV HALDQSL   IPRVES YFI++Y+E + KN+ 
Sbjct  179   DKAFTFCKANLESIAPNLPESPLKKQVLHALDQSLFRSIPRVESHYFISLYDESKPKNES  238

Query  806   LLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYS  985
             LLR AKLDFNLLQM HK+ELYE MRWWK    V+ + YARDR VECYFWALG+Y E +YS
Sbjct  239   LLRLAKLDFNLLQMLHKKELYEVMRWWKT---VSRVSYARDRIVECYFWALGIYSEPQYS  295

Query  986   KARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLID  1165
              AR++LAK I + +I DDTYDS+G  +EL +FTDAIQKWDI + +RLP +MKI Y+ L+D
Sbjct  296   SARIILAKTIAVITIIDDTYDSYGTVEELHVFTDAIQKWDISEIDRLPDYMKICYRALLD  355

Query  1166  LFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTER-CTPPVAEYIKNGQASST  1342
             L+E FD ELS +GRS+AVHY KE  KE+V SY  E KW  +R   P   EY++  + +  
Sbjct  356   LYESFDAELSPKGRSYAVHYAKEAAKEIVRSYYAEAKWFVKRDHLPAFDEYMRQAEITCG  415

Query  1343  LYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGID  1522
              Y L   SF+GM++ T E F+W    P+I+ A+  + R+I+DI++YE EK      TGID
Sbjct  416   CYYLTVTSFVGMENATIEVFDWLLARPKILRADNKVTRIIDDISTYEDEKKRGQATTGID  475

Query  1523  YYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYK  1702
              YMN++GV+ + AM +  E+ E  WKD NE  L    ++VS EIL+ + N+AR+ ++ YK
Sbjct  476   CYMNEHGVSKQVAMQRLNEIAEIGWKDLNEGFL---DNSVSMEILVRVFNWARVAEITYK  532

Query  1703  NKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             ++QDGYT+ EK LKP I ++LV+SFEI
Sbjct  533   HEQDGYTHSEKGLKPHIIALLVHSFEI  559



>ref|XP_006354694.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=554

 Score =   534 bits (1375),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 264/546 (48%), Positives = 373/546 (68%), Gaps = 5/546 (1%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             N + RP  +F  SPS+WG+ FR    DN+++E+  +EI+ LK +V  M++S  S  + +K
Sbjct  12    NGIFRPEANF--SPSMWGNVFRNSTKDNQISEKVVEEIEALKEEVKHMIISTTSNDIEQK  69

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             ++ IDT+ERLGI YHF + I+  L  I++ N      DDL   +L FRL RQHGY ISS 
Sbjct  70    VHLIDTLERLGIYYHFEKEIEHQLSKIFDLNF-IHEEDDLYNVSLYFRLFRQHGYPISSD  128

Query  512   IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ-LS  685
              F+ F++ NGKFK +L  DVKG+L+LYEA+H++ H DA L+EA  F+  HLE I P  L 
Sbjct  129   CFNQFKDTNGKFKKTLLRDVKGMLSLYEAAHVRKHGDATLEEALIFATFHLERITPNTLD  188

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             STL KQV HAL QS H GIPR E+ + I++YEE  S+N+ LLR AKLD+NL+Q+ HK+EL
Sbjct  189   STLEKQVTHALMQSHHRGIPRAEAHFNISIYEECGSRNEKLLRLAKLDYNLVQVLHKEEL  248

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  +WWK+LDF + L Y RDR VECYFW +GVYFE +YS+AR+MLAK I M S+ DDTY
Sbjct  249   SELTKWWKDLDFASKLSYVRDRMVECYFWTVGVYFEPQYSQARVMLAKCIAMISVIDDTY  308

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             DS+G  DEL IFT+ + +WDI + +RLP +MK IY +L+DLF E+++E++++ R   V+Y
Sbjct  309   DSYGTLDELIIFTEVVDRWDISEVDRLPNYMKPIYTSLLDLFNEYEREINEQDRFNGVNY  368

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KE +KE+V SY IE +W  E   P   +Y+ N   + T YLL  AS LGMKS +++ F+
Sbjct  369   VKEAMKEIVRSYYIEAEWFIEGKIPSFKDYLNNALVTGTYYLLAPASLLGMKSTSKKTFD  428

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W    P+I+ A+ ++ RVI+DIA+Y+ EK      TGI+ YM +  ++ EEA  +  E+ 
Sbjct  429   WMMNKPKILVASAIIGRVIDDIATYKIEKEKGQLVTGIECYMQENNLSVEEASAQLSEIA  488

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD N++ ++   S +  EIL+ ++N  R+ DVVYKN QDGY+NP+  +K  I ++L
Sbjct  489   EIAWKDLNKECIKTTTSNMPNEILMRVVNLTRLIDVVYKNNQDGYSNPKNNVKSVIEALL  548

Query  1766  VNSFEI  1783
             VN  ++
Sbjct  549   VNPIDM  554



>gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 265/545 (49%), Positives = 363/545 (67%), Gaps = 9/545 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFI  343
             RPV  F  SPSLWGD+F       +V ++Y+  + VLK +V  M ++    K+ + +  I
Sbjct  10    RPVADF--SPSLWGDQFIKHDSCPQVEKKYSNTVDVLKKEVKGM-ITAPGTKMVDTMELI  66

Query  344   DTMERLGISYHFHEMIDEMLENIYNANPNFQLGDD----LCTSALLFRLLRQHGYNISSG  511
             DT+ERLG+SYHF + I+  L+  ++  P++   DD    L T AL FRL RQHGY IS  
Sbjct  67    DTIERLGVSYHFQDEIEHKLQQFFDLKPDYCNDDDDAYDLHTVALHFRLFRQHGYRISCD  126

Query  512   IFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             IF  +   +GKF+  L +D KGLL+LYEAS+L+   +  L EA  F+   L+ I P L S
Sbjct  127   IFGRWVHGDGKFEEILKSDGKGLLSLYEASYLRTRGETILDEALDFATASLKSIAPCLES  186

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              LGKQV HAL Q LH G PR+E+  FI++YEE E +N+ LL FAK+D+NLLQM HK+EL+
Sbjct  187   PLGKQVVHALVQPLHFGTPRIEARNFISIYEEYEGRNESLLMFAKIDYNLLQMLHKEELH  246

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWKELD +  LPYARDR VEC+FWA+G Y E +YS+AR+ML K I M SI DDTYD
Sbjct  247   QVSRWWKELDLIAKLPYARDRVVECFFWAIGAYHEPQYSRARVMLTKTIAMTSIIDDTYD  306

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   EL+IFT+AI++W++++T RLP +MK +YK L++L+++F++EL  EGRS+  +Y 
Sbjct  307   AYGTIKELDIFTEAIERWNVKETKRLPEYMKPLYKALLELYQQFEQELENEGRSYVAYYA  366

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              E +KELV SY +E KW  +   PP  EY+KN   + +       SFLG++S  +E FEW
Sbjct  367   IESLKELVRSYRVEAKWFIQGYLPPFEEYLKNALITCSYCYHTMTSFLGVESAIKEDFEW  426

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S  P+++ A  L+ R+++DIA+YE EK     ATGI+ YM D G T EEAM KF E+  
Sbjct  427   LSNKPKMLVAGLLICRLVDDIATYEVEKARGQVATGIESYMKDNGATKEEAMAKFFEIAR  486

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             +AWKD NE+ LRP     S ++ + ILN  RI  V YK+ QDGYT PEKVLKP I ++ V
Sbjct  487   DAWKDINEECLRP-NLYNSRDVWMRILNLERIIHVAYKDSQDGYTQPEKVLKPHIIALFV  545

Query  1769  NSFEI  1783
             +  +I
Sbjct  546   DPIQI  550



>gb|AAG17667.1|AF272244_1 5-epi-aristolochene synthase, partial [Nicotiana tabacum]
Length=441

 Score =   523 bits (1347),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 264/444 (59%), Positives = 335/444 (75%), Gaps = 5/444 (1%)
 Frame = +2

Query  458   SALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKE  634
             SAL FRLLRQHG+NIS  IF  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++
Sbjct  1     SALQFRLLRQHGFNISPEIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILED  60

Query  635   AYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLL  811
             A  FS  HLE   P L S L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKNDVLL
Sbjct  61    ALAFSTIHLESAVPHLKSPLREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNDVLL  120

Query  812   RFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKA  991
             RFAKLD+NLLQM HKQEL E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+A
Sbjct  121   RFAKLDYNLLQMLHKQELAEVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQA  180

Query  992   RLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLF  1171
             R+ML K I+M SI DDT+D++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+
Sbjct  181   RVMLVKTISMISIVDDTFDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLY  240

Query  1172  EEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYL  1351
             ++++K+LS    S  V +  ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y 
Sbjct  241   KDYEKDLSV-PESHIVCHAIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYY  299

Query  1352  LITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYM  1531
             L T S+LGMKS T + FEW S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M
Sbjct  300   LATTSYLGMKSATEQDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCM  359

Query  1532  NDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQ  1711
              DYG++ +EAM KF+ M E AWKD NE +LRP P  VSTE L  ILN ARI +V Y +  
Sbjct  360   RDYGISTKEAMAKFQNMAETAWKDINEGLLRPTP--VSTEFLTPILNLARIVEVTYIHNL  417

Query  1712  DGYTNPEKVLKPCIFSVLVNSFEI  1783
             DGYT+PEKVLKP I ++LV+S +I
Sbjct  418   DGYTHPEKVLKPHIIALLVDSIDI  441



>gb|EYU43546.1| hypothetical protein MIMGU_mgv1a002915mg [Erythranthe guttata]
Length=626

 Score =   525 bits (1352),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 274/553 (50%), Positives = 373/553 (67%), Gaps = 17/553 (3%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             +VRPV +  F PSLWG  F  F  D ++ + Y +EI+VLK +  +ML+S   +KL+EKL 
Sbjct  80    IVRPVVA-NFPPSLWGGLFSSFNMDIQLLDMYTKEIEVLKEEARNMLIS-GDSKLSEKLV  137

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNIS  505
              IDT+ERLG+SYHF   I + L   +N   + +L     DDL   AL FRLLRQHG +  
Sbjct  138   LIDTIERLGLSYHFENEIQQQLSLAFNGG-HLKLENEESDDLFIVALQFRLLRQHGMDAP  196

Query  506   SGIFDNFQEN-GKFKSSLS---NDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
             S IF  F EN GKFK ++    ++VKG+L+LYEA++L+   +  + +A++FSK HLE + 
Sbjct  197   SSIFKRFTENNGKFKKTVVSNIDEVKGVLSLYEATYLRRQGEEIMDKAFSFSKAHLEFVA  256

Query  674   PQLS-STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMH  850
             P L+ S L KQV HALDQS   GIPRVES  FI++YE+DES ++ LLR AKLDFNLLQMH
Sbjct  257   PNLTESPLKKQVLHALDQSFFRGIPRVESRNFISLYEQDESNSESLLRLAKLDFNLLQMH  316

Query  851   HKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY-FEAKYSKARLMLAKIITMAS  1027
             HK+EL + MRWWKE+D ++ L YARDR VE YFW LG+Y  E ++S AR++LAK   M S
Sbjct  317   HKEELCQVMRWWKEMDLISRLSYARDRVVELYFWTLGIYPPEPRHSNARIILAKTAAMIS  376

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             + DDTYD++G  +EL++FT+AIQKWDI + +RLP +MKI+Y  ++DL+E FD ELS +GR
Sbjct  377   VIDDTYDTYGTIEELQVFTEAIQKWDISEMDRLPNYMKILYGAVLDLYEAFDAELSPKGR  436

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTP-PVAEYIKNGQASSTLYLLITASFLGMKS  1384
             SFAVHY +E +KELV  Y +E KW TE   P    EY+ N   ++     +  SF+    
Sbjct  437   SFAVHYAREAMKELVKCYYVEAKWFTEGYLPSSFDEYMSNAMTTAATDAAVVTSFISSAI  496

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
                E F+W    P+I++   L+ RVI+DIA+YE E        GID Y  ++GV+ + A+
Sbjct  497   AKIEVFDWLLAKPKILQVVNLIVRVIDDIATYELENGRGQVTIGIDCYKKEHGVSTQVAL  556

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
               F E+ EN+WKD N+ ++    + VS EIL+ + NFA++ DV YK+ QDGYTNPEKVLK
Sbjct  557   KHFNEIAENSWKDLNDGLM---DNRVSKEILVQVFNFAKLMDVTYKHNQDGYTNPEKVLK  613

Query  1745  PCIFSVLVNSFEI  1783
             P I ++LV+S EI
Sbjct  614   PHILALLVHSCEI  626



>gb|EYU32628.1| hypothetical protein MIMGU_mgv1a005108mg [Erythranthe guttata]
Length=496

 Score =   516 bits (1330),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 260/498 (52%), Positives = 346/498 (69%), Gaps = 4/498 (1%)
 Frame = +2

Query  296   LVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD-DLCTSALLF  472
             ++  +  K+ + LN IDT+ERLGISYHF + I+E L+  +N + N++    DL T +L F
Sbjct  1     MLKAKETKIFDGLNLIDTIERLGISYHFEDEIEEKLQQYFNMDTNYEDKTYDLYTVSLHF  60

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             R+ RQHG+ ISS IF  F +  GKFK  + +D KGLL+LYEAS+L+ H +  L++A  F+
Sbjct  61    RVFRQHGHRISSDIFRKFMDGEGKFKEVIKSDAKGLLSLYEASYLRVHEEDILEDALAFA  120

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
              ++L+ I P LSS L + V HAL Q LH G PR+E+  FI+ YE+DE+KN+ LLRFAKLD
Sbjct  121   TSNLKFIAPNLSSPLREYVFHALVQPLHFGNPRIEARNFISFYEQDENKNETLLRFAKLD  180

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             +NLLQ  HK EL E  RWWKELD V+ LPYARDR VECYFWA+GVY E +YS+AR+ML K
Sbjct  181   YNLLQTLHKDELREVSRWWKELDLVSKLPYARDRVVECYFWAMGVYHEPQYSRARVMLTK  240

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
              I M SI DDTYD++G  +EL IFTDAI+KWDI Q +RLP ++K  Y  L+DL+ +F+KE
Sbjct  241   TIIMTSIIDDTYDAYGVIEELNIFTDAIEKWDISQIDRLPEYIKPFYSALLDLYVQFEKE  300

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASF  1369
             L +EGRS+A+ Y KE +KELV SY++E KW  E   PP  EY+ N   + T     T + 
Sbjct  301   LEQEGRSYAITYAKESLKELVRSYHVEAKWFIEGYLPPFNEYLDNALITCTYCYHTTTAL  360

Query  1370  LGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVT  1549
             LG KS     FEW SQ P+++ A+  + R+I+DIA+YE EK     ATGI+ YM ++G T
Sbjct  361   LGTKSANEPDFEWLSQKPKMLVASLKICRLIDDIATYEVEKARGQIATGIESYMKEFGAT  420

Query  1550  AEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
              EEAM+KF E+  N+WKD NE+ L+  PS+    +L+ ILN  RI DV YKN +DGYT P
Sbjct  421   KEEAMDKFFEIATNSWKDMNEECLK--PSSHPRNVLMRILNLERIIDVTYKNNEDGYTQP  478

Query  1730  EKVLKPCIFSVLVNSFEI  1783
             EKVLKP I ++ V+  +I
Sbjct  479   EKVLKPHIVALFVDPIKI  496



>gb|AAX16077.1| valencene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   514 bits (1323),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 263/535 (49%), Positives = 357/535 (67%), Gaps = 9/535 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFI  343
             RPV  F  SPSLWGD+F  +    +V ++Y+  + VLK +V  M ++    K+ + +  I
Sbjct  10    RPVADF--SPSLWGDQFVKYDSCPQVQKKYSNTVDVLKKEVKGM-ITAPGTKMVDTMELI  66

Query  344   DTMERLGISYHFHEMIDEMLENIYNANPNF-QLGDD---LCTSALLFRLLRQHGYNISSG  511
             DT+ERLG+S+HF + I++ L+  ++   ++   GDD   L T AL FRL RQHGY IS  
Sbjct  67    DTIERLGVSFHFQDEIEQKLQQFFDLKTDYCNDGDDAYDLYTVALHFRLFRQHGYRISCD  126

Query  512   IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             IF  + + NGKFK  L +D K LL+LYEAS+L+   +  L EA  F+   L+ I P L S
Sbjct  127   IFGRWIDGNGKFKEGLKSDGKSLLSLYEASYLRTRGETILDEALDFAAASLKSIAPHLQS  186

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              LGKQV HAL Q LH G PR+E+  FI++YEE E  N+ LLR AKLD+NLLQM HK+EL+
Sbjct  187   PLGKQVVHALVQPLHFGNPRIEARNFISIYEEYEGMNEALLRLAKLDYNLLQMLHKEELH  246

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LD +T LPYARDR VEC+FWA+GVY E +YS+AR+ML K I M SI DDTYD
Sbjct  247   QVSRWWKDLDLITKLPYARDRVVECFFWAVGVYHEPQYSRARVMLTKTIVMTSIIDDTYD  306

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G  +EL+IFT+AI++W++ +T RLP +MK +YK L++L+++F++EL KEGRS+  +Y 
Sbjct  307   AYGTIEELDIFTEAIERWNVEETKRLPEYMKPLYKALLELYKQFEQELEKEGRSYVAYYA  366

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              E +KELV SY IE KW  +   PP  EY+KN   + T     T S LG++S  +E FEW
Sbjct  367   IESLKELVRSYRIEAKWFIQGYLPPYEEYLKNALITCTYCYHTTTSLLGVESAIKENFEW  426

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              S  P+++ A  L+ R+I+DIA+Y  E+     ATGI+ YM D G T EE + K  E+  
Sbjct  427   LSNKPKMLVAGLLICRLIDDIATYILERGRGQVATGIESYMKDNGATQEEPIAKIFEIAT  486

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
             +AWKD N++ LRP     S ++L+ I N  RI DV YK  QD YT PEKVLKP I
Sbjct  487   DAWKDINDECLRP-SLYNSRDVLMRIFNLERIIDVTYKGNQDRYTQPEKVLKPHI  540



>ref|XP_004237611.1| PREDICTED: vetispiradiene synthase 2 [Solanum lycopersicum]
 gb|AEP82775.1| terpene synthase [Solanum lycopersicum]
Length=554

 Score =   508 bits (1308),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 260/542 (48%), Positives = 368/542 (68%), Gaps = 5/542 (1%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             N + RP  +F  SPS+WG+ FR    DN+++E   +EI+ LK  V  M++S  S  + +K
Sbjct  12    NGIFRPEANF--SPSMWGNIFRDSSKDNQISEEVVEEIEALKEVVKHMIISTTSNAIEQK  69

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             ++ IDT+ERLGI YHF + I++ L  +++ N      DDL   AL FRL RQHGY ISS 
Sbjct  70    IHLIDTLERLGIYYHFEKEIEDQLSKMFDQNL-IHEEDDLYKVALYFRLFRQHGYPISSD  128

Query  512   IFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLS  685
              F+ F++  GKFK +L  DVKG+L+LYEA+H++ H D  L+EA  F+  HLE I P  L 
Sbjct  129   CFNQFKDTKGKFKKTLLIDVKGMLSLYEAAHVREHGDDILEEALIFATFHLERITPNSLD  188

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             STL KQV HAL QSLH GIPR E+ + I++YEE  S N+ LLR AKLD+NL+Q+ HK+EL
Sbjct  189   STLEKQVGHALMQSLHRGIPRAEAHFNISIYEECGSSNEKLLRLAKLDYNLVQVLHKEEL  248

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  +WWK+LDF + L Y RDR VEC+FW +GVYFE +YS+AR+MLAK I M S+ DDTY
Sbjct  249   SELTKWWKDLDFASKLSYVRDRMVECFFWTVGVYFEPQYSRARVMLAKCIAMISVIDDTY  308

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             DS+G  DEL IFT+ + +WDI + +RLP +MK IY +L+ LF E+++E++++ R   V+Y
Sbjct  309   DSYGTLDELIIFTEVVDRWDISEVDRLPNYMKPIYISLLYLFNEYEREINEQDRFNGVNY  368

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KE +KE+V SY IE +W  E   P   EY+ N   + T YLL  AS LGM+S ++  F+
Sbjct  369   VKEAMKEIVRSYYIEAEWFIEGKIPSFEEYLNNALVTGTYYLLAPASLLGMESTSKRTFD  428

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W  + P+I+ A+ ++ RVI+DIA+Y+ EK      TGI+ YM +  ++ E+A  +  E+ 
Sbjct  429   WMMKKPKILVASAIIGRVIDDIATYKIEKEKGQLVTGIECYMQENNLSVEKASAQLSEIA  488

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E+AWKD N++ ++   S +  EIL+ ++N  R+ DVVYKN QDGY+NP+  +K  I ++L
Sbjct  489   ESAWKDLNKECIKTTTSNIPNEILMRVVNLTRLIDVVYKNNQDGYSNPKNNVKSVIEALL  548

Query  1766  VN  1771
             VN
Sbjct  549   VN  550



>ref|XP_009599829.1| PREDICTED: 5-epi-aristolochene synthase 3-like, partial [Nicotiana 
tomentosiformis]
Length=451

 Score =   504 bits (1298),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/426 (59%), Positives = 323/426 (76%), Gaps = 4/426 (1%)
 Frame = +2

Query  512   IFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             IF  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S
Sbjct  28    IFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKS  87

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
              L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL
Sbjct  88    PLREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQEL  147

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR++L K I+M SI DDT+
Sbjct  148   AQVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVILVKTISMISIVDDTF  207

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V +
Sbjct  208   DAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCH  267

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
               ER+KE+V +YN+E  W  E   PPV+EY+ N  A++T Y L T S+LGMKSVT + FE
Sbjct  268   AIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFE  327

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W S+NP+I+EA+ ++ RVI+D A+YE EK     ATGI+  M DYG++ +EAM KF+ M 
Sbjct  328   WLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQGMA  387

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             E AWKD NE  +RP P  VSTEIL  ILN ARI +V Y +  DGYT+PEKVLKP I ++L
Sbjct  388   EGAWKDLNEGFVRPTP--VSTEILFRILNLARIVEVTYIHNLDGYTHPEKVLKPHINALL  445

Query  1766  VNSFEI  1783
             V+S EI
Sbjct  446   VDSIEI  451



>ref|XP_010319920.1| PREDICTED: vetispiradiene synthase 3-like [Solanum lycopersicum]
Length=527

 Score =   496 bits (1276),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 255/521 (49%), Positives = 357/521 (69%), Gaps = 8/521 (2%)
 Frame = +2

Query  239   VAERYAQEIQVLKGQVMSMLVSIR--SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENI  412
             ++E+  +EI+ LK +V  M++S    S  + +K+  IDT+ERLGI YHF + I++ L  +
Sbjct  9     ISEKVTEEIEGLKEEVKHMIISTTTTSNDIEQKIYLIDTLERLGIYYHFEKEIEDQLSKM  68

Query  413   YNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLY  589
             ++ N   +  DDL   AL FRL RQHGY ISS  F+ F++N G+FK +L  + KGLL+LY
Sbjct  69    FDQNVIHE-EDDLHKIALYFRLFRQHGYPISSDYFNQFKDNNGEFKKALIANTKGLLSLY  127

Query  590   EASHLKGHNDANLKEAYTFSKTHLEVIG--PQLSSTLGKQVRHALDQSLHNGIPRVESSY  763
             EA+H++ H D  L++A  F+K HLE I     L STL KQV HAL QSLH GIPR E+ +
Sbjct  128   EAAHVRKHGDDILEDALIFAKFHLEKITNVHTLDSTLEKQVTHALMQSLHRGIPRAEAHF  187

Query  764   FITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVEC  943
              I++YEE ES+N+ LLRFAKLD+NLLQ+ HK+EL E  +WWK+LDF + L Y RDR VEC
Sbjct  188   NISIYEECESRNEKLLRFAKLDYNLLQVLHKEELCELTQWWKDLDFASKLSYVRDRMVEC  247

Query  944   YFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNR  1123
             +FWA+GVYFE +YS+AR+MLAK I M S+ DDTYDS+G  DEL IFT+ + +WDI + +R
Sbjct  248   FFWAVGVYFEPQYSQARVMLAKCIAMISVIDDTYDSYGTLDELIIFTEIVDRWDISEVDR  307

Query  1124  LPRFMKIIYKTLIDLFEEFDKELSKEGRSF-AVHYTKERIKELVSSYNIEVKWCTERCTP  1300
             LP +MK IY +L++LF E++ E+  E   F  VHY KE +KE+V SY IE +W  E   P
Sbjct  308   LPTYMKPIYISLLNLFNEYEIEIELEQDRFNGVHYVKEAMKEIVKSYYIEAEWFLEGKIP  367

Query  1301  PVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASY  1480
                EY+ N   + T YLL  AS LGMK  ++  F+W    P+I+ A+ ++ RVI+DIA+Y
Sbjct  368   SFKEYLGNALVTGTYYLLGPASLLGMKLASKRTFDWMMNKPKILVASAIIGRVIDDIATY  427

Query  1481  EREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILL  1660
             + EK      TGI+ YM +  ++ EEA  +F E+ ENAWKD N++ ++   S + TEIL+
Sbjct  428   KIEKEKGQLVTGIECYMEENNLSVEEASAQFSEIAENAWKDLNKECIKSTDS-MPTEILM  486

Query  1661  CILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              ++N  R+ DVVYKN QDGY++P+  +K  I ++LVNS ++
Sbjct  487   RVVNLTRLIDVVYKNNQDGYSDPKNNVKAVIEALLVNSIKL  527



>gb|EYU31456.1| hypothetical protein MIMGU_mgv1a004071mg [Erythranthe guttata]
Length=545

 Score =   490 bits (1262),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 234/542 (43%), Positives = 360/542 (66%), Gaps = 9/542 (2%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             +RP  +  FSPS+WGD F  F  D +V E+Y + I+ LK +V S LV   S KL   L  
Sbjct  12    IRPPVTV-FSPSMWGDTFSTFSLDKQVQEKYEKAIETLKQEVRSKLVEATSGKL---LVL  67

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFD  520
             +DT+ERLG++YHF   I+E LE IYN +  +   DDL T+AL FRLLRQH Y +S  +FD
Sbjct  68    VDTIERLGLAYHFETAIEEKLEQIYNEDQEY---DDLFTTALRFRLLRQHQYQVSCSVFD  124

Query  521   NF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
              F  ++ KF+ SL NDV+GLL+LYEA+H++   +  L+EA  F+K H+      L S L 
Sbjct  125   KFTNKDNKFEESLGNDVEGLLSLYEAAHVRIRGENILEEAVAFTKHHMTRHMLSLESPLK  184

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
              +V+ AL  SLH G+P +E+  +I++YE+D+S+++++L+ AKL+FN LQ  +K+EL E  
Sbjct  185   DKVKRALVHSLHRGVPIIEARVYISIYEKDDSRDEMILKLAKLNFNYLQNMYKEELSELY  244

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWW   D  + LPYARDR++ECY W +  +FE +YS  R  +AK   MAS+ DDTYD++ 
Sbjct  245   RWWNNFDLKSKLPYARDRSIECYLWGIAFHFEPQYSYVRKAVAKATQMASVLDDTYDNYA  304

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
               +E ++FTD +++WD+ +  +LP +MK++Y+ ++ ++E++++E +K+G+SFA+   KE 
Sbjct  305   TLNEAQLFTDVLERWDMNEIGQLPDYMKVVYQYIMSIYEDYEREATKQGKSFAIPSYKEA  364

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQ  1417
             +K+L  +YNIE  W  ER  PP+ EY+KN   +S+++++ TA F GMKSVT+E  +W   
Sbjct  365   VKQLARAYNIEQNWIMERKMPPLEEYLKNSVITSSIFVMFTAHFPGMKSVTQETIDWLLS  424

Query  1418  NPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAW  1597
             NP+I+ +  ++ R I+D+ S+ERE       T +D YM  YG++ EE ++ FE +VE+AW
Sbjct  425   NPKIVVSTAMIGRHIDDLGSHERENKEGKYLTVVDCYMKHYGISKEEVLSMFEVLVEDAW  484

Query  1598  KDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSF  1777
             KD + +      S +  EI+  ++N+AR  ++ Y+N +DGYTNPEK L P I ++ V+  
Sbjct  485   KDISNEWANKTGS-IPKEIVEQLVNYARAAEMTYRNSEDGYTNPEKNLGPHIVALFVDPI  543

Query  1778  EI  1783
              I
Sbjct  544   VI  545



>gb|EYU31458.1| hypothetical protein MIMGU_mgv1a004009mg [Erythranthe guttata]
Length=549

 Score =   478 bits (1229),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 228/545 (42%), Positives = 359/545 (66%), Gaps = 11/545 (2%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             +RP  +  FSPS+WGD F  F FD +V E+Y + ++ LK +V S LV   S KL   L  
Sbjct  12    IRPPMTV-FSPSMWGDTFSTFSFDEQVQEKYEKAMETLKQEVRSKLVEATSGKL---LVL  67

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFD  520
             +DT+ERLG+SYHF   I+E LE IYN +  +   DDL T+AL FRLLRQH Y +S  +FD
Sbjct  68    VDTIERLGLSYHFETEIEEKLEQIYNEDQEY---DDLFTTALRFRLLRQHQYQVSCSVFD  124

Query  521   NF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL--EVIGPQ-LSS  688
              F  E  K K  L++DV+GLL+LYEA+H++   +  L+EA  F+K H+   ++  Q L S
Sbjct  125   KFTDEANKLKEMLTSDVEGLLSLYEAAHVRIRGEEILEEAVPFTKHHMTRHMLSSQSLES  184

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L  +V+ AL  SLH G+P +E+  +I++YE+D+S++D++L+ AKL+FN LQ  +K+EL 
Sbjct  185   PLKDKVKRALVHSLHRGVPIIEARVYISIYEKDDSRDDIILKLAKLNFNYLQNMYKEELS  244

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWW   D  + LPYARDR++ECY W +  +FE +YS  R  +AK + M  + DDTYD
Sbjct  245   ELYRWWNNFDLKSKLPYARDRSIECYLWGVAFHFEPQYSYVRKAVAKAVQMVIVIDDTYD  304

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++   +E ++FTD +++WD+ +  +LP +MK ++K ++ ++E++ ++ +K+G+SFA+   
Sbjct  305   NYATLNEAQLFTDVLERWDMNEIGQLPDYMKAVFKYIMSIYEDYKRDATKQGKSFAIPSY  364

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
             KE +K+L  ++NIE  W  ER  PP+ EY+KN   +S ++++ TA F GMKSVT+E  +W
Sbjct  365   KEAVKQLARAFNIEQNWIMERRMPPLEEYLKNSVITSCIFVVFTAHFPGMKSVTQETIDW  424

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
               +NP+I+ +  ++ R+I+D+ S++RE       T +D YM  YG++ +E ++ F+ +VE
Sbjct  425   LLRNPKIVVSTAMMGRLIDDLGSHDRENKEGKLPTVVDCYMKHYGISKDEVLSMFKVLVE  484

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             + WKD +++       ++  EI+  +LN+AR  +V Y+N +DG TNPEK L P I ++ V
Sbjct  485   DGWKDISKEWTNKTEGSIPKEIVEQLLNYARAAEVTYRNSEDGITNPEKNLAPHIVALFV  544

Query  1769  NSFEI  1783
             +   I
Sbjct  545   DPIVI  549



>ref|XP_010644711.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
Length=562

 Score =   472 bits (1215),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 247/558 (44%), Positives = 358/558 (64%), Gaps = 23/558 (4%)
 Frame = +2

Query  146   TNNEVVRPVTSFQFSPSLWGDEF--------RYFVFDNEVAERYAQEIQVLKGQVMSMLV  301
             T  EVVR   S  + PS+WG+ F        +  + D        Q++Q LK +V  M++
Sbjct  16    TTTEVVR--DSANYHPSIWGNHFLENASHDVKVHIIDGHTE----QQVQQLKEEVRKMII  69

Query  302   SIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENI--YNANPNFQLGDDLCTSALLFR  475
             S  +   ++K N IDT++RLG+SYHF   I+E L+++  Y      +  DDLCT AL FR
Sbjct  70    S-STDNYSQKYNLIDTIQRLGVSYHFESEIEEALKHLSDYYHVSCEEDDDDLCTVALRFR  128

Query  476   LLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSK  652
             LLRQHGYNIS   F  F++N G FK SL +DVKG+L+LYEA+HL+ H +  L EA TF+ 
Sbjct  129   LLRQHGYNISYDAFKKFKDNKGNFKESLISDVKGMLSLYEATHLRKHGEDILDEALTFTT  188

Query  653   THLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDF  832
             THL+ + P  SS L +QV HAL Q LH GI R+E+ + I++Y+ED++ ++ LL+ AKLDF
Sbjct  189   THLQSM-PYFSSPLAEQVVHALRQPLHKGIQRLEARHHISIYQEDDAHSEALLKLAKLDF  247

Query  833   NLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKI  1012
             N LQ  H+QEL   + WWK+LDF   LP+ARDR VECYFWAL VYFE +Y  AR +L K+
Sbjct  248   NQLQKVHQQELSVIVSWWKDLDFAKKLPFARDRVVECYFWALTVYFEPQYFHARRILTKV  307

Query  1013  ITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKEL  1192
             I + SI DD YD FG  +ELEIFT+AI++WDI    +LP +MK+ Y+ L+D++ E ++  
Sbjct  308   IALTSILDDIYDLFGTLEELEIFTEAIERWDISFIGQLPDYMKVFYQALLDVYNEIEEVT  367

Query  1193  SKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFL  1372
              K GRS+  HY KE +K  V +Y  E KW   R  P + EY+     +S   LL T SF+
Sbjct  368   VKAGRSYRAHYAKEAMKNQVRAYFAEAKWLFLRQMPTIEEYMSVALPTSGYQLLATTSFI  427

Query  1373  GMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVT  1549
             GM++ VT++ FEW   +P+I+ A++ + R++ND+  ++ E+      + ++ YM  +GV+
Sbjct  428   GMENMVTKDTFEWVFSDPKIVRASSTICRLMNDMVPHKFEQKRGHVPSAVECYMKQHGVS  487

Query  1550  AEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
              ++ +++    V +AWKD N++ L   P+AV   I++ +LN AR  DVVYK+ +DGYT+ 
Sbjct  488   EQQTLDELHNQVRDAWKDMNQECLS--PTAVPMPIIMRVLNLARFIDVVYKD-EDGYTHS  544

Query  1730  EKVLKPCIFSVLVNSFEI  1783
             E VLK  I S+L++   I
Sbjct  545   ETVLKDLIASLLIHPVPI  562



>gb|AII32471.1| terpene synthase [Populus trichocarpa]
Length=553

 Score =   470 bits (1210),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 242/559 (43%), Positives = 369/559 (66%), Gaps = 12/559 (2%)
 Frame = +2

Query  116   QQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMS  292
             Q + E++    +NE++R   ++   PS+WGD+F   +  ++V E    QEI+ L+ Q   
Sbjct  4     QVSQEVVPKAHHNEIIRRTANYH--PSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKR  61

Query  293   MLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLF  472
              L++  S   +++L+ ID ++RLG++YHF   I+E L++IYN   + +  DDL  +AL F
Sbjct  62    ELLAAASNS-SQQLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIDME-DDDLYNTALGF  119

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQHGYN+S  IF+ F+++ G FK S  NDV+G+L LYEA+HL  H +  L EA  F+
Sbjct  120   RLLRQHGYNVSCDIFNKFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALAFT  177

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
               HL+ +    +  L  +V HAL Q +  G+PR+ES  +I++Y+++ S N  LLR AKL+
Sbjct  178   TIHLKSMASSPNCPLTAKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLN  237

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             FNL+Q  HK+EL E  RWWK LDF   LP+ARDR VEC+FW +GVYFE +YS AR +L K
Sbjct  238   FNLVQELHKEELAEITRWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTK  297

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
             +I M SI DD YD +G  +ELE+FT+AI +WD +  ++LP +MKI Y+ L+++F E +++
Sbjct  298   VIAMTSIIDDIYDVYGTLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVFSEIEEK  357

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASF  1369
             ++KEG S+ VHY K+ +K LV +Y  E KW  E   P + EY++    +S   +L T SF
Sbjct  358   VAKEGWSYRVHYGKDAMKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSF  417

Query  1370  LGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             +GM   VT++AF+W   +P+II A+  + R+++D+ S++ E+     A+G++ Y+  YG+
Sbjct  418   IGMGDMVTKQAFDWVFNHPKIIRASETIGRLLDDVKSHKFEQERGHAASGVECYIRQYGL  477

Query  1547  TAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTN  1726
             + +E   +F   V NAWKD NE+ L+  P+AV T +L  ILN +R+ DV+YK ++DGYT+
Sbjct  478   SEQEVYKEFHMQVVNAWKDINEECLK--PTAVPTPLLERILNLSRVIDVIYK-EEDGYTH  534

Query  1727  PEKVLKPCIFSVLVNSFEI  1783
               KV+K  + S+L+NS  I
Sbjct  535   VGKVMKNNVASLLINSVPI  553



>sp|F6M8H4.1|SAST_SANAL RecName: Full=Probable sesquiterpene synthase; Short=SaSTPS [Santalum 
album]
 gb|AEF32534.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   470 bits (1209),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 358/562 (64%), Gaps = 15/562 (3%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQ  283
             +E Q   I  +    ++ RP+ +F   PS+WGD F  +   +E  ER  +E QV  LK Q
Sbjct  1     MENQKMPISSVPILKDLSRPIANF--PPSIWGDRFINYTCQDE-NERAQKERQVEELKEQ  57

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDL  451
             V   L +     L ++ N ID  +RLGI+YHF   I+E LE+IY      N  F+  DDL
Sbjct  58    VRRELAATVDKPLQQQ-NIIDATQRLGIAYHFENEIEESLEHIYLHTYVENTCFEGSDDL  116

Query  452   CTSALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANL  628
              + AL FRLLRQ+GY +S  +F+ F++N G FK++L  D KGLL LYEA+HL  H +  L
Sbjct  117   YSVALWFRLLRQNGYRVSCDVFNKFRDNEGNFKNNLMEDAKGLLELYEATHLSVHGEEML  176

Query  629   KEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVL  808
              +A  F+KT LE +   L+  L +QVRHAL Q LH G+PR+E+ YF  +YE   S N  L
Sbjct  177   DDALEFTKTRLESVVSHLNYPLAEQVRHALYQPLHKGLPRLEAVYFFRIYEAHASHNKAL  236

Query  809   LRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSK  988
             L+ AKLDFNLLQ  HK+EL +  RWWK LDF T +P+ARDR VE YFW LGVYFE +YS 
Sbjct  237   LKLAKLDFNLLQSFHKKELSDIARWWKSLDFATKVPFARDRLVEGYFWVLGVYFEPQYSL  296

Query  989   ARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDL  1168
             AR ++ K+ TM S  DD YD++G  DEL++FT+AI++WD+   ++LP +MK  YK+++++
Sbjct  297   ARKIIIKVFTMISTIDDIYDAYGTVDELKLFTEAIRRWDVGSLDQLPEYMKPCYKSILEV  356

Query  1169  FEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLY  1348
             + E ++E+  +G  F +HY KE +K+LV  Y  E KWC E+  P   EY+     +S   
Sbjct  357   YNEIEEEMDNQGSLFRMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFEEYMSVALVTSGYT  416

Query  1349  LLITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDY  1525
              L T S+LGM  + ++EAF+W   +P +IEA+  + R+++D+ S++ E+     A+GI+ 
Sbjct  417   FLTTMSYLGMGEIASKEAFDWLFSHPPVIEASESVGRLMDDMRSHKFERERGHVASGIEC  476

Query  1526  YMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKN  1705
             YM  Y VT EEA ++F + +  AWKD NE+ LRP    V   +L+ ILN  R+ DV+YKN
Sbjct  477   YMKQYSVTEEEAYDEFCKRLVKAWKDINEECLRPY--HVPKPLLMRILNLTRVIDVIYKN  534

Query  1706  KQDGYTNPEKVLKPCIFSVLVN  1771
              +DGYT+ +K +K  I S+L++
Sbjct  535   -EDGYTHVKKAMKDNIASLLID  555



>sp|E3W208.1|SPISS_SANSP RecName: Full=Sesquiterpene synthase; Short=SspiSesquiTPS [Santalum 
spicatum]
 gb|ADO87006.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   469 bits (1208),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/546 (45%), Positives = 353/546 (65%), Gaps = 15/546 (3%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFD--NEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             + RP+ +F   PS+WGD F  +  +  NE A++  ++++ LK QV   L +     L ++
Sbjct  20    ISRPIANF--PPSVWGDRFINYACEDENEQAQK-ERQVEELKEQVRRELAAAIDKPL-QQ  75

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDLCTSALLFRLLRQHGYN  499
             LN ID  +RLGI+YHF   I+E L++IY      N  F+  DDLC+ AL FRLLRQ GY 
Sbjct  76    LNIIDATQRLGIAYHFENEIEESLKHIYLHTYVENTCFEGSDDLCSVALWFRLLRQDGYR  135

Query  500   ISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S  +F  F+++ G FK+SL  D KGLL LYEA+HL  + +  L +A  F+KTHLE++  
Sbjct  136   VSCDVFKKFRDSEGNFKNSLMEDAKGLLELYEATHLSVNGEEMLDDALEFTKTHLELVVS  195

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
              L+  L +QVRHAL Q  H G+PR+E+ YF  +YE  +S N+ LL+ AKLDFNLLQ  H 
Sbjct  196   HLNYPLAEQVRHALYQPQHKGLPRLEAVYFFRIYEAYDSHNEALLKLAKLDFNLLQSLHM  255

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL    +WWK LDF T  P+ARDR VE YFW LGVYFE +YS AR ++ K+ TM S  D
Sbjct  256   KELSHMAKWWKSLDFATKFPFARDRLVEGYFWILGVYFEPQYSLARKIIIKVFTMISTID  315

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  DEL++FT AIQ+WDI   ++LP +MK  YK+++D++ E ++E+  +G  F 
Sbjct  316   DIYDAYGTLDELKLFTKAIQRWDIGSLDQLPEYMKPCYKSVLDVYNEIEEEMDNQGSLFR  375

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TR  1393
             +HY KE +K++V  Y  E KWC E+  P   EY+     ++    L T S+LGM  + ++
Sbjct  376   MHYAKEEMKKIVEGYMDEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIASK  435

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             EAF+W   +P IIEA+  + R+++D+ S+E E+     A+GI+ YM  YGVT EEA +KF
Sbjct  436   EAFDWLFSHPPIIEASESVGRLMDDMRSHEFEQERGHVASGIECYMKQYGVTEEEAHDKF  495

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
              + +  AWKD NE  LRP P  V   +L+ IL+  R+ DV+YKN +D YT+ +K +K  I
Sbjct  496   HKRLVKAWKDINEGCLRPYP--VPKPLLMRILSLTRVIDVIYKN-EDWYTHVKKPMKDKI  552

Query  1754  FSVLVN  1771
              S+L++
Sbjct  553   ASLLID  558



>emb|CDP20681.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   468 bits (1205),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 250/541 (46%), Positives = 349/541 (65%), Gaps = 11/541 (2%)
 Frame = +2

Query  122   TSEILKMVTNN--EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSM  295
             TS    +++NN  E+VR +  F    ++W D    F  D +  +  A+EI++LK +VMSM
Sbjct  4     TSTETVVLSNNQHEIVRQLADF--PENIWADSISSFTLDEQGYDLCAKEIEMLKAEVMSM  61

Query  296   LVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALL  469
             L++  S  + EKLNFI+ +ERLGI +HF + I+  L+  +N   N   Q   DL    L 
Sbjct  62    LLAT-SKTMMEKLNFINQIERLGILHHFEDEIENQLQQFFNLCTNLGEQQEYDLSAVGLQ  120

Query  470   FRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTF  646
             FRL RQHGYNIS  IFD F + NGKF+ SL +D+KGLL+LYEA+H++ H D  L EA  F
Sbjct  121   FRLFRQHGYNISCDIFDQFIDGNGKFQESLCSDMKGLLSLYEAAHVRTHGDKILDEALAF  180

Query  647   SKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKL  826
             + THL+     + STL KQV HAL++ LH GI R E+  +I++YEEDES N +LLR AKL
Sbjct  181   TTTHLKRGLSYVGSTLAKQVTHALEKPLHKGISRYEAYCYISIYEEDESNNKLLLRLAKL  240

Query  827   DFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLA  1006
             D++ LQM +KQ+L E +RW K+LD  + +PYAR+R VECYFWA+G ++E KYS AR M A
Sbjct  241   DYHSLQMLYKQDLCEIIRWGKKLDMRSKIPYARERFVECYFWAVGTFYEPKYSFARQMFA  300

Query  1007  KIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDK  1186
             KI    +I DD YD++G  +EL+IFTDA+ +WD    ++LP  +K  Y TL+ L +E ++
Sbjct  301   KIAVFVTIVDDAYDAYGTLEELKIFTDAVDRWDGNGIDQLPECLKTTYMTLLSLNKELEE  360

Query  1187  ELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITAS  1366
              L+KE R++A +   +  +    +  I+ KW      PP A+Y+ N   +ST YLL  A+
Sbjct  361   ILAKERRTYAFNKYIQEWENYTRTSFIQSKWFLTNELPPFADYLSNSLITSTYYLLAAAA  420

Query  1367  FLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             FLGM S + +   W S NP++  A T  AR+IND+AS++ EK  R + T I+ YM DY V
Sbjct  421   FLGMDSASEDVINWMSTNPKLFVAFTKHARLINDVASHKFEK-ERGSGTPIECYMKDYNV  479

Query  1547  TAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTN  1726
             + EEAM KFEEM E+AWK  NE+ LR  P+ +  EI   +LN ARI +VVY  ++D +T 
Sbjct  480   SEEEAMKKFEEMCEDAWKVMNEECLR--PTTIPREIFKVMLNLARICEVVYDQREDKFTC  537

Query  1727  P  1729
             P
Sbjct  538   P  538



>dbj|BAP74389.1| delta-elemene synthase [Citrus jambhiri]
Length=563

 Score =   469 bits (1206),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 243/545 (45%), Positives = 353/545 (65%), Gaps = 14/545 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV-LKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  F PS+WGD F  +  D++  +  +    + LK ++  ML +    K +  L  ID +
Sbjct  24    SANFHPSIWGDHFLQYTCDSQEPDDGSNVKHLELKKEIRRMLKA--DNKPSRTLELIDAI  81

Query  353   ERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSGIFD  520
             +RLG+SYHF   IDE+L  ++ A     L     D L   +L FRLLR++GY IS+ +F+
Sbjct  82    QRLGVSYHFESEIDEILGRVHQAYQESDLCVNENDGLYYISLQFRLLRENGYRISADVFN  141

Query  521   NFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSSTL  694
              F++ +G FK SL+ DV+G+L+LYEA+HL+ H +  L EA+ F+ +HLE I   Q+SS L
Sbjct  142   KFRDIDGNFKPSLAKDVRGMLSLYEATHLRVHEENILDEAHAFATSHLESIATHQISSPL  201

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV+HAL Q +H G+ R+E+ ++I++Y E+ S N+ LL FAKLDFN LQ  H++EL + 
Sbjct  202   AEQVKHALFQPIHKGVQRLEARHYISIYREESSHNEALLTFAKLDFNKLQKLHQKELSDI  261

Query  875   MRWWKELDFVTTLPYA-RDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
              RWWKELDF   LP+  RDR  ECYFWA+ VYFE +YS  R MLAK+  M SI DD YD 
Sbjct  262   SRWWKELDFAHNLPFTIRDRIAECYFWAVAVYFEPQYSLGRRMLAKVFPMTSIIDDIYDV  321

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +GK +ELE+FT AI++WDI   + LP +MK+ Y+ L+D++ E +K+L+ +G+ + +HY K
Sbjct  322   YGKFEELELFTSAIERWDISAIDELPEYMKLCYRALLDVYSEAEKDLASQGKLYHLHYAK  381

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEW  1408
             E +K  V +Y  E KWC +   P V EY+     +S   +L T SF+GM   VT+E+FEW
Sbjct  382   EAMKNQVKNYFFEAKWCHQNYIPSVDEYMTVASVTSGYPMLSTTSFVGMGDIVTKESFEW  441

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
             S  NPR+I A+++ AR++ND+ S++ E+     A+ ++ Y+  YG T EEA N+F + V 
Sbjct  442   SLTNPRVIRASSVAARLMNDMVSHKFEQSRGHVASCVECYIKQYGATEEEACNEFRKQVS  501

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAWKD NE+ LR  P+ V   +L+ ILN  R  DVVY+  +DGYT+   VLK  + S+L+
Sbjct  502   NAWKDVNEECLR--PTVVPMPLLMRILNLTRFLDVVYRF-EDGYTHSGVVLKDFVASLLI  558

Query  1769  NSFEI  1783
             N   I
Sbjct  559   NPVSI  563



>ref|XP_006475286.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Citrus 
sinensis]
Length=562

 Score =   468 bits (1205),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 240/544 (44%), Positives = 353/544 (65%), Gaps = 13/544 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV-LKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  + PS+WGD F  +  D +  +  +    + LK ++  ML +    K +  L  ID +
Sbjct  24    SANYHPSIWGDHFLQYTCDTQETDDGSNVKHLELKKEIRRMLKA--DNKPSRTLQLIDAI  81

Query  353   ERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSGIFD  520
             +RLG+SYHF   IDE+L  ++ A+ +  L     D+L   +L FRLLRQ+GY IS+ +F 
Sbjct  82    QRLGVSYHFESEIDEILGKMHKASQDSDLCDNENDELYYISLHFRLLRQNGYKISADVFK  141

Query  521   NFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSSTL  694
              F++ +G FK+SL+ DV+G+L+LYEA+HL  H +  L EA  F+ +HLE I   Q+ S L
Sbjct  142   KFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHEEDILDEALAFTTSHLESIATHQIRSPL  201

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV+HAL Q +H G+ R+E+  +I +Y+E+   N+ LL FAKLDFN LQ  H++EL + 
Sbjct  202   VEQVKHALVQPIHRGLQRLEARQYIPIYQEESPHNEALLTFAKLDFNKLQKLHQKELGDI  261

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF   LP+ RDR  ECYFW LGVYFE +YS AR +L K+I+M S+ DD YD +
Sbjct  262   SRWWKELDFAHKLPFIRDRVAECYFWILGVYFEPQYSFARRILTKVISMTSVIDDIYDVY  321

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             GK +ELE+FT AI++WDI   ++LP +MK+ Y+ L+D+F E +K+L+ +G+S+ ++Y KE
Sbjct  322   GKIEELELFTSAIERWDISAIDQLPEYMKLCYRALLDVFSEAEKDLAPQGKSYRLYYAKE  381

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWS  1411
              +K +V +Y  E KWC +   P V EY+     +S   +L T SF+GM   VT+E+FEW 
Sbjct  382   AMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEWL  441

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
               NPR I A++++ R+++DI S++ E+     A+ ++ YM  +G T EEA N+F + V N
Sbjct  442   FSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVASSVECYMKQHGATEEEACNEFRKQVSN  501

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AWKD NED LR  P+ V   +L+ ILN  R+ DV+YK  +DGYT+   VLK  + S+ +N
Sbjct  502   AWKDINEDCLR--PTVVPMPLLMRILNLTRVIDVIYKY-EDGYTHSAVVLKDFVASLFIN  558

Query  1772  SFEI  1783
                I
Sbjct  559   PVPI  562



>emb|CAA77191.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   468 bits (1203),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 239/535 (45%), Positives = 350/535 (65%), Gaps = 7/535 (1%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F P +WGD F     D ++      + + LK QV  M++        +KL FID ++RLG
Sbjct  26    FHPGIWGDMF-IICPDTDIDAATELQYEELKAQVRKMIMEPVDDS-NQKLPFIDAVQRLG  83

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGK  541
             +SYHF + I++ LENIY    N     DL T+AL FRLLR+HG++IS   F+ F+ E G 
Sbjct  84    VSYHFEKEIEDELENIYRDTNNNDADTDLYTTALRFRLLREHGFDISCDAFNKFKDEAGN  143

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALD  721
             FK+SL++DV+GLL LYEAS+++ H +  L EA +F+   L +  P L   L +QV HAL 
Sbjct  144   FKASLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTLHHPLSEQVGHALK  203

Query  722   QSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDF  901
             QS+  G+PRVE+  FI++Y++ ES N  LL+FAK+DFNLLQ+ H++EL E  RWWK+LDF
Sbjct  204   QSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKELSEICRWWKDLDF  263

Query  902   VTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIF  1081
                LP+ARDR VE YFW +GVYFE +YS  R ML K+I MASI DDTYDS+   DEL  +
Sbjct  264   TRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYATYDELIPY  323

Query  1082  TDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSY  1261
             T+AI++WDI+  N+LP +MKI YK L+D++EE ++ L+ +GR + V Y K+ +  LV +Y
Sbjct  324   TNAIERWDIKCMNQLPNYMKISYKALLDVYEEMEQLLANQGRQYRVEYAKKAMIRLVQAY  383

Query  1262  NIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIEA  1438
              +E KW  +   P   E+  N   +S   +L   +F+GM  V T E F+W++ +P+II+A
Sbjct  384   LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAASDPKIIKA  443

Query  1439  NTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDI  1618
             +T++ R ++DIA ++       + + I+ YM  YGVTA+EA N+F + +E++WKD NE+ 
Sbjct  444   STIICRFMDDIAEHKFNHRREDDCSAIECYMKQYGVTAQEAYNEFNKHIESSWKDVNEEF  503

Query  1619  LRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             L+  P+ + T +L   LN AR+ DV+Y+ + DGYT+  K  K  I S+L++  +I
Sbjct  504   LK--PTEMPTPVLCRSLNLARVMDVLYR-EGDGYTHVGKAAKGGITSLLIDPIQI  555



>sp|E3W207.1|SAUSS_SANAS RecName: Full=Sesquiterpene synthase; Short=SauSesquiTPS [Santalum 
austrocaledonicum]
 gb|ADO87005.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=559

 Score =   468 bits (1203),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 355/562 (63%), Gaps = 15/562 (3%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFD--NEVAERYAQEIQVLKGQ  283
             +E Q   I  +    E+ RP+ +F   PS+WGD F  +  +  NE A++  ++++ LK Q
Sbjct  1     MENQKVPISSVPNLKELSRPIANF--PPSIWGDRFINYTCEDENEQAQK-ERQVEELKEQ  57

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDL  451
             V   L +     L ++LN ID  +RLGI+YHF   I+E LE+IY      N  FQ   DL
Sbjct  58    VRRELAATVDKPL-QQLNIIDATQRLGIAYHFENEIEESLEHIYLHTYVKNNCFQGSHDL  116

Query  452   CTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANL  628
              + AL FRLLRQ GY +S  +FDNF++  G FK+SL  D KGLL LYEA+HL  H +  L
Sbjct  117   YSVALWFRLLRQDGYKVSCDVFDNFRDYEGNFKNSLMEDAKGLLELYEATHLSVHGEEML  176

Query  629   KEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVL  808
              +A  F+KT LE I   L+  L +QVRHAL + L  G+PR+E+ YF  +YE   S N  L
Sbjct  177   DDALEFAKTRLESIVNHLNYPLAEQVRHALYRPLRKGLPRLEAVYFFRIYEAYHSHNKAL  236

Query  809   LRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSK  988
             L+ AKLDFNLLQ  H++EL +  RWW+ LDF T  P+ARDR VE YFW LGVYFE +YS 
Sbjct  237   LKLAKLDFNLLQSLHRKELGDMARWWRSLDFATKFPFARDRLVEGYFWILGVYFEPQYSL  296

Query  989   ARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDL  1168
             AR +  K+  M S  DD YD++G  DEL++FT+AIQ+WD+   ++LP +MK  YK+++D+
Sbjct  297   AREITTKVFAMISTIDDIYDAYGTLDELKLFTEAIQRWDVGSLDQLPEYMKPCYKSILDV  356

Query  1169  FEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLY  1348
             + E ++E++ +G  F +HY KE +K +V  Y  E KWC E+  P   EY+     +S   
Sbjct  357   YNEIEEEMANQGSLFRMHYAKEVMKTIVEGYMDEAKWCHEKYVPTFQEYMSLALVTSGYT  416

Query  1349  LLITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDY  1525
              L T S+LGM  + ++EAFEW   +P IIEA+  + R+++D++S++ E+     A+GI+ 
Sbjct  417   FLTTISYLGMGGIASKEAFEWLFSHPPIIEASESICRLMDDMSSHKFEQERGHVASGIEC  476

Query  1526  YMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKN  1705
             YM  YGV  EEA ++F + +  AWKD NE  LRP   AV   +L+ ILN  R+ DV+YKN
Sbjct  477   YMKQYGVIEEEAHDEFHKRLVKAWKDINEGFLRPY--AVPEPLLMRILNLTRVMDVIYKN  534

Query  1706  KQDGYTNPEKVLKPCIFSVLVN  1771
              +D YT+ +K +K  I S+L++
Sbjct  535   -EDSYTHVKKAMKDNIASLLID  555



>sp|B5A435.1|STPS1_SANAL RecName: Full=Sesquiterpene synthase; Short=SaSesquiTPS1 [Santalum 
album]
 gb|ACF24768.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   467 bits (1202),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 355/562 (63%), Gaps = 15/562 (3%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFD--NEVAERYAQEIQVLKGQ  283
             +E Q   I  +    E+ RP+ +F   PS+WGD F  +  +  NE A++  ++++ LK Q
Sbjct  1     MENQKVPISSVPNLKELSRPIANF--PPSIWGDRFINYACEDENEQAQK-ERQVEELKEQ  57

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDL  451
             V   L +     L ++LN ID  +RLGI+YHF   I+E LE+IY      N  FQ   DL
Sbjct  58    VRRELAATVDKPL-QQLNIIDATQRLGIAYHFENEIEESLEHIYLHTYVENNCFQGSHDL  116

Query  452   CTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANL  628
              + AL FRLLRQ GY +S  +FD F++    FK+SL  D KGLL LYEA+HL  H +  L
Sbjct  117   YSVALWFRLLRQDGYKVSCDVFDKFRDYEDNFKNSLMEDAKGLLELYEATHLSVHGEEML  176

Query  629   KEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVL  808
              +A  F+KT LE I   L+  L +QVRHAL + L  G+PR+E+ YF  +YE  +S N  L
Sbjct  177   DDALEFAKTRLESIVNHLNYPLAEQVRHALYRPLRKGLPRLEAVYFFRIYEAYDSHNKAL  236

Query  809   LRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSK  988
             L+ AKLDFNLLQ  HK+EL +  RWWK LDF    P+ARDR VE YFW LGVYFE +YS 
Sbjct  237   LKLAKLDFNLLQSLHKKELSDMARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSL  296

Query  989   ARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDL  1168
             AR ++ K+ TM S  DD YD++G  DELE+FT A+Q+WD+   ++LP +MK  YK+++D+
Sbjct  297   ARKIIIKVFTMISTIDDIYDAYGTLDELELFTKAMQRWDVGSLDQLPEYMKPCYKSILDV  356

Query  1169  FEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLY  1348
             + E ++E+  +G  F +HY KE +K+LV  Y  E KWC E+  P   EY+     +S   
Sbjct  357   YNEIEEEMDNQGSLFRMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFEEYMPVALVTSGYT  416

Query  1349  LLITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDY  1525
              L T S+LGM  + ++EAF+W   +P +IEA+  + R+++D+ S++ E+     A+GI+ 
Sbjct  417   FLTTISYLGMGEIASKEAFDWLFSHPPVIEASESVCRLMDDMRSHKFEQERGHVASGIEC  476

Query  1526  YMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKN  1705
             YM  YGVT EEA ++F + +  AWKD NE+ LRP    V   +L+ ILN  R+ DV+YKN
Sbjct  477   YMKQYGVTEEEAHDEFRKQLVKAWKDINEECLRPY--RVPKPLLMRILNLTRVIDVIYKN  534

Query  1706  KQDGYTNPEKVLKPCIFSVLVN  1771
              +DGYT+ +K +K  I S+L++
Sbjct  535   -EDGYTHVKKAMKDNIASLLID  555



>ref|XP_009762842.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=466

 Score =   463 bits (1192),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/378 (61%), Positives = 283/378 (75%), Gaps = 8/378 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F  +N+ AE+YA+EI+ LK Q  SML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIENQAAEKYAKEIEALKEQTRSMLLAT-GRKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+LE IYN   N    DDL TSAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILEQIYNQTSN---CDDLSTSALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK  LSNDV GLLNLYEASH++ H D  L+ A  FS  HLE + P L S 
Sbjct  126   FSKFQDENGKFKECLSNDVLGLLNLYEASHVRTHADDILENALAFSTIHLEFVAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +YE+++SKNDVLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNDVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   EVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE +TDAIQ+WDI + +RLP +MKI YK ++DL+++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHA  365

Query  1229  KERIKELVSSYNIEVKWC  1282
              ER+++        ++ C
Sbjct  366   IERVEKSRGQIATGIECC  383


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +2

Query  1508  ATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARID  1687
             ATGI+  M DYG++ EEAM KF+EM E AWKD NE +L P P  VSTE L  ILN ARI 
Sbjct  377   ATGIECCMRDYGISTEEAMTKFQEMAEVAWKDLNEGLLSPTP--VSTEFLSRILNLARIV  434

Query  1688  DVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             +V Y +  DGYT+PEKVLKP I ++LV+S E+
Sbjct  435   EVTYIHNLDGYTHPEKVLKPHIIALLVDSIEV  466



>emb|CBI20483.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   466 bits (1200),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/562 (42%), Positives = 368/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   +F   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSVVLLAPSKNLSPEVGRRCANFH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++      A+KL  ID ++RLG++YHF   IDE+L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDS-AQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSV-VSAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+LYEA+H + H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+      S+ L +QV HAL Q +  G+PR+E+ ++ +VY+ D+S N  LL+ A
Sbjct  179   AFTTTHLQSATKHSSNPLAEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+I M SI DD YD +G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+ ++ E 
Sbjct  299   LTKVIAMTSIIDDIYDVYGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E++KEGRS+ ++Y KE +K  V +Y  E KW   +  P + EY+     +S   +L T
Sbjct  359   EEEMAKEGRSYRLYYAKEAMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLAT  418

Query  1361  ASFLGM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              SF+GM  +VT+E+F+W    P+I+ A+ ++ R+++D+ S++ E+     A+ ++ YM  
Sbjct  419   TSFVGMGDAVTKESFDWIFSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  N+F + V +AWKD NE+ L  IP+AV   IL+ +LN AR+ DV+YKN +DG
Sbjct  479   HGASEQETHNEFHKQVRDAWKDINEECL--IPTAVPMPILMRVLNLARVIDVIYKN-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+   VLK  + S+L++   I
Sbjct  536   YTHSGTVLKDFVTSMLIDPVPI  557



>gb|ADR66821.1| germacrene A synthase [Vitis vinifera]
Length=555

 Score =   466 bits (1200),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 243/541 (45%), Positives = 359/541 (66%), Gaps = 12/541 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RP+   +F PS+WGD+F  +  ++E   R  +E QV  LK +V   L++  +   A+ LN
Sbjct  19    RPMA--EFHPSIWGDQFIAYTPEDE-DTRACKEKQVEDLKAEVRRELMAA-AGNPAQLLN  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             FID ++RLG++YHF   I+E L++IY+  +      DDL   AL FRLLRQ GYNIS GI
Sbjct  75    FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  134

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F+ E G FK  L ++V+G+L LYEA+HL+ H +  L+EA  F+ THL+     L   
Sbjct  135   FNKFKDEKGSFKEDLISNVQGMLGLYEAAHLRVHGEDTLEEALAFTTTHLKATVESLGYP  194

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L +QV HAL   +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+EL  
Sbjct  195   LAEQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSN  254

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELDF T LP+ARDR VE YFW LGVYFE +YS+AR +L K+  MASI DD YD+
Sbjct  255   LARWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSRARRILTKLFAMASIIDDIYDA  314

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  +EL+ FT+AI++WDI+  + LP +MK+ Y TL+DL++E D+EL K G  + V+Y K
Sbjct  315   YGTLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYAK  374

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEW  1408
             E +K  V +Y  E KW  E   P + EY+     +S   +L T SF+GM  + T+EAF+W
Sbjct  375   EVLKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDW  434

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                +P+II A+T++ R+++DI +++ E+     A+GI+ YM  YGV+ E+  ++F + VE
Sbjct  435   VISDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVE  494

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAW D N++ L+  P+AV   +L  ++N +R+ DV+YK + DGYT+  KV+K  I SVL+
Sbjct  495   NAWLDINQECLK--PTAVPMPLLTRVVNLSRVMDVIYK-EGDGYTHVGKVMKDNIGSVLI  551

Query  1769  N  1771
             +
Sbjct  552   D  552



>ref|NP_001268063.1| uncharacterized protein LOC100267145 [Vitis vinifera]
 gb|ADR74196.1| terpene synthase [Vitis vinifera]
Length=555

 Score =   466 bits (1199),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 240/545 (44%), Positives = 365/545 (67%), Gaps = 18/545 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV   Q+ PS+WGD+F  +  ++EV  R  +E Q+  LK ++   L++  +   +++L 
Sbjct  19    RPVV--QYHPSIWGDQFLSYTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQQLK  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL----CTSALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  75    FIDAVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNIS  131

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L
Sbjct  132   CGLFNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESL  191

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+E
Sbjct  192   GYHLAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEE  251

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWKELDF T LP+ARDR VECYFW LGVYFE +Y +AR +L K+I M SI DD 
Sbjct  252   LSNLARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRARRILTKVIAMISILDDI  311

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G P+EL++F +AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG  + VH
Sbjct  312   HDAYGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVH  371

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREA  1399
             Y KE +K  V +Y  E KW  E   P   EY++    SS   +L T SF+GM  + T+EA
Sbjct  372   YAKEVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEA  431

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W + NP+I+ ++  +AR+++DI S++ E+     A+ ++ YM  YGV+ E+   +F++
Sbjct  432   FDWVTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQK  491

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              +ENAW D N++ L+  P+AVS  +L  ILN  R  DVVYK +QD YT+  KV++  I S
Sbjct  492   QIENAWLDINQECLK--PTAVSMPLLARILNLTRAADVVYK-EQDSYTHVGKVMRDNIAS  548

Query  1760  VLVNS  1774
             VL+N+
Sbjct  549   VLINA  553



>sp|Q43714.1|DCS3_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme A; Short=D-cadinene 
synthase A [Gossypium arboreum]
 gb|AAB41259.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 emb|CAA65289.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   466 bits (1198),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 350/535 (65%), Gaps = 7/535 (1%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F P +WGD F     D ++      + + LK QV  M++        +KL FID ++RLG
Sbjct  26    FHPGIWGDMF-IICPDTDIDAATELQYEELKAQVRKMIMEPVDDS-NQKLPFIDAVQRLG  83

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGK  541
             +SYHF + I++ LENIY    N     DL T+AL FRLLR+HG++IS   F+ F+ E G 
Sbjct  84    VSYHFEKEIEDELENIYRDTNNNDADTDLYTTALRFRLLREHGFDISCDAFNKFKDEAGN  143

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALD  721
             FK+SL++DV+GLL LYEAS+++ H +  L EA +F+   L +  P L   L +QV HAL 
Sbjct  144   FKASLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTLHHPLSEQVGHALK  203

Query  722   QSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDF  901
             QS+  G+PRVE+  FI++Y++ ES N  LL+FAK+DFNLLQ+ H++EL E  RWWK+LDF
Sbjct  204   QSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKELSEICRWWKDLDF  263

Query  902   VTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIF  1081
                LP+ARDR VE YFW +GVYFE +YS  R ML K+I MASI DDTYDS+   DEL  +
Sbjct  264   TRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYATYDELIPY  323

Query  1082  TDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSY  1261
             T+AI++WDI+  N+LP +MKI YK L++++EE ++ L+ +GR + V Y K+ +  LV +Y
Sbjct  324   TNAIERWDIKCMNQLPNYMKISYKALLNVYEEMEQLLANQGRQYRVEYAKKAMIRLVQAY  383

Query  1262  NIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIEA  1438
              +E KW  +   P   E+  N   +S   +L   +F+GM  V T E F+W++ +P+II+A
Sbjct  384   LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAASDPKIIKA  443

Query  1439  NTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDI  1618
             +T++ R ++DIA ++       + + I+ YM  YGVTA+EA N+F + +E++WKD NE+ 
Sbjct  444   STIICRFMDDIAEHKFNHRREDDCSAIECYMKQYGVTAQEAYNEFNKHIESSWKDVNEEF  503

Query  1619  LRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             L+  P+ + T +L   LN AR+ DV+Y+ + DGYT+  K  K  I S+L++  +I
Sbjct  504   LK--PTEMPTPVLCRSLNLARVMDVLYR-EGDGYTHVGKAAKGGITSLLIDPIQI  555



>emb|CAN68620.1| hypothetical protein VITISV_013313 [Vitis vinifera]
Length=557

 Score =   465 bits (1196),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 237/562 (42%), Positives = 368/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   +F   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSVVLLAPSKNLSPEVGRRCANFH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++      A+KL  ID ++RLG++YHF   IDE+L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDS-AQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSV-VSAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+LYEA+H + H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+      S+ L +QV HAL Q +  G+PR+E+ ++ +VY+ D+S N  LL+ A
Sbjct  179   AFTTTHLQSATKYSSNPLAEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+I M SI DD YD +G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+ ++ E 
Sbjct  299   LTKVIAMTSIIDDIYDVYGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E++KEGRS+ ++Y KE +K  V +Y  E KW   +  P + EY+     +S   +L T
Sbjct  359   EEEMAKEGRSYRLYYAKEAMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLAT  418

Query  1361  ASFLGM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              SF+GM  +VT+E+F+W    P+I+ A+ ++ R+++D+ S++ E+     A+ ++ YM  
Sbjct  419   TSFVGMGDAVTKESFDWIFSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  N+F + V +AWKD NE+ L  IP+AV   IL+ +LN AR+ DV+YKN +DG
Sbjct  479   HGASEQETHNEFNKQVRDAWKDINEECL--IPTAVPMPILMRVLNLARVIDVIYKN-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+   VLK  + S+L++   I
Sbjct  536   YTHSGTVLKDFVTSMLIDPVPI  557



>ref|XP_006475285.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=563

 Score =   465 bits (1196),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 240/545 (44%), Positives = 353/545 (65%), Gaps = 14/545 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV-LKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  + PS+WGD F  +  D +  +  +    + LK ++  ML +    K +  L  ID +
Sbjct  24    SANYHPSIWGDHFLQYTCDTQETDDGSNVKHLELKKEIRRMLKA--DNKPSRTLQLIDAI  81

Query  353   ERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSG-IF  517
             +RLG+SYHF   IDE+L  ++ A+ +  L     D+L   +L FRLLRQ+GY IS+  +F
Sbjct  82    QRLGVSYHFESEIDEILGKMHKASQDSDLCDNENDELYYISLHFRLLRQNGYKISAADVF  141

Query  518   DNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSST  691
               F++ +G FK+SL+ DV+G+L+LYEA+HL  H +  L EA  F+ +HLE I   Q+ S 
Sbjct  142   KKFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHEEDILDEALAFTTSHLESIATHQIRSP  201

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L +QV+HAL Q +H G+ R+E+  +I +Y+E+   N+ LL FAKLDFN LQ  H++EL +
Sbjct  202   LVEQVKHALVQPIHRGLQRLEARQYIPIYQEESPHNEALLTFAKLDFNKLQKLHQKELGD  261

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELDF   LP+ RDR  ECYFW LGVYFE +YS AR +L K+I+M S+ DD YD 
Sbjct  262   ISRWWKELDFAHKLPFIRDRVAECYFWILGVYFEPQYSFARRILTKVISMTSVIDDIYDV  321

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +GK +ELE+FT AI++WDI   ++LP +MK+ Y+ L+D+F E +K+L+ +G+S+ ++Y K
Sbjct  322   YGKIEELELFTSAIERWDISAIDQLPEYMKLCYRALLDVFSEAEKDLAPQGKSYRLYYAK  381

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEW  1408
             E +K +V +Y  E KWC +   P V EY+     +S   +L T SF+GM   VT+E+FEW
Sbjct  382   EAMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEW  441

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                NPR I A++++ R+++DI S++ E+     A+ ++ YM  +G T EEA N+F + V 
Sbjct  442   LFSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVASSVECYMKQHGATEEEACNEFRKQVS  501

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAWKD NED LR  P+ V   +L+ ILN  R+ DV+YK  +DGYT+   VLK  + S+ +
Sbjct  502   NAWKDINEDCLR--PTVVPMPLLMRILNLTRVIDVIYKY-EDGYTHSAVVLKDFVASLFI  558

Query  1769  NSFEI  1783
             N   I
Sbjct  559   NPVPI  563



>ref|XP_006472987.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=620

 Score =   466 bits (1200),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 238/537 (44%), Positives = 348/537 (65%), Gaps = 12/537 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D+   +  + + Q LK ++  ML +  +      L+ ID ++
Sbjct  85    SANFHPSIWGDRFLSYTSDSMEKDDGSAKHQELKEEIRRMLKAYINKPTQNNLDLIDAIQ  144

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  ++ A+ +  LGD    +L   +L FRLLRQHG  IS+ +F  
Sbjct  145   RLGVSYHFESEIDEILGKLHEAHQDCGLGDNENDELYYISLQFRLLRQHGCKISADVFKR  204

Query  524   FQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSSTLG  697
             F++ +G FK+SL+ DV G+L+LYEA+HL  H +  L EA  F+ +HLE I   Q+ S L 
Sbjct  205   FKDSDGNFKTSLAKDVGGMLSLYEATHLGVHEENILDEALAFTTSHLESIAAHQIGSPLA  264

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
             ++V+HAL Q +H G+ R+E+ ++I +Y+E  S N+ LL FAKLDFN LQ  H++EL +  
Sbjct  265   ERVKHALIQPIHRGLQRLEARHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKELGDIS  324

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWWKELDF   LP+ RDR  ECYFW LGVYFE +YS AR +L K+I+M SI DD YD +G
Sbjct  325   RWWKELDFAHKLPFIRDRIAECYFWILGVYFEPQYSFARRILTKVISMTSIIDDIYDVYG  384

Query  1058  KPDELEIFTDAI--QKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             K +ELE+FT  I  ++WDI   ++LP +MK+ Y+ L+D++ E +K+L+ +G+ + +HY K
Sbjct  385   KIEELELFTSTIFFRRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLHYAK  444

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEW  1408
             + +K +V +   E KWC +   P + EY+     +S   +L T SF+GM   VT+E+FEW
Sbjct  445   KAMKNIVKNCFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEW  504

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                NPR I A++++ R+++D+AS+E E+     A+ ++ YM  +G T EEA N+F + V 
Sbjct  505   LFSNPRFIRASSVVCRLMDDMASHEFEQSRGHVASSVECYMKQHGATEEEACNEFRKQVS  564

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
             NAWKD NED LR  P+ V   +L+ ILN  R+ DV+YK  +DGYT+   VLK  I S
Sbjct  565   NAWKDINEDCLR--PTVVPMPLLMRILNLTRVIDVIYKY-EDGYTHSAVVLKSLIIS  618



>gb|AFJ04408.1| 5-epi-aristolochene synthase [Nicotiana tabacum]
Length=466

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/378 (60%), Positives = 284/378 (75%), Gaps = 8/378 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             E+VRPV  F  SPSLWGD+F  F   N+VAE+YA+EI+ LK Q  +ML++    KLA+ L
Sbjct  12    EIVRPVADF--SPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLAT-GMKLADTL  68

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID +ERLGISYHF + IDE+L+ IYN N N    DDLC SAL FRLLRQHG+NIS  I
Sbjct  69    NLIDIIERLGISYHFEKEIDEILDQIYNQNSN---CDDLCISALQFRLLRQHGFNISPEI  125

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  FQ ENGKFK SL++DV GLLNLYEASH++ H D  L++A  FS  HLE   P L S 
Sbjct  126   FSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLKSP  185

Query  692   LGKQVRHALDQSLHNGIPRVESSYFIT-VYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L +QV HAL+Q LH G+PRVE+ +FI+ +Y++++SKN+VLLRFAKLDFNLLQM HKQEL 
Sbjct  186   LKEQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQMLHKQELA  245

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  RWWK+LDFVTTLPYARDR VECYFWALGVYFE +YS+AR+ML K I+M SI DDT+D
Sbjct  246   QVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFD  305

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++G   ELE FTD IQ+WDI + +RLP +MKI YK ++DLF++++KELS  GRS  V + 
Sbjct  306   AYGTVKELEAFTDPIQRWDINEIDRLPDYMKISYKAILDLFKDYEKELSSAGRSHIVFHA  365

Query  1229  KERIKELVSSYNIEVKWC  1282
              ER+++        ++ C
Sbjct  366   IERVEKSRGQIATGIECC  383


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +2

Query  1508  ATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARID  1687
             ATGI+  M DYG+T +EAM KF+EM E AWKD NE +LRP P  V+TE L  ILN ARI 
Sbjct  377   ATGIECCMRDYGITTKEAMTKFQEMAEAAWKDLNEGLLRPTP--VATEFLSRILNLARIV  434

Query  1688  DVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             +V Y +  DGYT+PEKVLKP I ++LV+S +I
Sbjct  435   EVTYIHNLDGYTHPEKVLKPHINALLVDSIDI  466



>ref|XP_002321642.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
 gb|EEF05769.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
Length=553

 Score =   462 bits (1190),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 239/559 (43%), Positives = 366/559 (65%), Gaps = 12/559 (2%)
 Frame = +2

Query  116   QQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMS  292
             Q + E++    +NE++R   ++   PS+WGD+F   +  ++V E    QEI+ L+ Q   
Sbjct  4     QVSQEVVPKAHHNEIIRRTANYH--PSIWGDQFISHLPKDKVHEATELQEIEKLREQFKR  61

Query  293   MLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLF  472
              L++  S   +++L+ ID ++RLG++YHF   I+E L+ IYN   + +  +DL  +AL F
Sbjct  62    ELLAAASNS-SQQLDLIDAIQRLGVAYHFETEIEEALQKIYNNRIDME-DEDLYNTALGF  119

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQHGYN+S  IF+ F+++ G FK S  NDV+G+L LYEA+HL  H +  L EA  F+
Sbjct  120   RLLRQHGYNVSCDIFNKFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALAFT  177

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
               HL+ +    +  L  +V HAL Q +  G+PR+ES  +I++Y+++ S N  LLR AKL+
Sbjct  178   TIHLKSMETSPNCPLTAKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLN  237

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             FNL+Q  HK+EL E  RWWK LDF   LP+ARDR VEC+FW +GVYFE +YS AR +L K
Sbjct  238   FNLVQELHKEELAEITRWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTK  297

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
             +I M SI DD YD +G  +ELE+FT+AI +WD +  ++LP +MKI Y+ L+++F E +++
Sbjct  298   VIAMTSIIDDIYDVYGTLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVFSEIEEK  357

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASF  1369
             ++KEG S+ VHY K+ +K LV +Y  E KW  E   P + EY++    +S   +L T SF
Sbjct  358   VAKEGWSYRVHYGKDAMKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSF  417

Query  1370  LGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             +GM   VT++AF+W   +P+II A+  + R+++D+ S++ E+     A+G++ Y+  YG+
Sbjct  418   IGMGDMVTKQAFDWVFNHPKIIRASETIGRLMDDVKSHKFEQERGHAASGVECYIRQYGL  477

Query  1547  TAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTN  1726
             + +E   +F   V NAWKD NE+ L+  P+A    +L  ILN +R+ DV+YK ++DGYT+
Sbjct  478   SEQEVYKEFHMQVVNAWKDINEECLK--PTAAPMPLLERILNLSRVIDVIYK-EEDGYTH  534

Query  1727  PEKVLKPCIFSVLVNSFEI  1783
               KV+K  + S+L+NS  I
Sbjct  535   VGKVMKNNVASLLINSVPI  553



>ref|XP_004288818.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=560

 Score =   462 bits (1190),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 243/566 (43%), Positives = 368/566 (65%), Gaps = 19/566 (3%)
 Frame = +2

Query  107   LLEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEV---AERYAQEIQVLK  277
             +L  Q+ + L    NN   R   S ++ PS+WGD  R+  ++N +    +   Q IQ LK
Sbjct  7     ILASQSPQTL----NNADTR--RSAKYHPSIWGD--RFLSYNNTMETNMQGKQQVIQQLK  58

Query  278   GQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIY-NANPNFQLGDDLC  454
              +V  ML++        KL  ID ++RLG+SYHF   ID+ ++ I+ N N  +   DDL 
Sbjct  59    EEVKRMLMAPPVETGLGKLELIDDIQRLGVSYHFEYEIDQTMQQIHENLNGTYD-DDDLH  117

Query  455   TSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLK  631
             T AL FRLLRQHGYN+S  +F+ F++ +GKF  SL +DV GL +LYEA+HL+   +  L+
Sbjct  118   TCALRFRLLRQHGYNVSCDMFNKFKDCDGKFDESLHHDVAGLQSLYEATHLRVRGEDFLE  177

Query  632   EAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVL  808
             EA  F+ THL+    +LS  L KQVRHAL+Q L  G+PR+E+ +++++++E   S+N VL
Sbjct  178   EALAFTTTHLQSAANRLSPPLSKQVRHALNQPLRKGLPRLEARHYMSLHQELHGSRNHVL  237

Query  809   LRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSK  988
             LRFAKLDFNLLQ  H++EL +  RWWK+LDF + LP+ARDR +ECYFW LGVYFE KY  
Sbjct  238   LRFAKLDFNLLQQVHQKELSDIARWWKKLDFASKLPFARDRVIECYFWILGVYFEPKYYF  297

Query  989   ARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDL  1168
             AR  L K+I M SI DD YD +G  +EL++FT AI++WDI   + LP +MK  Y+ L+D+
Sbjct  298   ARRTLTKVIAMTSIIDDIYDVYGTLEELDLFTRAIERWDISAMDVLPEYMKFCYEALLDV  357

Query  1169  FEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLY  1348
             + E ++ L+ EG+S+ + Y KE +K  V +Y+ E KW     TP + EY++    +S   
Sbjct  358   YAEAEQGLASEGKSYRIDYAKEAMKRQVRAYHAEAKWFHNNYTPTMDEYMEVALVTSAYS  417

Query  1349  LLITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDY  1525
             +L T SF+GM   VT+++FEW   +P++++A+ ++ R+++DI S++ E+     A+ ++ 
Sbjct  418   MLATTSFVGMGDIVTKDSFEWIFSDPKMVKASAVVCRLMDDIVSHKFEQKRGHVASAVEC  477

Query  1526  YMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKN  1705
             YM  YG T EE + +F + V +AWKD NE+ L   P++V+  +L+ +LN  R+ DV+YK+
Sbjct  478   YMIQYGATEEETIIEFRKQVSDAWKDINEECLH--PTSVNMPLLMRVLNLTRVIDVLYKS  535

Query  1706  KQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              +DGYT+   +LK  + S+LV+   +
Sbjct  536   -EDGYTHAGTILKDFVASLLVDPVTV  560



>emb|CAN83470.1| hypothetical protein VITISV_030783 [Vitis vinifera]
Length=557

 Score =   462 bits (1190),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 236/562 (42%), Positives = 366/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   +F   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSVVLLAPSKNLSPEVGRRCANFH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++      A+KL  ID ++RLG++YHF   IDE+L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDS-AQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSV-VSAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+LYEA+H + H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+      S+ L +QV HAL Q +  G+PR+E+ ++ +VY+ D+S N  LL+ A
Sbjct  179   AFTTTHLQSATKYSSNPLAEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+I M SI DD YD +G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+ ++ E 
Sbjct  299   LTKVIAMTSIIDDIYDVYGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E++KEGRS+ ++Y KE +K  V +Y  E KW   +  P + EY+     +S   +L T
Sbjct  359   EEEMAKEGRSYRLYYAKEAMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLAT  418

Query  1361  ASFLGM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              S +GM  +VT+E F+W    P+I+ A+ ++ R+++D+ S++ E+     A+ ++ YM  
Sbjct  419   TSLVGMGDAVTKETFDWIFSKPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  N+F + V +AWKD NE+ L  IP+AV   IL+ +LN AR+ DV+YKN +DG
Sbjct  479   HGASEQETHNEFNKQVRDAWKDINEECL--IPTAVPMPILMRVLNLARVIDVIYKN-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+   VLK  + S+L++   I
Sbjct  536   YTHSGTVLKDFVTSMLIDPVPI  557



>sp|F6M8H5.1|SAUST_SANAS RecName: Full=Probable sesquiterpene synthase; Short=SauSTPS 
[Santalum austrocaledonicum]
 gb|AEF32535.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=562

 Score =   462 bits (1189),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 346/547 (63%), Gaps = 13/547 (2%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             N + RPV +F   PS+WGD F  Y   D     +  ++++ LK  V   L +I   K  +
Sbjct  18    NMISRPVANF--PPSIWGDRFINYACEDENDQAQKEKQVEELKELVRREL-AITVDKPLQ  74

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDLCTSALLFRLLRQHGY  496
             +LN ID  +RLGI+Y F   I+E LE+IY      N  F+  DDL + AL FRLLRQ+ Y
Sbjct  75    QLNIIDATQRLGIAYLFENEIEESLEHIYLHTYVENTCFEGSDDLYSVALWFRLLRQNDY  134

Query  497   NISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
              +S  +F+ F++N G FK++L  D KGLL LYEA+HL  H +  L +A  F+KT LE + 
Sbjct  135   RVSCDVFNKFRDNEGNFKNNLMEDTKGLLELYEATHLSVHGEEMLDDALEFTKTRLESVV  194

Query  674   PQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
               L+  L +QVRHAL Q LH G+PR+E+ YF  +YE   S N  LL+ AKLDFNLLQ  H
Sbjct  195   SHLNYPLAEQVRHALYQPLHKGLPRLEAVYFFRIYEAHASHNKALLKLAKLDFNLLQSFH  254

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             K+EL +  RWWK LDF    P+ARDR VE YFW LGVYFE +YS AR ++ K+ TM S  
Sbjct  255   KKELSDIARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMISTI  314

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DD YD++G  DELE+FT A+Q+WD+   ++LP +MK  YK+++D++ E + E+  +G  F
Sbjct  315   DDIYDAYGTLDELELFTKAMQRWDVGSLDQLPEYMKPCYKSILDVYNEIEVEMDNQGSLF  374

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-T  1390
              +HY KE +K+LV  Y  E KWC E+  P   EY+     +S    L T S+LGM  + +
Sbjct  375   RMHYAKEVMKKLVEGYMDEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIAS  434

Query  1391  REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK  1570
             +EAF+W   +P +IEA+  + R+++D  S++ E+     A+GI+ YM  YGVT EEA ++
Sbjct  435   KEAFDWLFSHPPVIEASESVGRLMDDTRSHKFEQERGHVASGIECYMKQYGVTEEEARDE  494

Query  1571  FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
             F + +  AWKD NE+ LRP    V   +L+ ILN  R+ DV+YKN +DGYT+ +K +K  
Sbjct  495   FRKRLVKAWKDINEECLRPY--RVPKPLLMRILNLTRVIDVIYKN-EDGYTHVKKAMKDN  551

Query  1751  IFSVLVN  1771
             I S+L++
Sbjct  552   IASLLID  558



>sp|F6M8H6.1|SPIST_SANSP RecName: Full=Probable sesquiterpene synthase; Short=SspiSTPS 
[Santalum spicatum]
 gb|AEF32536.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   462 bits (1189),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 245/548 (45%), Positives = 351/548 (64%), Gaps = 15/548 (3%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFD--NEVAERYAQEIQVLKGQVMSMLVSIRSAKLA  325
             N + RPV +F   PS+WGD F  +  +  NE A++  ++++ LK QV   L +     L 
Sbjct  18    NMISRPVANF--PPSIWGDRFINYACEDENEQAQK-ERQVEELKEQVRRELATAIDKPL-  73

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDLCTSALLFRLLRQHG  493
             ++LN ID  +RLGI+YHF   I+E L++IY      N  F+  DDL + AL FRLLRQ  
Sbjct  74    QQLNIIDATQRLGIAYHFENEIEESLKHIYLHTYVENTCFEGSDDLYSVALWFRLLRQDD  133

Query  494   YNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVI  670
             Y +S  +F  F+++ G FK+SL  D KGLL LYEA+HL  + +  L +A  F+KTHLE++
Sbjct  134   YRVSCDVFKKFRDSEGNFKNSLMEDAKGLLELYEATHLSVNGEEMLDDALEFTKTHLELV  193

Query  671   GPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMH  850
                L+  L +QVRHAL Q  H G+PR+E+ YF  +YE  +S N+ LL+ AKLDFNLLQ  
Sbjct  194   VSHLNYPLAEQVRHALYQPQHKGLPRLEAVYFFRIYEAYDSHNEALLKLAKLDFNLLQSL  253

Query  851   HKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASI  1030
             H +EL    +WWK LDF T  P+ARDR VE YFW LGVYFE +YS AR ++ K+ TM S 
Sbjct  254   HMKELSHMAKWWKSLDFATKFPFARDRLVEGYFWILGVYFEPQYSLARKIIIKVFTMIST  313

Query  1031  FDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRS  1210
              DD YD++G  DEL++FT AIQ+WDI   ++LP +MK  YK+++D++ E ++E+  +G  
Sbjct  314   IDDIYDAYGTLDELKLFTKAIQRWDIGSLDQLPEYMKPCYKSVLDVYNEIEEEMDNQGSL  373

Query  1211  FAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-  1387
             F +HY KE +K++V  Y  E KWC E+  P   EY+     ++    L T S+LGM  + 
Sbjct  374   FRMHYAKEEMKKIVEGYMDEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIA  433

Query  1388  TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMN  1567
             ++EAF+W    P IIEA+  + R+++D+ S+E E+     A+GI+ YM  YGVT EEA +
Sbjct  434   SKEAFDWLFSRPPIIEASESVCRLMDDMRSHEFEQERGHVASGIECYMKQYGVTEEEAHD  493

Query  1568  KFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKP  1747
             KF + +  AWKD NE  LRP P  +   +L+ IL+  R+ DV+YKN +D YT+ +K +K 
Sbjct  494   KFHKRLVKAWKDINEGCLRPYP--MPKPLLMRILSLTRVIDVIYKN-EDWYTHVKKPMKD  550

Query  1748  CIFSVLVN  1771
              I S+L++
Sbjct  551   KIASLLID  558



>ref|XP_004505471.1| PREDICTED: (-)-germacrene D synthase-like [Cicer arietinum]
Length=563

 Score =   462 bits (1189),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 229/543 (42%), Positives = 353/543 (65%), Gaps = 10/543 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIR--SAKLAEKLNFIDT  349
             S  F P++WGD F  +V +    +   ++I +LK +V  MLV +   + +  E+ N ID+
Sbjct  24    SANFHPTIWGDHFIQYVSEPMEIDEIMKQIVMLKEKVSKMLVLMNESATRPLEEANLIDS  83

Query  350   MERLGISYHFHEMIDEMLENIYNA---NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFD  520
             ++RLG+ +HF   I E+L++I+N+   N    L +DL   AL+FRLLRQ GY+I   +F 
Sbjct  84    IQRLGLYHHFEHEIGEVLQHIHNSYVENGAITLNEDLHCVALVFRLLRQQGYHILPDVFK  143

Query  521   NFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
              F+ E G F  +L  DV+G+++L+E +H++ H +  L EA+ F+ +HLE++ PQLS +L 
Sbjct  144   KFKNEQGNFNETLFGDVEGMISLFEVTHMRIHGEDILDEAFVFTSSHLEMMTPQLSLSLA  203

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
              +V H+L   L   +PR+ + Y+I+ YEED S +  LL  AKLDFNLLQ  HK+E  E  
Sbjct  204   AKVNHSLKWPLFKNLPRLVARYYISTYEEDPSHDATLLLLAKLDFNLLQKQHKKEAGELS  263

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             +WWK+LD  T  P+AR+R +E YFW++GVYFE +YS  R ++ K++++ SI DDTYD +G
Sbjct  264   KWWKDLDLETKFPFARNRIIELYFWSMGVYFEPQYSLGRRIMTKVLSLVSIIDDTYDVYG  323

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
               +EL++FTDAI++WDI+  + LP +MK +Y +L+DL+EE ++E++KEGR+ +  Y K  
Sbjct  324   TIEELQLFTDAIERWDIKCMDFLPEYMKCVYNSLLDLYEEIEQEMAKEGRTLSAIYVKNE  383

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSS  1414
             +  LV SY  E KW   +  P V EY+ NG  +S  YLL   SF+GM S+ T+E F W +
Sbjct  384   LIRLVQSYFTEAKWFNSKYIPTVEEYVANGIVTSVNYLLTAISFIGMGSIATQETFRWLT  443

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
               P+I+ A+ ++ R++ND+ S E E+     A+ I+ YM  YGV+ E+A+N+    V NA
Sbjct  444   NRPKIVSASCIIGRLVNDLLSNEFEQKRGHVASAIECYMKQYGVSREDAINEISRQVTNA  503

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD NE++L PI   V   +L+ +LN  R  DV+YK ++DGYT+  ++ K  I S+++N 
Sbjct  504   WKDINENLLHPI--QVPKPLLIRVLNLTRAIDVMYK-EEDGYTHSLRLTKNYIQSIMLNP  560

Query  1775  FEI  1783
              +I
Sbjct  561   CQI  563



>ref|XP_011015484.1| PREDICTED: valencene synthase-like [Populus euphratica]
Length=554

 Score =   462 bits (1188),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/548 (44%), Positives = 359/548 (66%), Gaps = 14/548 (3%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMSMLVSIRSAKLA  325
             +NE++R   +F   PS+WGD+F   +  ++V E    QEI+ L+ Q    L++  S+   
Sbjct  18    HNEIIRRTANFH--PSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLASNSS---  72

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             ++L+ ID ++RLG++YHF   I+E L+ IYN     +  DDL  +AL FRLLRQHGYN+S
Sbjct  73    QQLDLIDAIQRLGVAYHFETEIEEALQYIYNNRIGME-DDDLYNTALGFRLLRQHGYNVS  131

Query  506   SGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF+ F+++ G FK S  NDV+G+L LYEA+HL  H +  L EA   +  HL+ +    
Sbjct  132   CDIFNKFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALALTTIHLKSMATSP  189

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L  +V HAL Q +  G+PR+ES  +I++Y+++ S N  LLR AKL+FNL+Q  HK+E
Sbjct  190   DCPLAAKVSHALKQPIQRGVPRLESRRYISIYQDEPSCNKTLLRLAKLNFNLVQELHKEE  249

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK LDF   LP+ARDR VEC+FW +GVYFE +YS AR +L K+I MASI DD 
Sbjct  250   LAEITRWWKGLDFARRLPFARDRVVECFFWIIGVYFEPQYSLARKILTKVIAMASIIDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD +G  +ELE+FT+AI +WD +  + LP +MKI Y+ L++++ E +++++KEG S+ VH
Sbjct  310   YDVYGTLEELELFTEAIDRWDTKSMDHLPDYMKICYEALLNVYSEMEEKVAKEGWSYRVH  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREA  1399
             Y KE +K LV +Y  E KW  E   P + EY++    +S   +L T SF+GM   VT +A
Sbjct  370   YGKEAMKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFVGMGDMVTEQA  429

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W   +P+II A+  +AR+++D+ S++ E+     A+G++ Y+  YG++ +E   +F  
Sbjct  430   FDWVFNHPKIIRASETIARLMDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHM  489

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              V NAWKD NE+ L+  P+AV   +L  ILN +R+ DV+YK ++DGYT+  KV+K  + S
Sbjct  490   QVVNAWKDINEECLK--PTAVPMPLLERILNLSRVMDVIYK-EEDGYTHVGKVMKNNVAS  546

Query  1760  VLVNSFEI  1783
             +L++S  I
Sbjct  547   LLIDSVPI  554



>gb|AFR42419.1| driminol synthase [Valeriana officinalis]
Length=556

 Score =   462 bits (1188),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 241/555 (43%), Positives = 358/555 (65%), Gaps = 14/555 (3%)
 Frame = +2

Query  146   TNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLA  325
             + +E VRP+ SFQ  PS WGD F  +  D+++ E Y +E + LK QV +ML+ + + +++
Sbjct  7     SEHETVRPLASFQ--PSTWGDLFISYSEDSQLKEVYGKEHECLKQQVKTMLLDVTNYRIS  64

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD---DLCTSALLFRLLRQHGY  496
             EK+ FI+T+ERLG+S+ F   I+ +L  +++A+  FQ G    DL T  + FR+LRQHGY
Sbjct  65    EKIAFINTLERLGVSHEFENEIEGLLHQMFDAHSKFQDGIQHFDLFTLGIYFRILRQHGY  124

Query  497   NISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
              I   +F+  ++ N +FK  L  D  GLL+LYEA+ ++ H +  L EA  F+K  LE I 
Sbjct  125   RIYCDVFNKLKDSNNEFKKELKEDAIGLLSLYEATQVRAHAEEILDEALIFTKAQLESIA  184

Query  674   P--QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 LS  + KQ+ HAL Q+LH GIPRVES +FI+VYEED  KND+LLRF+K+D+N++QM
Sbjct  185   ATSSLSPFVEKQITHALVQALHKGIPRVESRHFISVYEEDPDKNDLLLRFSKIDYNIVQM  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              HKQEL    +WW++ +  T L YAR+R  EC+ W L VY E KYS ARL+L K+I + S
Sbjct  245   LHKQELCHISKWWRDSELETKLTYARNRVAECFLWTLCVYHEPKYSPARLLLGKLINIIS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKE--  1201
               DDTYD++G  +E++IFTD IQ+ D     +LP +MKI+YK ++DLF+E + +LS +  
Sbjct  305   CTDDTYDAYGTLEEVQIFTDVIQRLDRSSMEQLPDYMKILYKAVLDLFDEVEVQLSNQET  364

Query  1202  GRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMK  1381
               ++ + Y KE +K +   Y  E  W  +   PP  EY++N   S    L +T SFLGM 
Sbjct  365   NNTYRMAYAKEELKAIAKCYEKEHIWFRKCHVPPFEEYLENAVVSIGNRLAVTFSFLGMD  424

Query  1382  SVTR-EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
              V   EAFEW+  +P+++++   + R+++D+ S+E E      ATG++ YM ++GV+ EE
Sbjct  425   QVAAVEAFEWAKTDPKMVKSCGKVLRLVDDVMSHEEEDVRGHVATGVECYMKEHGVSREE  484

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             A+ +F + VE AWKD NE+ +   P+ +  ++L  +LN  RI DVVYK  +DGYT+PEK 
Sbjct  485   AVVEFYKRVEYAWKDVNEEFI--TPNHLHIDLLNRVLNLTRIADVVYKF-EDGYTHPEKT  541

Query  1739  LKPCIFSVLVNSFEI  1783
             LK  I ++ V+   I
Sbjct  542   LKHHIMALFVDPVPI  556



>gb|KHG04498.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 gb|KHG30537.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
Length=555

 Score =   461 bits (1187),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/535 (44%), Positives = 348/535 (65%), Gaps = 7/535 (1%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F P +WGD F     D ++      + +  K QV  M++        +KL FID ++RLG
Sbjct  26    FHPGIWGDMF-LNCPDTDIDAATELQYEEFKAQVRKMIMEPVDDS-NQKLPFIDAVQRLG  83

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGK  541
             +SYHF + I++ LENIY    N    +DL T+AL FRLLR+HG++IS   F+ F+ E G 
Sbjct  84    VSYHFEKEIEDELENIYRDTNNNDAENDLYTTALRFRLLREHGFDISCDAFNKFKDEAGN  143

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALD  721
             FK SL++DV+GLL LYEAS+++ H +  L EA +F+   L +  P L   L +QV HAL 
Sbjct  144   FKPSLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQLTLALPTLDHPLSEQVGHALK  203

Query  722   QSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDF  901
             QS+  G+PRVE+  FI++Y++ ES N  LL+FAK+DFNLLQ+ H++EL E  RWWK+LDF
Sbjct  204   QSIRRGLPRVEARNFISIYQDLESHNKSLLQFAKIDFNLLQLLHRKELSEICRWWKDLDF  263

Query  902   VTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIF  1081
                LP+ARDR VE YFW +GVYFE +YS  R ML K+I MASI DDTYDS+   DEL  +
Sbjct  264   TRKLPFARDRVVEGYFWIMGVYFEPQYSLGRKMLTKVIAMASIVDDTYDSYATYDELIPY  323

Query  1082  TDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSY  1261
             T+AI++WDI+  N+LP +MKI YK L+D++EE ++ L+ +GR + V Y K+ +  L  +Y
Sbjct  324   TNAIERWDIKCMNQLPDYMKISYKALLDVYEEMEQLLANQGRQYRVEYAKKAMIRLAQAY  383

Query  1262  NIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIEA  1438
              +E KW  +   P   E+  N   +S   +L   +F+GM  V T E F+W++ +P+II+A
Sbjct  384   LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAANDPKIIKA  443

Query  1439  NTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDI  1618
             +T++ R ++DIA ++       + + I+ YM  YGVTA+EA N+F + +E++WKD NE+ 
Sbjct  444   STIICRFMDDIAEHKFNHRREDDCSAIECYMEQYGVTAQEAYNEFNKHIESSWKDVNEEF  503

Query  1619  LRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             L+  P+ + T +L   LN AR+ DV+Y+ + DGYT+  K  K  I S+L++  +I
Sbjct  504   LK--PTEMPTPVLCRSLNLARVMDVLYR-EGDGYTHVGKAAKGGITSLLIDPIQI  555



>sp|F6M8H7.1|SMST_SANMU RecName: Full=Probable sesquiterpene synthase; Short=SmSTPS [Santalum 
murrayanum]
 gb|AEF32537.1| putative sesquiterpene synthase [Santalum murrayanum]
Length=562

 Score =   462 bits (1188),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 242/547 (44%), Positives = 348/547 (64%), Gaps = 13/547 (2%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             N + RP+ +F   PS+WGD F  Y   D     +  ++++ LK QV   L +     L +
Sbjct  18    NMISRPIANF--PPSIWGDRFINYTCEDENDQTQKERQVEELKEQVRRELAATVDKPL-Q  74

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDLCTSALLFRLLRQHGY  496
             +LN ID  +RLGI+Y F   I+E L++IY      N  F+  DDL + AL FRLLRQ+GY
Sbjct  75    QLNIIDATQRLGIAYLFENEIEESLKHIYLHTYVENNCFEGSDDLYSVALWFRLLRQNGY  134

Query  497   NISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
              +S  +F+ F++N G FK++L  D KGLL LYEA+H+  H +  L +A  F+KT LE + 
Sbjct  135   KVSCDVFNKFRDNEGNFKNNLMEDAKGLLELYEATHVSIHGEEMLDDALEFTKTRLESVV  194

Query  674   PQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
               L+  L +QVRHAL Q LH G+PR+E+ YF  +YE   S N  LL+ AKLDFNLLQ  H
Sbjct  195   SHLNYPLAEQVRHALYQPLHRGLPRLEAVYFFRIYEAHASHNKALLKLAKLDFNLLQSFH  254

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             K+EL +  RWWK LDF    P+ARDR VE YFW LGVYFE +YS AR ++ K+ TM S  
Sbjct  255   KKELSDIARWWKSLDFAAKFPFARDRLVEGYFWVLGVYFEPQYSLARKIIIKVFTMISTI  314

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DD YD++G  DEL++FT A+Q+WD+   ++LP +MK  YK+++D++ E ++E++ +G  F
Sbjct  315   DDIYDAYGTLDELKLFTKAMQRWDVGSLDQLPEYMKPCYKSILDVYNEIEEEMANQGSLF  374

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-T  1390
              +HY KE +K +V  Y  E KWC E+  P   EY+     +S    L T S+LGM  + +
Sbjct  375   RMHYAKEVMKTIVEGYMDEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIAS  434

Query  1391  REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK  1570
             +EAF+W   +P +IEA+  + R+++D+ S++ E+     A+GI+ YM  YGVT EEA ++
Sbjct  435   KEAFDWLFSHPPVIEASESVGRLMDDMRSHKFEQERGHVASGIECYMKQYGVTEEEAHDE  494

Query  1571  FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
             F + +  AWKD NE+ LRP    V   +L  ILN  R+ DV+YKN +DGYT+ +K +K  
Sbjct  495   FRKRLVKAWKDINEECLRPY--RVPKPLLTRILNLTRVIDVIYKN-EDGYTHVKKAMKDN  551

Query  1751  IFSVLVN  1771
             I S+L++
Sbjct  552   IASLLID  558



>ref|XP_010247958.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   461 bits (1187),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 242/573 (42%), Positives = 363/573 (63%), Gaps = 16/573 (3%)
 Frame = +2

Query  83    SSTYSKISLLEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQE  262
             SS  S     +  +SE  K     E++R  T+F   PS+WGD F  +  DN   E Y Q+
Sbjct  2     SSQISSCPPTQHSSSEAEK----TELIRHTTTFH--PSIWGDRFITYTCDNMKLESYNQQ  55

Query  263   IQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF--Q  436
             ++ LK +V S+L +  + K  E L+ ID ++RLG+ Y F   ID+MLE I++A+  +   
Sbjct  56    VEELKEEVRSILRN-SANKPLEMLSLIDGVQRLGLGYQFEREIDKMLEQIFDAHIVYFND  114

Query  437   LGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGH  613
             + D+L   ALLFRLLRQHGYNI   +F  F+ E+GKF+ SL+ D++G+L+LYEA++L   
Sbjct  115   MDDNLNAVALLFRLLRQHGYNIPCDVFKKFRDEDGKFRESLARDIQGMLSLYEAAYLGKR  174

Query  614   NDANLKEAYTFSKTHLE--VIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEED  787
              +  L EA  F+  HL+  V     S TL KQV+HAL+Q LH GIP++E+ ++I+ YEED
Sbjct  175   GEEVLDEALAFTTAHLKSTVATDTTSPTLVKQVKHALEQPLHRGIPKIEARHYISFYEED  234

Query  788   ESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY  967
             +S+  VLL+ AKLDFN  Q+ +  EL +  RWWK +DF +  PYARDR VECYFW+ GVY
Sbjct  235   KSRIQVLLKLAKLDFNRTQLLYLNELSQVSRWWKNIDFTSKTPYARDRLVECYFWSAGVY  294

Query  968   FEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKII  1147
              E +YS  R +LAKII + +I DDTYD++G  +EL++ TDAI++WD  +T++LP +MK+I
Sbjct  295   PEPQYSLGRKILAKIIAITTILDDTYDAYGTFEELQLLTDAIRRWDANETDKLPEYMKVI  354

Query  1148  YKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNG  1327
             Y TL++++ E ++E+ KEGR F V Y KE +K+L+ +Y IE  W  E   P   E+ K G
Sbjct  355   YVTLLNIYNEIEEEMRKEGRCFCVSYAKEAMKDLIEAYQIEATWLKEGHIPTFEEFSKLG  414

Query  1328  QASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRV  1504
               +ST  ++    F  M  + T+E F+W S+ P  +++  ++ R ++DI + E E+    
Sbjct  415   LITSTCIMMTNVIFACMGEMATKEVFDWLSKTPDAVKSTCIIGRFLDDIQTNEFEQERGH  474

Query  1505  NATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARI  1684
               + I+ YM  YGV++EEA N+  ++V NAWK  NE+ +   P+A    +L+ ++NF R+
Sbjct  475   VCSSIECYMKQYGVSSEEAKNELRKLVTNAWKVLNEECI--TPTAAPMPLLMPLVNFTRL  532

Query  1685  DDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              DV+YK+  D +TN    LK  I  +L++   I
Sbjct  533   ADVIYKHG-DAFTNVITGLKTHIKLLLIDPITI  564



>ref|NP_001268028.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74192.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score =   461 bits (1186),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 240/541 (44%), Positives = 359/541 (66%), Gaps = 12/541 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RP+   +F PS+WGD+F  +  ++E   R  +E QV  LK +V   L++  +   ++ LN
Sbjct  19    RPMA--EFHPSIWGDQFIAYTPEDE-DTRACKEKQVEDLKAEVRRELMAA-AGNPSQLLN  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             FID ++RLG++YHF   I+E L++IY+  +      DDL   AL FRLLRQ GYNIS GI
Sbjct  75    FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  134

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F+ E G FK  L ++++G+L LYEA+HL+ H +  L+EA  F+ THL+     L   
Sbjct  135   FNKFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKATVESLGYP  194

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L +QV HAL   +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+EL  
Sbjct  195   LAEQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSN  254

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELDF T LP+ARDR VE YFW LGVYFE +YS+AR +L K+ +MASI DD YD+
Sbjct  255   LARWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSRARRILTKLFSMASIIDDIYDA  314

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  +EL+ FT+AI++WDI+  + LP +MK+ Y TL+DL++E D+EL K G  + V+Y K
Sbjct  315   YGTLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYAK  374

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEW  1408
             E +K  V +Y  E KW  E   P + EY+     +S   +L T SF+GM  + T+EAF+W
Sbjct  375   EVLKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDW  434

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                +P+II A+T++ R+++DI +++ E+     A+GI+ YM  YGV+ E+  ++F + VE
Sbjct  435   VISDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVE  494

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAW   N++ L+  P+AV   +L  ++N +R+ DV+YK + DGYT+  KV+K  I SVL+
Sbjct  495   NAWLGINQECLK--PTAVPMPLLTRVVNLSRVMDVIYK-EGDGYTHVGKVMKDNIGSVLI  551

Query  1769  N  1771
             +
Sbjct  552   D  552



>ref|NP_001268213.1| (-)-germacrene D synthase [Vitis vinifera]
 sp|Q6Q3H3.1|TPSGD_VITVI RecName: Full=(-)-germacrene D synthase [Vitis vinifera]
 gb|AAS66357.1| (-)-germacrene D synthase [Vitis vinifera]
Length=557

 Score =   461 bits (1186),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/562 (42%), Positives = 366/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   +F   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSGVLLAPSKNLSPEVGRRCANFH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++      A+KL  ID ++RLG++YHF   IDE+L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDS-AQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSV-VSAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+LYEA+H + H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSLYEATHFRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+      S+ L +QV HAL Q +  G+PR+E+ ++ +VY+ D+S N  LL+ A
Sbjct  179   AFTTTHLQSATKHSSNPLAEQVVHALKQPIRKGLPRLEARHYFSVYQADDSHNKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFFARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+I M SI DD YD +G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+ ++ E 
Sbjct  299   LTKVIAMTSIIDDIYDVYGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E++KEGRS+ ++Y KE +K  V +Y  E KW   +  P + EY+     +S   +L T
Sbjct  359   EEEMAKEGRSYRLYYAKEAMKNQVRAYYEEAKWLQVQQIPTMEEYMPVALVTSAYSMLAT  418

Query  1361  ASFLGM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              SF+GM  +VT+E+F+W    P+I+ A+ ++ R+++D+  ++ E+     A+ ++ YM  
Sbjct  419   TSFVGMGDAVTKESFDWIFSKPKIVRASAIVCRLMDDMVFHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  N+F + V  AWKD NE+ L  IP+AV   IL+ +LN AR+ DV+YKN +DG
Sbjct  479   HGASEQETPNEFPQPVREAWKDINEECL--IPTAVPMPILMRVLNLARVIDVIYKN-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+   VLK  + S+L++   I
Sbjct  536   YTHFGAVLKDFVTSMLIDPVPI  557



>emb|CDP07837.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   461 bits (1185),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 239/555 (43%), Positives = 353/555 (64%), Gaps = 16/555 (3%)
 Frame = +2

Query  140   MVTNN--EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRS  313
             + +NN  E  RP+  F    ++W D    F  D +  E   +EIQ+LK +V SM+++   
Sbjct  8     LPSNNRQETARPLADF--PENIWADHIAPFTLDKQEYEMCEREIQILKAEVASMVLAT-G  64

Query  314   AKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLL  481
               + E+ +FID +ERLG+S+HF   I+  L+  +N   N  LG+    DL ++AL FRL 
Sbjct  65    KTMTERFDFIDKIERLGVSHHFDIEIENQLQEFFNVYTN--LGEYSAYDLSSAALQFRLF  122

Query  482   RQHGYNISSGIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTH  658
             RQHG+NIS GIFD F    GKFK SL ND +GLL+LYEASH++ H D  L+EA  F+ TH
Sbjct  123   RQHGFNISCGIFDQFIDAKGKFKESLCNDTRGLLSLYEASHVRTHGDKILEEALAFTTTH  182

Query  659   LEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNL  838
             L   GP L STL KQV+HAL+Q LH GIPR E+  +I++YEEDES N VLLR AKLD++L
Sbjct  183   LTSGGPHLDSTLAKQVKHALEQPLHEGIPRYEAWRYISIYEEDESHNKVLLRLAKLDYHL  242

Query  839   LQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIIT  1018
             LQM +K+EL E  RW K L+ V+  PYARDR VECYFWA+G  +E ++S AR+  AK+  
Sbjct  243   LQMSYKEELCEITRWGKGLESVSNFPYARDRFVECYFWAVGTLYEPQHSLARMTFAKVAA  302

Query  1019  MASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSK  1198
             + ++ DD YD++G  DEL+I TD+ ++WD    ++L  ++K  Y TL+   +E  ++L+K
Sbjct  303   LITMIDDIYDAYGTLDELQILTDSAERWDGSGVDQLSDYIKASYATLLKFNKEVGEDLAK  362

Query  1199  EGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM  1378
             + R++A +   E  K+ + +   + +W   +  P  A+YI NG  +   YL+ +A FL M
Sbjct  363   KQRTYAFNKYIEDWKQYMRTNLTQSRWFLTKELPSFADYISNGAITIGAYLIASAGFLDM  422

Query  1379  KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
              S + +   W S NP+++ A +  +R+IND   ++ +K  R ++T ++ YM D+ ++ EE
Sbjct  423   DSASEDVINWMSTNPKLMVAYSTHSRLINDYGGHKFDK-ERGSSTALECYMKDHNISEEE  481

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             A  KF EM+ENAWK  NE+ LRP P  +  + L  +LN AR+ + VYK++ DG+T P  +
Sbjct  482   AAKKFREMIENAWKVMNEECLRPTP--IPRDGLKMLLNIARVGETVYKHRIDGFTEPH-I  538

Query  1739  LKPCIFSVLVNSFEI  1783
             +K  I ++LV+   I
Sbjct  539   IKDHIRAMLVDFMSI  553



>gb|AAF74977.1|AF270425_1 (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=551

 Score =   459 bits (1182),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 239/548 (44%), Positives = 361/548 (66%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  11    LSSNKDEMRPKADFQ--PSIWGDFFLNCPDKNIDAETQKRHQQ----LKEEVRKMIVA-P  63

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+H
Sbjct  64    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREH  121

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             G+N+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  122   GFNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSL  181

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N VLL FAK+DFN++Q+
Sbjct  182   AVASLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQL  241

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  242   LHRKELSEISRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  301

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T+AI++WDI+  + LP +MK  YK L+D++EE ++ +++ GR
Sbjct  302   IVDDTYDSYATYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGR  361

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   
Sbjct  362   QYRVEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  421

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGVTA+EA 
Sbjct  422   VTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  481

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  482   DVFNKHVESAWKDVNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  538

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  539   GGITSLLI  546



>gb|AAX44033.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score =   459 bits (1182),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 239/548 (44%), Positives = 361/548 (66%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDFFLNCPDKNIDAETQKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+H
Sbjct  67    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             G+N+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GFNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N VLL FAK+DFN++Q+
Sbjct  185   AVASLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQL  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEISRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T+AI++WDI+  + LP +MK  YK L+D++EE ++ +++ GR
Sbjct  305   IVDDTYDSYATYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGR  364

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   
Sbjct  365   QYRVEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  424

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGVTA+EA 
Sbjct  425   VTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  484

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  485   DVFNKHVESAWKDVNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  541

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  542   GGITSLLI  549



>gb|AFE56211.1| terpene synthase [Camellia sinensis]
Length=567

 Score =   460 bits (1183),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/547 (43%), Positives = 359/547 (66%), Gaps = 12/547 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             EV R   S  + PS+WGD F  Y     EV  +  Q++Q  K +V  MLV+    + ++K
Sbjct  20    EVTR--RSANYHPSIWGDHFLTYASHAVEVDVKMGQQLQQQKEEVRKMLVAAND-QPSQK  76

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNF---QLGDDLCTSALLFRLLRQHGYNI  502
             LNF D ++RLG+SYHF   ++  L++IY  + +    +  DDL T AL+FRLLRQ GY I
Sbjct  77    LNFTDAIQRLGVSYHFESEMETALQHIYETDYDHHDDKANDDLYTVALMFRLLRQQGYPI  136

Query  503   SSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
             S  +F+ F++ NGK + SL  DV+G+L+LYEA+HL+   +  L EA +F+ THLE   P 
Sbjct  137   SCDVFNKFKDDNGKIRESLIGDVRGMLSLYEAAHLRVRGEDILDEALSFTITHLESAVPN  196

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             LS+ + +QV HAL+Q +H G+ R+E++ +   YE+D+S N+VLL FAKLDFNLLQ  H+ 
Sbjct  197   LSNLVQEQVIHALNQPIHMGLTRLEATRYFFFYEQDDSHNEVLLNFAKLDFNLLQKMHQW  256

Query  860   ELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             EL E  RWWKE DF   + +ARDR VECYFW LGVYFE +Y  AR ML K+I + SI DD
Sbjct  257   ELSEITRWWKEFDFAKKMCFARDRIVECYFWILGVYFEPQYLLARRMLTKVIALTSIIDD  316

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
              YD +   +EL +FTDAI++W+I  T++LP +MK  Y+ L+D++   D+E++++GRS+ +
Sbjct  317   IYDVYATLEELVLFTDAIERWEISATDQLPEYMKPCYQALLDVYNMIDEEMARKGRSYCI  376

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTRE  1396
             HY K  +K LV +Y  E KW  +   P + EY++    +    +L T S +GM + V++E
Sbjct  377   HYAKSAMKILVRAYFEEAKWFHQGNVPSIEEYMRVALVTGAYTMLATTSLVGMGEVVSKE  436

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
             AF+W S +P I++A++++ R+++D+  ++ E+      + ++ +M  YG + EEA+ + +
Sbjct  437   AFDWVSSDPLIVQASSVVCRLMDDMVGHKFEQKRGHIVSAVECHMKQYGASEEEALVELK  496

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             + V NAWKD N++ LR  P+AV   +LL ++N AR+ +V+YK+ +DGYT+    LK  + 
Sbjct  497   KRVTNAWKDINQECLR--PTAVPMPLLLRVVNLARVINVLYKD-EDGYTHSGTKLKGFVT  553

Query  1757  SVLVNSF  1777
             SVL++S 
Sbjct  554   SVLIDSM  560



>sp|Q39760.1|DCS2_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC14; Short=D-cadinene 
synthase XC14 [Gossypium arboreum]
 gb|AAA93065.1| (+)-delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score =   459 bits (1181),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 240/548 (44%), Positives = 360/548 (66%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDLFLNCPDKNIDAETEKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+H
Sbjct  67    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             G+N+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GFNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N VLL FAK+DFN++Q+
Sbjct  185   AVASLDYPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQL  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEISRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T AI++WDI+  + LP +MK  YK L+D++EE ++ ++K GR
Sbjct  305   IVDDTYDSYATYEELIPYTKAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAKHGR  364

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   
Sbjct  365   QYRVEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  424

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGVTA+EA 
Sbjct  425   VTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  484

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  485   DVFNKHVESAWKDVNKEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  541

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  542   GGITSLLI  549



>emb|CBI31274.3| unnamed protein product [Vitis vinifera]
Length=750

 Score =   465 bits (1197),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 240/545 (44%), Positives = 365/545 (67%), Gaps = 18/545 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV   Q+ PS+WGD+F  +  ++EV  R  +E Q+  LK ++   L++  +   +++L 
Sbjct  214   RPVV--QYHPSIWGDQFLSYTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQQLK  269

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL----CTSALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  270   FIDAVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNIS  326

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L
Sbjct  327   CGLFNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESL  386

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+E
Sbjct  387   GYHLAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEE  446

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWKELDF T LP+ARDR VECYFW LGVYFE +Y +AR +L K+I M SI DD 
Sbjct  447   LSNLARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRARRILTKVIAMISILDDI  506

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G P+EL++F +AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG  + VH
Sbjct  507   HDAYGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVH  566

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREA  1399
             Y KE +K  V +Y  E KW  E   P   EY++    SS   +L T SF+GM  + T+EA
Sbjct  567   YAKEVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEA  626

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W + NP+I+ ++  +AR+++DI S++ E+     A+ ++ YM  YGV+ E+   +F++
Sbjct  627   FDWVTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQK  686

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              +ENAW D N++ L+  P+AVS  +L  ILN  R  DVVYK +QD YT+  KV++  I S
Sbjct  687   QIENAWLDINQECLK--PTAVSMPLLARILNLTRAADVVYK-EQDSYTHVGKVMRDNIAS  743

Query  1760  VLVNS  1774
             VL+N+
Sbjct  744   VLINA  748


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = +2

Query  1460  INDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK-FEEMVENAWKDTNEDILRPIPS  1636
             ++DI+S++ E+     A+GI+ YM  YG + EE  N+ F++ V +AW+D NE+ LR  P+
Sbjct  1     MDDISSHKFEQKRGHVASGIECYMKQYGASEEEETNREFQKQVVDAWRDINEEFLR--PT  58

Query  1637  AVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
              V   +L+C+LN +R+ DV+Y    DGYT+  KV+K  + S+L++S
Sbjct  59    VVPMPLLMCVLNLSRVMDVIYTGG-DGYTHVGKVMKNNVASLLIHS  103



>ref|XP_010258444.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=562

 Score =   459 bits (1180),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/564 (42%), Positives = 367/564 (65%), Gaps = 12/564 (2%)
 Frame = +2

Query  116   QQTSEILKMVTNNEVVRPVT---SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQV  286
              Q S    ++   E+ +P     S  F PS+WGD F  +  DN   +   ++ + LK +V
Sbjct  3     HQASSCPPILCLPEIEKPKVVRRSANFHPSIWGDRFTTYTCDNMTLDACNKQAEGLKEEV  62

Query  287   MSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG--DDLCTS  460
               ML++  +   +E L+ IDT++RLG++YHF   IDE+LE++   +  +  G  DDL T 
Sbjct  63    RCMLMNSTNGP-SEILSLIDTIQRLGLAYHFEREIDEILEHMLVTHVGYFNGVDDDLHTI  121

Query  461   ALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEA  637
             AL FRLLRQ+GYNI   IF+ F+++ GKF+  L+ D+KG+L LYEA+HL    +  L EA
Sbjct  122   ALWFRLLRQNGYNIPCDIFNKFKDDHGKFRDGLTRDLKGILGLYEAAHLGIRGEEVLDEA  181

Query  638   YTFSKTHLEV-IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLR  814
               F+   LE  +    SS L KQV HAL+Q  H G+ ++E+ ++I+ YE+DE+ N VLL+
Sbjct  182   LAFTTAQLESSVVTNTSSHLVKQVMHALEQPFHRGMLKLEARHYISFYEQDETHNPVLLQ  241

Query  815   FAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKAR  994
             FAKLDFN LQ  H +EL +  +WWK+LDF   +PYAR+R VECYFW +GVY E +YS  R
Sbjct  242   FAKLDFNRLQPLHLKELSQISKWWKDLDFALKIPYARNRVVECYFWIMGVYPEPQYSLGR  301

Query  995   LMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFE  1174
             ++L K+I M S+ DDTYD +G  +EL++FTDAI++WD+ +T++L  +MK+IY  L+D++ 
Sbjct  302   MILTKVIAMTSVLDDTYDIYGTLEELQLFTDAIERWDVGETDQLLEYMKVIYLALLDVYN  361

Query  1175  EFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLL  1354
             E ++++++EGRS+ V+Y KE +++   +Y +E KW  +   P V EY+     S++  LL
Sbjct  362   EIEEQVNREGRSYCVYYAKEAMRKQARAYLVEAKWFFQGHIPIVEEYMDVALISTSYPLL  421

Query  1355  ITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYM  1531
               ASF+GM  + T+EAF+W S  P +++ ++++ R+++DI ++E E+      + ++ YM
Sbjct  422   AVASFVGMGEIATKEAFDWVSNLPNLVKNSSIICRLMDDIMTHEYEQEKGDVCSSVECYM  481

Query  1532  NDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQ  1711
               YGV+ +E + +F   + NAWKD NE+ LR   +A+   +L  + N AR+ DV+YK+  
Sbjct  482   KQYGVSKQEVVEEFSRSITNAWKDINEECLR--TTAIPKPLLTRVANLARMMDVIYKHG-  538

Query  1712  DGYTNPEKVLKPCIFSVLVNSFEI  1783
             +GYTN E VLK  I S+L++S +I
Sbjct  539   NGYTNAETVLKDHITSLLIDSIKI  562



>dbj|BAP75561.1| linalool synthase [Citrus unshiu]
Length=565

 Score =   459 bits (1180),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/525 (44%), Positives = 346/525 (66%), Gaps = 10/525 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F P++WGD F  +  D + +   + + Q LK ++ +ML +  +     KL+ ID ++
Sbjct  25    SANFDPTIWGDYFLSYTGDFKESGDASVKHQELKKEIRTMLRADINKPTQTKLDLIDDIQ  84

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDD-----LCTSALLFRLLRQHGYNISSGIFD  520
             RLG+SYHF   IDE+L  ++ AN +  LGDD     L   +L FRLLRQ+GY IS+ +F+
Sbjct  85    RLGVSYHFESEIDEILRKMHEANQDCDLGDDENVQELYYISLHFRLLRQNGYKISADVFN  144

Query  521   NFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
             +F++ NG FKS L  D++G+L+LYEA+HL+ H +  L EA TF+ THLE    Q ++ L 
Sbjct  145   SFKDSNGNFKSFLKRDIRGMLSLYEAAHLRVHGENILNEALTFTVTHLESFTSQSNTQLA  204

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
              QV  AL++ +   +PR+E+ +++ +Y++D S N  LL FA LDFN+LQ  H++EL + +
Sbjct  205   AQVNRALNRPIRKSLPRLEAKHYMPIYQKDPSHNKDLLTFAMLDFNILQKQHQEELRDIV  264

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWWK  D    LP+ RDR VE YFW LGVYFE K+  AR +L K+I+MASI DD YD++G
Sbjct  265   RWWKNFDVPNKLPFIRDRVVEGYFWILGVYFEPKFLLARKILTKVISMASIIDDIYDAYG  324

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
               +ELE+F  AI++WD+   + LP +MK+ Y  L+D + EF+K+L+ +G  + + + KE 
Sbjct  325   TIEELELFATAIERWDLSAIDLLPEYMKLCYCALLDAYSEFEKDLASKGILYGLPFAKES  384

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSS  1414
             +K LV SY IE +WC ++  P + EY++    S    LL T+SFLGM+  VT+EAFEW S
Sbjct  385   MKILVRSYIIEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEAFEWVS  444

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
              NP+I++A++++ R+++DI S++ E+     A+ ++ YM  +GV+ EEA+  F E V NA
Sbjct  445   GNPKIVQASSIICRLMDDIVSHKFEQQRGHVASAVECYMKQHGVSEEEAVKVFREKVGNA  504

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
             WKD NE+++R  P  V   +L  +LN AR+ DV+Y+N  D YTNP
Sbjct  505   WKDINEELMR--PPVVPMPLLERVLNLARLMDVLYQN-NDSYTNP  546



>gb|KHG05331.1| delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score =   458 bits (1179),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 239/548 (44%), Positives = 360/548 (66%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDLFLNCPDKNIDAETEKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+H
Sbjct  67    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             G+N+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GFNVSYDVFNKFKDEQGNFKSSMTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N VLL FAK+DFN++Q+
Sbjct  185   AVASLDYPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQL  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEISRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T AI++WDI+  + LP +MK  YK L+D++EE ++ +++ GR
Sbjct  305   IVDDTYDSYATYEELIPYTKAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGR  364

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   
Sbjct  365   QYRVEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  424

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGVTA+EA 
Sbjct  425   VTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  484

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  485   DVFNKHVESAWKDVNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  541

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  542   GGITSLLI  549



>emb|CDP18842.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   458 bits (1179),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 250/548 (46%), Positives = 357/548 (65%), Gaps = 11/548 (2%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
              +E+VR +    F  ++W      F  D +  E  A+EI++LK +V S L++I    + E
Sbjct  13    QHEIVRQLA--DFPENIWAHRIASFTLDKQGYEMCAKEIEMLKEEV-SRLLAIEKP-MME  68

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYNI  502
             K N ID +ERLGISYHF + I++ L+  Y+A  NF+     DL  +AL FRL RQHG+NI
Sbjct  69    KFNLIDNIERLGISYHFGDKIEDQLQEYYDACTNFEKHAECDLSIAALQFRLFRQHGFNI  128

Query  503   SSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
             S GIFD F + NGKFK SL ND+KGLL+LYEA+H++ H D  L+EA  F+ THL    P 
Sbjct  129   SCGIFDGFLDANGKFKESLCNDIKGLLSLYEAAHVRTHGDKILEEALFFTTTHLTREIPN  188

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             + STL K+V+HAL+Q LH GIPR E+  +I++YEEDES N +LLR AKLD++LL M +K+
Sbjct  189   VGSTLAKKVKHALEQPLHKGIPRYEAYCYISMYEEDESSNKLLLRLAKLDYHLLHMLYKR  248

Query  860   ELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             +L E +RW KELD ++ +PYARDR VECYFWA+G Y+E +YS AR+ L K    A + DD
Sbjct  249   DLSEIIRWGKELDIISKVPYARDRIVECYFWAVGTYYEPQYSLARMTLTKATVFAGMIDD  308

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
             TYD++G  DEL+IFT+A+++WD    ++L  +MK  Y  +++  +E +++L+K+ R+FA 
Sbjct  309   TYDAYGTLDELKIFTEAVERWDSSGIDQLSDYMKAAYTLVLNFNKELEEDLAKKKRTFAF  368

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREA  1399
                 E  K+   +   + KW      P  ++Y+ NG  +ST YLL  A+FLGM S + + 
Sbjct  369   DKYIEEWKQYARTSFTQSKWFLANELPSFSDYLSNGMVTSTYYLLSAAAFLGMDSASEDV  428

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
               W S NP+   A T  AR+ ND+ S++ EK  R + T I+ YM DY V+ EEAM KFEE
Sbjct  429   INWMSTNPKFFVALTTHARLANDVGSHKFEK-ERGSGTAIECYMKDYNVSEEEAMEKFEE  487

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
             M E+ WK  NE+ LR   + +  EIL  ILN AR  +VVYK++ DG+T+  ++ +  I +
Sbjct  488   MCEDTWKVMNEECLR--STTIPREILKVILNLARTCEVVYKHRGDGFTDQRRI-EAHINA  544

Query  1760  VLVNSFEI  1783
             +L++S  I
Sbjct  545   MLMDSVSI  552



>ref|XP_007021117.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12642.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   458 bits (1179),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 239/560 (43%), Positives = 363/560 (65%), Gaps = 17/560 (3%)
 Frame = +2

Query  110   LEQQTSEIL----KMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLK  277
             +  Q S++L     ++++N   RP   F   P +WGD F     D ++      + +  K
Sbjct  1     MASQASQVLASTHNVISSNMENRPKADFH--PGIWGDVF-LTCPDKDIDSTAELQYEESK  57

Query  278   GQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCT  457
              +V  MLV+   A   +K + ID ++RLG+ YHF + I++ LE IY  N +    +DL T
Sbjct  58    EEVRRMLVA-PMANSNQKWSLIDAVQRLGVKYHFEKEIEDALEQIYPDNSD---ANDLYT  113

Query  458   SALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKE  634
             +AL FR+LR+HG+++S  IF+ F+++ G FKSSL++DV GLL LYEAS+L+ H +  L E
Sbjct  114   AALRFRILREHGFDVSCDIFNKFKDDKGNFKSSLTSDVHGLLELYEASYLRVHGEDILDE  173

Query  635   AYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLR  814
             A +F+ THL +    L   L +QV HAL QS+  G+PRVE+  +I++Y++DES N  LL+
Sbjct  174   AISFTTTHLTLAAATLDYPLSEQVAHALKQSIRRGLPRVEARQYISLYQDDESHNKALLQ  233

Query  815   FAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKAR  994
             FAK+DFNLLQ+ H++EL E  RWWK+LDF   LP+ARDR VE YFW +GVYFE +YS  R
Sbjct  234   FAKIDFNLLQLLHRKELSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFEPQYSLGR  293

Query  995   LMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFE  1174
              ML K+I MASI DDTYDS+G  DEL ++T+AI++WDI+  ++LP +MKI YK L+D++E
Sbjct  294   RMLTKVIAMASIVDDTYDSYGTYDELILYTEAIERWDIKCIDQLPDYMKISYKALLDVYE  353

Query  1175  EFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLL  1354
             E + +L +EG+ + V Y K+ +  L  +Y +E KW    C P   EY  N   +S   +L
Sbjct  354   EME-QLLEEGKQYRVEYAKKAMIRLAQAYLLEAKWMHANCKPTFEEYKANALPTSGYAML  412

Query  1355  ITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYM  1531
                +F+GM   VT+E F W++++P II A+T++ R ++DIA ++  +    + + I+ Y+
Sbjct  413   AITAFVGMGDVVTQETFNWAAKDPNIIRASTIICRFMDDIAEHKFNQRREDDCSAIECYV  472

Query  1532  NDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQ  1711
               YGV+A+EA ++F + +E++WKD N++ L+P    V   +L   LN AR+ DV+Y+ + 
Sbjct  473   EQYGVSAQEAYDEFNKHIESSWKDVNKEFLKPTEMPVP--VLNRSLNLARVMDVLYR-EG  529

Query  1712  DGYTNPEKVLKPCIFSVLVN  1771
             DGYT+  K  K  I S+L++
Sbjct  530   DGYTHVGKAAKDGITSLLID  549



>gb|EYU31464.1| hypothetical protein MIMGU_mgv1a003909mg [Erythranthe guttata]
Length=555

 Score =   458 bits (1178),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/541 (41%), Positives = 351/541 (65%), Gaps = 10/541 (2%)
 Frame = +2

Query  167   PVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFID  346
             PVT F+  PS+WG  F  F  D++V E Y + I+ +K +V S+L++  S K    L  +D
Sbjct  23    PVTIFK--PSMWGHTFASFSLDHQVQETYEKTIEAIKKKVRSILMAKTSGKPI--LILVD  78

Query  347   TMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNF  526
             T+ RLG++YHF   I+E LE IY  +  F    DL T+AL FRLLRQH + +S  +FD F
Sbjct  79    TLVRLGLAYHFETEIEEKLEQIYKEDEEF----DLFTTALRFRLLRQHRHQVSCSVFDKF  134

Query  527   --QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGK  700
               ++N   +S + NDV+GLL+LYEA+H++   +  L+EA  F+K HL      L S L  
Sbjct  135   TNKDNKLEESLIGNDVEGLLSLYEAAHVRIRGEDILEEAVPFTKHHLTRHMLSLESPLKD  194

Query  701   QVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             +V+ AL  SLH G+P +E+  +I++YE+D+S+++++L+ AKL+FN LQ  +K+EL E  R
Sbjct  195   KVKRALVHSLHRGVPIIEARVYISIYEKDDSRDEIILKLAKLNFNYLQNMYKEELSELYR  254

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WW   D  + LPYARDR +ECY W +  +FE +YS  R  +AK + M SI DDTYD++  
Sbjct  255   WWNNFDLKSKLPYARDRWIECYMWGVAFHFEPQYSYVRNAVAKAMQMVSILDDTYDNYAT  314

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERI  1240
              +E ++FTD +++WD+ +  +LP +MK++Y+ ++ + E +++E +++G+SFA+   KE +
Sbjct  315   LNEAQLFTDVLERWDMNEIGQLPDYMKVVYQFIMSVSEVYEREATQQGKSFAIPSYKEAV  374

Query  1241  KELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQN  1420
             K+L  +YNIE  W  ER  PP+ EY+KN   +S ++++ TA F GMKSVT+E  +W   N
Sbjct  375   KQLARAYNIEQSWIMERKMPPLEEYLKNSVITSCVFVMFTAHFPGMKSVTQETIDWLLSN  434

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+I+ +  ++ R I D+ S+ERE       T +D Y+  YG++ EE ++ FE +VE+AWK
Sbjct  435   PKIVVSTAMIGRHIEDLGSHERENREGKYLTVVDCYIKHYGISKEEVLSMFEVLVEDAWK  494

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             D +++       ++  EI+  ++N+AR+ +V Y+N  DGYT+PEK L P I ++ V+   
Sbjct  495   DISKEWANKTEGSIPKEIVEQLVNYARVAEVTYRNSDDGYTDPEKNLGPHIVALFVDPIV  554

Query  1781  I  1783
             I
Sbjct  555   I  555



>ref|XP_011005622.1| PREDICTED: valencene synthase-like isoform X1 [Populus euphratica]
 ref|XP_011005623.1| PREDICTED: valencene synthase-like isoform X2 [Populus euphratica]
Length=554

 Score =   457 bits (1177),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 237/548 (43%), Positives = 357/548 (65%), Gaps = 14/548 (3%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMSMLVSIRSAKLA  325
             +NE++R   +F   PS+WGD+F   +  ++V E    QEI+ L+ Q    L++  S+   
Sbjct  18    HNEIIRRTANFH--PSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLASNSS---  72

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             ++L+ ID ++RLG++YHF   I+E L++IYN     +  DDL  +AL FRLLRQHGYN+S
Sbjct  73    QQLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIGME-DDDLYNTALGFRLLRQHGYNVS  131

Query  506   SGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF+ F+++ G FK S  NDV+G+L LYEA+HL  H +  L EA   +  HL+ +    
Sbjct  132   CDIFNKFKDDKGYFKQS--NDVRGILGLYEAAHLAVHGEDILDEALALTTIHLKSMATSP  189

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L  +V HAL Q +  G+PR+ES  +I++Y+++ S N  LLR  KL+FNL+Q  HK+E
Sbjct  190   DCPLAAKVSHALKQPIRRGVPRLESRRYISIYQDEPSCNKTLLRLGKLNFNLVQELHKEE  249

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK LDF   LP+ARDR VEC+FW +GVYFE +YS AR +L K+I M SI DD 
Sbjct  250   LAEITRWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD +G  +ELE+FT AI +WD +  + LP +MKI Y+ L++++ E +++++KEG S+ VH
Sbjct  310   YDVYGTLEELELFTAAIDRWDTKSMDHLPDYMKICYEALLNVYSEMEEKVAKEGWSYRVH  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREA  1399
             Y KE +K LV +Y  E KW  E   P + EY++    ++   +L T SF+GM   VT +A
Sbjct  370   YGKEAMKVLVHAYFNEAKWFHENHIPTMEEYMQVALVTTGYCMLATVSFVGMGDMVTEQA  429

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W   +P+II A+  +AR+++D+ S++ E+     A+G++ Y+  YG++ +E   +F  
Sbjct  430   FDWVFNHPKIIRASETIARLMDDVKSHKFEQERGHAASGVECYIRQYGLSEQEVYEEFHM  489

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              V NAWKD NE+ L+  P+AV   +L  ILN +R+ DV+YK ++DGYT+  KV+K  + S
Sbjct  490   QVVNAWKDINEECLK--PTAVPMPLLERILNLSRVMDVIYK-EEDGYTHVGKVMKNNVAS  546

Query  1760  VLVNSFEI  1783
             +L++S  I
Sbjct  547   LLIDSVPI  554



>ref|XP_007021123.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12648.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=557

 Score =   457 bits (1176),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 353/539 (65%), Gaps = 8/539 (1%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S +F PS+WGD F  F     V        + LK +V  ML      +L++KL  I+T++
Sbjct  24    STKFHPSIWGDLFLSFPSKVNVDTTTQLHYEELKQEVRRMLRVPTDNQLSQKLRLIETIK  83

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQEN  535
             RLG+SYHF   I+++L+NIY+ +      D+L  ++L FRLLR+HG+N+    F+ F+++
Sbjct  84    RLGVSYHFEREIEDVLQNIYDQDYK---DDNLEVTSLRFRLLREHGFNVQCETFNKFKDD  140

Query  536   -GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS-TLGKQVR  709
              G FK SL +DVKGLL LYEA+H++ H +  L+EA  F+ THLE     L    +   V 
Sbjct  141   KGNFKVSLKSDVKGLLELYEAAHIRTHGEHILEEALAFTTTHLESAKTSLCEYPISVLVS  200

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
             HA  + +  G+ R+E+  FI++Y+ED S +  LL+FAKLDF+L+Q  HK+EL +  RWWK
Sbjct  201   HARKRPIRKGLQRLEARRFISIYQEDGSHDKTLLKFAKLDFSLVQNLHKEELSKISRWWK  260

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             +LDF   LP+ARDR VE YFW LGVYFE +YS AR +L K I MAS  DD YD++G  +E
Sbjct  261   DLDFKRQLPFARDRLVEGYFWILGVYFEPQYSFARQILTKAIVMASTMDDIYDAYGTFEE  320

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             L++FT AI++WD    +RLP +MK+ YK L+D++EE ++ ++K+ +S+ V Y KE +K+L
Sbjct  321   LQLFTKAIERWDTNCMDRLPAYMKLFYKALLDVYEEMEEVMTKQVKSYRVKYAKEAMKQL  380

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPR  1426
               +Y +E KW  E   P V EY+ N   SS   ++   SF+GM + VT+E F+W+S NPR
Sbjct  381   SQAYFVEAKWYHENYVPTVEEYMTNALVSSGYIMVTVTSFVGMGNVVTKETFQWASNNPR  440

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             I+ A++++AR+++DI S++ E+     A+ I+ YM  +GV+ E+A N+  + +ENAWKD 
Sbjct  441   IVRASSIIARLMDDIVSHKFEQERGHVASAIECYMKQHGVSEEKACNELNKQIENAWKDI  500

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             N++++RP P+ V   +L  ILN AR+ D +YK + DGYT+  + +K  I S++++   I
Sbjct  501   NQELVRP-PAGVPMPVLTRILNLARVMDFLYK-EGDGYTHVGEAVKDGITSLMIDPIPI  557



>emb|CAN78342.1| hypothetical protein VITISV_000109 [Vitis vinifera]
Length=555

 Score =   457 bits (1175),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/545 (43%), Positives = 361/545 (66%), Gaps = 18/545 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV  +     +WGD+F  +  ++EV  R  +E Q+  LK ++   L++  +   +++L 
Sbjct  19    RPVVXYHXX--IWGDQFLSYTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQQLK  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL----CTSALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  75    FIDAVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNIS  131

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L
Sbjct  132   CGLFNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESL  191

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+E
Sbjct  192   GYHLAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEE  251

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWKELDF T LP+ARDR VECYFW LGVYFE +Y + R +L K+I M SI DD 
Sbjct  252   LSNLARWWKELDFATKLPFARDRLVECYFWMLGVYFEPQYLRGRRILTKVIAMISILDDI  311

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             +D++G P+EL++F +AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG  + VH
Sbjct  312   HDAYGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVH  371

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREA  1399
             Y KE +K  V +Y  E KW  E   P   EY++    SS   +L T SF+GM  + T+EA
Sbjct  372   YAKEVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCILATTSFVGMGEIATKEA  431

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W + NP+I+ ++  +AR+++DI S++ E+     A+ ++ YM  YGV+ E+   +F++
Sbjct  432   FDWVTSNPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYKEFQK  491

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              +ENAW D N++ L+  P+AVS  +L  ILN  R  DVVYK +QD YT+  KV++  I S
Sbjct  492   QIENAWLDINQECLK--PTAVSMPLLARILNLTRAADVVYK-EQDSYTHVGKVMRDNIAS  548

Query  1760  VLVNS  1774
             VL+N+
Sbjct  549   VLINA  553



>ref|XP_006475284.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=565

 Score =   457 bits (1175),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/525 (44%), Positives = 347/525 (66%), Gaps = 10/525 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F P++WGD F  +  D + +   + + Q LK ++ +ML +  +     KL+ ID ++
Sbjct  25    SANFDPTIWGDYFLSYTGDFKESGDASVKHQELKKEIRTMLRADINKPSQTKLDLIDDIQ  84

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDD-----LCTSALLFRLLRQHGYNISSGIFD  520
             RLG+SYHF   IDE+L+ ++ AN +  LGDD     L   +L FRLLRQ+GY IS+ +F+
Sbjct  85    RLGVSYHFESEIDEILQKMHEANQDCDLGDDENVQELYYISLQFRLLRQNGYKISADVFN  144

Query  521   NFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
             +F++ NG FKS L  D++G+L+LYEA+HL+ H +  L EA TF+ THLE    Q ++ L 
Sbjct  145   SFKDSNGNFKSFLKRDIRGMLSLYEAAHLRVHGENILNEALTFTVTHLESFTSQSNTQLA  204

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
              QV  AL++ +   +PR+E+ +++ +Y++D S N  LL FA LDFN+LQ  H++EL + +
Sbjct  205   AQVNRALNRPIRKSLPRLEAKHYMPIYQKDPSHNKDLLTFAMLDFNILQKQHQEELRDIV  264

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWWK  D    LP+ RDR VE YFW LGVYFE K+  AR +L K+I+MASI DD YD++G
Sbjct  265   RWWKNFDVPNKLPFIRDRVVEGYFWILGVYFEPKFLLARKILTKVISMASIIDDIYDAYG  324

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
               +ELE+F  AI++WD+   + LP ++K+ Y  L+D + EF+K+L+ +G  + + + KE 
Sbjct  325   TIEELELFATAIERWDLSAIDLLPEYIKLCYCALLDAYSEFEKDLASKGILYGLPFAKES  384

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSS  1414
             +K LV SY IE +WC ++  P + EY++    S    LL T+SFLGM+  VT+EAFEW S
Sbjct  385   MKILVRSYIIEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEAFEWVS  444

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
              NP+I++A++++ R+++DI S++ E+     A+ ++ YM  +GV+ EEA+  F E V NA
Sbjct  445   GNPKIVQASSIICRLMDDIVSHKFEQQRGHVASAVECYMKQHGVSEEEAVKVFREKVGNA  504

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
             WKD NE+++R  P  V   +L  +LN AR+ DV+Y+N  D YTNP
Sbjct  505   WKDINEELMR--PPVVPMPLLERVLNLARLMDVLYQN-NDSYTNP  546



>sp|Q39761.1|DCS1_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC1; Short=D-cadinene 
synthase XC1 [Gossypium arboreum]
 pdb|3G4D|A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4D|B Chain B, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4F|A Chain A, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 pdb|3G4F|B Chain B, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 gb|AAA93064.1| (+)-delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=554

 Score =   456 bits (1174),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 239/548 (44%), Positives = 358/548 (65%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDLFLNCPDKNIDAETEKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T+++ FRLLR+H
Sbjct  67    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSIRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             GYN+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GYNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTHHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ 
Sbjct  185   AVASLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQF  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEICRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T+AI++WDI+  + +P +MK  YK L+D++EE  + +++ GR
Sbjct  305   IVDDTYDSYATYEELIPYTNAIERWDIKCIDEIPEYMKPSYKALLDVYEEMVQLVAEHGR  364

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E KW  +   P   E+  N   +    +L   SF+GM   
Sbjct  365   QYRVEYAKNAMIRLAQSYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  424

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGVTA+EA 
Sbjct  425   VTPETFKWAASDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAY  484

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  485   DVFNKHVESAWKDLNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  541

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  542   GGITSLLI  549



>emb|CBI31262.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   458 bits (1178),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 357/541 (66%), Gaps = 13/541 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RP+   +F PS+WGD+F  +  ++E   R  +E QV  LK +V   L++  +   A+ LN
Sbjct  69    RPMA--EFHPSIWGDQFIAYTPEDE-DTRACKEKQVEDLKAEVRRELMAA-AGNPAQLLN  124

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             FID ++RLG++YHF   I+E L++IY+  +      DDL   AL FRLLRQ GYNIS GI
Sbjct  125   FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  184

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F+ E G FK  L ++V+G+L LYEA+HL+ H +  L+EA  F+ THL+     L   
Sbjct  185   FNKFKDEKGSFKEDLISNVQGMLGLYEAAHLRVHGEDTLEEALAFTTTHLKATVESLGYP  244

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L +QV HAL   +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+EL  
Sbjct  245   LAEQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSN  304

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELDF T LP+ARDR VE YFW LGVYFE +YS AR +L K+  MASI DD YD+
Sbjct  305   LARWWKELDFATKLPFARDRFVEGYFWTLGVYFEPQYSCARRILTKLFAMASIIDDIYDA  364

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  +EL+ FT+AI++WDI+  + LP +MK+ Y TL+DL++E D+EL K G  + V+Y K
Sbjct  365   YGTLEELQPFTEAIERWDIKSIDHLPEYMKLFYVTLLDLYKEIDQELEKYGNQYRVYYAK  424

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEW  1408
             E +K  V +Y  E KW  E   P + EY+     +S   +L T SF+GM  + T+EAF+W
Sbjct  425   E-LKSQVRAYFAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDW  483

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                +P+II A+T++ R+++DI +++ E+     A+GI+ YM  YGV+ E+  ++F + VE
Sbjct  484   VISDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVE  543

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAW   N++ L+  P+AV   +L  ++N +R+ DV+YK + DGYT+  KV+K  I SVL+
Sbjct  544   NAWLGINQECLK--PTAVPMPLLTRVVNLSRVMDVIYK-EGDGYTHVGKVMKDNIGSVLI  600

Query  1769  N  1771
             +
Sbjct  601   D  601



>ref|XP_009338863.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   456 bits (1173),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 241/541 (45%), Positives = 355/541 (66%), Gaps = 11/541 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V RP  S  FSPS+WGD F  +    EV     Q +Q LK +V  ML +     +++KL
Sbjct  19    DVHRPKPSTTFSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRRMLTT-SLENVSQKL  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID ++ LG+SYHF   I+E+L+ I+ ++ +    DDL T+AL FRLLRQ GYNIS  +
Sbjct  77    NLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDL---DDLYTAALRFRLLRQQGYNISCDL  133

Query  515   FDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F++ +GKFK SL +DV GLL+LYEA+HL+ H +  L EA TF++T+LE    +LS  
Sbjct  134   FNKFKDSDGKFKESLVDDVAGLLSLYEATHLRIHGEEILDEALTFTRTNLESATFRLSPP  193

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL 
Sbjct  194   LAKAVTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLMFAKLDFNRLQRVHQKELS  253

Query  869   EHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             E  RWWK+LD    LP+ARDR VE YF W+L VYF+ +YS  R +L K+  +ASI DD Y
Sbjct  254   EITRWWKDLDVPNKLPFARDRLVEVYFCWSLSVYFQPQYSFGRRILCKVTAIASIMDDIY  313

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D+ G  +ELE+FT+AI++WD+   ++LP +MK+ Y+ L++++ E  ++L+ EG+ + +H+
Sbjct  314   DAHGTFEELELFTEAIERWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRIHH  373

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              +E +K  V  +  E K   ++  P + EY+     ++   LLIT SF+GM+  T ++F+
Sbjct  374   AREAMKNQVRGFFDEAKLFRQKHLPSLDEYMSVAIVTNGYALLITLSFVGMEEATIDSFD  433

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W   +P+ ++A + +AR+++DI  ++ E+      + ++ YM  YG T EEA+ + +  V
Sbjct  434   WLLTSPQAVKAASTVARLMDDIVDHKFEQEKEHLVSAVNCYMRKYGATQEEAIIELQRQV  493

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              NAWKD NE  L   P+AV   +L+ ILNFAR+ DVVYK  ++GYTN + VLK  I S L
Sbjct  494   NNAWKDINEACLH--PTAVPMPLLIRILNFARVMDVVYKC-ENGYTNAKGVLKDLIASTL  550

Query  1766  V  1768
             V
Sbjct  551   V  551



>ref|NP_001268204.1| uncharacterized protein LOC100257265 [Vitis vinifera]
 ref|XP_010644042.1| PREDICTED: uncharacterized protein LOC100257265 isoform X1 [Vitis 
vinifera]
 gb|ADR74193.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   456 bits (1173),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/562 (41%), Positives = 367/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   ++   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSVVLLAPSKNLSPEVGRRCANYH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++     + +KL  ID ++RLG++YHF   IDE L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDSV-QKLLLIDAIQRLGVAYHFESEIDEALKHMFDGSVA-SAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+LYEA+HL+ H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSLYEATHLRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+       + L +QV HAL Q +  G+PR+E+ ++ ++Y+ D+S +  LL+ A
Sbjct  179   AFTTTHLQSAAKYSLNPLAEQVVHALKQPIRKGLPRLEARHYFSIYQADDSHHKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFLARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+ITM S  DD YD +G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+D++ E 
Sbjct  299   LTKVITMTSTIDDIYDVYGTLEELELFTEAVERWDISVIDQLPEYMRVCYRALLDVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E++KEGRS+  +Y KE +K+ V +Y  E +W   +  P + EY+    A+S   +L T
Sbjct  359   EEEMAKEGRSYRFYYAKEAMKKQVRAYYEEAQWLQAQQIPTMEEYMPVASATSGYPMLAT  418

Query  1361  ASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              SF+ M   VT+E F+W    P+I+ A+  ++R+++D+ S++ E+     A+ ++ YM  
Sbjct  419   TSFIAMGDVVTKETFDWVFSEPKIVRASATVSRLMDDMVSHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  ++F++ V +AWKD N++ L  +P+AV   +L+ ILN AR+ DVVYK+ +DG
Sbjct  479   HGASEQETRDEFKKQVRDAWKDINQECL--MPTAVPMTVLMRILNLARVMDVVYKH-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+    LK  + S+L++S  I
Sbjct  536   YTHSGTFLKDLVTSLLIDSVPI  557



>ref|XP_004301355.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=554

 Score =   455 bits (1171),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 242/558 (43%), Positives = 355/558 (64%), Gaps = 13/558 (2%)
 Frame = +2

Query  128   EILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSI  307
             ++L   +     RP  ++  +PS+WGD F  +    EV   + Q+ Q LK QV  ML+ +
Sbjct  4     QVLASQSQTPNARPTANY--TPSIWGDHFLSYA-TAEVDFSHKQQFQELKRQVKMMLM-V  59

Query  308   RSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANP--NFQLGDDLCTSALLFRLL  481
                + +EKLN +D ++RLG+SYHF   IDE+LE IY A    + +  DDL T+AL FRLL
Sbjct  60    PVKEPSEKLNLVDDIQRLGVSYHFENEIDEVLEQIYQATHGNDMENDDDLYTTALRFRLL  119

Query  482   RQHGYNISSGIFDNFQENG--KFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKT  655
             RQ GYN+S  IF+ F+E     FK +L +DV GLL+LYEA+HL+ H +  L+EA  F+ T
Sbjct  120   RQQGYNVSCDIFNKFKEGSDQTFKQTLQSDVSGLLSLYEATHLRIHGEDILEEALDFTTT  179

Query  656   HLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFN  835
             HLE I   LS +L KQV H+L+Q L  GI RVE+ Y++++Y E +S N+ LL FAKLDFN
Sbjct  180   HLESIKHSLSHSLSKQVSHSLNQPLRKGIIRVEARYYLSIYHECDSHNETLLTFAKLDFN  239

Query  836   LLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKI  1012
             LLQ  H+ EL E  RWWK+LD    LP+ RDR  E YF WAL + FE +Y+ AR  L K+
Sbjct  240   LLQQVHQIELCEITRWWKDLDVRNELPFTRDRVTEVYFCWALSICFEPEYAFARRTLCKV  299

Query  1013  ITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKEL  1192
               + SI DD YD +G  +ELE+FT+AI++WDIR  + LP +MK+ YK L+D++ E ++EL
Sbjct  300   TALTSILDDIYDLYGTLEELELFTEAIERWDIRVIDALPNYMKVCYKALLDVYTEVEEEL  359

Query  1193  SKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFL  1372
             +KE + + +HY +E +K    SY +E KW  ++  P + EYI     +S   LLIT +F+
Sbjct  360   AKERKLYLIHYAREAMKLQARSYYLEAKWFHQKYIPTMDEYIALSSLTSGYPLLITTTFV  419

Query  1373  GMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVT  1549
              M+ + T++ F+W +  P+ ++ + ++AR+++D+ S++ E+     A+ ++ YM ++G T
Sbjct  420   TMEEITTQDPFDWLATYPKSVKGSAVVARLMDDLVSHKFEQKRGHVASAVECYMKEFGAT  479

Query  1550  AEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
              EE + +    V +AWKD NE  L  +P+ VS  +L  ILNFA + DVVYK  +DGYT  
Sbjct  480   EEETIIELRSKVSDAWKDINESFL--VPNYVSRPLLTRILNFACVMDVVYKY-EDGYTTQ  536

Query  1730  EKVLKPCIFSVLVNSFEI  1783
               +LK  I SVL+    +
Sbjct  537   HGMLKDLITSVLIEQVPV  554



>ref|XP_011080335.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=544

 Score =   454 bits (1168),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 348/544 (64%), Gaps = 5/544 (1%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFD-NEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             VRP T    +P++W D F     D N+V E+YAQ+I+  K +  SML + + ++ A++L 
Sbjct  3     VRP-TIGSSAPTMWADTFTSLSADMNKVQEKYAQDIEAPKEEARSMLTA-KGSRTADRLI  60

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIF  517
              IDT+ERLG++YHF + I++ L+ I+  +P  +   DL T+AL FRLLRQH + +S  +F
Sbjct  61    LIDTLERLGVAYHFEQEIEDQLQEIFQFHPKDENHYDLFTTALQFRLLRQHRHFVSCSVF  120

Query  518   DNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             D F+ E+ KFK +L ND KGLL+LYEA+ L+ H +A L+EA  F+  HL+ +  QL   L
Sbjct  121   DKFKSEDNKFKETLKNDGKGLLSLYEAAQLRIHGEAILEEAVAFTTHHLKRMLQQLECPL  180

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
               QV+ AL  SLH G+PR+E+ +FI+ YE D+SKN +LL+ AKLDFN LQ  +K+EL++ 
Sbjct  181   QDQVKRALQHSLHRGVPRIETRHFISFYERDDSKNQLLLKLAKLDFNYLQNVYKKELHDL  240

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWW E D  + LPYARDR VE YFW + ++F+ + S AR+ +AK   M +  +DTYDS+
Sbjct  241   TRWWNEFDLKSKLPYARDRLVEAYFWGIALHFKPQDSYARVAIAKSTQMITTANDTYDSY  300

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
                +   +FT+ +++WD+ +  +LP +MKI+YK ++ ++E+++ E SK+G+S+AV Y KE
Sbjct  301   ATLENAHLFTEILERWDVNEIYQLPDYMKIVYKFILSIYEDYEIEASKQGKSYAVCYAKE  360

Query  1235  RIKELVSSYNIEVKWCTERCT-PPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWS  1411
              +K+L  +Y+  +KW   +   P   EY+ N   +S +Y+L+T++ L  KS  +E  +W 
Sbjct  361   SVKQLCKAYDKMLKWAMGQVPMPTFEEYVANMMVTSCVYVLLTSNILAAKSAPKETIDWL  420

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
                P+I+ A   + R +ND+ SYERE         +  YM  YGV+ EEA++KF E VE+
Sbjct  421   MSEPKIVAAAAKIGRYLNDLGSYERESKGGNLPVAVRCYMKQYGVSKEEALDKFVEQVED  480

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AWKD N + +          +   +LN+AR  ++ Y+N +DG TNPEK + P + ++ V+
Sbjct  481   AWKDLNTEWITQTSVLGRDIVAEQLLNYARAAEMTYENCEDGITNPEKYMAPQLVALFVD  540

Query  1772  SFEI  1783
                I
Sbjct  541   PIHI  544



>gb|AAR99061.1| (-)-germacrene D synthase [Populus trichocarpa x Populus deltoides]
Length=561

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/542 (43%), Positives = 355/542 (65%), Gaps = 16/542 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  +SPS+WGD F  +  D+ E +++   E + LK +V   L++    K ++ L+FID +
Sbjct  22    SAGYSPSIWGDHFLSYATDSMETSDK--AEHKKLKEEVKRELMA-NINKPSQTLDFIDAI  78

Query  353   ERLGISYHFHEMIDEMLENIYNAN-------PNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             +RLGISYHF   IDE+L  +Y ++        +    +DL   +L FRLLRQ GY IS  
Sbjct  79    QRLGISYHFEIEIDEILREMYKSHCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKISCD  138

Query  512   IFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F  F+ + G F  SL+ND +G+L+LYEA+HL+ H D  L+EA  F+ +HLE +    SS
Sbjct  139   VFGKFKNSQGTFNDSLANDTRGILSLYEATHLRVHGDEVLEEALVFTTSHLEFLATHSSS  198

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L  ++ HAL Q +   IPR+E+ ++ ++Y+ED S ++VLL FAKLDFN+LQ  H++EL 
Sbjct  199   PLRAKINHALKQPVRKNIPRLEARHYFSIYQEDPSCSEVLLNFAKLDFNILQKQHQKELS  258

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             E   WWKELDF   LP+ARDR +ECYFW LGVY E +Y  AR +L K+I M S+ DD YD
Sbjct  259   EIANWWKELDFAKKLPFARDRVIECYFWILGVYLEPEYFLARRILTKVIAMTSVIDDIYD  318

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
              +G P+ELE+FTDAI++W+I   ++LP +MK+ YK L+D++ E ++ +  E RS+ V+Y 
Sbjct  319   VYGTPEELELFTDAIERWEITAVDQLPEYMKVTYKALLDVYTEIEENMVTEERSYRVYYA  378

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFE  1405
             KE +K LV +Y +E KW  ++ TP + EY+     +S   +L   SF+GM   VT+++F+
Sbjct  379   KEAMKNLVRAYYLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHVVTKDSFD  438

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W  + P+I++A+ ++ R+++DI S++ E+     A+ I+ YM  +G T +E +++F + V
Sbjct  439   WLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRKQV  498

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ L   P+AV   +L  +LN AR+ DVVYK+ +DGYTN   VLK  + ++L
Sbjct  499   TDAWKDLNEEFLH--PTAVPMPLLTRMLNLARVIDVVYKD-EDGYTNAGTVLKDLVSALL  555

Query  1766  VN  1771
             ++
Sbjct  556   ID  557



>ref|XP_006478794.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 346/542 (64%), Gaps = 12/542 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D++  +    +   LK ++  ML ++   K +  L  ID ++
Sbjct  24    SANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAVN--KTSHTLELIDAIQ  81

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  ++    +  L     D+L   +L FRL RQ+GY IS+ +F+ 
Sbjct  82    RLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISADVFNT  141

Query  524   FQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGK  700
             F+  +GKFK+SL+ DV+G+L+LYEA+HL+ H +  L EA  F+ +HLE +  Q+ S L +
Sbjct  142   FEGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCSPLAE  201

Query  701   QVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             QV+HAL Q +H G+ R+E+ ++I +Y+ + S N+ LL FAKLDFN LQ  H++EL +  R
Sbjct  202   QVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNGLQKLHQKELGDISR  261

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WWKELDF   LP+ RDR  E YFWA+GV+FE +YS AR +  K+I M SI DD YD +GK
Sbjct  262   WWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFARKLFTKVIYMTSIIDDIYDVYGK  321

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERI  1240
              +EL++FT AI++WDI   ++LP +MK+ Y+ LI+++ E +K+L+ + + + +HY KE +
Sbjct  322   IEELDLFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLASQAKLYRLHYAKEAM  381

Query  1241  KELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQ  1417
             K  V  Y  E KW  +   P V EY+     SS    L   SF+GM   VT+E+FEW   
Sbjct  382   KNQVKHYFFEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFS  441

Query  1418  NPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAW  1597
             NPR I A+  + R++ND+AS++ E+     A+ ++ YMN YG T EEA ++F + V NAW
Sbjct  442   NPRSIRASCAVGRLMNDMASHKFEQSRGHVASSVECYMNQYGATEEEAYSEFRKQVSNAW  501

Query  1598  KDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSF  1777
             KD NE+ LR  P+ V   +L+ ILN  R  DV+YK K DGYT+ E+ LK  I S+L+N  
Sbjct  502   KDINEECLR--PTVVPVPLLIRILNLTRAADVIYKYK-DGYTDSEE-LKDFIVSLLINPV  557

Query  1778  EI  1783
              I
Sbjct  558   PI  559



>ref|XP_006469889.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=562

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 246/559 (44%), Positives = 349/559 (62%), Gaps = 15/559 (3%)
 Frame = +2

Query  137   KMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFD-NEVAERYAQEIQVLKGQVMSMLVSIRS  313
             K++ N+       S  F PS+WGD F  +  D  E  +R  + ++ LK ++  ML ++  
Sbjct  11    KVIQNSGKDSTRRSANFRPSIWGDHFLQYTCDYQETDDRSLKHLE-LKKEIRRMLKALN-  68

Query  314   AKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLL  481
              K +  L  ID ++RLG+SYHF   IDE+L  ++ A     L     D L   +L FRL 
Sbjct  69    -KTSHTLELIDAIQRLGVSYHFESEIDEILGKMHEAYRECDLWDNENDKLYYISLQFRLF  127

Query  482   RQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTH  658
             RQ+GY ISS +F+ F+  +GKF +SL+ DV+G+L+LYEA+HL+ H +  L EA  F+ +H
Sbjct  128   RQNGYRISSDVFNTFKGSDGKFTASLAKDVRGMLSLYEATHLRVHEENILDEALAFTTSH  187

Query  659   LEVIGP-QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFN  835
             LE I   Q+ S L +QV+HAL Q +H G+ R+E+  +I +Y E+ S N+ LL FAKLDFN
Sbjct  188   LESIATHQIRSPLAEQVKHALVQPIHKGLQRLEAREYIPIYHEEPSHNEALLTFAKLDFN  247

Query  836   LLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKII  1015
              LQ  H++EL +  RWWKELDF   LP+ RDR  E YFWA+G YFE ++S AR +  K+I
Sbjct  248   KLQKLHQKELGDISRWWKELDFTHKLPFIRDRVAEGYFWAIGAYFEPQHSFARRLFTKVI  307

Query  1016  TMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELS  1195
             T+ S+ DD YD +GK +ELE+FT AI++WDI   ++LP +MK+ Y  LID++ E +K+L+
Sbjct  308   TLISVIDDIYDVYGKIEELELFTSAIERWDINAIDQLPEYMKLCYGALIDVYSEAEKDLA  367

Query  1196  KEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLG  1375
              +G+ + +HY KE +K LV  Y  E KWC +   P V EY+     +S   +L T SF+G
Sbjct  368   SQGKLYRLHYAKEAMKNLVKHYLFEAKWCHQNYVPTVDEYMAVALITSASLMLSTISFVG  427

Query  1376  MKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTA  1552
             M   VT+E+FEW   NPR I A++++ R++NDI S++ E+     A+ ++ YM  Y  T 
Sbjct  428   MGDIVTKESFEWLFSNPRSIRASSVVNRLMNDIMSHKFEQSRGHVASSVECYMKQYEATE  487

Query  1553  EEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPE  1732
             EEA N+  + V NAWKD NED LR  P+ V   +L+ ILN  R  DV YK   DGYT  E
Sbjct  488   EEAYNELRKQVSNAWKDINEDCLR--PTVVPMPLLMRILNLTRDADVTYK-YDDGYTFAE  544

Query  1733  KVLKPCIFSVLVNSFEI*A  1789
              VLK  I S+ +N   I A
Sbjct  545   -VLKDFIASLFINPVPISA  562



>gb|AAV36464.1| wound-inducible putative cytosolic terpene synthase 1 [Medicago 
truncatula]
 gb|KEH30760.1| sesquiterpene synthase [Medicago truncatula]
Length=562

 Score =   454 bits (1168),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/538 (42%), Positives = 353/538 (66%), Gaps = 9/538 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLV-SIRSAKLAEKLNFIDTM  352
             S  + P++WGD F  +V +    +   ++I +LK +V  MLV ++     + + N ID++
Sbjct  24    SANYHPNIWGDLFIQYVLEPMEFDEIMKQIIMLKEKVRQMLVPNVNVTNPSREANLIDSI  83

Query  353   ERLGISYHFHEMIDEMLENIYN---ANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDN  523
             +RLG+ +HF + I E+L +I N    N    L +DL + AL+FRLLRQ GY+I   +F  
Sbjct  84    QRLGLYHHFEQEIGELLRHIDNNHVENGTITLNEDLHSIALVFRLLRQQGYHILPDVFKK  143

Query  524   FQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGK  700
             F+ E G FK +L  DV+G+L+LYEA+H++ H +  L +A +F+  HLE++  QLS ++  
Sbjct  144   FKNEQGNFKETLVGDVEGMLSLYEATHMRIHGEEILDDALSFTSLHLEMMTTQLSPSVAT  203

Query  701   QVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             ++ H+L + L   +PR+ + ++I+ YEED S +  LL  AKLDFNLLQ  H++E+ +  +
Sbjct  204   KINHSLKRPLFKNLPRLVARHYISTYEEDPSHDATLLLLAKLDFNLLQKQHQKEVGDISK  263

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WWK+LDF T LP+AR+R VE YFW LGVYFE +YS  R ++ K+I++AS+ DD YD +G 
Sbjct  264   WWKDLDFATKLPFARNRIVEAYFWILGVYFEPQYSFGRRIMTKVISLASVIDDIYDVYGT  323

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERI  1240
              +EL++FT AI++WDI   + LP++MK  YK ++D++EE ++E+ KEGR+F V Y K  +
Sbjct  324   IEELQLFTQAIERWDISCMDFLPQYMKFCYKAVLDVYEEMEQEMVKEGRAFCVFYAKNEM  383

Query  1241  KELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQ  1417
             K LV +Y  E KW +    P V EY+  G  +S  YL+   SF+GM  + T + F+W + 
Sbjct  384   KRLVQAYFTEAKWFSRNYIPTVDEYMALGIVNSGYYLITATSFIGMGCIATEDVFQWLTN  443

Query  1418  NPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAW  1597
             NP+I+ A++ +AR+++DI S E E+     A+ I+ YMN++GV+ E+A+N+    V NAW
Sbjct  444   NPKIVNASSKIARLMDDIVSNEFEQERGHGASAIECYMNEHGVSREDAVNELSRQVTNAW  503

Query  1598  KDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             KDTNE++L   P+ V   +L+ +LN +R+ DV+YK+  D YTN +   K  I S+L+N
Sbjct  504   KDTNEELLD--PTEVPKPLLIRVLNLSRVIDVLYKDG-DCYTNSQGSTKNDIISILLN  558



>sp|Q39980.1|VTSS3_HYOMU RecName: Full=Vetispiradiene synthase 3; Short=HVS3, partial 
[Hyoscyamus muticus]
 gb|AAA86339.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=350

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 274/352 (78%), Gaps = 2/352 (1%)
 Frame = +2

Query  728   LHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVT  907
             LH  IPRVE+ YFIT+YEE+E KNDVLLRFAKLDFNLLQM HKQEL E   WWK+LDFVT
Sbjct  1     LHKSIPRVETRYFITIYEEEELKNDVLLRFAKLDFNLLQMLHKQELTEVSMWWKDLDFVT  60

Query  908   TLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTD  1087
             TLPYARDRAVECYFW +GVY E +YS+AR+MLAK I M SI DDT+D++G   ELE++TD
Sbjct  61    TLPYARDRAVECYFWTVGVYAEPQYSEARVMLAKTIAMISIVDDTFDAYGIVKELEVYTD  120

Query  1088  AIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNI  1267
             AIQ+WDI Q +RLP +MKI YK L+DL+++++ ELSK+GRS  VHY KER+KE+V +Y +
Sbjct  121   AIQRWDINQIDRLPDYMKISYKVLLDLYKDYETELSKDGRSEVVHYAKERMKEIVRNYFV  180

Query  1268  EVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTL  1447
             E KW  E   PPV+EY+ N  A+ST YLL T S+LGMK   +E FEW ++NP+I+EAN  
Sbjct  181   EAKWFIEGYMPPVSEYLNNRLATSTYYLLTTTSYLGMKCANKEDFEWLTKNPKILEANVT  240

Query  1448  LARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRP  1627
             L RVI+DIA+YE EK     ATGI+ YM DYGV+ EEAM KF+EM E AWKD NE ILRP
Sbjct  241   LCRVIDDIATYEVEKGRGQIATGIECYMRDYGVSTEEAMEKFQEMAEIAWKDVNEGILRP  300

Query  1628  IPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              P  VS +IL  ILN ARI DV Y + QDGYT+PEKVLKP I +++V+S EI
Sbjct  301   TP--VSAKILTRILNLARIIDVTYLHNQDGYTHPEKVLKPHIIALVVDSIEI  350



>sp|O49853.1|DCS4_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme C2; Short=D-cadinene 
synthase C2 [Gossypium arboreum]
 emb|CAA76223.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=554

 Score =   454 bits (1167),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/545 (43%), Positives = 356/545 (65%), Gaps = 11/545 (2%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             + +N + +RP   FQ  PS+WGD F     D  +     +  Q LK +V  M+V+   A 
Sbjct  14    LSSNKDEIRPKADFQ--PSIWGD-FFLNCPDKNIDAGTEKRHQQLKEEVRKMIVA-PMAN  69

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
               +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+HGYN
Sbjct  70    STQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREHGYN  127

Query  500   ISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +   
Sbjct  128   VSCDVFNKFKDEQGNFKSSVTSDVQGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVS  187

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
              L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ  H+
Sbjct  188   SLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQFLHR  247

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MASI D
Sbjct  248   KELSEICRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVD  307

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             DTYDS+   +EL  +T+AI++WDI+  + LP +MK  YK L+D+++E ++ +++ GR + 
Sbjct  308   DTYDSYATYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYKEMEQLVAEHGRQYR  367

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTR  1393
             V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   VT 
Sbjct  368   VEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTP  427

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YGV+A+EA + F
Sbjct  428   ETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVSAQEAYDVF  487

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
              + VE+AWKD N++  +  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K  I
Sbjct  488   NKHVESAWKDVNQEFQK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAKGGI  544

Query  1754  FSVLV  1768
              S+L+
Sbjct  545   TSLLI  549



>emb|CDP16468.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   453 bits (1166),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 238/550 (43%), Positives = 348/550 (63%), Gaps = 8/550 (1%)
 Frame = +2

Query  122   TSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLV  301
             T   + +   +E++RP+  F     +W D F +F  D +V + YA+EI++LK +V +ML+
Sbjct  4     TEAAVPLQNQSEILRPLPDF--PDDIWSDHFDFFSQDQQVYDMYAKEIKMLKEEVRNMLL  61

Query  302   SIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF-QLGDDLCTSALLFRL  478
             +  +  + EKL+ ID ++RLGISYH+   I  ++E  +    N  +  DDL + AL FRL
Sbjct  62    ATENT-ITEKLSLIDIVQRLGISYHYGAEIANLVEKTFKVYANTKEYPDDLLSVALHFRL  120

Query  479   LRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKT  655
              RQHG+NIS  IF  F E +GKFK SLS D+KGLL+LYEA+ ++ H D  L+EA  F++ 
Sbjct  121   FRQHGFNISESIFYQFVETDGKFKESLSTDIKGLLSLYEAAQVRTHKDIILEEALAFAEA  180

Query  656   HLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFN  835
             +L+ +    S +L KQV + L Q+LH  IPR+E+ ++I+VYEEDE +N +LL+FAKLD+N
Sbjct  181   NLKHVASYTSHSLAKQVNYTLKQALHKCIPRIEARHYISVYEEDECRNQLLLKFAKLDYN  240

Query  836   LLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKII  1015
             LLQM +KQEL E +RW  E + V+ LPY+R R VE YF+ LG++FE ++S  R++ AK  
Sbjct  241   LLQMLYKQELSEIIRWGNESEIVSKLPYSRARLVESYFYGLGMFFEPQHSLGRIISAKTT  300

Query  1016  TMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELS  1195
              + +  DDTYDS+G  DEL  FTDAI++WD ++ +RL   M+  Y  L+++ +  D EL+
Sbjct  301   ALLTAIDDTYDSYGTLDELITFTDAIERWDAKEIDRLSICMRASYLALLNVSDGVDNELT  360

Query  1196  KEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLG  1375
              + RS+A    K+  K+   S  IE  W   R  P   +Y+ NG  +S  YLLI  + L 
Sbjct  361   AQQRSYASDKYKDEWKQYARSSYIEALWFIPRELPAFPDYLSNGLVTSLCYLLIPTALLA  420

Query  1376  MKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAE  1555
             M+  T + ++W S  P+I+ +   + R+ NDI SYEREK  R   TGI+ YM  Y V+  
Sbjct  421   MECATEDVYDWLSNYPKILVSLAKICRLTNDIGSYEREKQYR--GTGIECYMKHYNVSEL  478

Query  1556  EAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEK  1735
             EA  KF ++ E AWKD NE+ L+ + + + TEIL   LN ARI +V YK   DG+TNP  
Sbjct  479   EAKKKFADIAEAAWKDINEEFLK-LSTTIPTEILERFLNLARIVNVFYKQGVDGFTNPHN  537

Query  1736  VLKPCIFSVL  1765
             V++P I  +L
Sbjct  538   VVEPHIIDLL  547



>ref|XP_009358866.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   453 bits (1165),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 240/541 (44%), Positives = 354/541 (65%), Gaps = 11/541 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V RP  S  FSPS+WGD F  +    EV     Q +Q LK +V  ML +     +++KL
Sbjct  19    DVHRPKPSSTFSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRRMLTT-SLENVSQKL  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID ++ LG+SYHF   I+E+L+ I+ ++ +    DDL T+AL FRLLRQ GYNIS  +
Sbjct  77    NLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDL---DDLYTAALRFRLLRQQGYNISCDL  133

Query  515   FDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F++ +GKFK SL +DV GLL+LYEA+HL+ H +  L EA TF++T+LE    +LS  
Sbjct  134   FNKFKDSDGKFKESLVDDVAGLLSLYEATHLRIHGEEILDEALTFTRTNLESATFRLSPP  193

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL 
Sbjct  194   LAKAVTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLMFAKLDFNRLQRVHQKELS  253

Query  869   EHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             E  RWWK+L     LP+ARDR VE YF W+L VYF+ +YS  R +L K+  +ASI DD Y
Sbjct  254   EITRWWKDLGVPNKLPFARDRLVEVYFCWSLSVYFQPQYSFGRRILCKVTAIASIMDDIY  313

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D+ G  +ELE+FT+AI++WD+   ++LP +MK+ Y+ L++++ E  ++L+ EG+ + +H+
Sbjct  314   DAHGTFEELELFTEAIERWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRIHH  373

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              +E +K  V  +  E K   ++  P + EY+     ++   LLIT SF+GM+  T ++F+
Sbjct  374   AREAMKNQVRGFFDEAKLFRQKHLPSLDEYMSVAIVTNGYALLITLSFVGMEEATIDSFD  433

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W   +P+ ++A + +AR+++DI  ++ E+      + ++ YM  YG T EEA+ + +  V
Sbjct  434   WLLTSPQAVKAASTVARLMDDIVDHKFEQEKEHLVSAVNCYMRKYGATQEEAIIELQRQV  493

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              NAWKD NE  L   P+AV   +L+ ILNFAR+ DVVYK  ++GYTN + VLK  I S L
Sbjct  494   NNAWKDINEACLH--PTAVPMPLLIRILNFARVMDVVYKC-ENGYTNAKGVLKDLIASTL  550

Query  1766  V  1768
             V
Sbjct  551   V  551



>gb|AEP17005.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   453 bits (1165),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 364/562 (65%), Gaps = 15/562 (3%)
 Frame = +2

Query  119   QTSEILKMVTNN---EVVRPVTSFQFSPSLWGDEFRYFV--FDNEVAERYAQEIQVLKGQ  283
             Q+S +L   + N   EV R   +F   PS+WGD F  +   F N   +   Q +Q LK +
Sbjct  4     QSSVVLLAPSKNLSPEVGRRCANFH--PSIWGDHFLSYASEFTN-TDDHLKQHVQQLKEE  60

Query  284   VMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA  463
             V  ML++      A+KL  ID ++RLG++YHF   IDE+L+++++ +      +D+ T++
Sbjct  61    VRKMLMAADDDS-AQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSV-VSAEEDVYTAS  118

Query  464   LLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAY  640
             L FRLLRQ GY++S  +F+NF++N G FK SLS+DV+G+L+ YEA+H + H +  L EA 
Sbjct  119   LRFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVRGMLSSYEATHFRVHGEDILDEAL  178

Query  641   TFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFA  820
              F+ THL+      S+ L +QV HAL Q +  G+PR+E+ ++ +VY+  +S N  LL+ A
Sbjct  179   AFTTTHLQSATKYSSNPLAEQVVHALKQPIRKGLPRLEARHYFSVYQAYDSHNKALLKLA  238

Query  821   KLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLM  1000
             KLDFNLLQ  H++EL +   WWK+LDF   LP+ARDR VECYFW LGVYFE ++  AR +
Sbjct  239   KLDFNLLQKLHQKELSDISAWWKDLDFAHKLPFARDRVVECYFWILGVYFEPQFFLARRI  298

Query  1001  LAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF  1180
             L K+I M SI DD YD++G  +ELE+FT+A+++WDI   ++LP +M++ Y+ L+ ++ E 
Sbjct  299   LTKVIAMTSIIDDIYDAYGTLEELELFTEAVERWDISAIDQLPEYMRVCYQALLYVYSEI  358

Query  1181  DKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLIT  1360
             ++E+++EGRS+ ++Y KE +K  V +Y  E KW   +  P + EY+     +S   +L T
Sbjct  359   EEEMAREGRSYRLYYAKEAMKNQVRAYYEEAKWPQVQQIPTMEEYMPVALVTSAYSMLAT  418

Query  1361  ASFLGM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMND  1537
              SF+GM  ++T+E  +W    P+I+ A+ ++ R+++D+  ++ E+     A+ ++ YM  
Sbjct  419   TSFVGMGDALTKETLDWIFSEPKIVRASAIVCRLMDDMVPHKFEQKRGHVASAVECYMKQ  478

Query  1538  YGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDG  1717
             +G + +E  N+F + V +AWKD NE+ L  IP+AV   IL+ +LN AR+ DV+YKN +DG
Sbjct  479   HGASEQETHNEFNKQVRDAWKDINEECL--IPTAVPMPILMRVLNLARVIDVIYKN-EDG  535

Query  1718  YTNPEKVLKPCIFSVLVNSFEI  1783
             YT+   VLK  + S+L++   I
Sbjct  536   YTHSGTVLKDFVTSMLIDPVPI  557



>gb|KDO52415.1| hypothetical protein CISIN_1g008620mg [Citrus sinensis]
Length=559

 Score =   453 bits (1165),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 236/542 (44%), Positives = 346/542 (64%), Gaps = 12/542 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D++  +    +   LK ++  ML ++   K +  L  ID ++
Sbjct  24    SANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAVN--KTSHTLELIDAIQ  81

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  ++    +  L     D+L   +L FRL RQ+GY IS+ +F+ 
Sbjct  82    RLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISADVFNT  141

Query  524   FQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGK  700
             F+  +GKFK+SL+ DV+G+L+LYEA+HL+ H +  L EA  F+ +HLE +  Q+ S L +
Sbjct  142   FEGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCSPLAE  201

Query  701   QVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             QV+HAL Q +H G+ R+E+ ++I +Y+ + S N+ LL FAKLDFN LQ  H++EL +  R
Sbjct  202   QVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNGLQKLHQKELGDISR  261

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WWKELDF   LP+ RDR  E YFWA+GV+FE +YS AR +  K+I M SI DD YD +GK
Sbjct  262   WWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFARKLFTKVIYMTSIIDDIYDVYGK  321

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERI  1240
              +EL++FT AI++WDI   ++LP +MK+ Y+ LI+++ E +K+L+ + + + +HY KE +
Sbjct  322   IEELDLFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLASQAKLYRLHYAKEAM  381

Query  1241  KELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQ  1417
             K  V  Y  E KW  +   P V EY+     SS    L   SF+GM   VT+E+FEW   
Sbjct  382   KNQVKHYFFEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFS  441

Query  1418  NPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAW  1597
             NPR I A+  + R++ND+AS++ E+     A+ ++ Y+N YG T EEA ++F + V NAW
Sbjct  442   NPRSIRASCAVGRLMNDMASHKFEQSRGHVASSVECYINQYGATEEEAYSEFRKQVSNAW  501

Query  1598  KDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSF  1777
             KD NE+ LR  P+ V   +L+ ILN  R  DV+YK K DGYT+ E+ LK  I S+L+N  
Sbjct  502   KDINEECLR--PTVVPVPLLIRILNLTRAADVIYKYK-DGYTDSEE-LKDFIVSLLINPV  557

Query  1778  EI  1783
              I
Sbjct  558   PI  559



>ref|NP_001268024.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74197.1| germacrene D synthase [Vitis vinifera]
Length=584

 Score =   453 bits (1166),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 356/540 (66%), Gaps = 10/540 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERY-AQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             RPVT+F   P++WGD+F  +  +++V      ++I+ LK +V   L +  +A  +  LNF
Sbjct  48    RPVTNFH--PNIWGDQFITYTPEDKVTRACKVEQIEDLKKEVKRKLTAA-TANHSLLLNF  104

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             ID ++RLG++YHF + I+E L++IY +  +   +  DL   AL FRLLRQ GY+IS GI 
Sbjct  105   IDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCGIL  164

Query  518   DNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
               F  E G+FK  L  +V+GLL LYEA+HL+ H +  L EA TF+ THL+ +   L   L
Sbjct  165   KKFTDERGRFKEVLITNVRGLLGLYEAAHLRVHGEDILAEALTFTTTHLKAMVESLGYPL  224

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  H++EL   
Sbjct  225   AEQVVHALNRPIRKGLERIEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHREELSNL  284

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF T LP+ARDR VE YFW LGVYFE +Y +AR +L K+I M SI DD YD++
Sbjct  285   ARWWKELDFATKLPFARDRLVEGYFWILGVYFEPQYLRARRILTKVIAMTSILDDIYDAY  344

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G P+EL++FT+AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG  + VHY KE
Sbjct  345   GNPEELKLFTEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAKE  404

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E KW  E   P + EY++    SS   +L T S +GM  + T+EAF+W 
Sbjct  405   VMKNQVRAYFAEAKWLHEEHVPTIEEYLRVALVSSGYCMLATTSLVGMGEIATKEAFDWV  464

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + +P+I+ ++  +AR+++DI+S++ E+     A+ I+ YM  YGV+ E+A ++F + +EN
Sbjct  465   TSDPKIMSSSNFIARLMDDISSHKFEQKREHVASAIECYMKQYGVSEEQAYSEFRKQIEN  524

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW D N++ L+  P+AV   +L  +LN  R  DV+YK +QD YT+  KV+K  I +  +N
Sbjct  525   AWMDINQECLK--PTAVPMPLLARVLNLTRAADVIYK-EQDSYTHVGKVMKNNIAAFFIN  581



>ref|XP_007021120.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12645.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   452 bits (1163),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 237/560 (42%), Positives = 362/560 (65%), Gaps = 17/560 (3%)
 Frame = +2

Query  110   LEQQTSEIL----KMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLK  277
             +  Q S++L      +++N   RP   F   P +WGD F     + ++      + + LK
Sbjct  1     MASQVSQVLASTHNAISSNMENRPKADFH--PGIWGDVF-LTCPEKDIDTTTELQYEELK  57

Query  278   GQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCT  457
              +V  MLV+       +KL  ID ++RLG++YHF + I++ LE IY+ N +    +DL T
Sbjct  58    EEVSRMLVAPMDNS-NQKLPLIDAVQRLGVNYHFEKEIEDALEQIYHDNSD---ANDLYT  113

Query  458   SALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKE  634
             +AL FR+LR+HG+++S  IF+ F+++ G F SSL++DV+GLL LYEA++L+ H +  L E
Sbjct  114   TALRFRILREHGFDVSCDIFNKFKDDKGNFMSSLTSDVRGLLELYEATYLRVHGEDILDE  173

Query  635   AYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLR  814
             A +F+ THL +    L   L + V HAL QS+  G+PRVE+  +I++Y++DES N  LL+
Sbjct  174   AISFTTTHLTLAAATLDYPLSEHVAHALKQSIRRGLPRVEARRYISLYQDDESHNKALLQ  233

Query  815   FAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKAR  994
             FAK+DFNLLQ+ H++EL E  RWWK+LDF   LP+ARDR VE YFW +GVYFE +YS  R
Sbjct  234   FAKIDFNLLQLLHRKELSEICRWWKDLDFTRKLPFARDRVVEGYFWIMGVYFETQYSLGR  293

Query  995   LMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFE  1174
              ML K+I MASI DDTYDS+G  DEL ++TDAI++WDI+  ++LP +MKI YK L+D++E
Sbjct  294   RMLTKVIAMASIVDDTYDSYGTYDELILYTDAIERWDIKCIDQLPDYMKISYKALLDVYE  353

Query  1175  EFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLL  1354
             E + +L +EG+ + V Y K+ +  L  +Y +E KW      P   EY  N   +S   +L
Sbjct  354   EME-QLLEEGKQYRVEYAKKAMIRLAQAYLLEAKWMHANYKPTFEEYKANALPTSGYAML  412

Query  1355  ITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYM  1531
                +F+GM   VT+E F W++++P II A+T++ R ++DIA ++  +    + + I+ YM
Sbjct  413   AITAFIGMGDVVTQETFNWAAKDPNIIRASTIICRFMDDIAEHKFNQRREDDCSAIECYM  472

Query  1532  NDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQ  1711
               YGV+A+EA ++F + +E++WKD N++ L+P    V   +L   LN AR+ DV+Y+ + 
Sbjct  473   EQYGVSAQEAYDEFNKHIESSWKDVNKEFLKPTEMPVP--VLNRSLNLARVMDVLYR-EG  529

Query  1712  DGYTNPEKVLKPCIFSVLVN  1771
             DGYT+  K  K  I S+L++
Sbjct  530   DGYTHVGKAAKYGITSLLID  549



>gb|KHG16315.1| delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=564

 Score =   452 bits (1164),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 241/563 (43%), Positives = 360/563 (64%), Gaps = 27/563 (5%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E A+R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDLFLNCPDKNIDAETAKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A   +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T+++ FRLLR+H
Sbjct  67    MANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSIRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             GYN+S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GYNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ 
Sbjct  185   AVASLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQF  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEICRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQ----------KWDIRQTNRLPRFMKIIYKTLIDLFEE  1177
             I DDTYDS+   +EL  +T+AI+          +WDI+  + LP +MK  YK L+D++EE
Sbjct  305   IVDDTYDSYATYEELIPYTNAIERLVFFNFAGNRWDIKCIDELPEYMKPSYKALLDVYEE  364

Query  1178  FDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLI  1357
               + +++ GR + V Y K  +  L  SY +E KW  +   P   E+  N   +    +L 
Sbjct  365   MVQLVAEHGRQYRVEYAKNAMIRLAQSYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLA  424

Query  1358  TASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMN  1534
               SF+GM   VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM 
Sbjct  425   ITSFVGMGDIVTPETFKWAASDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYME  484

Query  1535  DYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQD  1714
             +YGVTA+EA + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + D
Sbjct  485   EYGVTAQEAYDVFNKHVESAWKDVNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGD  541

Query  1715  GYTNPEKVLKPCIFSVLVNSFEI  1783
             GYT   K  K  I S+L+    +
Sbjct  542   GYTYVGKAAKGGITSLLIEPIAV  564



>ref|XP_011080337.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=555

 Score =   452 bits (1162),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 237/555 (43%), Positives = 360/555 (65%), Gaps = 4/555 (1%)
 Frame = +2

Query  122   TSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLV  301
             T ++  + +  + VRP  +  F+P++W D F     D++V E+YA+ I+ LK +  SML+
Sbjct  4     TGDVDALTSCPKNVRPPIA-SFAPTMWADTFTSLSLDDKVQEKYAEAIEALKEEARSMLM  62

Query  302   SIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLL  481
             +I S  +A+KL  ID +ERLG++YHF + I++ L+ I+  +   +   DL T+AL FRLL
Sbjct  63    AIGST-IADKLILIDRLERLGVAYHFDQEIEDQLQEIFLFHSKDKNDYDLFTTALQFRLL  121

Query  482   RQHGYNISSGIFDNFQENGKFK-SSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTH  658
             RQH + +S G+FD F++       +LS+D KGLL+LYEA+ ++ H +  L+EA  F+  H
Sbjct  122   RQHRHFVSCGVFDKFKDKDNKFKETLSSDGKGLLSLYEAAQVRVHGEDILEEAVGFTTHH  181

Query  659   LEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNL  838
             L+ +  QL S L +QV+ AL+QSLH G+PR+E+ +FI++Y +D S+ND+LL+ AKLDFN 
Sbjct  182   LKCMVQQLESPLQEQVKRALEQSLHRGVPRIETRHFISLYGKDNSRNDLLLKLAKLDFNF  241

Query  839   LQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIIT  1018
             LQ  +K+ELYE  RWW + D  T LPYARDR VECY W +   FE +YS  R  +AK + 
Sbjct  242   LQNLYKKELYELSRWWDKFDLKTKLPYARDRLVECYLWGMTFRFEPQYSYVRGAVAKGMQ  301

Query  1019  MASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSK  1198
             M SI DDTYD++   +E ++FT+ +++WDI + NRLP +MKI+YK ++ ++++++ E  K
Sbjct  302   MVSIMDDTYDNYATLEEADLFTEILERWDINEINRLPDYMKIVYKFILSIYDDYEVEAIK  361

Query  1199  EGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM  1378
             +G+SFA+ Y KE +K+L  +YN E+KW   R  P   +Y  N   +S +Y++ TA   GM
Sbjct  362   QGKSFAIPYAKEAVKQLGRAYNKELKWFMGRQMPTFEDYFANTVYTSCIYVMFTALIPGM  421

Query  1379  KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
             +S + E  +W    P I+ A   + R + D+ ++ERE  +    T +D YM  YG++ EE
Sbjct  422   QSASEETIDWLMSEPEILIATAKMGRYVEDLGTHERENKDGQMLTAVDCYMKQYGISKEE  481

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
              +NKF E+ E+ WKD N + +    S V  + +  +LN+AR+ +V YKN QDGYTNPEK 
Sbjct  482   TLNKFMELAEDGWKDLNTEWVTKT-STVPKDTVEQLLNYARVAEVTYKNCQDGYTNPEKF  540

Query  1739  LKPCIFSVLVNSFEI  1783
             L P I  VLV+   I
Sbjct  541   LAPQIIVVLVDPIAI  555



>gb|AAX44034.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score =   452 bits (1162),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 232/558 (42%), Positives = 363/558 (65%), Gaps = 14/558 (3%)
 Frame = +2

Query  110   LEQQTSEILK---MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKG  280
             + +Q S++L    + +N + +R    FQ  PS+WGD F     DN++     Q  Q L+G
Sbjct  1     MAKQVSQLLSSSPLTSNKDEMRLKADFQ--PSIWGDLF-LTCLDNDIDAETEQRHQQLEG  57

Query  281   QVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTS  460
              V  M+V+   A   +KL FID+++RLG+SY F + I++ LENIY+ N + +  +DL T+
Sbjct  58    GVRKMIVA-PMANSTQKLTFIDSVQRLGVSYRFTKEIEDELENIYHNNNDAE--NDLYTT  114

Query  461   ALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEA  637
             +L FRLLR+HG+N+S  +F+ F+ E G FKSSL++DV+GLL LYEAS+L+ H +  L EA
Sbjct  115   SLRFRLLREHGFNVSCEVFNKFKDEQGDFKSSLTSDVRGLLELYEASYLRVHGEDILDEA  174

Query  638   YTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRF  817
              +F+  HL +    L   L + V HAL +S+  G+PR+E+ ++++VY++ ES N  LL F
Sbjct  175   ISFTTDHLTLAVATLEYPLSEHVSHALKKSIRRGLPRIEARHYLSVYQDIESHNTALLEF  234

Query  818   AKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARL  997
             AK+DFN+LQ+ H++EL E  RWWK+LDF   LPY RDR VEC+FW LGVYFE +YS  R 
Sbjct  235   AKIDFNMLQLLHRKELSEICRWWKDLDFKRKLPYVRDRVVECFFWILGVYFEPQYSLGRK  294

Query  998   MLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEE  1177
             +L K+I M S+ DDTYDS+   DEL  +T+AI++WDI+  ++LP +MK+ YK L+D++EE
Sbjct  295   ILTKVIAMTSVIDDTYDSYATYDELIPYTNAIERWDIKCIDQLPEYMKLSYKALLDVYEE  354

Query  1178  FDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLI  1357
              ++ ++++GR + V Y K  + +L  ++ +E KW  +   P   E+      ++   +L 
Sbjct  355   MEQLMAEDGRQYRVEYAKNIMIQLAQAFLMEAKWTLQNHKPSFEEFKATALQTTGYAMLA  414

Query  1358  TASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMN  1534
               + + M   VT E F W++ NP+II+A+T++ R ++D+A ++ ++    + +GI+ YM 
Sbjct  415   ITALVDMGDIVTPETFTWAANNPKIIQASTIICRFMDDVAEHKFKQRREDDFSGIECYME  474

Query  1535  DYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQD  1714
             +YGV  +EA N F + +E+AWKD N+  L+  P+ +  E+L  ILN AR+ +V+Y N+ D
Sbjct  475   EYGVMVQEAYNVFYKHIESAWKDVNKGFLK--PTEMPIEVLNRILNLARVMNVLY-NEGD  531

Query  1715  GYTNPEKVLKPCIFSVLV  1768
             GYT   K  K  I  +L+
Sbjct  532   GYTYVGKATKGIISILLI  549



>ref|XP_011080424.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=558

 Score =   452 bits (1162),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 228/548 (42%), Positives = 353/548 (64%), Gaps = 12/548 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V  P+TS+  SPS+WGD F  F  DN+V E++A+ I+ LK +  +ML++  S   A+KL
Sbjct  18    DVRPPITSY--SPSIWGDTFTSFSLDNKVQEKHAEAIKELKEEARNMLLAEGSK--ADKL  73

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNI  502
               IDT+ERLG+ YHF + I+  L  I+ +   F+  D    DL T+AL FRLLRQH Y++
Sbjct  74    VLIDTIERLGVGYHFGQQIENQLREIFQSQ--FEDKDQHHYDLFTTALQFRLLRQHRYSV  131

Query  503   SSGIFDNFQENG-KFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
             S  +F+ F+  G KF+ +LS+D KGLL+LYEA++++ H +  L++A  F+   L+ +  Q
Sbjct  132   SCDVFNKFKGEGNKFEETLSSDAKGLLSLYEAANVRIHGEDVLEDAVAFTTHQLKHMVQQ  191

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             L   L  QV+ AL+Q LH G+PRVE+ ++I+ YE D+SKN +LL+ AKLDFN LQ  +K+
Sbjct  192   LEPVLQCQVKRALEQPLHRGVPRVEARHYISFYEMDKSKNKILLKLAKLDFNYLQNLYKK  251

Query  860   ELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             EL++  RWWKELD +  LPY RDR VE YFW +  +FE +YS  R  + KI+ M ++ DD
Sbjct  252   ELHDLSRWWKELDLILKLPYVRDRLVESYFWGMAFHFEPQYSYVRTTIGKILPMLTVMDD  311

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
             TYD++   +E ++FT+ +++WDI + +RLP +MKIIY+ +++L+E+++ E +K+ + FAV
Sbjct  312   TYDNYATLEEADLFTEILERWDINEIDRLPDYMKIIYRFILNLYEDYEVEATKQDKLFAV  371

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREA  1399
              Y KE +K++  +YN  ++W      P   EYI N   +S +Y ++ A   G+K  ++E 
Sbjct  372   PYAKETLKQVAKAYNQHMQWFMGGQMPTYEEYIVNTVVTSCIYAILLAIIPGIKFASKET  431

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
              +W    P+ + A+T + R  +D+ S ERE       T +D Y   YGV+ ++ ++KF E
Sbjct  432   IDWLMTEPKGLIASTRVCRYADDVGSDEREGKGGTMLTAVDCYAKQYGVSKKQTVDKFNE  491

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
             + E+AWKD N +      S  S  ++  +LN AR+ +V YKN +DGYTNP+K L P I +
Sbjct  492   LFEDAWKDLNTE-WSTKTSTTSNNMMEELLNHARVAEVTYKNGRDGYTNPQKYLAPEIVA  550

Query  1760  VLVNSFEI  1783
             + V+   I
Sbjct  551   LFVDPMVI  558



>ref|XP_002282488.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20289.3| unnamed protein product [Vitis vinifera]
 gb|ADR74225.1| selina-411-diene/intermedeol synthase [synthetic construct]
Length=561

 Score =   452 bits (1162),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/559 (41%), Positives = 357/559 (64%), Gaps = 11/559 (2%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA---QEIQVLKG  280
             L    + IL    + EV R   ++   P+ WGD F ++  D++    +A   Q+IQ LK 
Sbjct  5     LSVSVTPILSQRIDPEVARHEATYH--PNFWGDRFLHYNPDDDFCGTHACKEQQIQELKE  62

Query  281   QVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTS  460
             +V   L +  +   ++ L  ID+++RLG++YHF   I+E L+ +Y         D L T 
Sbjct  63    EVRKSLEAT-AGNTSQLLKLIDSIQRLGLAYHFEREIEEALKAMYQTYTLVDDNDHLTTV  121

Query  461   ALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEA  637
             +LLFRLLRQ GY+I S +F  F  E G FK SL  D+ G+L LYEA+HL  H +  L EA
Sbjct  122   SLLFRLLRQEGYHIPSDVFKKFMDEGGNFKESLVGDLPGMLALYEAAHLMVHGEDILDEA  181

Query  638   YTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRF  817
               F+  HL+ +     + L KQV  AL + +  G+PRVE+ ++IT+Y+ED+S N+ LL+ 
Sbjct  182   LGFTTAHLQSMAIDSDNPLTKQVIRALKRPIRKGLPRVEARHYITIYQEDDSHNESLLKL  241

Query  818   AKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARL  997
             AKLD+N+LQ  H++EL E  +WWK LDF T LP+ARDR VE YFW LGVYFE +Y  AR 
Sbjct  242   AKLDYNMLQSLHRKELSEITKWWKGLDFATKLPFARDRIVEGYFWILGVYFEPQYYLARR  301

Query  998   MLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEE  1177
             +L K+  + SI DD YD++G  +EL++FT+AI++WD    ++LP +MK+ Y+ L+D++EE
Sbjct  302   ILMKVFGVLSIVDDIYDAYGTFEELKLFTEAIERWDASSIDQLPDYMKVCYQALLDVYEE  361

Query  1178  FDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLI  1357
              ++E++K+G+ + VHY +  +K  V +Y +E KW  +   P + EY+ N   SS   +L 
Sbjct  362   MEEEMTKQGKLYRVHYAQAALKRQVQAYLLEAKWLKQEYIPRMDEYMSNALVSSACSMLT  421

Query  1358  TASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMN  1534
             T SF+GM   VT+EAF+W   +P++I A+ ++ R+++DI S+E E+     A+ ++ YM 
Sbjct  422   TTSFVGMGDIVTKEAFDWVFSDPKMIRASNVICRLMDDIVSHEFEQKRGHVASAVECYMK  481

Query  1535  DYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQD  1714
              YGV+ EEA ++F++ VE+AWKD NE+ L+  P+AV   +L  +LNF+R+ DV+YK+ +D
Sbjct  482   QYGVSKEEAYDEFKKQVESAWKDNNEEFLQ--PTAVPVPLLTRVLNFSRMMDVLYKD-ED  538

Query  1715  GYTNPEKVLKPCIFSVLVN  1771
              YT    ++K  +  +L++
Sbjct  539   EYTLVGPLMKDLVAGMLID  557



>gb|KDO69460.1| hypothetical protein CISIN_1g044370mg [Citrus sinensis]
Length=554

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 235/559 (42%), Positives = 349/559 (62%), Gaps = 12/559 (2%)
 Frame = +2

Query  119   QTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAE-RYAQEIQVLKGQVMSM  295
             Q  +I      ++V+R   +F   PS+WGD F  +  ++++   R  +E++ LK +V   
Sbjct  4     QVPQISSQNAKSQVMRRTANFH--PSVWGDRFANYTAEDKMNHARDLKELKALKEEVGRK  61

Query  296   LVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNAN-PNFQLGDDLCTSALLF  472
             L++        +LN ID ++RLG+ YHF   +++ L+++YN    +    DDL   +L F
Sbjct  62    LLATAGPI---QLNLIDAIQRLGVGYHFERELEQALQHLYNEKYSDDDTEDDLYRISLRF  118

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQHGYN+S   F+ F+++ G FK SL++D  G+L+LYEA+HL  H +  L EA  F+
Sbjct  119   RLLRQHGYNVSCDKFNMFKDDKGNFKESLASDALGMLSLYEAAHLGVHGEDILDEAIAFT  178

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
              THL+ +   LS+ L  QVRHAL Q LH G+PR+E   +I++Y++D S    LL  AKLD
Sbjct  179   TTHLKSVATHLSNPLKAQVRHALRQPLHRGLPRLEHRRYISIYQDDASHYKALLTLAKLD  238

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             FNL+Q  HK+EL E  RWWK+LDF   LP+ARDR VECYFW LGVYFE  YS AR +L K
Sbjct  239   FNLVQSLHKKELCEISRWWKDLDFARKLPFARDRMVECYFWILGVYFEPNYSLARRILTK  298

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
             +I M SI DD YD +G P+EL++FT+ I++WD    ++LP +M+  +  L+DL+ E +KE
Sbjct  299   VIAMTSIIDDIYDVYGTPEELKLFTEVIERWDESSMDQLPEYMQTFFGALLDLYNEIEKE  358

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASF  1369
             ++ EG S+ V Y KE +K LV  Y  E KW  E   P + EY++    +S   +L T SF
Sbjct  359   IANEGWSYRVQYAKEAMKILVEGYYDESKWFHENYIPKMEEYMRVALVTSGYTMLTTVSF  418

Query  1370  LGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             LGM + VT+E F+W    P+II A+ ++ R ++DI S++ E+     A+ ++ YM  +G+
Sbjct  419   LGMDNIVTKETFDWVFSRPKIIRASEIIGRFMDDIKSHKFEQERGHAASAVECYMKQHGL  478

Query  1547  TAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTN  1726
             + +E   +    V NAWKD NE+ L   P+AV   +L+  LN AR+ DVVYK + DGYT+
Sbjct  479   SEQEVCEELYRQVSNAWKDINEECLN--PTAVPMPLLMRALNLARVIDVVYK-EGDGYTH  535

Query  1727  PEKVLKPCIFSVLVNSFEI  1783
                 +K  + ++L++   I
Sbjct  536   VGNEMKQNVAALLIDQVPI  554



>gb|KHG01539.1| delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=583

 Score =   452 bits (1163),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 239/571 (42%), Positives = 363/571 (64%), Gaps = 38/571 (7%)
 Frame = +2

Query  146   TNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLA  325
             +N + +RP ++    PS+WGD F    + N  AE   +  Q LK +V  M+V+   A   
Sbjct  16    SNKDEMRPKSNIP-PPSIWGDVFLNCPYKNIDAET-EKHHQQLKEEVRKMIVA-PMANST  72

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             +KL FID+++RLG+SYHF + I++ LENIY+ + + +  +DL T++L FRLLR+HG+N+S
Sbjct  73    QKLPFIDSVQRLGVSYHFTKEIEDELENIYHNDNDAE--NDLYTTSLRFRLLREHGFNVS  130

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               +F+ F+ E G FKSS+++DV+GLL LYEAS+++ H +  L EA +F+  HL ++   L
Sbjct  131   CEVFNKFKDEQGNFKSSVTSDVRGLLELYEASYMRVHGEDILDEAISFTTNHLSLVVASL  190

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L +QV HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ+ H++E
Sbjct  191   DYPLSEQVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKSLLEFAKIDFNMLQLLHRKE  250

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             + E  RWWK+LDF   LPYARDR VECYFW LGVYFE +YS  R M  K++ M S  DDT
Sbjct  251   ISEICRWWKDLDFKRKLPYARDRVVECYFWILGVYFEPQYSLGRKMTTKVLAMTSHLDDT  310

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YDS+   DEL I+  AI++W+I+  ++LP +MK+ YK L+D++EE ++ +++ GR + V 
Sbjct  311   YDSYATYDELIIYRSAIERWEIKCIDQLPEYMKLNYKALLDVYEEMEQLVAEHGRQYCVE  370

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREA  1399
             Y K  + +L+  Y +E KW  +   P   E+  N  +SS   +L   SF+GM   +T E 
Sbjct  371   YAKNAMIQLLQFYFMEAKWALQNYKPSFEEFKANAVSSSGYAMLAITSFVGMGDMITPET  430

Query  1400  FEWSSQNPRIIEANTLLARVINDIA----------------------------SYEREKY  1495
             F+W+  NP+IIEA+T++ R  +D+                             +Y+  + 
Sbjct  431   FKWAVSNPKIIEASTIICRFTDDVTEHKFKHRREDEWSTIDYYMKEYGATAQEAYDFNQR  490

Query  1496  NRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNF  1675
                  + IDYYM +YGVTA+EA + F + +E+AWKDTN++ L+  P  + TE+L   LN 
Sbjct  491   REDEWSTIDYYMKEYGVTAQEAYDVFNKHIESAWKDTNQEFLK--PREMPTEVLNRSLNL  548

Query  1676  ARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             +R+ DV YK + DGYT+ +K +K  I S+L+
Sbjct  549   SRVMDVFYK-EGDGYTHVKKPIKDAITSLLL  578



>ref|XP_006478792.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=559

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 343/542 (63%), Gaps = 12/542 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D++  +    +   LK ++  ML +  + K +  L  ID ++
Sbjct  24    SANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKA--ANKTSHTLELIDAIQ  81

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDD----LCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  ++    +  L D+    L   +L FRL RQ+GY IS+ +F+ 
Sbjct  82    RLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNA  141

Query  524   FQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGK  700
             F   +GKF +SL+ DV+G+L+ YEA+HL+ H +  L EA  F+ +HLE +  Q+SS L +
Sbjct  142   FMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVAKQVSSPLAE  201

Query  701   QVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             QV+HAL Q +H G+ R+E+ ++I +Y+ + S N+ LL FAKLDFN LQ  H++EL +  R
Sbjct  202   QVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLDFNRLQKLHQKELGDISR  261

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WWKELDF   LP+ RDR  E YFWA+GVYFE +YS AR +  K++ M SI DD YD +GK
Sbjct  262   WWKELDFAHKLPFVRDRIAEGYFWAVGVYFEPQYSFARKLFTKVVYMTSIIDDIYDVYGK  321

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERI  1240
              +ELE+FT AI++WDI   ++LP +MK+ Y+ LI+++ E +K+L  +G+   +HY KE +
Sbjct  322   IEELELFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLVSQGKLSRLHYAKEAM  381

Query  1241  KELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQ  1417
             K  V  Y  E KW  +   P V EY+     SS    L T SF+GM   VT+E+FEW   
Sbjct  382   KNQVKHYFFEAKWYHQNYVPTVDEYMTVALISSAHPNLSTISFVGMGDIVTKESFEWLFS  441

Query  1418  NPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAW  1597
             NPR I A+  + R++ND+ S++ E+     A+ ++ YMN YG T EEA ++F + V NAW
Sbjct  442   NPRSIRASCAVGRLMNDMVSHKFEQSRGHVASSVECYMNQYGATEEEAYSEFRKQVSNAW  501

Query  1598  KDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSF  1777
             KD NE+ LR  P+ V   +L+ ILN  R  DVVYK K DGYT+ E+ LK  I S+L+N  
Sbjct  502   KDINEECLR--PTLVPVPLLMRILNLTRAADVVYKYK-DGYTDTEE-LKDFIASLLINPV  557

Query  1778  EI  1783
              I
Sbjct  558   PI  559



>ref|XP_010645872.1| PREDICTED: LOW QUALITY PROTEIN: valencene synthase [Vitis vinifera]
Length=556

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/540 (42%), Positives = 360/540 (67%), Gaps = 9/540 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV-LKGQVMSMLVSIRSAKLAEKLNF  340
             RPV ++   P++WGD+F  ++ +++V     +E  V LK +V   L +   A  ++ LNF
Sbjct  19    RPVANYH--PNIWGDQFISYIPEDKVTRACKEEQFVDLKKEVKRKLTAAAVANPSQLLNF  76

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             ID ++RLG++YHF + I+E L++I N+  +   +  DL   AL FRLLRQ GY+IS GIF
Sbjct  77    IDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISCGIF  136

Query  518   DNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F  E G+FK +L +DV+G+L LYEA+HL+ H +  + +A  F+ THL+ +   L   L
Sbjct  137   NKFMDERGRFKEALISDVRGMLCLYEAAHLRVHGEDIIAKALAFTTTHLKAMVESLGYHL  196

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+EL   
Sbjct  197   AEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSNL  256

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF T LP+ARDR VECYFW LGVYFE +Y + R +L K+I M SI DD +D++
Sbjct  257   ARWWKELDFATKLPFARDRLVECYFWILGVYFEPQYLRGRRILTKVIAMTSILDDIHDAY  316

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G P+EL++F +AI++WDI   ++LP +MK+ Y +L+D+++E ++E+ KEG  + VHY KE
Sbjct  317   GTPEELKLFKEAIERWDINSIDQLPEYMKLCYASLLDVYKEIEEEMEKEGNQYRVHYAKE  376

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E KW  E   P + +Y++    SS   +L+T S +GM  + T+EAF+W 
Sbjct  377   VMKNQVRAYFAEAKWLHEEHVPTIEDYMRVALVSSGYCMLVTTSLVGMGEIATKEAFDWM  436

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + +P+I+ ++  +AR+++DI S++ E+     A+G++ YM  YG + EE  +KF++ VE+
Sbjct  437   TSDPKIMSSSNFIARLMDDIKSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQKQVED  496

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             A KD NE+ LR  P+AV   +L+ +LN +R+  V+Y    DGYT+  KV+K  + S+L++
Sbjct  497   ACKDINEEFLR--PTAVPMPLLMRVLNLSRVMYVIYTGG-DGYTHVGKVMKNNVASLLIH  553



>emb|CBI31305.3| unnamed protein product [Vitis vinifera]
Length=645

 Score =   454 bits (1167),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 356/540 (66%), Gaps = 10/540 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERY-AQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             RPVT+F   P++WGD+F  +  +++V      ++I+ LK +V   L +  +A  +  LNF
Sbjct  109   RPVTNFH--PNIWGDQFITYTPEDKVTRACKVEQIEDLKKEVKRKLTAA-TANHSLLLNF  165

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             ID ++RLG++YHF + I+E L++IY +  +   +  DL   AL FRLLRQ GY+IS GI 
Sbjct  166   IDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCGIL  225

Query  518   DNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
               F  E G+FK  L  +V+GLL LYEA+HL+ H +  L EA TF+ THL+ +   L   L
Sbjct  226   KKFTDERGRFKEVLITNVRGLLGLYEAAHLRVHGEDILAEALTFTTTHLKAMVESLGYPL  285

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  H++EL   
Sbjct  286   AEQVVHALNRPIRKGLERIEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHREELSNL  345

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF T LP+ARDR VE YFW LGVYFE +Y +AR +L K+I M SI DD YD++
Sbjct  346   ARWWKELDFATKLPFARDRLVEGYFWILGVYFEPQYLRARRILTKVIAMTSILDDIYDAY  405

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G P+EL++FT+AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG  + VHY KE
Sbjct  406   GNPEELKLFTEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQYRVHYAKE  465

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E KW  E   P + EY++    SS   +L T S +GM  + T+EAF+W 
Sbjct  466   VMKNQVRAYFAEAKWLHEEHVPTIEEYLRVALVSSGYCMLATTSLVGMGEIATKEAFDWV  525

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + +P+I+ ++  +AR+++DI+S++ E+     A+ I+ YM  YGV+ E+A ++F + +EN
Sbjct  526   TSDPKIMSSSNFIARLMDDISSHKFEQKREHVASAIECYMKQYGVSEEQAYSEFRKQIEN  585

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW D N++ L+  P+AV   +L  +LN  R  DV+YK +QD YT+  KV+K  I +  +N
Sbjct  586   AWMDINQECLK--PTAVPMPLLARVLNLTRAADVIYK-EQDSYTHVGKVMKNNIAAFFIN  642



>ref|XP_010241001.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   451 bits (1159),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 238/573 (42%), Positives = 358/573 (62%), Gaps = 16/573 (3%)
 Frame = +2

Query  83    SSTYSKISLLEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQE  262
             SS  S     +  +SE  K     E++R  T+F   PS+WGD F  +  DN   E Y Q+
Sbjct  2     SSQISSCPPTQHSSSEAEK----TELIRHTTNFH--PSIWGDRFITYTCDNMKLESYNQQ  55

Query  263   IQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF--Q  436
             ++ LK +V S+L +  + K  E L+ ID ++RLG+ YHF   I++MLE I++A+  +   
Sbjct  56    VEELKEEVRSILRN-SANKPLEMLSLIDAVQRLGLGYHFEREINKMLEQIFDAHIVYFND  114

Query  437   LGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGH  613
             + D+L   ALLFRLLRQHGYNI   +F  F+ E+GK + SL+ D++G+L+LYEA++L   
Sbjct  115   MDDNLNAVALLFRLLRQHGYNIPCDVFKKFKDEDGKLRESLARDIQGMLSLYEAAYLGKR  174

Query  614   NDANLKEAYTFSKTHLE--VIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEED  787
              +  L EA  F+  HL+  V     S TL KQV+HAL+Q LH GIP++E+ ++I+ YEED
Sbjct  175   GEEVLDEALAFTTAHLKSTVATDTTSPTLVKQVKHALEQPLHRGIPKIEARHYISFYEED  234

Query  788   ESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY  967
             +S+N VLL+ AKLDFN  Q+ +  EL +  RWWK +DF +  PYARDR  ECYFW+ G  
Sbjct  235   KSRNQVLLKLAKLDFNRTQLLYLNELSQVSRWWKNIDFTSKTPYARDRLAECYFWSAGAL  294

Query  968   FEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKII  1147
              E +YS  R  LAKI+ + +I DDTYD++G  +EL++ TDAI++WD  +T++LP +MK+I
Sbjct  295   PEPQYSLGRKTLAKIVAINTILDDTYDAYGTFEELQLLTDAIRRWDANETDKLPEYMKVI  354

Query  1148  YKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNG  1327
             Y TL+D++ E ++E+ KEGR F V Y KE +K+L+ +Y IE  W  E   P   E+ K G
Sbjct  355   YVTLLDIYNEIEEEMRKEGRCFCVSYAKEAMKDLIEAYQIEATWLKEGHIPTFEEFSKLG  414

Query  1328  QASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRV  1504
               +ST  ++    F  M  + T+E F+W S+ P  ++++ ++ R  +DI + E E+    
Sbjct  415   LITSTYIMMTNVIFACMGEMATKEVFDWLSKTPDAVKSSCIIGRFSDDIMTNEFEQERGH  474

Query  1505  NATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARI  1684
               + I+ YM  YGV+ EEA N+  ++V  AWK  NE+ +   P+A    +L+ ++N AR+
Sbjct  475   VCSAIECYMKQYGVSREEANNELRKIVTKAWKVLNEECI--TPTAAPMPLLIPVVNLARL  532

Query  1685  DDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              +VVYK+  D +TN    LK  I  +L++   I
Sbjct  533   IEVVYKHG-DAFTNVTTGLKTHIKLLLIDPITI  564



>gb|ADX01384.1| germacrene D synthase [Citrus hystrix]
Length=541

 Score =   450 bits (1157),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 236/543 (43%), Positives = 345/543 (64%), Gaps = 14/543 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFD-NEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  F PS+WGD F  +  D  E  +R  + ++ LK ++  ML ++   K +  L  ID +
Sbjct  6     SANFHPSIWGDHFLQYTRDFQETGDRSVKHLE-LKKEIRRMLKAVN--KTSHTLELIDAI  62

Query  353   ERLGISYHFHEMIDEMLENIYNANPNFQL----GDDLCTSALLFRLLRQHGYNISSGIFD  520
             +RLG+SYHF   IDE+L  ++    +  L     D+L   +L FRL RQ+GY IS+ +F+
Sbjct  63    QRLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNGYRISADVFN  122

Query  521   NFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLG  697
              F+  +GKFK+SL+ DV+G+L+LYEA+HL+ H +  L EA  F+ +HLE +  Q+ S L 
Sbjct  123   TFKGSDGKFKASLAKDVRGMLSLYEATHLRVHGENILDEALAFTTSHLESVAKQVCSPLV  182

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
             +QV+HAL Q +H G+ R+E+ ++I +Y+ + S N+ LL FAKL FN LQ  H++EL +  
Sbjct  183   EQVKHALVQPIHKGLERLEARHYIPIYQGESSHNEALLTFAKLGFNGLQKLHQKELGDIS  242

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWWKELDF   LP+ RDR  E YFWA+GV+FE +YS  R +  K+I M SI DD YD +G
Sbjct  243   RWWKELDFAHKLPFVRDRIAEVYFWAVGVHFEPQYSFTRKLFTKVIYMTSIIDDIYDVYG  302

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
             K +EL++FT AI++WDI   ++LP +MK+  + LI+++ E +K+L  +G+ + +HY KE 
Sbjct  303   KIEELDLFTSAIERWDINAIDQLPEYMKLCIRALINVYSEVEKDLVSQGKLYRLHYAKEA  362

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSS  1414
             +K  V  Y  E KWC +   P V EY+     SS    L T SF+G+   VT+E+FEW  
Sbjct  363   MKNQVKHYFFEAKWCHQNYVPTVDEYMTVALISSGHPNLSTISFVGLGDIVTKESFEWLF  422

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
              NPR I A+  + R++ND+ S++ E+     A+ ++ Y+N YG T EEA ++F + V NA
Sbjct  423   SNPRSIRASCAVGRLMNDMVSHKFEQSRGHVASSVECYINQYGATEEEAYSEFRKQVSNA  482

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD NE+ LR  P+ V   +L+ ILN  R  DV+YK K DGYT  E+ LK  I S+L+N 
Sbjct  483   WKDINEECLR--PTVVPVPLLMRILNLTRAADVIYKYK-DGYTYSEE-LKDFIVSLLINP  538

Query  1775  FEI  1783
               I
Sbjct  539   VPI  541



>sp|P93665.1|DCS1_GOSHI RecName: Full=(+)-delta-cadinene synthase; Short=D-cadinene synthase 
[Gossypium hirsutum]
 gb|AAC12784.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score =   450 bits (1157),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 236/548 (43%), Positives = 357/548 (65%), Gaps = 17/548 (3%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             + +N + +RP   FQ  PS+WGD F        D E  +R+ Q    LK +V  M+V+  
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGDFFLNCPDKNIDAETQKRHQQ----LKEEVRKMIVA-P  66

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQH  490
              A    KL FID+++ LG+SYHF + I++ LENIY+ N + +  +DL T++L FRLLR+H
Sbjct  67    MANSTLKLAFIDSVQGLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTTSLRFRLLREH  124

Query  491   GYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             G+++S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +
Sbjct  125   GFHVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHLSL  184

Query  668   IGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQM  847
                 L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N VLL FAK+DFN++Q+
Sbjct  185   AVASLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKVLLEFAKIDFNMVQL  244

Query  848   HHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
              H++EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MAS
Sbjct  245   LHRKELSEISRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMAS  304

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             I DDTYDS+   +EL  +T+AI++WDI+  + LP +MK  YK L+D++EE ++ +++ GR
Sbjct  305   IVDDTYDSYATYEELIPYTNAIERWDIKCIDELPEYMKPSYKALLDVYEEMEQLVAEHGR  364

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-  1384
              + V Y K  +  L  SY +E +W  +   P   E+  N   +    +L   SF+GM   
Sbjct  365   QYRVEYAKNAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDI  424

Query  1385  VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAM  1564
             VT E F+W++ +P+II+A+T++ R ++D+  ++ +     + + I+ YM +YGVTA+EA 
Sbjct  425   VTPETFKWAANDPKIIQASTIICRFMDDVTEHKFKHRREDDCSAIECYMEEYGVTAQEAY  484

Query  1565  NKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLK  1744
             + F + VE+AWKD N+  L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K
Sbjct  485   DVFNKHVESAWKDVNQGFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAK  541

Query  1745  PCIFSVLV  1768
               I S+L+
Sbjct  542   GGITSLLI  549



>ref|XP_008232170.1| PREDICTED: (-)-germacrene D synthase-like [Prunus mume]
Length=559

 Score =   450 bits (1157),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 236/550 (43%), Positives = 359/550 (65%), Gaps = 20/550 (4%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKL  322
              T+N++ R   S  FSPS+WG  F  +    E + +  Q  Q LK +V  M++     K 
Sbjct  17    ATSNDINR--RSANFSPSVWGSHFLSYA-SVETSIKAKQRAQELKEKV-KMILMAPVKKP  72

Query  323   AEKLNFIDTMERLGISYHFHEMIDEMLENIYNAN-----PNFQLGD-DLCTSALLFRLLR  484
             ++KL+ I  ++RLG+S+HF   I+E+L+ I+N++     P  Q  D +L T+AL FRLLR
Sbjct  73    SQKLDLIQDIQRLGVSHHFENEIEELLQKIHNSSHDSTEPGDQETDNELYTAALRFRLLR  132

Query  485   QHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL  661
             Q GYNIS  IF+NF++ +GKFK SL NDV GLL+LYEA+HL+ H +  L EA  F+ THL
Sbjct  133   QQGYNISCDIFNNFKDSDGKFKESLVNDVLGLLSLYEATHLRNHGEDILDEALIFTTTHL  192

Query  662   EVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLL  841
             E    +LS  L KQV HA+ Q    G+PR+E+ +++++Y+E +S+N+ LL FAKLDFNLL
Sbjct  193   ESATHRLSPILSKQVTHAMYQPFWKGLPRLETRHYMSLYQERDSQNETLLNFAKLDFNLL  252

Query  842   QMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITM  1021
             Q  H++EL E  RWWK+LDFV TLP+ARDR VE YFWA GV+FE +Y  AR+ L K+I +
Sbjct  253   QQVHQRELSEISRWWKDLDFVNTLPFARDRVVESYFWASGVHFEPQYYSARITLCKVIAL  312

Query  1022  ASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKE  1201
              ++ DD YD  G  +ELE+FT+A+++WDI   + LP +MK+ Y+ L+D++ E ++ L+ E
Sbjct  313   ITVIDDIYDVHGTHEELELFTEAVERWDISAMDHLPEYMKVCYQALLDVYVEIEENLANE  372

Query  1202  GRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMK  1381
             G  +++HY +E +K LV +Y  E KW  ++ TP + +Y+     +S  ++L T SF+GM 
Sbjct  373   GNLYSIHYAREAMKVLVRAYFREAKWFHQKYTPTMDDYMSAALNTSN-FMLATTSFVGMG  431

Query  1382  SV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
              + T+++ +W   +P++++A +L+ R++NDI S +R       A+ +  YM +YG T EE
Sbjct  432   DIATKDSMDWVFDDPKMVKAASLIGRIMNDIKSDQRGHV----ASAVKCYMKEYGATEEE  487

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             A  +  + V NAWKD NE  ++   + +   +LL ILN AR+ +V+YK+  DG+T+    
Sbjct  488   ANIELSKQVNNAWKDINETCIQ--NTTIPMPLLLRILNLARVVEVLYKHG-DGFTDAGIF  544

Query  1739  LKPCIFSVLV  1768
             LK  + S+ V
Sbjct  545   LKDSVVSLFV  554



>sp|Q6Q3H2.1|TPSVS_VITVI RecName: Full=Valencene synthase; Short=VvVal; AltName: Full=7-epi-alpha-selinene 
synthase [Vitis vinifera]
 gb|AAS66358.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score =   450 bits (1157),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 355/541 (66%), Gaps = 9/541 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQE-IQVLKGQVMSMLVSIRSAKLAEKLNF  340
             RPV +F   P++WGD+F  +  +++V     +E I+ LK +V   L +   A  ++ LNF
Sbjct  19    RPVANFH--PNIWGDQFITYTPEDKVTRACKEEQIEDLKKEVKRKLTAAAVANPSQLLNF  76

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             ID ++RLG++YHF + I+E L++I N+  +   +  DL   AL FRLLRQ GY IS  IF
Sbjct  77    IDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTISCDIF  136

Query  518   DNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F  E G+FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L   L
Sbjct  137   NKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYHL  196

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+EL   
Sbjct  197   AEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSNL  256

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF T LP+ARDR VE YFW  GVYFE +Y + R +L K+I M SI DD +D++
Sbjct  257   ARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDAY  316

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G P+EL++F +AI++WDI   N+LP +MK+ Y  L+D+++E ++E+ KEG  + VHY KE
Sbjct  317   GTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKEGNQYRVHYAKE  376

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E KW  E   P   EY++   ASS   LL T SF+GM  + T+EAF+W 
Sbjct  377   VMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAFDWV  436

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + +P+I+ ++  + R+++DI S++ E+      + ++ YM  YGV+ E+  ++F++ +EN
Sbjct  437   TSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVTSAVECYMKQYGVSEEQVYSEFQKQIEN  496

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW D N++ L+  P+AVS  +L  +LNF R  DV+YK +QD YT+  KV++  I SV +N
Sbjct  497   AWLDINQECLK--PTAVSMPLLARLLNFTRTMDVIYK-EQDSYTHVGKVMRDNIASVFIN  553

Query  1772  S  1774
             +
Sbjct  554   A  554



>ref|NP_001268215.1| valencene synthase [Vitis vinifera]
 gb|ACO36239.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score =   449 bits (1156),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 355/541 (66%), Gaps = 9/541 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQE-IQVLKGQVMSMLVSIRSAKLAEKLNF  340
             RPV +F   P++WGD+F  +  +++V     +E I+ LK +V   L +   A  ++ LNF
Sbjct  19    RPVANFH--PNIWGDQFITYTPEDKVTRACKEEQIEDLKKEVKRKLTAAAVANPSQLLNF  76

Query  341   IDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGIF  517
             ID ++RLG++YHF + I+E L++I N+  +   +  DL   AL FRLLRQ GY IS  IF
Sbjct  77    IDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTISCDIF  136

Query  518   DNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F  E G+FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L   L
Sbjct  137   NKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYHL  196

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL  AKLDFNL+Q  HK+EL   
Sbjct  197   AEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKLDFNLVQSLHKEELSNL  256

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RWWKELDF T LP+ARDR VE YFW  GVYFE +Y + R +L K+I M SI DD +D++
Sbjct  257   ARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDAY  316

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G P+EL++F +AI++WDI   N+LP +MK+ Y  L+D+++E ++E+ KEG  + VHY KE
Sbjct  317   GTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKEGNQYRVHYAKE  376

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E KW  E   P   EY++   ASS   LL T SF+GM  + T+EAF+W 
Sbjct  377   VMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAFDWV  436

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
             + +P+I+ ++  + R+++DI S++ E+     A+ ++ YM  YGV+ E+  ++F++ +EN
Sbjct  437   TSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQVYSEFQKQIEN  496

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW D N++ L+  P+AVS  +L  +LN  R  DV+YK +QD YT+  KV++  I SV +N
Sbjct  497   AWLDINQECLK--PTAVSMPLLARLLNLTRTMDVIYK-EQDSYTHVGKVMRDNIASVFIN  553

Query  1772  S  1774
             +
Sbjct  554   A  554



>gb|AEI52901.1| terpene synthase 1 [Populus trichocarpa]
Length=561

 Score =   450 bits (1157),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 230/542 (42%), Positives = 352/542 (65%), Gaps = 16/542 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  F PS+WGD F  +  D+ E +++   E + LK +V   L++  + K ++ L+FID +
Sbjct  22    SASFPPSIWGDHFLSYATDSMETSDK--AEHKKLKEEVKRELMTTIN-KPSQTLDFIDAI  78

Query  353   ERLGISYHFHEMIDEMLENIYNA-------NPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             +RLGISYHF   IDE+L  +Y +       + +    +DL   +L FRLLRQ GY IS  
Sbjct  79    QRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKISCD  138

Query  512   IFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F  F+ + G F  SL ND + +L+ YEA+HL+ H D  L+EA  F+ +HLE +    SS
Sbjct  139   VFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHLEFLATHSSS  198

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L  ++ HAL Q +   IPR+E+  + +VY+ED S ++VLL FAKLDFN+LQ  H++EL 
Sbjct  199   PLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNILQKQHQKELS  258

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  +WWKELDF   LP+ARDR +ECYFW LGVYFE ++  AR ML K+I M S+ DD YD
Sbjct  259   DIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKVIAMTSVIDDIYD  318

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
              +GKP+ELE+FTDAI++W+I   + LP +MK+ YK L+D++ E ++ +  E RS+ V+Y 
Sbjct  319   VYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNEERSYRVYYA  378

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREAFE  1405
             KE +K  V +Y +E KW  ++ TP + EY+     +S   +L   SF+GM + VT+++F+
Sbjct  379   KEAMKNQVRAYYLESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFD  438

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W  + P+I++A+ ++ R+++DI S++ E+     A+ I+ YM  +G T +E +++F + V
Sbjct  439   WLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRKQV  498

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ L   P+AV   +L  +LN AR+ DVVYK+ +DGYTN    LK  + ++L
Sbjct  499   TDAWKDVNEEFLH--PTAVPMPLLTRMLNLARVIDVVYKD-EDGYTNAGTALKDLVSALL  555

Query  1766  VN  1771
             ++
Sbjct  556   ID  557



>gb|ABB01625.1| terpene synthase [Medicago truncatula]
Length=553

 Score =   449 bits (1155),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 228/539 (42%), Positives = 340/539 (63%), Gaps = 10/539 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERL  361
             + PS+WG  F  +  +  E+ +  A +I  LK +V +MLVS     L  K+  ID++ RL
Sbjct  19    YHPSVWGGFFLQYASETMELDQNLASQIDTLKDEVRNMLVSKTEMPLT-KVKLIDSICRL  77

Query  362   GISYHFHEMIDEMLENIYNA---NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             G+ YHF + IDE+L++I+ +   N    L D LC+ A+LFR+ RQ G ++S  +F+ F++
Sbjct  78    GVGYHFEKEIDEVLQHIHKSYVENGEITLEDSLCSLAMLFRVFRQQGLHVSPNVFNKFKD  137

Query  533   -NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVR  709
               G F  +LS DV+G+L+LYEASH+  H D  L+EA  F+ THLE I  Q S +L  Q+ 
Sbjct  138   KQGNFNENLSTDVEGMLSLYEASHMMVHEDDILEEALNFTSTHLESIASQSSPSLAAQIE  197

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
             + L Q+LH  IPR+E+ ++I++YE+D + ++VLL FAKLDFNLLQ  H++E     +WWK
Sbjct  198   YTLKQALHKNIPRLEARHYISIYEKDPTCDEVLLTFAKLDFNLLQSLHQKEFGNISKWWK  257

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             ELDF T LPYARDR  EC FW L  +FE +YS+AR M+ K+IT+ SI DDTYD++G  DE
Sbjct  258   ELDFSTKLPYARDRIAECSFWVLTAFFEPQYSQARKMMIKVITLLSIIDDTYDAYGTIDE  317

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             LE+FT A+++WDI   + LP +MK IY++ + ++EE +KE+ KEGR + + Y K   K+ 
Sbjct  318   LELFTKAVERWDISSLDELPDYMKPIYRSFLTIYEEIEKEMRKEGRIYTLDYYKIEFKKS  377

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPR  1426
             V ++  E +W  E   P   EY++  + S    LLI  S++GM  + T+E F W S  PR
Sbjct  378   VQAFMTEARWLNENHIPTTEEYMRISKKSGAYPLLILTSYIGMGDIATKEIFNWVSNEPR  437

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             I+ A   L R++++I S E E+      + +D YM  + ++ E A+ + +  +   WKD 
Sbjct  438   IVNAAATLCRLMDEIVSSEFEQKRGHVCSLLDCYMKQFDMSREAAIQECKNRMTIVWKDI  497

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             NE+ LR  P+ V    +  +LN +R  DV+YKNK D YT+ + ++K CI  VLV+   I
Sbjct  498   NEECLR--PTEVPMPFMTRVLNLSRFMDVIYKNK-DNYTDSDGLMKTCIKEVLVDPVPI  553



>ref|XP_002522812.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9S9Z3.1|TPS1_RICCO RecName: Full=Alpha-copaene synthase; AltName: Full=(+)-delta-cadinene 
synthase; AltName: Full=Terpene synthase 1; Short=RcSeTPS1 
[Ricinus communis]
 gb|EEF39510.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 gb|AEQ27766.1| alpha-copaene synthase [Ricinus communis]
Length=558

 Score =   449 bits (1156),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 227/535 (42%), Positives = 356/535 (67%), Gaps = 12/535 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAE-RYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  + P++WGD F   +  +++ +    Q+ + LK +V  M++ + +    +KL  ID +
Sbjct  25    SSTYHPTIWGDHFLANLSHSKIIDGSIEQQFEGLKQKVRKMIIDLNNEP-CKKLGLIDAV  83

Query  353   ERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +RLG+ YHF   I+++L+ +Y+   + +  DDL T AL FRLLRQHG  +S  IF+ F++
Sbjct  84    QRLGVGYHFKSEIEDVLQKVYHDYSDDE--DDLNTVALRFRLLRQHGIKVSCAIFEKFKD  141

Query  533   N-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVR  709
             + G FK+SL ND  G+L+LYEA+HL    +  L EA  F+ T+L+ + PQL++ L  Q+ 
Sbjct  142   SEGNFKTSLINDALGMLSLYEATHLSIRGEDVLDEALAFTTTNLQSVLPQLNTHLAAQIS  201

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
              AL++ +   +PR+E+  +I +Y  +ES N  LL FAKLDFN+LQ  H++EL    +WWK
Sbjct  202   RALNRPIRKYLPRLEARNYIDIYATEESYNTTLLNFAKLDFNMLQELHQKELNVVTKWWK  261

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
              LD  T LPYARDR VECYFW +GVYFE +YS AR+M+ KII + S+ DDTYD++   +E
Sbjct  262   SLDVATKLPYARDRVVECYFWMVGVYFEPQYSFARIMMTKIIAITSLLDDTYDNYATGEE  321

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRS--FAVHYTKERIK  1243
             LEI T+AI++WDI+  + LP +MKIIY TL+D++ E+++ ++KE +S  ++V+Y KE +K
Sbjct  322   LEILTEAIERWDIKAKDALPEYMKIIYTTLLDIYNEYEENIAKEEKSLLYSVYYAKEVMK  381

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQN  1420
              +V +Y  EV+W     TP + EY+++   ++   +L  ASFLG+K + T+EA+EW+S++
Sbjct  382   RVVRAYLAEVRWRDNCYTPTMEEYMQSALLTTCSPMLAIASFLGLKEIATKEAYEWASED  441

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+II A++++ R+++DI S+E E+  +  A+G++ Y+  YG + EE +  F + V NAWK
Sbjct  442   PKIIRASSIVCRLMDDIVSHEFEQTRKHVASGVECYIKQYGASEEEVIKLFRKEVTNAWK  501

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
             D NE+ L P P  V   +L  ++N  R  DV+YK+  DGYTN   ++K  + SVL
Sbjct  502   DLNEECLNPTP--VPMPMLERVVNLTRAIDVIYKD-DDGYTNSH-IMKDYVASVL  552



>emb|CAD90835.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   449 bits (1155),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/542 (43%), Positives = 351/542 (65%), Gaps = 11/542 (2%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             N + +RP   +   PS+WGD F +   D  +     +  Q LK +V  M+V+   A   +
Sbjct  18    NKDEMRPKADY--PPSIWGD-FFHNCPDKNIDAETEKRHQQLKEEVRKMIVA-PMANSTQ  73

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             KL FID+++RLG+SYHF + I++ LENIY+ N N    +DL T++L FRLLR+HG+N+S 
Sbjct  74    KLTFIDSVQRLGVSYHFTKEIEDELENIYHNN-NIDAENDLYTTSLRFRLLREHGFNVSC  132

Query  509   GIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
               F+ F +E G FKSS++N+V+GLL LYEAS+L+ H +  L EA +FS  +L +    L 
Sbjct  133   DAFNKFKEEQGNFKSSVTNNVRGLLELYEASYLRVHGEDILDEAISFSANNLSLAVASLD  192

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
               L +QV HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ+ H++EL
Sbjct  193   YPLSEQVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQLLHRKEL  252

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RW  +LDF T LPY +DR VECYFW LGVYFE  YS  R M+ K+I M  + DDTY
Sbjct  253   SEIFRWRNDLDFQTKLPYTKDRVVECYFWILGVYFEPHYSLGRKMMTKVIIMTPVIDDTY  312

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             DS+   DEL  +T AI+ W+I+  ++LP +MK+ YK L+D++EE  + L++ GR + V Y
Sbjct  313   DSYATYDELNPYTSAIE-WEIKCIDQLPEYMKLSYKALLDVYEEMKQLLAEHGRQYRVEY  371

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAF  1402
              K  +  L  SY +E KW  +   P   E+  N  +S+   +L   SF+GM+  VT E F
Sbjct  372   AKNAMIRLAQSYFVEAKWTLQNYKPSFEEFKINALSSTGYAMLAITSFVGMRDIVTPETF  431

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             +W++  P+II+A+ ++ R ++DIA ++ +     + + IDYYM +Y VTA +  + F + 
Sbjct  432   KWAASEPKIIQASAIICRFMDDIAEHKFKHRREDDWSVIDYYMKEYNVTAHDTYDVFNKY  491

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             +E+AWKD N+++L+  P+ + TE++   LN +R+ DVVYK + DGYT   K +K  I S+
Sbjct  492   IESAWKDMNQELLK--PTEMPTEVMNRSLNLSRVMDVVYK-EGDGYTYVRKAMKDVITSL  548

Query  1763  LV  1768
             L+
Sbjct  549   LI  550



>ref|XP_006374233.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
 gb|ERP52030.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
Length=554

 Score =   449 bits (1154),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 233/548 (43%), Positives = 357/548 (65%), Gaps = 14/548 (3%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMSMLVSIRSAKLA  325
             +NE++R   ++   PS+WGD+F   +  ++V E    QEI+ L+ Q    L++  S+   
Sbjct  18    DNEIIRRTANYH--PSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKRELLASNSS---  72

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             +KL+ ID ++RLG++YHF   I+E L++IYN   + +  DDL  +AL FRLLRQHGYN+S
Sbjct  73    QKLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIDME-DDDLYNTALGFRLLRQHGYNVS  131

Query  506   SGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF+ F+++ G FK S  NDV+G+L LYEA+HL  H +  L EA  F+  HL+ +    
Sbjct  132   CDIFNKFKDDKGYFKPS--NDVRGILGLYEAAHLAVHGEDILDEALAFTTIHLKSMATSP  189

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
             +  L  +V HAL Q +  G+PR+ES  +I+ Y+++ S N  LLR AKL+FN++Q  HK+E
Sbjct  190   NCPLTAKVSHALKQPIRRGVPRLESRRYISFYQDEPSCNKTLLRLAKLNFNVVQELHKEE  249

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L E  RWWK LDF   LP+ARDR VEC+FW +G YFE +YS AR +L K+I M SI DD 
Sbjct  250   LSEITRWWKGLDFARRLPFARDRVVECFFWIVGAYFEPQYSLARKILTKVIAMTSIIDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD +G  +ELE+FT+AI +WD +  ++LP +MKI Y+ L++++ E +++++KEG S+ VH
Sbjct  310   YDVYGTLEELELFTEAIDRWDTKSMDQLPDYMKICYEALLNVYSEIEEKVAKEGWSYRVH  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREA  1399
             + K+ +K LV +Y  E KW  E   P + EY++    +S   LL T SF+GM   VT +A
Sbjct  370   FGKQAMKVLVHAYFDEAKWFHENHIPTMEEYMQVALVTSGYSLLATVSFIGMGDMVTEQA  429

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W    P+I+ A+  ++R+++D+ S++ E+     A+G++ Y+  YG++ +E   +F  
Sbjct  430   FDWVFNRPKIVRASETISRLVDDVRSHKFEQERGHAASGVECYIRQYGLSEQEVYKEFHM  489

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              V NAWKD NE+ L+  P+AV   +L  ILN  R+ DV+YK K D YT+  +V+K  + S
Sbjct  490   QVVNAWKDINEECLK--PTAVPMPLLERILNLTRVIDVIYKEK-DEYTHVGEVMKNNVAS  546

Query  1760  VLVNSFEI  1783
             ++++S  I
Sbjct  547   LVIDSVPI  554



>ref|XP_011048258.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=561

 Score =   448 bits (1153),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/542 (42%), Positives = 348/542 (64%), Gaps = 22/542 (4%)
 Frame = +2

Query  185   FSPSLWGDEF----RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             F PS+WGD F       +  N+ AE + +  + LK ++M+ +      K ++ L+FID +
Sbjct  25    FPPSIWGDHFLSSATASMETNDKAE-HKKLKEELKRELMANI-----NKPSQALDFIDAI  78

Query  353   ERLGISYHFHEMIDEMLENIYNAN-------PNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             +RLGISYHF   IDE+L  +Y ++        +    +DL   +L FRLLRQ GY IS  
Sbjct  79    QRLGISYHFEIEIDEILREVYRSHCDFDNGDDDDDHHNDLYAISLKFRLLRQQGYKISCD  138

Query  512   IFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F  F+ + G F  SL ND +G+L+ YEA+HL+ H D  L+EA+ F+ +HLE +    SS
Sbjct  139   VFGKFKNSQGNFSDSLVNDTRGILSFYEATHLRVHGDEVLEEAFVFTTSHLEFLATHSSS  198

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L  Q+ HAL Q +   IPR+E+ ++ ++Y+ED S ++VLL FAK DFN+LQ  H +EL 
Sbjct  199   PLKAQINHALKQPIRKNIPRLEARHYFSIYQEDPSCSEVLLNFAKFDFNILQKQHLKELS  258

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  +WWKELDF   LP+ARDR +ECYFW LGVYFE +Y  AR +L K+I M S+ DD YD
Sbjct  259   DIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEYFLARRLLTKVIAMTSVIDDIYD  318

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
             ++GKP+ELE+FTDAI++W+I   ++LP +MK+ YK L+D++ E ++ +  E RS  V Y 
Sbjct  319   AYGKPEELELFTDAIERWEITAVDQLPEYMKVTYKALLDVYTEIEENMVTEERSCRVSYA  378

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREAFE  1405
             KE +K  V +Y +E KW  ++ TP + EY+     +S   +L   SF+GM  +VT+++F+
Sbjct  379   KEALKNQVRAYYLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHAVTKDSFD  438

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W    P+I++A+ ++ R+++DI S+E E+     A+ I+ YM  +G T +E + +F + V
Sbjct  439   WLFSGPKILKASEIICRLMDDIVSHEFEQKRGHVASSIECYMKQHGTTEQETVREFRKQV  498

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ L   P+AV   +L  ILN AR+ DVVYK+ +DGYTN    LK  + ++L
Sbjct  499   TDAWKDINEEFL--YPTAVPMPLLTRILNLARVIDVVYKD-EDGYTNAGTALKDLVSALL  555

Query  1766  VN  1771
             ++
Sbjct  556   ID  557



>ref|XP_010057304.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW74421.1| hypothetical protein EUGRSUZ_E03115 [Eucalyptus grandis]
Length=567

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/546 (43%), Positives = 346/546 (63%), Gaps = 14/546 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFV-----FDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             S  F PS+WGD F  +       +N   +   QEIQ L  +V  ML +  + K + KL+ 
Sbjct  25    SANFHPSIWGDYFLKYASCSCSMENGHDQHAEQEIQKLDDEVKRMLCA-DADKPSLKLDM  83

Query  341   IDTMERLGISYHFHEMIDEML----ENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             ID ++RLGI++HF   ID +L    E  +  N   +  DDL T+ALLFRLLRQ GY +SS
Sbjct  84    IDQIQRLGIAHHFASDIDHVLKQLSETCFACNNGDRDIDDLYTAALLFRLLRQQGYRVSS  143

Query  509   GIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF+ F++ +GKF    ++DV+GLL+LYEASHL  H +  L +A +FS THLE +  QLS
Sbjct  144   DIFNKFKDPSGKFSEKHASDVRGLLSLYEASHLSVHGEDVLDQALSFSLTHLESVKEQLS  203

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
               L  QVRHAL Q++  G+PR+E+  +I++YE +   N+VLL  AKLDFN LQ  H++EL
Sbjct  204   PPLATQVRHALKQTIRKGVPRLEARQYISMYEAEPLHNEVLLSLAKLDFNRLQKQHQKEL  263

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             ++  RWW  LDF   LP+ARDR VE YFW +GV+FE + + AR M+ K+I + S+ DD Y
Sbjct  264   FDITRWWMGLDFKRKLPFARDRLVEGYFWIVGVHFEPELAVARRMMTKVIAVTSVLDDIY  323

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D +G  +ELE+FT AIQ+WDI   + LP +M++ YK LI+++ E ++ L+  G+S+ + Y
Sbjct  324   DVYGTYEELELFTQAIQRWDIDCIHELPEYMQVFYKALINIYVEIEEILACTGKSYCLCY  383

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAF  1402
               E +K    SY  E KW  ++  P + EY+     SS   LL   SF+GM   VT++  
Sbjct  384   AVEAMKRQARSYFAEAKWLHQQHKPTMDEYMSIALVSSGYPLLAVTSFVGMPDIVTKDDL  443

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             +W   +P+I++A+T++ R+++D+A+++ E+      + +  YM  YGVT +EA N   + 
Sbjct  444   DWLFNDPKILKASTIICRLMDDLATHKFEQSRGHVDSAVQCYMKQYGVTEQEAENNLRKQ  503

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             V ++WKD NE+ LR  P+AV+  +L+ ILN +R+ DV+YK+  D YTNP   LK  I SV
Sbjct  504   VNDSWKDINEECLR--PTAVAMPLLVGILNLSRVMDVLYKDGGDHYTNPHIALKDYIHSV  561

Query  1763  LVNSFE  1780
             L++  +
Sbjct  562   LIDPVQ  567



>dbj|BAJ46125.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   448 bits (1152),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 234/539 (43%), Positives = 344/539 (64%), Gaps = 12/539 (2%)
 Frame = +2

Query  185   FSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERL  361
             + P++WGD F  Y   D      + Q I+ LK  V   L++   A    +LN ID ++RL
Sbjct  24    YHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLT---ATGLSQLNLIDAIQRL  80

Query  362   GISYHFHEMIDEMLENIYNANP-NFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-EN  535
             G+ YHF   ++E L+++Y+ N  +    D+L   +L FRLLRQHGY +S  I + F+ E 
Sbjct  81    GVGYHFERELEEALQHVYHKNHYHDDTEDNLYIISLRFRLLRQHGYYVSCDILNKFKDEK  140

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLE--VIGPQLSSTLGKQVR  709
               FK SL+ DV G+L+LYEA+HL  H +  L EA  F+ THL+   I    + +L  QV 
Sbjct  141   DNFKESLTTDVPGMLSLYEAAHLGAHGEDILDEAIAFTTTHLKSLAIDHLRNPSLASQVI  200

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
             HAL Q LH G+PR+E+  +I++Y+++ S N  L++  KLDFNL+Q  HK+EL E  +WWK
Sbjct  201   HALRQPLHRGVPRLENRRYISIYQDEVSHNKALVKLFKLDFNLVQSLHKKELSEISKWWK  260

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             ELD    LP+ARDR VECYFW +GVY+E +YS AR +L KII MASI DD YD +G  +E
Sbjct  261   ELDLANKLPFARDRLVECYFWIIGVYYEPQYSLARKILTKIIAMASIIDDIYDVYGTREE  320

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             L +FTDAI++WD    + LP +M+I Y+ L+DL+ E +KE++KEG S+ VHY KE +K L
Sbjct  321   LNLFTDAIERWDASCMDLLPEYMQIFYEALLDLYNEIEKEIAKEGWSYRVHYAKEAMKIL  380

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPR  1426
             V  Y+ E KW      P + EY++    +S   +L T+SFLGM + VT+E F+W    P+
Sbjct  381   VRGYHDESKWFHNNYIPTMEEYMRVALVTSAYTMLTTSSFLGMDNIVTKETFDWVFSGPK  440

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             II A+  ++R+++D+ S++ E+     A+ ++ YM  +GV+ +E   +F + V NAWKD 
Sbjct  441   IIRASETISRLMDDVKSHKFEQERGHAASAVECYMEQHGVSEQEVCKEFYQQVGNAWKDI  500

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             N+D L+  P+ V   IL+ +LN AR+ DVVYK + DGYT+  KV+K  + S+L++   +
Sbjct  501   NQDFLK--PTDVPMTILMRVLNLARVIDVVYK-EGDGYTHVGKVMKENVASLLIDPIPV  556



>ref|XP_007133004.1| hypothetical protein PHAVU_011G143100g [Phaseolus vulgaris]
 gb|ESW04998.1| hypothetical protein PHAVU_011G143100g [Phaseolus vulgaris]
Length=565

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 240/549 (44%), Positives = 351/549 (64%), Gaps = 15/549 (3%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVS-IRSAKLAEKLN  337
              RP  +F   PS+WGD F  +V  N   + + Q+ ++LK  V   LVS I     + KLN
Sbjct  24    TRPTANF--PPSVWGDRFLSYVPTNAETDSHIQQAKLLKEDVRKSLVSPIDHTNFSFKLN  81

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             FID+++RLG+SYHF   ID +L  IY+     N      D L  +ALLFRLLRQHGY IS
Sbjct  82    FIDSVQRLGVSYHFEYEIDSVLCQIYDISTKDNNIIAHSDHLYHTALLFRLLRQHGYRIS  141

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQ  679
             S IF  FQ + GKFK SL+ND++G+L+L+EA+ L+ H +  L+EA+ FS   L + I  Q
Sbjct  142   SSIFCKFQDQTGKFKESLANDIEGMLSLFEAAGLRCHGEDMLEEAHKFSFEQLMKFITTQ  201

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             L+ + G +V+H+L QSL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H +
Sbjct  202   LNCSHGVRVQHSLKQSLRRGLPRLEATYYMSFYEEDPSHDEKLLAFAKLDFNMLQELHLK  261

Query  860   ELYEHMRWW-KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             E+    +WW K+L+  T LP+ RDR VEC FW LGVYFE +YS  R +  K+I +AS  D
Sbjct  262   EVSSITKWWTKDLNVSTNLPFTRDRIVECCFWILGVYFEPQYS--RWITTKVIALASTID  319

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  DELE+FT AI++WDI     LP++M++ Y+T++D++EE ++E+ K+G+ + 
Sbjct  320   DLYDAYGTIDELELFTSAIERWDICCLVALPKYMQLCYRTILDVYEEIEQEMRKQGKVYF  379

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
             + Y K+ +K LV ++  E +WC     P + EY++    SS   LLIT SFLGM+  T E
Sbjct  380   MKYAKKEMKRLVQAHMAEARWCHTNHIPTMEEYMEVRGMSSGYPLLITLSFLGMEDTTEE  439

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
                W+   P II A+T ++R+++DI  YE E+      + I  YM  + V+ E A+ + +
Sbjct  440   VLIWAMNEPVIIAASTAISRIMDDIVGYEFEQQREHVVSSIYCYMKQHKVSRECAIEELQ  499

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             ++VENAWKD N+  L   P+ V    L+  LNFAR+ DV+YK+ +D YTN   ++K  I 
Sbjct  500   KLVENAWKDINDACL--APTQVPMTFLMRALNFARVIDVLYKD-EDNYTNAGGIMKVHIE  556

Query  1757  SVLVNSFEI  1783
             S+LV    +
Sbjct  557   SLLVKKMSL  565



>ref|XP_006476905.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=554

 Score =   447 bits (1151),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 233/559 (42%), Positives = 349/559 (62%), Gaps = 12/559 (2%)
 Frame = +2

Query  119   QTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAE-RYAQEIQVLKGQVMSM  295
             Q  +I      ++V+R   +F   PS+WGD F  +  ++++   R  +E++ LK +V   
Sbjct  4     QVPQISSQNAKSQVMRRTANFH--PSVWGDRFANYTAEDKMNHARDLKELKALKEEVGRK  61

Query  296   LVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNAN-PNFQLGDDLCTSALLF  472
             L++        +LN ID ++RLG+ YHF   +++ L+++YN    +    DDL   +L F
Sbjct  62    LLATAGPI---QLNLIDAIQRLGVGYHFERELEQALQHLYNEKYSDDDTEDDLYRISLRF  118

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQHGYN+S   F+ F+++ G FK SL++D  G+L+LYEA+HL  H +  L EA  F+
Sbjct  119   RLLRQHGYNVSCDKFNMFKDDKGNFKESLASDALGMLSLYEAAHLGVHGEDILDEAIAFT  178

Query  650   KTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLD  829
              THL+ +   LS+ L  QVRHAL Q LH G+PR+E   +I++Y++D S    LL  AKLD
Sbjct  179   TTHLKSVATHLSNPLKAQVRHALRQPLHRGLPRLEHRRYISIYQDDASHYKALLTLAKLD  238

Query  830   FNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAK  1009
             FNL+Q  HK+EL E  RWWK+LDF   LP+ARDR VEC+FW LGVYFE  YS AR +L K
Sbjct  239   FNLVQSLHKKELCEISRWWKDLDFARKLPFARDRMVECFFWILGVYFEPNYSLARRILTK  298

Query  1010  IITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKE  1189
             +I M SI DD YD +G P+EL++FT+ I++WD    ++LP +M+  +  L+DL+ E +KE
Sbjct  299   VIAMTSIIDDIYDVYGTPEELKLFTEVIERWDESSMDQLPEYMQTFFGALLDLYNEIEKE  358

Query  1190  LSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASF  1369
             ++ EG S+ V + KE +K LV  Y  E KW  E   P + EY++    +S   +L T SF
Sbjct  359   IANEGWSYRVQHAKEAMKILVEGYYDESKWFHENYIPKMEEYMRVALVTSGYTMLTTVSF  418

Query  1370  LGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGV  1546
             LGM + VT+E F+W    P+II A+ ++ R ++DI S++ E+     A+ ++ YM  +G+
Sbjct  419   LGMDNIVTKETFDWVFSRPKIIRASEIIGRFMDDIKSHKFEQERGHAASAVECYMKQHGL  478

Query  1547  TAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTN  1726
             + +E   +    V NAWKD NE+ L   P+AV   +L+  LN AR+ DVVYK + DGYT+
Sbjct  479   SEQEVCEELYRQVSNAWKDINEECLN--PTAVPMPLLMRALNLARVIDVVYK-EGDGYTH  535

Query  1727  PEKVLKPCIFSVLVNSFEI  1783
                 +K  + ++L++   I
Sbjct  536   VGNEMKQNVAALLIDQVPI  554



>gb|KHG14851.1| (+)-delta-cadinene synthase isozyme C2 [Gossypium arboreum]
Length=564

 Score =   448 bits (1152),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 237/555 (43%), Positives = 357/555 (64%), Gaps = 21/555 (4%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             + +N + +RP   FQ  PS+WGD F     D  +     +  Q LK +V  ++V+   A 
Sbjct  14    LSSNKDEMRPKADFQ--PSIWGD-FFLNCPDKNIDAGTEKRHQQLKEEVRKIIVA-PMAN  69

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
               +KL FID+++RLG+SYHF + I++ LENIY+ N + +  +DL T +L FRLLR+HGYN
Sbjct  70    STQKLAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDAE--NDLYTISLRFRLLREHGYN  127

Query  500   ISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S  +F+ F+ E G FKSS+++DV+GLL LY+AS+L+ H +  L EA +F+  HL +   
Sbjct  128   VSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHLSLAVA  187

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
              L   L ++V HAL QS+  G+PRVE+ ++++VY++ ES N  LL FAK+DFN+LQ  H+
Sbjct  188   SLDHPLSEEVSHALKQSIRRGLPRVEARHYLSVYQDIESHNKALLEFAKIDFNMLQFLHR  247

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL E  RWWK+LDF   LPYARDR VE YFW  GVYFE +YS  R ML K+I MASI D
Sbjct  248   KELSEICRWWKDLDFQRKLPYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVD  307

Query  1037  DTYDSFGKPDELEIFTDAIQ----------KWDIRQTNRLPRFMKIIYKTLIDLFEEFDK  1186
             DTYDS+   +EL  +T+AI+          +WDI+  + LP +MK  YK L+D++EE ++
Sbjct  308   DTYDSYATYEELIPYTNAIERLDFFNFVGNRWDIKCIDELPEYMKPSYKALLDVYEEMEQ  367

Query  1187  ELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITAS  1366
              +++ GR + V Y K+ +  L  SY +E +W  +   P   E+  N   +    +L   S
Sbjct  368   LVAEHGRQYRVEYAKKAMIRLAQSYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITS  427

Query  1367  FLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYG  1543
             F+GM   VT E F+W++ +P+II+A+T++ R ++D+A ++ +     + + I+ YM +YG
Sbjct  428   FVGMGDIVTPETFKWAASDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYG  487

Query  1544  VTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYT  1723
             VTA+EA + F + VE+AWKD N++ L+  P+ + TE+L   LN AR+ DV+Y+ + DGYT
Sbjct  488   VTAQEAYDIFNKHVESAWKDVNQEFLK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYT  544

Query  1724  NPEKVLKPCIFSVLV  1768
                K  K  I S+L+
Sbjct  545   YVGKAAKGGITSLLI  559



>ref|XP_006370591.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67160.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=561

 Score =   447 bits (1151),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 230/542 (42%), Positives = 351/542 (65%), Gaps = 16/542 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTM  352
             S  F PS+WGD F  +  D+ E +++   E + LK +V   L++  + K ++ L+FID +
Sbjct  22    SASFPPSIWGDHFLSYATDSMETSDK--AEHKKLKEEVKRELMTTIN-KPSQTLDFIDAI  78

Query  353   ERLGISYHFHEMIDEMLENIYNA-------NPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             +RLGISYHF   IDE+L  +Y +       + +    +DL   +L FRLLRQ GY IS  
Sbjct  79    QRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFRLLRQQGYKISCD  138

Query  512   IFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F  F+ + G F  SL ND + +L+ YEA+HL+ H D  L+EA  F+ +HLE +    SS
Sbjct  139   VFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTTSHLEFLATHSSS  198

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELY  868
              L  ++ HAL Q +   IPR+E+  + +VY+ED S ++VLL FAKLDFN+LQ  H++EL 
Sbjct  199   PLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDFNILQKQHQKELS  258

Query  869   EHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
             +  +WWKELDF   LP+ARDR +ECYFW LGVYFE ++  AR ML K+I M S+ DD YD
Sbjct  259   DIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKVIAMTSVIDDIYD  318

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
              +GKP+ELE+FTDAI++W+I   + LP +MK+ YK L+D++ E ++ +  E RS+ V+Y 
Sbjct  319   VYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENMVNEERSYRVYYA  378

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREAFE  1405
             KE +K  V +Y  E KW  ++ TP + EY+     +S   +L   SF+GM + VT+++F+
Sbjct  379   KEAMKNQVRAYYHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFD  438

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W  + P+I++A+ ++ R+++DI S++ E+     A+ I+ YM  +G T +E +++F + V
Sbjct  439   WLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTTEQETVHEFRKQV  498

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              +AWKD NE+ L   P+AV   +L  +LN AR+ DVVYK+ +DGYTN    LK  + ++L
Sbjct  499   TDAWKDVNEEFLH--PTAVPMPLLTRMLNLARVIDVVYKD-EDGYTNAGTALKDLVSALL  555

Query  1766  VN  1771
             ++
Sbjct  556   ID  557



>ref|XP_009344725.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=555

 Score =   447 bits (1150),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 240/541 (44%), Positives = 352/541 (65%), Gaps = 12/541 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V RP  S  FSPS+WGD F  +    EV     Q +Q LK +V  ML +     +++KL
Sbjct  19    DVHRPKPSATFSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRRMLTT-SPENVSQKL  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID ++ LG+SYHF   I+E+L+ I+ ++ +    DDL T+ALLFRLLRQ GYN+S  +
Sbjct  77    NLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDL---DDLYTAALLFRLLRQQGYNVSCDL  133

Query  515   FDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F++ +G FK SL +DV GLL+LYEA+HL+ H +  L EA TF+ T+LE    +LS  
Sbjct  134   FNKFKDGDGNFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTMTNLESATFRLSPP  193

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L K V HAL+Q L  G+PRVE+ Y ++VY+E  ES N+ LL FAKLDFN LQ  H++EL 
Sbjct  194   LAKAVTHALNQPLRKGLPRVEARYHLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELS  253

Query  869   EHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             E  RWWK+LD    LP+ARDR VE YF W++ VYF+ +YS AR    K+  +ASI DD Y
Sbjct  254   EITRWWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAVASIIDDLY  313

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             + +   ++L++FT+AI++WD+   ++LP +MK+ Y+ L+D++ E  ++L  +G+ + +H+
Sbjct  314   E-YDTDEQLKLFTEAIERWDVSAMDQLPEYMKVCYRALLDVYNEIHEKLLHDGKLYRIHH  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              +E +K+ V  Y +E K   ++  P + EY+     +S   LLIT SF+GM+  T ++F+
Sbjct  373   AREAMKKQVRGYFVEAKLFHQKHIPSLDEYMSLSLVTSGYPLLITTSFVGMEEATIDSFD  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W S  P+ ++A + + R+++DI  ++ E+      + ++ YM  YGVT EEA+ + +  V
Sbjct  433   WLSTFPQAVKAASKICRLMDDIVDHKFEQEKEHFISAVNCYMKKYGVTEEEAIIELKRQV  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              NAWKD NE  L   P+AV   +L+ ILNFARI DVVYK  +DGYTN + VLK  I S L
Sbjct  493   HNAWKDINEACLH--PTAVPMPLLIRILNFARIMDVVYKC-EDGYTNAKGVLKDLIVSTL  549

Query  1766  V  1768
             V
Sbjct  550   V  550



>ref|XP_011080426.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=559

 Score =   447 bits (1150),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 229/532 (43%), Positives = 348/532 (65%), Gaps = 8/532 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V  P+TS+  +PS+ GD F  F  D+++  +YA+ IQ LK Q  SML++  S  + EKL
Sbjct  18    DVRPPITSY--TPSMLGDAFTSFSLDDKLQRKYAEAIQELKQQARSMLMTKGSTTI-EKL  74

Query  335   NFIDTMERLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
               IDT+ERLG+ YHF + I++ L  I+   +    Q   DL  +AL FRLLRQH Y+IS 
Sbjct  75    ILIDTLERLGVGYHFEQEIEDQLREIFFFQSQDKDQDNYDLFATALQFRLLRQHRYSISC  134

Query  509   GIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +FD F+++  KF+ +L++D KGLL+LYEAS+++ H +  L++A  F+  HL  +  +L 
Sbjct  135   NVFDKFKDDDSKFEETLTSDAKGLLSLYEASNVRIHGEHILEDAVAFTTHHLNHMVQELE  194

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
               L  QV+ AL QS++ G+PR+E+ ++I+ YE +ESKN++LL+ AKLDFN LQ  +K+EL
Sbjct  195   PQLQCQVKRALVQSVYRGVPRLEARHYISFYERNESKNEILLKLAKLDFNYLQNIYKKEL  254

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             ++  RWW ELD V+ LPYARDR VE YFW  G+ F+ + S AR+ + K + M +I DDTY
Sbjct  255   HDLSRWWNELDLVSKLPYARDRLVESYFWGAGISFQPQDSYARIAITKSVVMLTIMDDTY  314

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++   +E ++FT+ ++KWDI + +RLP +MKIIYK +++LFE+++ E +K+G+ FAV Y
Sbjct  315   DNYATVEEADLFTEILEKWDINELDRLPDYMKIIYKFILNLFEDYEVEAAKQGKLFAVPY  374

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
               E +KE+  +YN   +W      P   EYI N   +S +Y+ +T    G+KS ++E+ +
Sbjct  375   ATEAVKEIAKAYNRHTQWFLGGQMPTYEEYIVNTVVTSCIYVFLTVGVPGLKSASKESID  434

Query  1406  WSSQNP-RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             W    P + + A+T + R  NDI S ERE       T +D YM  YGV+ EE ++KF E+
Sbjct  435   WLMSEPNKALIASTRICRHANDIGSDERESRGGNIPTAVDCYMKQYGVSKEETVDKFNEL  494

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
              ENAWKD N +    I S VS +++  +LN+AR+ +V YKN +D Y +P+ +
Sbjct  495   FENAWKDFNTEWSTEI-SIVSKDMMEQLLNYARVAEVNYKNGRDAYADPQNL  545



>gb|AGB14625.1| germacrene-D synthase [Malus domestica]
Length=553

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 350/542 (65%), Gaps = 11/542 (2%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             N+   P  S  FSPS+WGD F  +    EV     Q +Q LK +V SML++     +++K
Sbjct  15    NDTFDPKPSATFSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRSMLMT-SPENVSQK  72

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             LN ID ++RLG+SYHF   I+E+L+ I+ ++ +    DDL T AL FRLLRQ GYN+S  
Sbjct  73    LNLIDDIQRLGVSYHFGNEIEEILQKIHQSSYDL---DDLYTVALRFRLLRQQGYNVSCD  129

Query  512   IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F+  ++ +GKFK SL +DV GLL+LYEA+HL+ H +  L EA TF+ T+LE    +LS 
Sbjct  130   LFNKLKDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTNLESATFRLSP  189

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQEL  865
              L K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL
Sbjct  190   PLAKAVTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKEL  249

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
              E  RWWK+LD    LP+ARDR VE YF W++ VYF+ +YS AR    K+  + SI DD 
Sbjct  250   SEITRWWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAITSIMDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD+ GK +ELE+FT+AI++WD+   ++LP +MK+ Y+ L++++ E  ++L+ EG+ + + 
Sbjct  310   YDTHGKFEELELFTEAIERWDVSAIDQLPEYMKLCYRELLNIYSEIHEKLAHEGKLYRID  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             + +E +K  V  +  E K   +   P + EY+     +    LLIT SF+GM+  T ++F
Sbjct  370   HAREAMKNQVRGFFDEAKLFRQNHMPSLDEYMSVSLMTCGYALLITTSFVGMEEATIDSF  429

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             +W   +P+ ++A + + R+++DIA ++ E+     A+ ++ YM  YG T EEA+ + +  
Sbjct  430   DWLLTSPQAVKAASTVTRLMDDIADHKLEQEREHFASAVNCYMRKYGATEEEAIIELQRQ  489

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             V NAWKD NE  L   P+AV+  +L+ ILNFAR+ DVVYK  +DGY N +  LK  I S 
Sbjct  490   VNNAWKDINEACLH--PTAVAMPLLIRILNFARVMDVVYKC-EDGYNNADGGLKDFIVST  546

Query  1763  LV  1768
             LV
Sbjct  547   LV  548



>ref|XP_008347229.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=554

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 241/540 (45%), Positives = 347/540 (64%), Gaps = 13/540 (2%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             V RP  S  F  S+WGD F  + F  EV     Q +Q LK +V  ML +     +++KLN
Sbjct  20    VHRP--SATFYTSIWGDHFLSYGF-MEVDAELEQHVQELKEEVRRMLTT-SVENVSQKLN  75

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIF  517
              ID ++RLG+SY+F   I+E+L+ I+  + +    DDL T+AL FRLLRQ GYNI+  +F
Sbjct  76    LIDDVQRLGVSYYFGNEIEEILQKIHENSYDL---DDLYTAALCFRLLRQQGYNITCDLF  132

Query  518   DNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F++ +GKFK SL +DV GLL+LYEA+HL+ H +  L EA TF+ THLE    +LS  L
Sbjct  133   NKFKDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTHLESATNRLSPPL  192

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELYE  871
              K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL E
Sbjct  193   AKTVTHALNQQLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELSE  252

Query  872   HMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
               RWWK+LD    LP+ RDR VE YF W+L VYF+ +YS AR  L K+  + SI DD YD
Sbjct  253   LTRWWKDLDIPNKLPFVRDRLVEVYFCWSLSVYFQPQYSFARRTLCKVTAITSIIDDVYD  312

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
              +G  +ELE+FT+AI++WD+   ++LP +MK+ Y+ L+D++ E  ++L  EG+ + +H+ 
Sbjct  313   EYGTNEELELFTEAIERWDVSAMDQLPEYMKVCYRALLDIYSEIHEKLVHEGKLYHIHHA  372

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              E +K+ V  Y +E K   ++  P + +Y+     +S   LLIT SF+GM+  T ++F+W
Sbjct  373   IEAMKKQVRGYFVEGKLFRQKHIPSLDDYMSISLVTSGYPLLITTSFVGMEEATIDSFDW  432

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                +P+ ++A + +AR+++DIA ++ E+ N    + +  YM  YG T EEA+ +    V 
Sbjct  433   LLNSPQAVKAASTVARLMDDIADHKLEQENEHLVSAVTCYMMKYGATKEEAVIELRRQVN  492

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE  L   P+AV   +L+ ILNFAR+ DVVYK  +DGYT  +  LK  I S LV
Sbjct  493   KAWKDINEACLH--PTAVPMPLLIRILNFARVMDVVYKC-EDGYTIAQGGLKDFIVSTLV  549



>dbj|BAM24405.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 342/539 (63%), Gaps = 12/539 (2%)
 Frame = +2

Query  185   FSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERL  361
             + P++WGD F  Y   D      + Q I+ LK  V   L++   A    +LN ID ++RL
Sbjct  24    YHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLT---ATGLSQLNLIDAIQRL  80

Query  362   GISYHFHEMIDEMLENIYNANP-NFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-EN  535
             G+ YHF   ++E L+++Y+ N  +    D+L + +L FRLLRQHGY +S  I + F+ E 
Sbjct  81    GVGYHFERELEEALQHVYHKNHYHDDTEDNLYSISLRFRLLRQHGYYVSCDILNKFKDEK  140

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLE--VIGPQLSSTLGKQVR  709
               FK SL+ DV G+L+LYEA+H   H +  L EA  F+ THL+   I    + +L  QV 
Sbjct  141   DNFKESLTTDVPGMLSLYEAAHPGVHGEDILDEAIAFTTTHLKSLAIDHLRNPSLASQVI  200

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
             HAL Q LH G+PR+E+  +I++Y+++ S N  L++  KLDFNL+Q  HK+EL E  RWWK
Sbjct  201   HALRQPLHRGVPRLENRRYISIYQDEVSHNKALVKLFKLDFNLVQSLHKKELSEISRWWK  260

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             ELD    LP+ARDR VECYFW +GVY+E +YS AR +L K I M SI DD YD +G P+E
Sbjct  261   ELDLANKLPFARDRLVECYFWIIGVYYEPQYSLARKILTKTIAMGSIIDDIYDVYGTPEE  320

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             L +FTDAI++WD    ++LP +M+I Y+ L+DL+ E +KE++KEG S+ VHY KE +K L
Sbjct  321   LNLFTDAIERWDASCMDQLPEYMQIFYEALLDLYNEIEKEIAKEGWSYRVHYAKEAMKIL  380

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPR  1426
                Y+ E KW      P + EY+     +S   +L T+SFLGM + VT+E F+W    P+
Sbjct  381   ARGYHDESKWFHNNYIPTMEEYMHVALVTSGYTMLTTSSFLGMDNIVTKETFDWVFSGPK  440

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             II A+  +AR+++D+ S++ E+     A+ ++ YM  +GV+ +E   +F + V NAWKD 
Sbjct  441   IIRASGTIARLMDDVKSHKFEQERGHAASAVECYMEQHGVSEQEVCKEFYQQVGNAWKDI  500

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             N+D L+  P+ V   IL+ +LN AR+ DVVYK + DGYT+  KV+K  + S+L++   +
Sbjct  501   NQDFLK--PTDVPMTILMRVLNLARVIDVVYK-EGDGYTHVGKVMKENVASLLIDPIPV  556



>gb|ADR74199.1| gamma-cadinene synthase [Vitis vinifera]
Length=585

 Score =   446 bits (1148),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 233/542 (43%), Positives = 356/542 (66%), Gaps = 11/542 (2%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV ++   P++WGD+F  ++ +++V  R  +E Q+  LK +V   L +   A  ++ LN
Sbjct  48    RPVANYH--PNIWGDQFISYIPEDKVT-RACKEEQIVDLKKEVKRKLTAAAVANPSQLLN  104

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQ-LGDDLCTSALLFRLLRQHGYNISSGI  514
             FID ++RLG++YHF + I+E L++I N+  +   +  DL   AL FRLLRQ GY+IS GI
Sbjct  105   FIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISCGI  164

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F  E G+FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL+ +   L   
Sbjct  165   FNKFMDERGRFKEALISDVRGMLCLYEAAHLRVHGEDILAKALAFTTTHLKAMVEGLGYH  224

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L +QV HAL++ +  G+ R+E  ++I+VY+++   +  LL  AKLDFNL+Q  HK+EL  
Sbjct  225   LAEQVAHALNRPIRKGLERLEXRWYISVYQDEAFHDRTLLELAKLDFNLVQSLHKEELSN  284

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               RWWKELDF T LP+ARDR VE YFW  GVYFE +Y + R +L K+I M SI DD +D+
Sbjct  285   LARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDA  344

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G P+EL++F +AI++WDI   ++LP +MK+ Y  L+D+++E ++E+ KEG    VHY K
Sbjct  345   YGTPEELKLFIEAIERWDINSIDQLPEYMKLCYAALLDVYKEIEEEMEKEGNQHRVHYAK  404

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEW  1408
             E +K  V +Y  E KW  E   P   EY++    SS   +L T SF+GM  + T EAF+W
Sbjct  405   EVMKNQVRAYFAEAKWLHEEHVPTFEEYMRVALVSSGYCMLATTSFVGMGEIATNEAFDW  464

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              + +P+I+ ++  +AR+++DI S++ E+     A+ ++ YM  YGV+ E+A ++F++ +E
Sbjct  465   VTSDPKIMSSSNFIARLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQAYSEFQKQIE  524

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             NAW D N++ L+  P+AVS  +L  ILN  R  DV YK +QD YT+  KV++  I SV +
Sbjct  525   NAWLDINQECLK--PTAVSMPLLARILNLTRTADVFYK-EQDSYTHVGKVMRDNIASVFI  581

Query  1769  NS  1774
             N+
Sbjct  582   NA  583



>gb|AGB14624.1| beta-caryophyllene synthase [Malus domestica]
Length=554

 Score =   445 bits (1145),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 240/540 (44%), Positives = 346/540 (64%), Gaps = 13/540 (2%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             V RP  S  F  S+WGD F  + F  EV     Q +Q LK +V  ML +     +++KLN
Sbjct  20    VHRP--SATFYTSIWGDHFLSYGF-MEVDAELEQHVQELKEEVRRMLTT-SVENVSQKLN  75

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIF  517
              ID ++RLG+SY+F   I+E+L+ I+  + +    DDL T+ L FRLLRQ GYN++  +F
Sbjct  76    LIDDIQRLGVSYYFGNEIEEILQKIHENSYDL---DDLYTATLCFRLLRQQGYNVTCDLF  132

Query  518   DNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F++ +GKFK SL +DV GLL+LYEA+HL+ H +  L EA TF+ THLE    +LS  L
Sbjct  133   NKFKDGDGKFKESLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTHLESATNRLSPPL  192

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELYE  871
              K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL E
Sbjct  193   AKTVTHALNQQLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELSE  252

Query  872   HMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTYD  1048
               RWWK+LD    LP+ RDR VE YF W+L VYF+ +YS AR  L K+  + SI DD YD
Sbjct  253   LTRWWKDLDIPNKLPFVRDRLVEVYFCWSLSVYFQPQYSFARRTLCKVTAITSIIDDVYD  312

Query  1049  SFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYT  1228
              +G  +ELE+FT+AI++WD+   ++LP +MK+ Y+ L+D++ E  ++L  EG+ + +H+ 
Sbjct  313   EYGTNEELELFTEAIERWDVSAMDQLPEYMKVCYRALLDIYSEIHEKLVHEGKLYHIHHA  372

Query  1229  KERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEW  1408
              E +K+ V  Y +E K   ++  P + +Y+     +S   LLIT SF+GM+  T ++F+W
Sbjct  373   IEAMKKQVRGYFVEGKLFRQKHIPSLDDYMSISLVTSGYPLLITTSFVGMEEATIDSFDW  432

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
                +P+ ++A + +AR+++DIA ++ E+ N    + +  YM  YG T EEA+ +    V 
Sbjct  433   LLNSPQAVKAASTVARLMDDIADHKLEQENEHLVSAVTCYMMKYGATKEEAVIELRRQVN  492

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE  L   P+AV   +L+ ILNFAR+ DVVYK  +DGYT  E  LK  I S LV
Sbjct  493   KAWKDINEACLH--PTAVPMPLLIRILNFARVMDVVYKC-EDGYTIAEGGLKDFIVSTLV  549



>ref|XP_011005621.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   445 bits (1144),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 233/548 (43%), Positives = 355/548 (65%), Gaps = 14/548 (3%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-QEIQVLKGQVMSMLVSIRSAKLA  325
             +NE +R   +F+  PS+WGD+F   +  ++V E    QEI+ L+ Q    L++  S+   
Sbjct  18    HNETIRRTANFR--PSIWGDKFISHLPRDKVHETIELQEIEKLREQFKRELLASDSS---  72

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             ++LN ID ++RLG++YHF   I+E L++IYN     +  DDL  +AL FRLLRQHGYN+S
Sbjct  73    QQLNLIDAIQRLGVAYHFETEIEEALQHIYNNRIGME-DDDLYNTALGFRLLRQHGYNVS  131

Query  506   SGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
               IF+ F+++ G FK S  NDV+G+L+LYEA+HL    +  L EA  F+  HL+ +    
Sbjct  132   CDIFNKFKDDKGYFKQS--NDVRGILSLYEAAHLAVRGEDILDEALAFTTIHLKSMATSP  189

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                L  +V HAL Q +  G+PR+ES  +I++Y+++ S N  LLR AKL+FNL+Q  HK+E
Sbjct  190   DCPLAAKVSHALKQPIRRGVPRLESRRYISIYQDEPSCNKNLLRLAKLNFNLVQELHKEE  249

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             + E  RWWK LDF   LP+ARDR VEC+FW +GVYFE +YS AR +L K+I M SI DD 
Sbjct  250   VAEISRWWKGLDFARRLPFARDRVVECFFWIVGVYFEPQYSLARKILTKVIAMTSIIDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD +G  +ELE+FT+AI +WD +  + LP +MKI Y+ L++++ + +++++KEG S+ VH
Sbjct  310   YDVYGTLEELELFTEAIDRWDTKSMDHLPDYMKICYEALLNVYSKMEEKVAKEGWSYRVH  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREA  1399
             Y KE +K LV +Y  E KW  E   P + EY++    ++   +L T SF+GM + VT +A
Sbjct  370   YGKEAMKVLVHAYLNEAKWFHENHIPTMEEYMQVALLTTGYCMLATVSFIGMANMVTEQA  429

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W    P+I+ A+  + R+++D+ S++ E+     A+G++ Y+  YG + +E   +F  
Sbjct  430   FDWVFNRPKIVRASETICRLMDDVKSHKFEQERGHAASGVECYIRQYGPSEQEVYKEFHM  489

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              V NAWKD NE+ L+  P+AV   +L  ILN +R+ DV+YK ++DGYT   K +K  + S
Sbjct  490   QVVNAWKDINEECLK--PTAVPMPLLERILNLSRVIDVIYK-EEDGYTLVGKAMKNDVAS  546

Query  1760  VLVNSFEI  1783
             + ++S  I
Sbjct  547   LFIDSVPI  554



>ref|XP_011030746.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Populus 
euphratica]
Length=558

 Score =   444 bits (1143),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 226/535 (42%), Positives = 345/535 (64%), Gaps = 6/535 (1%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F    F++   + + QE   LK +V  ML +  + KL+E+LNFID ++
Sbjct  23    SANFHPSIWGDYFVCHTFNSMFDDHFEQEFYRLKEEVKEMLYAT-TNKLSEQLNFIDVIQ  81

Query  356   RLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ  529
             RLG+SY F   ID+ML ++Y   +  ++    DL   AL FRLLRQ G+ +S  +F  F+
Sbjct  82    RLGVSYLFESDIDQMLCDLYYQGSGDDYVHDHDLQMVALRFRLLRQQGHYVSCDVFKKFK  141

Query  530   EN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQV  706
             +  G FK  L+ND++G+L+LYEA+HL+ H +  L+EA TF+ THL+ I   +   L  ++
Sbjct  142   DTEGNFKVCLTNDIQGMLSLYEATHLRVHGEDILEEALTFATTHLKSITTDMCPPLLVKL  201

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             RHALDQ +H  +P + +  +I+ Y+++ S  +VLL+FAKL+FN LQ  H++EL +   WW
Sbjct  202   RHALDQPIHKDLPWLGAKRYISSYKQEASHGEVLLKFAKLNFNFLQNMHQKELADITMWW  261

Query  887   KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPD  1066
             K++D    LP+ARDR VECYFW LGV FE +YS  R+++ K+I M S+ DD YD +G  +
Sbjct  262   KKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFTRIIMTKVIAMTSVMDDVYDVYGTME  321

Query  1067  ELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKE  1246
             EL +FTDAI++WDI + + LP +MK  YK L D+F+E +  L++ GRS+ V Y KE +K+
Sbjct  322   ELVLFTDAIERWDISKIDHLPEYMKFFYKQLFDVFKEIETGLAEPGRSYRVDYAKEAMKK  381

Query  1247  LVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNP  1423
              V +Y +E +W  E C P + EY++    SS   LL   SF+GM   VT++AFEW +++P
Sbjct  382   QVQAYFVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKDP  441

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
             +I++A +++AR+++D  S++ E+     A+ I+ YMN + V  E+A ++    V  AWKD
Sbjct  442   KIVKAASVIARLMDDTVSHKFEQERAHVASAIECYMNQHEVAEEQAYDELRRQVVEAWKD  501

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              NE++L      V   +L  +LN AR+ DV+YK+  DGYTN    ++  I S+L+
Sbjct  502   INEELLIIPKDHVPIPLLTRVLNLARVMDVMYKDG-DGYTNANGKVRNYITSLLI  555



>gb|KDO45658.1| hypothetical protein CISIN_1g039366mg [Citrus sinensis]
Length=547

 Score =   444 bits (1141),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/543 (43%), Positives = 348/543 (64%), Gaps = 27/543 (5%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D+   +  + + Q LK ++  ML   + ++    L+ ID ++
Sbjct  25    SANFHPSIWGDRFLSYTSDSMEKDDGSAKHQELKEEIRRMLKINKPSQ--NNLDLIDAIQ  82

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  +++A+ +  LGD    +L   +L FRLLRQHGY IS+ +F  
Sbjct  83    RLGVSYHFESEIDEILGKLHDAHQDCGLGDNENDELYYISLQFRLLRQHGYKISADVFKR  142

Query  524   FQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSSTLG  697
             F++ +G FK+SL+ DV+G+L+L+EA+HL  H +  L EA  F+ + LE I   Q+SS L 
Sbjct  143   FKDSDGNFKTSLAKDVRGMLSLFEATHLGVHEENILDEALAFTTSQLESIAAHQISSPLA  202

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
             +QV+HAL Q +H G+ R+E+ ++I +Y+E  S N+ LL FAKLDFN LQ  H++EL +  
Sbjct  203   EQVKHALIQPIHRGLQRLEARHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKELGD--  260

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
                           +RDR  ECYFW LGVYFE +YS AR +L K+I+M S  DD YD +G
Sbjct  261   -------------ISRDRIAECYFWILGVYFEPQYSFARRILTKVISMTSTIDDIYDVYG  307

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
             K +ELE+FT AI++WDI   ++LP +MK+ Y+ L+D++ E +K+L+ +G+ + +HY K+ 
Sbjct  308   KIEELELFTSAIKRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLHYAKKA  367

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSS  1414
             +K +V +Y  E KWC +   P + EY+     +S   +L T SF+GM   VT+E+FEW  
Sbjct  368   MKNIVKNYFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEWLF  427

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
              NPR I A++++ R+++D+AS+E E+     A+ ++ YM  +G T EEA N+F + V NA
Sbjct  428   SNPRFIRASSVVCRLMDDMASHEFEQSRGHVASSVECYMKQHGATEEEACNEFRKQVSNA  487

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD NED LR  P+ +   +L+ ILN  R+ DV+YK  +DGYT+   VLK  + S+L+N 
Sbjct  488   WKDINEDCLR--PTVLPMPLLMRILNLTRVIDVIYK-YEDGYTHSAVVLKDFVASLLINP  544

Query  1775  FEI  1783
               I
Sbjct  545   VPI  547



>gb|KHG04103.1| (-)-germacrene D synthase [Gossypium arboreum]
Length=545

 Score =   443 bits (1140),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 351/541 (65%), Gaps = 11/541 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  + PS+WGD F       ++     QE + LK ++  ML+       ++K   I T++
Sbjct  11    SVNYHPSIWGDIFLSCPSKMKIDTATRQEYEELKQEITRMLMVAPDGS-SQKYRLIATIK  69

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQEN  535
             RLG+SY F + I++ L+  ++ +  ++    L  ++L FRLLR++G+N  S IF+NF+++
Sbjct  70    RLGVSYLFEKEIEDALQTNFHHH-GYKADQTLEYTSLQFRLLRENGFNAQSEIFNNFKDD  128

Query  536   -GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV---IGPQLSSTLGKQ  703
              G FK SL++DVKGLL LYEASHL  H +  L+EA  F+ THLE+   IG  +   L   
Sbjct  129   KGNFKISLTSDVKGLLELYEASHLLVHGEHILEEALAFTTTHLELAQRIG--IERPLSAL  186

Query  704   VRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRW  883
             V HA  + +   +PR+E+  FI++Y+ED+S +  LL+FAKLDFNLLQ  HK+EL +  RW
Sbjct  187   VSHARKRPIRKALPRLEARQFISLYQEDDSHDKTLLKFAKLDFNLLQNLHKEELSKISRW  246

Query  884   WKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
             WK+LDF T LP+ARDR VECYFW LGVYFE +YS AR ++ K I MAS  DD YD  G  
Sbjct  247   WKDLDFATNLPFARDRLVECYFWILGVYFEPQYSFAREIMTKAIVMASTMDDIYDVHGTY  306

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             +ELE+FT+AI++WD    +RLP +MK+ YK L+DL+EE +K ++K+G+S+ V Y KE +K
Sbjct  307   EELELFTNAIERWDSNFIDRLPAYMKVFYKALLDLYEEMEKVMTKQGKSYRVQYAKEAMK  366

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQN  1420
             +L  +Y IE KW  E   P V EY+K    SS   ++   SF+GM   VT E F W+S N
Sbjct  367   QLSQAYFIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTEETFNWASNN  426

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+I+ A+++++R+++DI S++ E+     A+ ++ YM  +GV+ E+A  + ++++++AWK
Sbjct  427   PKIVRASSMISRIMDDIVSHKFEQERGHCASAVECYMKQHGVSEEKAYEELKKLIDSAWK  486

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             D N+++L   P+     +L C+LN AR+ D +YK + DGYT+   V K  I S+L++   
Sbjct  487   DINQELLFK-PARAPFPVLTCVLNLARVMDFLYK-EGDGYTHVGNVTKAGITSLLIDPVP  544

Query  1781  I  1783
             I
Sbjct  545   I  545



>gb|AII32473.1| terpene synthase [Populus trichocarpa]
Length=569

 Score =   444 bits (1142),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 226/541 (42%), Positives = 351/541 (65%), Gaps = 7/541 (1%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F    F++   + + QE   LK +V  ML +  + KL+++LNFID ++
Sbjct  23    SANFHPSIWGDYFACHTFNSMFDDHFEQEFIRLKEEVKEMLYAT-TNKLSQQLNFIDVIQ  81

Query  356   RLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ  529
             RLG+SY F   IDEML ++Y   +   +    DL   AL FRLLRQ G+ +S  +F  F+
Sbjct  82    RLGVSYLFESEIDEMLRDLYYQGSGGAYVHDHDLQMVALRFRLLRQQGHYVSCDVFKKFK  141

Query  530   EN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST-LGKQ  703
             +  G +K  L+ND++G+L+LYEA HL+ H +  L++A TF+ THL+ I   +    L  +
Sbjct  142   DTEGNYKVCLANDIQGMLSLYEAIHLRVHGEDILEDALTFATTHLKSITTDMCPPPLLVK  201

Query  704   VRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRW  883
             +RHALDQ +H  +P + + ++I++YE++ S ++VLL+FAKL+FN LQ  H++EL +   W
Sbjct  202   LRHALDQPIHKDLPWLGAKHYISIYEQEASHSEVLLKFAKLNFNFLQNMHQKELADMTMW  261

Query  884   WKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
             WK++D    LP+ARDR VECYFW LGV FE +YS AR+++ K+I M S+ DD YD +G  
Sbjct  262   WKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFARIIMTKVIAMTSVMDDVYDVYGTM  321

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             +EL +FTDAI++WDI   + LP +MK  YK L D+++E + EL+ +GRS+ V Y KE +K
Sbjct  322   EELVLFTDAIERWDISNIDHLPEYMKFFYKQLSDVYKEIETELAAQGRSYRVDYAKEAMK  381

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQN  1420
             + V +Y +E +W  E   P + EY++    SS   LL   SF+GM   VT++AFEW +++
Sbjct  382   KQVQAYFVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKD  441

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+I++A +L+AR+++DI S++ E+     A+ ++ YMN + V+ E+A ++    V  AWK
Sbjct  442   PKIVKAASLIARLMDDIVSHKFEQERGHVASAVECYMNQHEVSEEQAYDELRRQVVEAWK  501

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             D NE++L      V   +L  +LN AR+ DV+YK+  DGYTN +  ++  I S+L+   +
Sbjct  502   DINEELLIGPEDHVPIPLLTRVLNLARVMDVMYKDG-DGYTNAKGKVRNYITSLLIEPVQ  560

Query  1781  I  1783
             +
Sbjct  561   L  561



>gb|KCW52014.1| hypothetical protein EUGRSUZ_J01453 [Eucalyptus grandis]
Length=569

 Score =   444 bits (1142),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 240/569 (42%), Positives = 351/569 (62%), Gaps = 16/569 (3%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFV-----FDNEVAERYAQEIQVL  274
             LE   +  L    N+++V    S  + PSLW D    +       D+   ++  QEIQ L
Sbjct  3     LETSANRPLPAKGNSQMVER-RSVDYHPSLWEDYLAKYSSPSNSMDDGHDQQAEQEIQKL  61

Query  275   KGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEML----ENIYNANPNFQLG  442
             K +V  ML +  + K + K + ID ++RLGI+YHF   ID +L    E  + +N      
Sbjct  62    KDEVKWMLCA-HADKPSLKRDMIDQIQRLGIAYHFASEIDNVLIKLSETYFVSNNGDHDN  120

Query  443   DDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHND  619
             DDL T ALLFRLLRQ GY IS  IF+ F++ +GKF    ++D++GLL+LYEASHL  H +
Sbjct  121   DDLYTVALLFRLLRQQGYRISCDIFNKFKDTSGKFGEKHASDIRGLLSLYEASHLSVHGE  180

Query  620   ANLKEAYTFSKTHLEVIGP-QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESK  796
               L +A +FS  HLE I   QLS  L  QV+HAL Q++H G+PR+E+  +I++YE +   
Sbjct  181   DVLDQALSFSLKHLESIDKEQLSPPLAAQVQHALKQTIHRGVPRLEARQYISIYEAEPLH  240

Query  797   NDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEA  976
             N VLL  AKLDFN LQ  H++EL++  RWW  LDF   LP+ARDR VE YFW LGV+FE 
Sbjct  241   NKVLLSLAKLDFNHLQKQHQKELFDLARWWMGLDFKNKLPFARDRLVEGYFWILGVHFEP  300

Query  977   KYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKT  1156
             + +  R M+ K+I M S+ DD YD +G  +ELE+FT A+Q+WDI   N LP +M++ YK 
Sbjct  301   ELALVRRMMTKVIAMTSVLDDIYDVYGTYEELELFTRAVQRWDIDCINELPEYMQVFYKA  360

Query  1157  LIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQAS  1336
             LID++ E  ++L+  GRS+ + Y KE +K    SY  E KW   +  P + EY+     S
Sbjct  361   LIDVYVEIGEKLASAGRSYGLDYAKEAMKRQDRSYFAEAKWLHRQHKPTMDEYMSVALVS  420

Query  1337  STLYLLITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNAT  1513
             S  +LL   SF+GM+  VT++  +W   +P+I++A+T++ R+++D+A+++ E+      +
Sbjct  421   SGYHLLAITSFVGMQDIVTKDDLDWLFNDPKILKASTVICRLMDDLATHKFEQGREHADS  480

Query  1514  GIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDV  1693
              +  YM  Y VT +EA N   + V++AWKD NE+ L   P+AV+  +L+ ILN  R+ DV
Sbjct  481   AVQCYMKQYNVTEQEAENDLRKQVDDAWKDLNEECL--CPTAVAKPLLMGILNLTRVMDV  538

Query  1694  VYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             +YK+  D YTNP  +LK  I SVL++  +
Sbjct  539   LYKDGGDHYTNPHIMLKDYIRSVLMDPVQ  567



>ref|XP_006592517.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Glycine 
max]
Length=567

 Score =   444 bits (1142),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 346/536 (65%), Gaps = 10/536 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F Y+V  +   + + ++ Q+ K +V  ML++        KL FID+++RLG
Sbjct  28    FSPSIWGDYFLYYVPSSVEDDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFIDSVQRLG  87

Query  365   ISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +SYHF   ID +L  IYN     N      DDLC  ALLFRLLRQ GY+ISS +F  F++
Sbjct  88    VSYHFEHEIDGVLHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGYHISSNVFYKFKD  147

Query  533   NGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQLSSTLGKQV  706
               + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +  QLS ++  QV
Sbjct  148   QTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQLSPSMIAQV  207

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             +H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H++E+    RWW
Sbjct  208   KHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKEVNNVTRWW  267

Query  887   -KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
              K L+  T LP+ RDR  ECYFW+LG+YFE +YS AR +  K+I + S+ DD YD++G  
Sbjct  268   IKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDDMYDAYGTI  327

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+ + + Y K+ +K
Sbjct  328   DELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCIKYAKKEMK  387

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNP  1423
              L+ +   E +W     TP + EY++    SS   ++IT  F+GMK  T E   W++ +P
Sbjct  388   RLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKDTTEEVLIWATSDP  447

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
              II A +++ R+++DI   E E+  R  A+ I+ YM  +  + ++A+NK  EMV++AWKD
Sbjct  448   IIIGAASIICRLMDDIVGNEFEQERRHVASSIECYMKQHNTSRQDAINKLLEMVKSAWKD  507

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K  I ++LVN
Sbjct  508   INEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKDYIKTLLVN  560



>ref|XP_006475307.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006475308.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X2 [Citrus 
sinensis]
Length=555

 Score =   443 bits (1140),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/561 (42%), Positives = 357/561 (64%), Gaps = 14/561 (2%)
 Frame = +2

Query  122   TSEILKMVTNN--EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAER-YAQEIQVLKGQVMS  292
             ++++L  V+++  + VRP+  F   P+LWGD F     D +  +  + +E + LK +V S
Sbjct  2     SAQVLATVSSSTEKTVRPIAGFH--PNLWGDYFLTLASDCKTNDTTHQEEYEALKQEVRS  59

Query  293   MLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLF  472
             M+ +      A+KL  +D ++RLG++YHF + I++ +E IY+ + +     DL T +L F
Sbjct  60    MITATADTP-AQKLQLVDAVQRLGVAYHFEQEIEDAMEKIYHDDFDNIDDVDLYTVSLRF  118

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQ G+ +   +F+ F+++ GKFK+SL  DV+G+L+LYEA HL    +  L EA  F+
Sbjct  119   RLLRQQGFKVPCDVFEKFKDDEGKFKASLVKDVQGILSLYEAGHLAIRGEDILDEAIAFT  178

Query  650   KTHLEVIGPQ--LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAK  823
             +THL+ +       + L +Q+ HALD  L    PRVE+ +F++VY   +  +  LL+FAK
Sbjct  179   RTHLKSMASDDVCPNNLAEQINHALDCPLRRAFPRVETRFFLSVYPRVDKHDKTLLKFAK  238

Query  824   LDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLML  1003
             LDFNL+Q  H++EL    RWWK+LDF T LPYARDR VE YFW +G YFE KY+ AR ++
Sbjct  239   LDFNLVQRIHQKELSAITRWWKDLDFTTKLPYARDRIVELYFWIVGTYFEPKYTLARKIM  298

Query  1004  AKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFD  1183
              K I MASI DDT+D++G  +EL++F +A+Q+WDI   + LP +MK++YK L+D + E +
Sbjct  299   TKTIYMASIIDDTFDAYGFFEELKLFVEAVQRWDIGAMDILPEYMKVLYKALLDTYNEVE  358

Query  1184  KELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITA  1363
             ++L+KEGRS  + Y KE+++ELV  Y ++ KW +E   P   EY   G  S   ++L T 
Sbjct  359   QDLAKEGRSSYLRYDKEKMQELVQMYFVQAKWSSEGYVPTWEEYYPVGLVSGGYFMLATN  418

Query  1364  SFLGMKSVT-REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDY  1540
             SFLGM  V  +EAFEW S+NP+I  A+++++R++NDI S++ E+      TG++ Y   +
Sbjct  419   SFLGMCEVANKEAFEWISKNPKISRASSVISRLMNDIVSHQFEQKRGHVTTGVECYCKQH  478

Query  1541  GVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGY  1720
             GV+ EE +  F E VENAWKD NE+ LR  P+A    ++    N AR+ + +YK K D Y
Sbjct  479   GVSEEEVVKVFTEEVENAWKDMNEEFLR--PTAFPVALIERPFNIARVLEFLYK-KGDCY  535

Query  1721  TNPEKVLKPCIFSVLVNSFEI  1783
             T+   + K  I +VL +   I
Sbjct  536   THSHAI-KDQIAAVLRDPVTI  555



>ref|XP_006475310.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=983

 Score =   457 bits (1175),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 232/511 (45%), Positives = 339/511 (66%), Gaps = 12/511 (2%)
 Frame = +2

Query  272   LKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQL----  439
             LK ++  ML +    K +  L  ID ++RLG+SYHF   IDE+L  ++ A+ +  L    
Sbjct  478   LKKEIRRMLKA--DNKPSRTLQLIDAIQRLGVSYHFESEIDEILGKMHKASQDSDLCDNE  535

Query  440   GDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHN  616
              D+L   +L FRLLRQ+GY IS+ +F  F++ +G FK+SL+ DV+G+L+LYEA+HL  H 
Sbjct  536   NDELYYISLHFRLLRQNGYKISADVFKKFKDTDGNFKTSLAKDVRGMLSLYEATHLGVHE  595

Query  617   DANLKEAYTFSKTHLEVIGP-QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDES  793
             +  L EA  F+ +HLE I   Q+ S L +QV+HAL Q +H G+ R+E+  +I +Y+E+  
Sbjct  596   EDILDEALAFTTSHLESIATHQIRSPLVEQVKHALVQPIHRGLQRLEARQYIPIYQEESP  655

Query  794   KNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFE  973
              N+ LL FAKLDFN LQ  H++EL +  RWWKELDF   LP+ RDR  ECYFW LGVYFE
Sbjct  656   HNEALLTFAKLDFNKLQKLHQKELGDISRWWKELDFAHKLPFIRDRVAECYFWILGVYFE  715

Query  974   AKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYK  1153
              +YS AR +L K+I+M S+ DD YD +GK +ELE+FT AI++WDI   ++LP +MK+ Y+
Sbjct  716   PQYSFARRILTKVISMTSVIDDIYDVYGKIEELELFTSAIERWDISAIDQLPEYMKLCYR  775

Query  1154  TLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQA  1333
              L+D+F E +K+L+ +G+S+ ++Y KE +K +V +Y  E KWC +   P V EY+     
Sbjct  776   ALLDVFSEAEKDLAPQGKSYRLYYAKEAMKNMVKNYFYEAKWCLQNYVPTVDEYMTVALV  835

Query  1334  SSTLYLLITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNA  1510
             +S   +L T SF+GM   VT+E+FEW   NPR I A++++ R+++DI S++ E+     A
Sbjct  836   TSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRASSIVCRLMDDIVSHKFEQSRGHVA  895

Query  1511  TGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDD  1690
             + ++ YM  +G T EEA N+F + V NAWKD NED LR  P+ +   +L+ ILN  R+ D
Sbjct  896   SSVECYMKQHGATEEEACNEFRKQVSNAWKDINEDCLR--PTVLPMPLLMRILNLTRVID  953

Query  1691  VVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             V+YK  +DGYT+   VLK  + S+L+N   I
Sbjct  954   VIYKY-EDGYTHSAVVLKDFVASLLINPVPI  983


 Score =   395 bits (1015),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 294/443 (66%), Gaps = 9/443 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F  +  D+   +  + + Q LK ++  ML   + ++    L+ ID ++
Sbjct  25    SANFHPSIWGDRFLSYTSDSMEKDDGSAKHQELKEEIRRMLKINKPSQ--NNLDLIDAIQ  82

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYNISSGIFDN  523
             RLG+SYHF   IDE+L  ++ A+ +  LGD    +L   +L FRLLRQHGY IS+ +F  
Sbjct  83    RLGVSYHFESEIDEILGKLHEAHQDCGLGDNENDELYYISLQFRLLRQHGYKISADVFKR  142

Query  524   FQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP-QLSSTLG  697
             F++ +G FK+SL+ DV+G+L+L+EA+HL  H +  L EA  F+ + LE I   Q+SS L 
Sbjct  143   FKDSDGNFKTSLAKDVRGMLSLFEATHLGVHEENILDEALAFTTSQLESIAAHQISSPLA  202

Query  698   KQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHM  877
             +QV+HAL Q +H G+ R+E++++I +Y+E  S N+ LL FAKLDFN LQ  H++EL +  
Sbjct  203   EQVKHALIQPIHRGLQRLEATHYIPIYQEQSSHNEALLTFAKLDFNKLQKLHQKELGDIS  262

Query  878   RWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFG  1057
             RWWKELDF   LP+ RDR  ECYFW LGVYFE +YS  R +L K+I+M S  DD YD  G
Sbjct  263   RWWKELDFAHKLPFIRDRIAECYFWILGVYFEPQYSFTRRILTKVISMTSTIDDIYDVCG  322

Query  1058  KPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKER  1237
             K +ELE+FT AI++WDI   ++LP +MK+ Y+ L+D++ E +K+L+ +G+ + +HY K+ 
Sbjct  323   KIEELELFTSAIKRWDISAIDQLPEYMKLCYRALLDVYSEAEKDLAPQGKLYRLHYAKKA  382

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSS  1414
             +K +V +   E KWC +   P + EY+     +S   +L T SF+GM   VT+E+FEW  
Sbjct  383   MKNIVKNCFFEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEWLF  442

Query  1415  QNPRIIEANTLLARVINDIASYE  1483
              NPR I A++++ R+++D+AS+E
Sbjct  443   SNPRFIRASSVVCRLMDDMASHE  465



>ref|XP_002275408.3| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CBI31300.3| unnamed protein product [Vitis vinifera]
 gb|ADR74222.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score =   443 bits (1140),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 233/544 (43%), Positives = 358/544 (66%), Gaps = 18/544 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV   ++ PS+WGD+F  +  ++EV  R  +E Q+  LK ++   L++  +   ++KL 
Sbjct  19    RPVV--KYHPSIWGDQFMSYTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQKLK  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTS----ALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  75    FIDAVQRLGVAYHFEREIEEVLQHIYDSYPN---GDDMEGGIYNVALQFRLLRQAGFNIS  131

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+ H +  L EA   + THL  +   L
Sbjct  132   CGLFNEFKDEKGNFKKALVSDVRGMLGLYEAAHLRVHGEDILDEALALTTTHLRSMVEHL  191

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                  +QV HAL Q +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+E
Sbjct  192   EYPFAEQVAHALKQPIRKGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEE  251

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWK+L+F T LP+ARDR VE YFW LGV+FE +Y+ AR ++ K I M S  DD 
Sbjct  252   LSNITRWWKQLNFATKLPFARDRLVEGYFWILGVFFEPQYAWARRIVTKTIAMTSTMDDI  311

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD++G  +ELE+FT+AI++WDI   + LP +MK  Y  L+D+++E ++E+ KEG  + V 
Sbjct  312   YDAYGTFEELELFTEAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQ  371

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREA  1399
             Y  E +K+ V +Y  E KW  E   P + EY+   + SS   +L   SF+GM K VT+EA
Sbjct  372   YAIEAMKKQVRAYFHEAKWLHEGRIPTMEEYMSIARVSSGYPMLTATSFIGMGKIVTKEA  431

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W   +P+I+ A+ ++AR+++DI S++ E+     A+G++ YM  YG + EE  +KF++
Sbjct  432   FDWVISDPKIVTASAVIARLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQK  491

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              V +AWKDTNE+ LR  P+AV   +L+ +LN +R+  V+Y    DGYT+  KV+K  + S
Sbjct  492   QVVDAWKDTNEEFLR--PTAVPMPLLMRVLNLSRVMYVIYTGG-DGYTHVGKVMKNNVAS  548

Query  1760  VLVN  1771
             +L++
Sbjct  549   LLIH  552



>dbj|BAJ53216.1| JHL22C18.7 [Jatropha curcas]
Length=551

 Score =   443 bits (1139),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 341/530 (64%), Gaps = 11/530 (2%)
 Frame = +2

Query  146   TNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLA  325
             T +++ RP+ +F   PS+WG  F          E Y +E++ LK  V  ML    + +L 
Sbjct  10    TQHDIFRPLANF--PPSVWGYSFASSSPLEAEFESYTREVEALKENVKDMLKQ-STGELI  66

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD--DLCTSALLFRLLRQHGYN  499
             E + FI+ + RLGISYHF   I+E L +I+ A PN    +  DL TSALLF++LRQHGY 
Sbjct  67    ENIEFINLLYRLGISYHFEAEIEEQLNHIFIALPNIIHDNNYDLYTSALLFQVLRQHGYK  126

Query  500   ISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +   +F  F++N G+FK S+S+DVKGLL LYEA+ L  H +  L EA  F+K  LE++  
Sbjct  127   MPCDVFKKFKDNNGEFKKSISDDVKGLLGLYEATFLSVHGEDILDEALVFTKRCLEILAA  186

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
             Q S  L  ++R+AL +  H GI R+E+  +I+ Y E++S N  LL+FAKLDFN LQ+ +K
Sbjct  187   QSSPHLANRIRNALLRPFHQGIERIETRQYISFYAEEKSPNQTLLKFAKLDFNRLQLLYK  246

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             QEL    +WWK+L+ V  LPY RDR VE Y WA+G +FE +Y+ AR+M+ K   M S+ D
Sbjct  247   QELALVSKWWKDLNLVEKLPYVRDRIVEVYIWAIGAHFEPQYALARVMITKYTKMVSVVD  306

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             DTYD++G  DEL+ FT A+Q+ +I   ++LP +MK++Y+ L++LF E + +   EGRS  
Sbjct  307   DTYDAYGTLDELQQFTIAVQRCNIDAIDQLPEYMKVLYRALLNLFAETEND-ETEGRSQR  365

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTR  1393
               Y KE  KELV +Y +E KW  E   PP  EYI NG  SST  +L  ASF+G+ K V  
Sbjct  366   TAYAKETFKELVRAYFVEAKWFNEGYVPPFEEYISNGLVSSTYSVLPAASFIGLEKVVGS  425

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             + +EW  +NP+I+ A+ L++R+++D+ ++E E+     A+GI+ YM +YGV+ +EA+++ 
Sbjct  426   KEYEWVKENPKIVNASKLISRLMDDVTTHEHEQEREHCASGIECYMKEYGVSQKEAIDEI  485

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYT  1723
             ++M  NAWKD N+  ++  P+ VST +L   +N AR+ D VYK   D YT
Sbjct  486   QKMCANAWKDINQACMK--PTEVSTTLLKYYVNLARVVDFVYK-YSDSYT  532



>ref|XP_006592518.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Glycine 
max]
Length=566

 Score =   443 bits (1140),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/536 (42%), Positives = 347/536 (65%), Gaps = 11/536 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F Y+V  +E  + + ++ Q+ K +V  ML++        KL FID+++RLG
Sbjct  28    FSPSIWGDYFLYYVPSSE-DDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFIDSVQRLG  86

Query  365   ISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +SYHF   ID +L  IYN     N      DDLC  ALLFRLLRQ GY+ISS +F  F++
Sbjct  87    VSYHFEHEIDGVLHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGYHISSNVFYKFKD  146

Query  533   NGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQLSSTLGKQV  706
               + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +  QLS ++  QV
Sbjct  147   QTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQLSPSMIAQV  206

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             +H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H++E+    RWW
Sbjct  207   KHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKEVNNVTRWW  266

Query  887   -KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
              K L+  T LP+ RDR  ECYFW+LG+YFE +YS AR +  K+I + S+ DD YD++G  
Sbjct  267   IKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDDMYDAYGTI  326

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+ + + Y K+ +K
Sbjct  327   DELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCIKYAKKEMK  386

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNP  1423
              L+ +   E +W     TP + EY++    SS   ++IT  F+GMK  T E   W++ +P
Sbjct  387   RLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKDTTEEVLIWATSDP  446

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
              II A +++ R+++DI   E E+  R  A+ I+ YM  +  + ++A+NK  EMV++AWKD
Sbjct  447   IIIGAASIICRLMDDIVGNEFEQERRHVASSIECYMKQHNTSRQDAINKLLEMVKSAWKD  506

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K  I ++LVN
Sbjct  507   INEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKDYIKTLLVN  559



>ref|XP_009338867.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=557

 Score =   442 bits (1138),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 238/545 (44%), Positives = 356/545 (65%), Gaps = 18/545 (3%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V +P  S  +SPS+WGD F  +    EV     Q +Q LK +V  ML++     +++KL
Sbjct  19    DVHQPKPSATYSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRRMLMT-SLENVSQKL  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID ++RLG+SYHF   I+E+L+ I+ ++ +    DDLCT+AL FRLLRQ GYN+S  +
Sbjct  77    NLIDDIQRLGVSYHFGNEIEEILQKIHESSYDL---DDLCTAALFFRLLRQQGYNVSCDL  133

Query  515   FDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS--  685
             F+ F++ NG FK SL +DV GLL+LYEA+HL+ H +  L EA TF+ T+LE    +LS  
Sbjct  134   FNKFKDGNGNFKGSLVDDVVGLLSLYEATHLRIHGEEILDEALTFTTTNLESATFRLSPP  193

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQE  862
             S L K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL+FAKLDFN LQ  H++E
Sbjct  194   SPLAKAVTHALNQPLLKGLPRVEARYYLSVYQELRESPNETLLKFAKLDFNRLQRVHQKE  253

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             L E  RWWK LD    LP+ARDR VE YF W L V F+ +YS AR + +K+  + S+ DD
Sbjct  254   LSEITRWWKNLDVPNKLPFARDRLVEVYFCWGLTVDFQPQYSFARRISSKVTAIISLIDD  313

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
              Y+ +G  ++LE+FT+AI+ WD+   ++LP +MK+ Y+ L+D++ E  ++L+ +G+ + +
Sbjct  314   IYE-YGTNEQLELFTEAIESWDVSAIDQLPEYMKVCYRALLDVYTEIHEKLAHDGKLYRI  372

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREA  1399
             H+ +E +K++V  Y  E K   ++  P + EY+     +    LLIT SF+GM+  T E+
Sbjct  373   HHAREAMKKVVRGYFDEAKLFRQKHMPSLDEYMSVSLVTGGCLLLITTSFVGMEEATIES  432

Query  1400  FEWSSQNPRIIEANTLLARVINDIA--SYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             F+W   +P +++A + + R+++DIA   +E+EK + +    ++ YM  YG T EEA+ + 
Sbjct  433   FDWLLTSPPVVKATSTIQRLMDDIAEHKFEQEKEHFIGV--VNCYMKKYGATEEEAITEL  490

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
             +  V NAWKD NE  L   P+AV   +L+  LNFAR+ DV YK+ +DGYTN + V+K  I
Sbjct  491   QGQVNNAWKDINEACLH--PTAVPMPLLIRFLNFARVMDVAYKH-EDGYTNAKGVVKDLI  547

Query  1754  FSVLV  1768
              S LV
Sbjct  548   ISTLV  552



>gb|AFQ23183.1| sesquiterpene synthase [Gossypium hirsutum]
 gb|AGX84975.1| terpene synthase [Gossypium hirsutum]
Length=545

 Score =   442 bits (1137),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 231/541 (43%), Positives = 351/541 (65%), Gaps = 11/541 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  + PS+WGD F       ++     QE + LK ++  ML+       ++K   I T++
Sbjct  11    SVNYHPSIWGDIFLSCPSKMKIDTVTRQEYEELKQEITRMLMVAPDGS-SQKYRLIATIK  69

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQEN  535
             RLG+SY F + I++ L+  ++ +  ++    L  ++L FRLLR++G+N  + IF+NF+++
Sbjct  70    RLGVSYLFEKEIEDALQTDFHHH-GYKADQTLEYTSLQFRLLRENGFNAQAEIFNNFKDD  128

Query  536   -GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV---IGPQLSSTLGKQ  703
              G FK SL++DVKGLL LYEASHL  H +  L+EA  F+ THLE+   IG  +   L   
Sbjct  129   KGNFKISLTSDVKGLLELYEASHLLVHGEHILEEALAFTTTHLELAQRIG--IERPLSAL  186

Query  704   VRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRW  883
             V HA  + +   +PR+E+  FI++Y+ED+S +  LL+FAKLDFNLLQ  HK+EL +  RW
Sbjct  187   VSHARKRPIRKALPRLEARQFISLYQEDDSHDKTLLKFAKLDFNLLQNLHKEELSKISRW  246

Query  884   WKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
             WK+LDF T LP+ARDR VECYFW LGVYFE +YS AR ++ K I MAS  DD YD  G  
Sbjct  247   WKDLDFATNLPFARDRLVECYFWILGVYFEPQYSFAREIMTKAIVMASTMDDIYDVHGTY  306

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             +ELE+FT+AI++WD    +RLP +MK+ YK L+DL+EE +K ++K+G+S+ V Y KE +K
Sbjct  307   EELELFTNAIERWDSNFIDRLPAYMKVFYKALLDLYEEMEKVMTKQGKSYRVQYAKEAMK  366

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQN  1420
             +L  +Y IE KW  E   P V EY+K    SS   ++   SF+GM   VT E F W+S N
Sbjct  367   QLSQAYFIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTEETFNWASNN  426

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+I+ A+++++R+++DI S++ E+     A+ ++ YM  +GV+ E+A  + ++++++AWK
Sbjct  427   PKIVRASSMISRIMDDIVSHKFEQERGHCASAVECYMKQHGVSEEKAYEELKKLIDSAWK  486

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             D N+++L   P+     +L C+LN AR+ D +YK + DGYT+   V K  I S+L++   
Sbjct  487   DINQELLFK-PARAPFPVLTCVLNLARVMDFLYK-EGDGYTHVGNVTKAGITSLLIDPVP  544

Query  1781  I  1783
             I
Sbjct  545   I  545



>ref|XP_003541022.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Glycine 
max]
Length=567

 Score =   442 bits (1138),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 345/536 (64%), Gaps = 10/536 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F Y+V  +   + + ++ Q+ K +V  ML++        KL FID+++RLG
Sbjct  28    FSPSVWGDYFLYYVPSSVEDDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFIDSVQRLG  87

Query  365   ISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +SYHF   ID  L  IYN     N      DDLC  ALLFRLLRQ GY+ISS +F  F++
Sbjct  88    VSYHFEHEIDGALHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGYHISSNVFYKFKD  147

Query  533   NGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQLSSTLGKQV  706
               + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +  QLS ++  QV
Sbjct  148   QTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQLSPSMIAQV  207

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             +H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H++E+    RWW
Sbjct  208   KHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKEVNNVTRWW  267

Query  887   -KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
              K L+  T LP+ RDR  ECYFW LG+YFE +YS AR +  K+I + S+ DD YD++G  
Sbjct  268   IKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITTKVIALCSVIDDMYDAYGTI  327

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+ + + Y K+ +K
Sbjct  328   DELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCIKYAKKEMK  387

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNP  1423
              L+ ++  E +W     TP + EY++    SS   ++IT  F+GMK  T E   W++ +P
Sbjct  388   RLIKAHMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITICFVGMKDTTEEVLIWATSDP  447

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
              II A +++ R+++DI   E E+  R  A+ I+ YM  +  + ++A+NK  EMV++AWKD
Sbjct  448   IIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHNTSRQDAINKLLEMVKSAWKD  507

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K  I ++LVN
Sbjct  508   INEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKDYIKTLLVN  560



>ref|XP_002317018.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
 gb|EEE97630.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
Length=569

 Score =   442 bits (1138),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 226/541 (42%), Positives = 350/541 (65%), Gaps = 7/541 (1%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             S  F PS+WGD F    F++   + + QE   LK +V  ML +  + KL+++LNFID ++
Sbjct  23    SANFHPSIWGDYFACHTFNSMFDDHFEQEFIRLKEEVKEMLYAT-TNKLSQQLNFIDVIQ  81

Query  356   RLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ  529
             RLG+SY F   IDEML ++Y   +   +    DL   AL FRLLRQ G  +S  +F  F+
Sbjct  82    RLGVSYLFESEIDEMLRDLYYQGSGGAYVHDHDLQMVALRFRLLRQQGRYVSCDVFKKFK  141

Query  530   EN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST-LGKQ  703
             +  G +K  L+ND++G+L+LYEA HL+ H +  L++A TF+ THL+ I   +    L  +
Sbjct  142   DTEGNYKVCLANDIQGMLSLYEAIHLRVHREDILEDALTFATTHLKSITTDMCPPPLLVK  201

Query  704   VRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRW  883
             +RHALDQ +H  +P + + ++I++YE++ S ++VLL+FAKL+FN LQ  H++EL +   W
Sbjct  202   LRHALDQPIHKDLPWLGAKHYISIYEQEASHSEVLLKFAKLNFNFLQNMHQKELADMTMW  261

Query  884   WKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
             WK++D    LP+ARDR VECYFW LGV FE +YS AR+++ K+I M S+ DD YD +G  
Sbjct  262   WKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFARIIMTKVIAMTSVMDDVYDVYGTM  321

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             +EL +FTDAI++WDI   + LP +MK  YK L D+++E + EL+ +GRS+ V Y KE +K
Sbjct  322   EELVLFTDAIERWDISNIDHLPEYMKFFYKQLSDVYKEIETELAAQGRSYRVDYAKEAMK  381

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQN  1420
             + V +Y +E +W  E   P + EY++    SS   LL   SF+GM   VT++AFEW +++
Sbjct  382   KQVQAYFVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKD  441

Query  1421  PRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWK  1600
             P+I++A +L+AR+++DI S++ E+     A+ ++ YMN + V+ E+A ++    V  AWK
Sbjct  442   PKIVKAASLIARLMDDIVSHKFEQERGHVASAVECYMNQHEVSEEQAYDELRRQVVEAWK  501

Query  1601  DTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             D NE++L      V   +L  +LN AR+ DV+YK+  DGYTN +  ++  I S+L+   +
Sbjct  502   DINEELLIGPEDHVPIPLLTRVLNLARVMDVMYKDG-DGYTNAKGKVRNYITSLLIEPVQ  560

Query  1781  I  1783
             +
Sbjct  561   L  561



>ref|XP_007133006.1| hypothetical protein PHAVU_011G143300g [Phaseolus vulgaris]
 gb|ESW05000.1| hypothetical protein PHAVU_011G143300g [Phaseolus vulgaris]
Length=565

 Score =   442 bits (1137),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 348/544 (64%), Gaps = 15/544 (3%)
 Frame = +2

Query  161   VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVS-IRSAKLAEKLN  337
              RP+ +F   PS+WGD F  +V     ++ + Q+ ++LK  VM +LVS I     + KLN
Sbjct  24    TRPIANFH--PSIWGDRFLSYVPTFAESDSHIQQAKLLKEDVMKILVSLIDHNNFSFKLN  81

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             FID ++RLG+SYHF   ID +L  IY+     N      D+L  +ALLFRLLRQHGY IS
Sbjct  82    FIDYVQRLGVSYHFEHEIDTLLCQIYDISTKDNNIIAHSDNLYHTALLFRLLRQHGYRIS  141

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQ  679
             S IF  FQ + GKFK SL +D++G+L+LYEA+ L+ H +  L+EA+ FS   L + I  Q
Sbjct  142   SSIFCKFQDQTGKFKESLDDDIQGMLSLYEAAGLRCHGEDMLEEAHKFSFEQLTKFITTQ  201

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             LS +   +V+H+L QSL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H +
Sbjct  202   LSCSHVARVQHSLKQSLRRGLPRLEATYYMSYYEEDPSHDEKLLTFAKLDFNMLQKLHLK  261

Query  860   ELYEHMRWW-KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             E+    RWW K+L+  T LP+ RDR VEC FW LGVYFE +Y   R +  K I +ASI D
Sbjct  262   EVSSLTRWWTKDLNVSTNLPFTRDRIVECCFWILGVYFEPQY--YRWITTKAIALASIID  319

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  +ELE+FT AI++WDI     LP++M++ YK ++D++EE +KE+ K+G+ + 
Sbjct  320   DLYDAYGTIEELELFTSAIERWDICCLVDLPKYMQLCYKAILDVYEEIEKEMRKQGKVYF  379

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
             + Y K+ +K LV ++  E +WC     P + EY+K  + SS    LIT SFLGMK  T E
Sbjct  380   MKYAKKEMKRLVQAHMAEGRWCHTNHIPTMEEYMKVREISSGYPFLITLSFLGMKDTTEE  439

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
                W++  P II A+T + R+++DI   E E+      + I  YM  + V+ + A+ + +
Sbjct  440   VLIWATNEPIIIAASTTICRIMDDIVGDEFEQQREHVVSSISCYMKQHKVSRKCAIEELQ  499

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             ++VENAWKD N+  L   P+ V    L+ ++NFAR+ D+ YK+ +D YTN   ++K  I 
Sbjct  500   KLVENAWKDINDACLA--PTQVPMTFLMRVVNFARVIDMHYKD-EDNYTNAGGIMKNHIE  556

Query  1757  SVLV  1768
             S+LV
Sbjct  557   SLLV  560



>gb|KHN11075.1| (-)-germacrene D synthase [Glycine soja]
Length=567

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 344/536 (64%), Gaps = 10/536 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F Y+V  +   + + ++ Q+ K +V  ML++        KL FID+++RLG
Sbjct  28    FSPSVWGDYFLYYVPSSVEDDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFIDSVQRLG  87

Query  365   ISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +SYHF   ID  L  IYN     N      DDLC  ALLFRLLRQ GY+ISS +F  F++
Sbjct  88    VSYHFEHEIDGALHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGYHISSNVFYKFKD  147

Query  533   NGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQLSSTLGKQV  706
               + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +  QLS ++  QV
Sbjct  148   QTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQLSPSMIAQV  207

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             +H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H++E+    RWW
Sbjct  208   KHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKEVNNVTRWW  267

Query  887   -KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
              K L+  T LP+ RDR  ECYFW LG+YFE +YS AR +  K+I + S+ DD YD++G  
Sbjct  268   IKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITTKVIALCSVIDDMYDAYGTI  327

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+ + + Y K+ +K
Sbjct  328   DELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCIKYAKKEMK  387

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNP  1423
              L+ +   E +W     TP + EY++    SS   ++IT  F+GMK  T E   W++ +P
Sbjct  388   RLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITICFVGMKDTTEEVLIWATSDP  447

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
              II A +++ R+++DI   E E+  R  A+ I+ YM  +  + ++A+NK  EMV++AWKD
Sbjct  448   IIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHNTSRQDAINKLLEMVKSAWKD  507

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K  I ++LVN
Sbjct  508   INEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKDYIKTLLVN  560



>ref|XP_010032599.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW52013.1| hypothetical protein EUGRSUZ_J01451 [Eucalyptus grandis]
Length=569

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 240/570 (42%), Positives = 352/570 (62%), Gaps = 18/570 (3%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFV-----FDNEVAERYAQEIQVL  274
             LE   +  L    N+++V    S  + PSLW D    +       D+   ++  QEIQ L
Sbjct  3     LETSANRPLPAKENSQMVER-RSVDYHPSLWEDYLAKYSSPSNSMDDGHDQQAEQEIQKL  61

Query  275   KGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNA-----NPNFQL  439
             K +V  ML +  + K + KL+ ID ++RLGI+YHF   ID +L+ +        N N+  
Sbjct  62    KDEVKRMLCA-HADKPSLKLDMIDQIQRLGIAYHFASEIDNVLKKLSQTYFVSNNGNYD-  119

Query  440   GDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHN  616
              DDL T ALLFRLLRQ G  IS  IF+ F++ +GKF    ++DV+GLL+LYEASHL  H 
Sbjct  120   NDDLYTVALLFRLLRQQGCRISCDIFNKFKDTSGKFTEKHASDVRGLLSLYEASHLSVHG  179

Query  617   DANLKEAYTFSKTHLEVIGP-QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDES  793
             +  L +A +FS  HLE I   QLS  L  QV+HAL Q++  G+PR+E+  +I++YE +  
Sbjct  180   EDVLDQALSFSLKHLESIDKEQLSPPLAAQVQHALKQTIRRGVPRLEARRYISMYEAEPL  239

Query  794   KNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFE  973
              N VLL  AKLDFN LQ  H++EL++  RWW  LDF + LP+ARDR VE YFW LGV+FE
Sbjct  240   HNKVLLSLAKLDFNHLQKQHQEELFDLARWWMGLDFKSKLPFARDRLVEGYFWILGVHFE  299

Query  974   AKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYK  1153
              + +  R M+ K+I M S+ DD YD +G  +ELE+FT A+Q+WDI   N LP +M++ YK
Sbjct  300   PELAPVRRMMTKVIAMTSVLDDIYDVYGTYEELELFTRAVQRWDIDCINELPEYMQVFYK  359

Query  1154  TLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQA  1333
              LID++ E  ++L+  GRS+ + Y KE +K    SY  E KW  ++  P + EY+     
Sbjct  360   ALIDVYVEIGEKLACTGRSYGLDYAKEAMKRQARSYFAEAKWLHQQHKPTMDEYMSVALV  419

Query  1334  SSTLYLLITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNA  1510
             SS   LL   SF+GM+  VT++  +W   +P+I++A+T++ R+++D+A+++ E+      
Sbjct  420   SSGYPLLAITSFVGMQDIVTKDDLDWLFNDPKILKASTVICRLMDDLATHKFEQGREHAD  479

Query  1511  TGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDD  1690
             + +  YM  Y VT +EA N   + V++AWKD NE+ L   P+AV+  +L+ ILN  R+ D
Sbjct  480   SAVQCYMKQYNVTEQEAENDLRKQVDDAWKDLNEECL--CPTAVAKPLLMGILNLTRVMD  537

Query  1691  VVYKNKQDGYTNPEKVLKPCIFSVLVNSFE  1780
             V+YK+  D YTNP  +LK  I SVL++  +
Sbjct  538   VLYKDGGDHYTNPHIMLKDYIRSVLMDPVQ  567



>ref|XP_011080427.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=561

 Score =   441 bits (1135),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 222/548 (41%), Positives = 353/548 (64%), Gaps = 9/548 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V  P+TS+  SPS+WGD F  F  D++V E+Y + I+ LK +  SML+S  S  + EKL
Sbjct  18    DVRPPITSY--SPSMWGDTFTSFSLDDKVQEKYVETIEELKQEARSMLMSKGSTTI-EKL  74

Query  335   NFIDTMERLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
               IDT+ERLG+ YHF + I++ L  I+   +    Q   DL T+AL FR+ RQH Y++S 
Sbjct  75    VLIDTLERLGVGYHFEQEIEDQLREIFRFQSEDKDQGNYDLFTAALQFRVFRQHRYSVSC  134

Query  509   GIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F+ F  E G+F+ +L++D KGLL+LYEA++++ H +  L+ A  F+  HL+ +  QL 
Sbjct  135   DVFNKFMGEGGEFEETLTSDTKGLLSLYEAANVRIHGEDILENAVVFTTHHLKCMVQQLE  194

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
               L  QV+ AL+Q LH G+ +VE+ ++I+ YE++ES+N++LL+ AKLDF+  Q  +K+EL
Sbjct  195   PRLQCQVKRALEQPLHRGVAKVEARHYISFYEKEESRNEMLLKLAKLDFSYSQNLYKKEL  254

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             ++  RWW ELD ++ LP+ RDR VE YFW +  +F  ++S  R+ + K + M ++ DDTY
Sbjct  255   HDLSRWWNELDLMSKLPHVRDRLVESYFWGMAFHFHPEHSYTRIAVTKSLIMLTVVDDTY  314

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D++   +E ++FT+ ++KWDI +  RLP +MKIIY+ +++LFE ++ E +K+G+ FAV Y
Sbjct  315   DNYATLEEADLFTEILEKWDINEIGRLPDYMKIIYRFILNLFENYEIEAAKQGKLFAVSY  374

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              KE +K++  +YN  + W      P   EYI N   +S +Y+ +    LG+KS ++E+ +
Sbjct  375   AKEAVKQISKAYNKHMNWFMGGQMPAYEEYIANTVVTSCIYVFLIVGILGIKSTSKESID  434

Query  1406  W--SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             W  + +  + + A+T + R  +D+ S ERE  +    T +D Y+  YGV+ EE M KF E
Sbjct  435   WLMTDEPNKALIASTRVCRHADDVGSDERESKDGSMPTAVDCYVKQYGVSKEETMGKFNE  494

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
             + ENAWKD N + L  I S  S  ++  +LN+AR+ +V Y++ +DGYT+P+K L   I +
Sbjct  495   LFENAWKDFNTEWLIEI-STTSKYMMEQLLNYARVAEVTYRDGRDGYTHPQKYLAAQIAT  553

Query  1760  VLVNSFEI  1783
             V V+   I
Sbjct  554   VFVDPIVI  561



>ref|XP_010248057.1| PREDICTED: probable terpene synthase 2 [Nelumbo nucifera]
Length=635

 Score =   444 bits (1141),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/552 (42%), Positives = 359/552 (65%), Gaps = 12/552 (2%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKL  322
             +   EV+R   +F  SPS+WGD F  +  DN+  + Y ++++ LK +V  +L +  +  L
Sbjct  91    IKKTEVIRHTANF--SPSIWGDYFLAYTCDNKEPDTYDKQVEELKEEVKRLLTNSANRPL  148

Query  323   AEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGY  496
              E LN IDT++RLG+SYHF    ++MLE I+ A+ ++   +GDDL   ALLFRLLRQHGY
Sbjct  149   -EILNLIDTLQRLGLSYHFEGERNQMLEQIFEAHISYFNDMGDDLHAVALLFRLLRQHGY  207

Query  497   NISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
             NI   +F+ F+ E G FK  L+ D++G+L+LYEA+HL    +  L +  +F+ THL    
Sbjct  208   NIPCDVFNKFKDERGNFKEILTRDIRGMLSLYEAAHLGIRGEDILDDVLSFTTTHLNTFV  267

Query  674   PQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
                SS+L KQ+ HAL+Q LH G  ++E+  FI+ YEEDE++ +V+L+ AKLDFN +Q+ H
Sbjct  268   SNASSSLVKQMMHALEQPLHKGTVKLEARRFISFYEEDETRKEVILKLAKLDFNQVQLLH  327

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECY-FWALGVYFEAKYSKARLMLAKIITMASI  1030
             ++EL E  RWWK++DF T  PYARDR VE Y  W +G+Y E +YS  R++LAK+I + SI
Sbjct  328   RKELSELSRWWKDMDFKTKTPYARDRVVELYHMWIVGIYPEPQYSVGRIILAKVIGLVSI  387

Query  1031  FDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRS  1210
              DDTYD++G  +EL++FTDA+++WD  +T +LP +MK+IY  L+D++ E ++ + KEGRS
Sbjct  388   IDDTYDAYGHFNELKLFTDAVERWDASETGKLPEYMKVIYLALLDVYNEIEQNMKKEGRS  447

Query  1211  FAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-  1387
             + V Y KE +K LV +Y  E KW ++ C P V EY+     S    +L   SF+ M  V 
Sbjct  448   YCVSYPKEVMKTLVRAYFSEAKWLSQGCIPTVEEYLDISTISCGYPMLTLTSFVFMGEVA  507

Query  1388  TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMN  1567
             T+EAF++ S  P+I++ ++L+ R+++DI S E E+      + I+ YM  YG + +EA++
Sbjct  508   TKEAFDFVSSTPKIVKNSSLICRLMDDIMSNEFEQKREHVCSAIECYMKQYGTSRQEAID  567

Query  1568  KFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKP  1747
             +  ++  NAWK+ NE++L+    A+   +LL  +N AR+ D  YK+    YT+P K +K 
Sbjct  568   ELRKVATNAWKEMNEELLQ---PALPLPLLLRPINLARVMDTYYKHGS-SYTHPGKQMKD  623

Query  1748  CIFSVLVNSFEI  1783
              I S+ ++   I
Sbjct  624   DIVSLFISPIPI  635



>ref|XP_011030745.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   441 bits (1133),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 227/540 (42%), Positives = 346/540 (64%), Gaps = 11/540 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDNEV-----AERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNF  340
             S  F PS+WGD F    F++ V      + + QE   LK +V  ML +  + KL+E+LNF
Sbjct  23    SANFHPSIWGDYFVCHTFNSMVNVIYFDDHFEQEFYRLKEEVKEMLYAT-TNKLSEQLNF  81

Query  341   IDTMERLGISYHFHEMIDEMLENIY--NANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             ID ++RLG+SY F   ID+ML ++Y   +  ++    DL   AL FRLLRQ G+ +S  +
Sbjct  82    IDVIQRLGVSYLFESDIDQMLCDLYYQGSGDDYVHDHDLQMVALRFRLLRQQGHYVSCDV  141

Query  515   FDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F  F++  G FK  L+ND++G+L+LYEA+HL+ H +  L+EA TF+ THL+ I   +   
Sbjct  142   FKKFKDTEGNFKVCLTNDIQGMLSLYEATHLRVHGEDILEEALTFATTHLKSITTDMCPP  201

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
             L  ++RHALDQ +H  +P + +  +I+ Y+++ S  +VLL+FAKL+FN LQ  H++EL +
Sbjct  202   LLVKLRHALDQPIHKDLPWLGAKRYISSYKQEASHGEVLLKFAKLNFNFLQNMHQKELAD  261

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
                WWK++D    LP+ARDR VECYFW LGV FE +YS  R+++ K+I M S+ DD YD 
Sbjct  262   ITMWWKKVDLSKKLPFARDRLVECYFWILGVCFEPQYSFTRIIMTKVIAMTSVMDDVYDV  321

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  +EL +FTDAI++WDI + + LP +MK  YK L D+F+E +  L++ GRS+ V Y K
Sbjct  322   YGTMEELVLFTDAIERWDISKIDHLPEYMKFFYKQLFDVFKEIETGLAEPGRSYRVDYAK  381

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEW  1408
             E +K+ V +Y +E +W  E C P + EY++    SS   LL   SF+GM   VT++AFEW
Sbjct  382   EAMKKQVQAYFVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEW  441

Query  1409  SSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVE  1588
              +++P+I++A +++AR+++D  S++ E+     A+ I+ YMN + V  E+A ++    V 
Sbjct  442   LNKDPKIVKAASVIARLMDDTVSHKFEQERAHVASAIECYMNQHEVAEEQAYDELRRQVV  501

Query  1589  NAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
              AWKD NE++L      V   +L  +LN AR+ DV+YK+  DGYTN    ++  I S+L+
Sbjct  502   EAWKDINEELLIIPKDHVPIPLLTRVLNLARVMDVMYKDG-DGYTNANGKVRNYITSLLI  560



>ref|XP_007021067.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12592.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=557

 Score =   440 bits (1131),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 224/503 (45%), Positives = 337/503 (67%), Gaps = 8/503 (2%)
 Frame = +2

Query  272   LKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL  451
             LK +V  ML +    K ++KL+ ID ++RLG++YHF + I++ LE I N + N   G+D+
Sbjct  56    LKQEVQRMLTTPMD-KPSQKLHLIDAVQRLGVAYHFEKEIEDALETI-NGDCNSD-GNDI  112

Query  452   CTSALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANL  628
               ++L FRLLR+HG+++    F+ F+++ G FK SL +DVKGLL LYEA+H++ H +  L
Sbjct  113   YITSLRFRLLREHGFDVQCETFNKFKDDKGNFKVSLKSDVKGLLGLYEAAHIRMHGEHIL  172

Query  629   KEAYTFSKTHLEVIGPQLSS-TLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDV  805
             +EA  F+ THLE     +    L   V  A  + +  G+PR+E+  FI++Y+ED S +  
Sbjct  173   EEALAFTTTHLEFAETSIDQYPLSALVSRARKRPIRKGLPRLEARRFISIYQEDGSHDKT  232

Query  806   LLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYS  985
             LL+FAKLDFNL+Q  HK EL +  RWWK+LDF   LP ARDR VE YFW LGVYFE +YS
Sbjct  233   LLKFAKLDFNLVQNLHKAELSKISRWWKDLDFKRKLPSARDRLVEGYFWILGVYFEPQYS  292

Query  986   KARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLID  1165
              AR +L K I MAS  DDTYD++G  +E ++FT+AI++WDI   +RLP +MK++YK L+D
Sbjct  293   LARQILTKAIVMASTIDDTYDAYGTFEEFQLFTNAIERWDINCMDRLPAYMKLLYKALLD  352

Query  1166  LFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTL  1345
             ++EE ++ ++K+G+ + V Y KE +K+L  +Y +E KW  E   P V EY+ NG  SS  
Sbjct  353   VYEEMEEVMAKQGKIYRVQYAKEAMKQLSQAYFVEAKWYHENYVPTVEEYMTNGLVSSGY  412

Query  1346  YLLITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGID  1522
              ++   SF+GM   VT+E F+W+S NP+I+ A++++AR+++DI S++ E+     A+ I+
Sbjct  413   IMVAITSFVGMGDIVTKEIFDWASNNPKIVRASSMIARLMDDIVSHKFEQERGHVASAIE  472

Query  1523  YYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYK  1702
              YM  +GV+ E A N+  + +ENAWKD N++++RP P+ V    L  ILN AR+ D +YK
Sbjct  473   CYMKQHGVSEENACNELTKQIENAWKDINQELVRP-PAGVPMPALTRILNLARVMDFLYK  531

Query  1703  NKQDGYTNPEKVLKPCIFSVLVN  1771
              + DGYT+  +  K  I S+L++
Sbjct  532   -EGDGYTHVVEAAKGGITSLLID  553



>ref|NP_001239041.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEM23832.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82780.1| TPS17 [Solanum lycopersicum]
Length=554

 Score =   439 bits (1129),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 233/547 (43%), Positives = 344/547 (63%), Gaps = 6/547 (1%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             +  ++EV+    S    P+LWGD F  +       E   ++ + LK +V  MLV   S  
Sbjct  8     VAADHEVIITRRSGSHHPTLWGDHFLAYADLRGANEGEEKQNEDLKEEVRKMLVMAPSKS  67

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
             L EKL  I+T++ LG+ YHF   IDE L  +Y     + +GD L   AL FRLLRQ GY 
Sbjct  68    L-EKLELINTIQCLGLGYHFQSEIDESLSYMYTHYEEYSIGD-LHAIALCFRLLRQQGYY  125

Query  500   ISSGIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S   F  F  + G FK  L  DV+G+L+LYEA+  + H +  L EA  F+   L+ I P
Sbjct  126   VSCDAFKKFTNDQGNFKEELVKDVEGMLSLYEAAQFRVHGEQILDEALNFTIAQLKQILP  185

Query  677   QLS-STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
             +LS S L +Q+ +AL   + +GI RVE+  +I+ Y+++++ N+VLL FAKLDFN+LQ  H
Sbjct  186   KLSNSQLAQQITNALKYPIKDGIVRVETRKYISFYQQNQNHNEVLLNFAKLDFNILQTLH  245

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             K+EL +  RWWK+++ V TLPYARDR VECYFW LG YFE +YS AR ML KI    SI 
Sbjct  246   KKELSDMTRWWKKMELVNTLPYARDRLVECYFWCLGTYFEPQYSVARKMLTKISFYISII  305

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DDTYD +GK DEL +FT AI++W+I  + +LP +MKIIY+ L+D+++E +KEL+ E +SF
Sbjct  306   DDTYDIYGKLDELTLFTQAIERWNIDASEQLPLYMKIIYRDLLDVYDEIEKELANENKSF  365

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-T  1390
              V+Y+   +K++V  Y  E KW   +  P + +Y+KNG ++S   LL T S+L M +V T
Sbjct  366   LVNYSINEMKKVVRGYFQEAKWYYGKKVPTMEQYMKNGISTSAYILLTTTSWLAMGNVAT  425

Query  1391  REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK  1570
             ++AF+W +  P I+ A+  + R++ND+ S+E E+     A+ ++ YMN+Y VT EEA  K
Sbjct  426   KDAFDWVATEPPIVVASCYIIRLLNDLVSHEEEQKRGNAASAVECYMNEYSVTKEEAHIK  485

Query  1571  FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
               +++EN WKD NE+  +     +   +L+CI+N  R+ + +YK+ +D YT  +  LK  
Sbjct  486   IRDIIENYWKDLNEEYFKVDMIIIPRVLLMCIINLTRVAEFIYKD-EDAYTFSKNNLKDV  544

Query  1751  IFSVLVN  1771
             I  +LV+
Sbjct  545   ISDILVD  551



>ref|XP_011015428.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=558

 Score =   439 bits (1129),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 218/523 (42%), Positives = 338/523 (65%), Gaps = 8/523 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F PSLWG  F  F F     E Y+++++VLK  V  ML + +   + E + FI+ + RLG
Sbjct  23    FPPSLWGCSFASFSFPQTEFESYSRQVEVLKENVKDMLTASKKDTV-EHIEFINLLCRLG  81

Query  365   ISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-N  535
             +SYHF + I+  L+ I++  PN   +   DL T +LLFR+LRQHG+ +   +F+ F++ N
Sbjct  82    VSYHFDDEIENSLKQIFDDLPNLLEKQDFDLYTLSLLFRVLRQHGFKMPCVVFNKFKDTN  141

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHA  715
             G+FK ++ NDVKG+L LYEAS L  H +  L EA  F+K +LE    Q S  LG  +R+A
Sbjct  142   GEFKKTIINDVKGILGLYEASFLSVHGEQVLDEALVFTKANLESSAMQSSPRLGDHIRNA  201

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L +  H G+PR+E+  +I+ Y+E+ES+ND LL+FAK+DFN +Q+ H+QEL    RWW +L
Sbjct  202   LIRPFHKGLPRIEAREYISFYKEEESRNDTLLKFAKIDFNRVQLLHRQELSILSRWWNDL  261

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             +F    PYARDR VE YFWA G++FE +Y+ +R+M+ K   + S+ DDTYD++   +E++
Sbjct  262   NFAEEFPYARDRIVEIYFWANGIHFEPQYAFSRMMVTKYTKIVSLVDDTYDAYASFEEIQ  321

Query  1076  IFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELV  1252
              FT+AI++  +   ++LP  +MK++Y+ L++LF E + ++ K+GRS+A +Y KE  KELV
Sbjct  322   HFTNAIERCSMNAIDQLPADYMKVLYRALLNLFNETENDMGKQGRSYASYYVKEAFKELV  381

Query  1253  SSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVT-REAFEWSSQNPRI  1429
               Y+ E +W  +R  P   EY++NG A+S   +++ ASFLGM+ V   E +EW   NP+I
Sbjct  382   RGYHAEAEWADKRHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKI  441

Query  1430  IEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTN  1609
             I+A  ++ R++NDI  +E E+     A+G++ YM  Y  + ++A+ + ++M  NAWKD N
Sbjct  442   IKAGKMIGRLMNDIVGHEDEQKRGDCASGVECYMKQYDASEKKAIEEIQKMDVNAWKDIN  501

Query  1610  EDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             ED +RP  + +   +L   +N  R+ DV+Y N  D YT P  +
Sbjct  502   EDCMRPTNAPML--LLQHFVNLIRVTDVIYGNDDDAYTIPSSL  542



>emb|CAN81129.1| hypothetical protein VITISV_002911 [Vitis vinifera]
Length=561

 Score =   439 bits (1129),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 230/559 (41%), Positives = 355/559 (64%), Gaps = 11/559 (2%)
 Frame = +2

Query  110   LEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA---QEIQVLKG  280
             L    + IL    + EV R   ++   P+ WGD F ++  D++    +A   Q+IQ LK 
Sbjct  5     LSVSVTPILSQRIDPEVARHEATYY--PNFWGDRFLHYNPDDDFCGTHACKEQQIQELKE  62

Query  281   QVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTS  460
             +V   L +  +   ++ L  ID+++RLG++YHF   I+E L+ +Y         D L T 
Sbjct  63    EVRKSLEAT-AGNTSQLLKLIDSIQRLGLAYHFEREIEEALKAMYQTYTLVDDNDHLTTV  121

Query  461   ALLFRLLRQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEA  637
             +LLFRLLRQ GY+I S +F  F  E G FK SL  D+ G+L LYEA+HL  H +  L EA
Sbjct  122   SLLFRLLRQEGYHIPSDVFKKFMDEGGNFKESLVGDLPGMLALYEAAHLMVHGEDILDEA  181

Query  638   YTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRF  817
               F+  HL+ +     + L KQV  AL + +  G+PRVE+ ++IT+Y+ED+S N+ LL+ 
Sbjct  182   LGFTTAHLQSMAIDSDNPLTKQVIRALKRPIRKGLPRVEARHYITIYQEDDSHNESLLKL  241

Query  818   AKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARL  997
             AKLD+N+LQ  H++EL E  +WWK LDF T LP+ARDR VE YFW LGVYFE +Y  AR 
Sbjct  242   AKLDYNMLQSLHRKELSEITKWWKGLDFATKLPFARDRIVEGYFWILGVYFEPQYYLARR  301

Query  998   MLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEE  1177
             +L K+  + SI DD YD++G  +EL++FT+AI++WD    ++LP +MK+ Y+ L+D++EE
Sbjct  302   ILMKVFGVLSIVDDIYDAYGTFEELKLFTEAIERWDASSIDQLPDYMKVCYQALLDVYEE  361

Query  1178  FDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLI  1357
              ++E+ K+G+ + VHY +  +K  V +Y +E KW  +   P + EY+ N    S   +L 
Sbjct  362   MEEEMXKQGKLYRVHYAQAALKXQVQAYLLEAKWLKQEYIPTMEEYMSNALVXSACSMLT  421

Query  1358  TASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMN  1534
             T SF+GM   VT+EAF+W   +P++I A+ ++ R+++DI S+E E+     A+ ++ YM 
Sbjct  422   TTSFVGMGDXVTKEAFDWVFSDPKMIRASNVICRLMDDIVSHEFEQKRGHVASAVECYMK  481

Query  1535  DYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQD  1714
              YGV+ EEA ++F++ VE+AWKD NE+ L+  P+AV   +L  +LNF+R+ DV+YK+ +D
Sbjct  482   QYGVSKEEAYDEFKKQVESAWKDNNEEXLQ--PTAVPVPLLTRVLNFSRMXDVLYKD-ED  538

Query  1715  GYTNPEKVLKPCIFSVLVN  1771
              YT    ++K  +  +L++
Sbjct  539   EYTLVGPLMKDLVAGMLID  557



>ref|XP_011009446.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=558

 Score =   439 bits (1129),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/523 (42%), Positives = 338/523 (65%), Gaps = 8/523 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F PSLWG  F  F F     E Y+++++VLK  V  ML + +   + E + FI+ + RLG
Sbjct  23    FPPSLWGCSFASFSFPQTEFESYSRQVEVLKENVKDMLTASKKDTV-EHIEFINLLCRLG  81

Query  365   ISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-N  535
             +SYHF + I+  L+ I++  PN   +   DL T +LLFR+LRQHG+ +   +F+ F++ N
Sbjct  82    VSYHFDDEIENSLKQIFDDLPNLLEKQDFDLYTLSLLFRVLRQHGFKMPCVVFNKFKDTN  141

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHA  715
             G+FK ++ NDVKG+L LYEAS L  H +  L EA  F+K +LE    Q S  LG  +R+A
Sbjct  142   GEFKKTIINDVKGILGLYEASFLSVHGEQVLDEALVFTKANLESSAMQSSPRLGDHIRNA  201

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L +  H G+PR+E+  +I+ Y+E+ES+ND LL+FAK+DFN +Q+ H+QEL    RWW +L
Sbjct  202   LIRPFHKGLPRIEAREYISFYKEEESRNDTLLKFAKIDFNRVQLLHRQELSILSRWWNDL  261

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             +F    PYARDR VE YFWA G++FE +Y+ +R+M+ K   + S+ DDTYD++   +E++
Sbjct  262   NFAEEFPYARDRIVEIYFWANGIHFEPQYAFSRMMVTKYTKIVSLVDDTYDAYASFEEIQ  321

Query  1076  IFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELV  1252
              FT+AI++  +   ++LP  +MK++Y+ L++LF E + ++ K+GRS+A +Y KE  KELV
Sbjct  322   HFTNAIERCSMNAIDQLPADYMKVLYRALLNLFNETENDMGKQGRSYASYYVKEAFKELV  381

Query  1253  SSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVT-REAFEWSSQNPRI  1429
               Y+ E +W  +R  P   EY++NG A+S   +++ ASFLGM+ V   E +EW   NP+I
Sbjct  382   RGYHAEAEWADKRHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKI  441

Query  1430  IEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTN  1609
             I+A  ++ R++NDI  +E E+     A+G++ YM  Y  + ++A+ + ++M  NAWKD N
Sbjct  442   IKAGKIIGRLMNDIVGHEDEQKRGDCASGVECYMKQYDASEKKAIEEIQKMDVNAWKDIN  501

Query  1610  EDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             ED +RP  + +   +L   +N  R+ DV+Y N  D YT P  +
Sbjct  502   EDCMRPTNAPML--LLQHFVNLIRVTDVIYGNDDDAYTIPSSL  542



>ref|XP_009334624.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=557

 Score =   439 bits (1128),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 352/549 (64%), Gaps = 17/549 (3%)
 Frame = +2

Query  146   TNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLA  325
             T N+V R   S  FSP++WGD F  +    E+     Q +Q LK  V  M+++   +K  
Sbjct  13    TTNDVNR--RSANFSPTIWGDYFLSYA-SIEINIEEEQHVQELK--VKRMIMAPIPSKPL  67

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLG----DDLCTSALLFRLLRQHG  493
             +KL  ID ++R G+S HF   ID++L  I+N+   +  G    +DL  +AL FRLLRQ G
Sbjct  68    KKLELIDAIQRFGVSRHFENEIDQVLLQIHNSYHRYHQGSDDDEDLHAAALYFRLLRQQG  127

Query  494   YNISSGIFDNFQE--NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEV  667
             YNIS  +F+ F++  + KFK SL+ND+ GLL+LYEA+HL+ H +  L+EA +F+ THLE 
Sbjct  128   YNISCDMFNKFKDVNDAKFKGSLTNDIVGLLSLYEATHLRVHGEDILEEALSFTTTHLES  187

Query  668   IGPQLS-STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQ  844
                 LS   L +QV+HAL Q    G PR+E+ +++++Y E+ S N+ LL FAKLDFNLLQ
Sbjct  188   AAHSLSPGPLLQQVKHALYQPFWKGNPRLEARHYLSIYRENNSHNETLLTFAKLDFNLLQ  247

Query  845   MHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMA  1024
               H++EL E  RWWKELDFV  LP+ARDR VECY WALG Y+E KYS AR++  K+I M 
Sbjct  248   KVHQKELSEISRWWKELDFVNKLPFARDRVVECYLWALGCYYEPKYSFARMIFGKVIAML  307

Query  1025  SIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEG  1204
              I DD YD +G  +ELE+FT+A+++WDI     LP +MK+ Y+ L+DL+ E +++L  EG
Sbjct  308   VIIDDIYDVYGTFEELELFTEAVERWDISAMVHLPEYMKVCYQALLDLYAEIEEKLGNEG  367

Query  1205  RSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS  1384
              S+ +HY +E +K  V SY  E KW  +   P + EY+     +++ ++L T + +GM S
Sbjct  368   NSYRIHYAREAMKIQVKSYFKEAKWFYDNYIPTMDEYLSEA-LNTSYFMLATTALVGMGS  426

Query  1385  -VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEA  1561
              VT+++ +W   +P+I++A +L+ R+++D+ S++ E+     A+ ++ YM ++  T E+A
Sbjct  427   VVTKDSLDWVFSDPKIVKATSLIGRLVDDMKSHKFEQKRGHVASCVECYMKEHDATEEQA  486

Query  1562  MNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVL  1741
             + +  + V NAWKD NE   R  P+    +++L I+N AR+ +V+YK+  DG+T+    L
Sbjct  487   IIELSKQVNNAWKDVNETCHR--PTIFPMQLILRIVNLARMIEVIYKH-DDGFTHAGIFL  543

Query  1742  KPCIFSVLV  1768
             K  + S+ V
Sbjct  544   KDIVVSLFV  552



>ref|XP_006592519.1| PREDICTED: (-)-germacrene D synthase-like isoform X3 [Glycine 
max]
Length=564

 Score =   439 bits (1128),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 221/536 (41%), Positives = 345/536 (64%), Gaps = 13/536 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F Y+V  +   + + ++ Q+ K +V  ML++        KL FID+++RLG
Sbjct  28    FSPSIWGDYFLYYVPSSVEDDSHIKQAQLTKEEVRKMLIAPIDNNFYFKLEFIDSVQRLG  87

Query  365   ISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             +SYHF   ID +L  IYN     N      DDLC  ALLFRLLRQ GY+ISS +F  F++
Sbjct  88    VSYHFEHEIDGVLHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGYHISSNVFYKFKD  147

Query  533   NGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQLSSTLGKQV  706
               + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +  QLS ++  QV
Sbjct  148   QTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSLTTQLSPSMIAQV  207

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             +H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  H++E+    RWW
Sbjct  208   KHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQELHQKEVNNVTRWW  267

Query  887   -KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKP  1063
              K L+  T LP+ RDR  ECYFW+LG+YFE +YS AR +  K+I + S+ DD YD++G  
Sbjct  268   IKNLNVSTKLPFVRDRIAECYFWSLGIYFEPQYSLARRITTKVIALCSVIDDMYDAYGTI  327

Query  1064  DELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIK  1243
             DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+ + + Y K+ +K
Sbjct  328   DELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGKVYCIKYAKKEMK  387

Query  1244  ELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNP  1423
              L+ +   E +W     TP + EY++    SS   ++IT  F+GMK  T E   W++ +P
Sbjct  388   RLIKAQMAEARWLHCNHTPSIEEYMQVRNVSSAYSMVITICFVGMKDTTEEVLIWATSDP  447

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
              II A +++ R+++DI   E  ++    A+ I+ YM  +  + ++A+NK  EMV++AWKD
Sbjct  448   IIIGAASIICRLMDDIVGNEERRH---VASSIECYMKQHNTSRQDAINKLLEMVKSAWKD  504

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K  I ++LVN
Sbjct  505   INEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKDYIKTLLVN  557



>ref|XP_007021115.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12640.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=566

 Score =   438 bits (1127),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/544 (41%), Positives = 352/544 (65%), Gaps = 11/544 (2%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFV---FDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFID  346
             S  + P++WGD F  +     +N+  +   QE Q L  ++  ML++ +  K  EKL  ID
Sbjct  26    SAGYHPTIWGDHFLSYASNSLENDGDDNNKQEHQKLNNELRKMLMADQVDKPLEKLKLID  85

Query  347   TMERLGISYHFHEMIDEMLENIYNANPNFQLG---DDLCTSALLFRLLRQHGYNISSGIF  517
              ++RLG SYHF + ID +L+ +++++ +  +G   +DL T +L FRLLRQ+GY +SS  F
Sbjct  86    AIQRLGFSYHFEKEIDLVLQQMHSSHDDCDIGVNDEDLYTISLKFRLLRQNGYKMSSDAF  145

Query  518   DNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F+++ GKFK  L NDV+G+L+LYEA+HL+ H +  L +A  F+ THLE +   L+S+L
Sbjct  146   NKFRDSEGKFKECLINDVQGMLSLYEATHLRVHGEDILDQALAFTTTHLETMATCLNSSL  205

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
               Q+  AL Q +  G+PR+E+ ++I VYEED S ++ +L FAKLDFN+LQ  H++E+ E 
Sbjct  206   AAQISQALRQPIRKGLPRIEARHYIPVYEEDPSHSEAVLTFAKLDFNMLQRLHREEVSEI  265

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              +WWK+LDF   LP+ RDR +ECYFW LGVYFE +Y  AR +L K+I M S+ DD YD +
Sbjct  266   AKWWKDLDFSRKLPFIRDRVIECYFWILGVYFEPEYRLARRILTKVIAMTSVIDDIYDVY  325

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G  +EL +FT A+++WDI + + LP +M+I Y+ L+D+++E ++ +++EG+ + + Y  E
Sbjct  326   GTLEELALFTSAVERWDISEKDHLPEYMQICYQALLDVYKETEETMTEEGKLYRLDYAIE  385

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V +Y  E +W      P + EY+     +S   +L T SF+GM  V T+E FEW 
Sbjct  386   AMKNQVRAYFREAEWFHNHHVPTMEEYMAVALVTSAYAMLATTSFVGMGDVATKEVFEWL  445

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
               +P+++ A++++ R+++DI S++ E+     A+ I+ Y   +G T EEA+ +F + + +
Sbjct  446   FSDPKMVTASSIVCRLMDDIVSHKFEQKRGHVASAIECYTKQHGATEEEAVKEFRKQIAD  505

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AWKD NE+ L   P+ V   +L  ILN AR+ DVVYK  +DGYT+   +LK  + S+L++
Sbjct  506   AWKDINEECL--YPTTVPMPLLTRILNLARVIDVVYKT-EDGYTHAGVMLKDFVASLLID  562

Query  1772  SFEI  1783
                I
Sbjct  563   PVPI  566



>ref|XP_002523635.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9SCB6.1|TPS2_RICCO RecName: Full=Probable terpene synthase 2; Short=RcSeTPS2 [Ricinus 
communis]
 gb|EEF38721.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
Length=550

 Score =   438 bits (1126),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/534 (41%), Positives = 344/534 (64%), Gaps = 12/534 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERL  361
             F P++WGD F     ++ ++ +   Q+++ LK +V  M+ S  + + ++ LN ID ++RL
Sbjct  22    FHPNIWGDRFLSCAAESTDIEDDMEQQVERLKEEVKKMIAS--ADEPSQILNLIDLLQRL  79

Query  362   GISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NG  538
             G+SYHF + I+E L+ + N N +    DDL + AL FRLLR+ G N+S  +F+ F++ NG
Sbjct  80    GVSYHFEKEIEEALQQVLNMNSDSDKDDDLHSVALRFRLLREQGLNVSCDVFNKFRDRNG  139

Query  539   KFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHAL  718
              F  +L  D++G+L+LYEA+H + H +  L +A  F+ T+LE I P LS  L  Q+   L
Sbjct  140   HFIQTLKTDLQGMLSLYEAAHFRVHGEGILDDALAFTTTYLESIVPNLSPPLAAQISRTL  199

Query  719   DQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELD  898
              Q L   + RVE+ +FI++Y+ED S N+VLL FAKLDFNLLQ  H++EL     WWK+LD
Sbjct  200   RQPLRKSLARVEARHFISIYQEDTSHNEVLLTFAKLDFNLLQKLHQKELKYISLWWKDLD  259

Query  899   FVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEI  1078
             FV  LP+ RDR VE YFW LGVYFE +Y +AR  + K+I + S+ DD YD++G  +EL +
Sbjct  260   FVNKLPFTRDRVVEGYFWILGVYFEPQYHRARKFVTKVINVVSVIDDIYDAYGTLEELVV  319

Query  1079  FTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSS  1258
             FTDAI +WDI   ++LP +MK+ YK L++++EE ++ LS++GRS+ +HY KE +K+LV +
Sbjct  320   FTDAINRWDIDCIDQLPEYMKVCYKALLNVYEEIERALSEQGRSYRLHYAKEAMKKLVQA  379

Query  1259  YNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPRIIE  1435
             Y +E  W  +   P + EY+     S    LL   SF+GM  + T+E F+W+S +P+I+ 
Sbjct  380   YLVEANWMNKNYVPTMDEYMSIALVSCAYPLLTVTSFVGMGDIATKEVFDWASNDPKIVR  439

Query  1436  ANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNED  1615
               +++ R+++DI S+E E+     A+ ++ YM   GV+ E   ++F + + +AWKD NE+
Sbjct  440   VASIICRLMDDIVSHEFEQKRGHIASSVECYMKQNGVSEEATRDEFNKQIVDAWKDINEE  499

Query  1616  ILRP--IPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              L+P  +P    T     ++N ARI D +YK+  D YT+  +++K  + ++L++
Sbjct  500   HLQPNYVPMPFRTR----VVNSARIMDYLYKD-DDEYTHVGELMKGSVAALLID  548



>gb|KDP36230.1| hypothetical protein JCGZ_09950 [Jatropha curcas]
Length=555

 Score =   438 bits (1126),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/539 (41%), Positives = 351/539 (65%), Gaps = 15/539 (3%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNE---VAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             FSP +WGD  R+  +D+E   +     +++Q LK +V  M+++  + + +E LN ID+++
Sbjct  26    FSPDIWGD--RFLSYDSEFTNINNDMEEQVQRLKEEVKRMIIA-STHESSEDLNLIDSIQ  82

Query  356   RLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-  532
             RLG++YHF   I+E L  I+ +  N+   +DL ++AL FRLLRQ G+N+S  +F+ F++ 
Sbjct  83    RLGVAYHFENEIEEALLRIHCSTDNY---NDLHSAALRFRLLRQQGFNVSCDVFNKFRDS  139

Query  533   NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS-TLGKQVR  709
             NG F  +L ND++G+L+LYEA++L+ H +  L+EA  FS  HL+ I    +      QV 
Sbjct  140   NGHFNETLKNDIQGILSLYEAAYLRVHGEDILEEALAFSTVHLKSIANSNTRFPFAAQVS  199

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
              AL Q +  G+ R+ES ++I++Y+ED S N+VLL FAKLDFN+LQ  H++EL    +WWK
Sbjct  200   RALKQPIRKGLQRLESKHYISMYQEDASHNEVLLTFAKLDFNVLQKMHREELRYISKWWK  259

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             +LDF T LP+ RDR VE YFW +GVYFE++YS AR  L K+I ++S+ DD YD++G  +E
Sbjct  260   DLDFTTKLPFIRDRVVEGYFWIIGVYFESQYSLARRFLTKVIAISSVIDDIYDAYGTLEE  319

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             L IFT AIQ+WDI   ++LP +MK+ Y  L+D+++E ++ELS++G S  +HY K+ +K+L
Sbjct  320   LIIFTSAIQRWDIACMDQLPEYMKLCYMALLDIYDEMERELSEQGSSSYIHYAKDEMKKL  379

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSSQNPR  1426
             V +Y +E  W  +   P + EY+     +    LL T SF+GM  + T++ F+WSS  P+
Sbjct  380   VQAYLVEANWMNKDYIPTMDEYMSIALVTCGYSLLTTTSFIGMGDISTKDVFDWSSNGPK  439

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             I+ A +++ R+++DI S+E E+     A+ ++ YM   GV+ E   ++F + + +AWKD 
Sbjct  440   IVRAASVICRLMDDIVSHEFEQARGHVASAVECYMKQNGVSEEATRDEFNKQIVSAWKDI  499

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             N   L+  P+ V   IL  ++N AR+ D +YK+  D YT+  +++K  I SV ++  +I
Sbjct  500   NAACLK--PTEVPMPILTRVVNLARVIDYLYKDG-DEYTHTGELMKSSITSVFIDRVQI  555



>ref|XP_011009447.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=551

 Score =   438 bits (1126),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/520 (42%), Positives = 336/520 (65%), Gaps = 8/520 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F PSLWG  F  F F     E Y+++++VLK  V  ML + +   + E + FI+ + RLG
Sbjct  16    FPPSLWGCSFASFSFPQTEFESYSRQVEVLKENVKDMLTASKRDTV-EHIEFINLLCRLG  74

Query  365   ISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-N  535
             +SYHF + I+  L+ I+   PN   +   DL T +LLFR+LRQHG+ +   +F+ F++ N
Sbjct  75    VSYHFDDEIENSLKQIFGDLPNLLEKQDFDLYTLSLLFRVLRQHGFKMPCVVFNKFKDTN  134

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHA  715
             G+FK ++ NDVKG+L LYEAS L  H +  L EA  F+K +LE    Q S  LG  +R+A
Sbjct  135   GEFKKTIINDVKGILGLYEASFLSVHGEQVLDEALVFTKANLESSAMQSSPRLGDHIRNA  194

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L +  H G+PR+E+  +I+ YEE+ES+ND LL+FAK+DFN +Q+ H+QEL    RWW +L
Sbjct  195   LIRPFHKGLPRIEAREYISFYEEEESRNDTLLKFAKIDFNRVQLLHRQELSILSRWWNDL  254

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             +F    PYARDR VE YFWA G++FE +Y+ +R+M+ K   + S+ DDTYD++   +E++
Sbjct  255   NFAEEFPYARDRIVEIYFWANGIHFEPQYAFSRMMVTKYTKIVSLVDDTYDAYASFEEIQ  314

Query  1076  IFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELV  1252
              FT+AI++  +   ++LP  +MK++Y+ L++LF E + ++ K+GRS+A +Y KE  KELV
Sbjct  315   HFTNAIERCSMNAIDQLPADYMKVLYRALLNLFNETENDMGKQGRSYASYYVKEAFKELV  374

Query  1253  SSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVT-REAFEWSSQNPRI  1429
               Y+ E +W  +   P   EY++NG A+S   +++ ASFLGM+ V   E +EW   NP+I
Sbjct  375   RGYHAEAEWADKCHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKI  434

Query  1430  IEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTN  1609
             I+A  ++ R++NDI  +E E+     A+G++ YM  Y V+ ++A+ + ++MV N WKD N
Sbjct  435   IKAGKIIGRLMNDIVGHEDEQKRGDCASGVECYMKQYDVSDKKAIEEIQKMVANGWKDIN  494

Query  1610  EDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
             ED +R  P+     +L   +N AR+ +V+Y +  D YT P
Sbjct  495   EDCMR--PTNAPKVLLQHNVNLARVTNVMYGDDDDAYTTP  532



>gb|ADK94034.1| alpha-copaene synthase [Eleutherococcus trifoliatus]
Length=556

 Score =   438 bits (1126),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 235/543 (43%), Positives = 345/543 (64%), Gaps = 16/543 (3%)
 Frame = +2

Query  176   SFQFSPSLWGDEF-RYFVFDNEVAERYAQE-IQVLKGQVMSMLVSIRSAKLAEKLNFIDT  349
             S  + P++WGD+F +Y  FD    +   +E  + LK +V  MLV    A   ++LN ID 
Sbjct  23    SANYHPNIWGDQFLKYNSFDLSKTDANTKEHFRQLKEEVKKMLVD---AGPNQQLNLIDD  79

Query  350   MERLGISYHFHEMIDEMLENIYNANPNFQLGDD-LCTSALLFRLLRQHGYNISSGIFDNF  526
             ++RLG++Y F   ID  L+ +   N  FQ  DD L T +L FRLLRQHGYN+SS +F  F
Sbjct  80    IQRLGVAYQFEAEIDAALQRM---NVIFQGNDDDLHTISLRFRLLRQHGYNVSSDVFRKF  136

Query  527   QEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQ  703
              +N GKFK  L +D++G+L+LYEA+H + H +  L++A  F+ +HLE +   L + L  Q
Sbjct  137   MDNNGKFKECLISDLRGVLSLYEATHFRVHGEDILEDALEFTTSHLERLKSHLKNPLAAQ  196

Query  704   VRHALDQSLHNGIPRVESSYFITVYE-EDESKNDVLLRFAKLDFNLLQMHHKQELYEHMR  880
             V  AL   +H G+ R+E+ ++I++Y+ ED+S N VLL FAKLDFNLLQ  H+ EL    R
Sbjct  197   VIRALKCPIHKGLNRLEAKHYISIYQQEDDSHNKVLLNFAKLDFNLLQKMHQGELSHITR  256

Query  881   WWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGK  1060
             WWKEL+F   LP+ARDR VECYFW LGVYFE +Y  AR  L KII MAS+ DD YD +G 
Sbjct  257   WWKELNFAKKLPFARDRVVECYFWILGVYFEPQYLIARRFLTKIIAMASVADDIYDVYGT  316

Query  1061  PDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR-SFAVHYTKER  1237
              +EL I TDAI++WD+   +++P  M++ ++ L+D++ E ++E++K GR S+ VHY KE 
Sbjct  317   LEELVILTDAIERWDMGALDQIPECMRVYHRALLDVYTEMEEEMAKTGRPSYRVHYAKEA  376

Query  1238  IKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWSS  1414
              KELV  Y  E KW  E   P + EY+     S    +L T SF+GM  + T+EAF+W S
Sbjct  377   YKELVRQYLAEAKWFQEDYDPTLEEYLPVALISGGYKMLATHSFVGMGDLATKEAFDWVS  436

Query  1415  QNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENA  1594
              NP I++A++++ R+ +D+  +E E      A+ ++ YM  YGVT +E   +F++ + NA
Sbjct  437   NNPLIVKASSVICRLSDDMVGHEVEHERGDVASAVECYMKQYGVTKQEVYIEFQKQISNA  496

Query  1595  WKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             WKD N++ L   P+ V+  +L  I N  R+ +++Y +++DGYTN     K  I SVL++ 
Sbjct  497   WKDMNQECLH--PTTVTMPLLTVIFNMTRVINLLY-DEEDGYTNSNTRTKDFITSVLIDP  553

Query  1775  FEI  1783
              +I
Sbjct  554   VQI  556



>ref|XP_006475306.1| PREDICTED: (E)-beta-farnesene synthase-like [Citrus sinensis]
Length=555

 Score =   437 bits (1125),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 234/561 (42%), Positives = 357/561 (64%), Gaps = 14/561 (2%)
 Frame = +2

Query  122   TSEILKMVTNN--EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAER-YAQEIQVLKGQVMS  292
             ++++L  V+++  + VRP+  F   P+LWGD F     D +  +  + +E + LK +V S
Sbjct  2     SAQVLATVSSSTEKTVRPIAGFH--PNLWGDYFLTLASDCKTNDTTHQEEYEALKQEVRS  59

Query  293   MLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLF  472
             M+ +      A+KL  +D ++RLG+ YHF + I++ LENI++ + +     DL T +L F
Sbjct  60    MITATADTP-AQKLQLVDAVQRLGVGYHFEQEIEDALENIFHNSFDNNDDVDLHTVSLRF  118

Query  473   RLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFS  649
             RLLRQ G+ +S  +F+ F+++ GKFK+SL  +V+G+L+LYEA HL    +  L EA  F+
Sbjct  119   RLLRQQGFKVSCDVFEKFKDDEGKFKASLVKEVQGILSLYEAGHLAIRGEDILDEAIAFT  178

Query  650   KTHLEVIGPQ--LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAK  823
             +THL+ +       + L +Q+ HALD  L   +PRVE+ +F++VY  D+  +  LL+FAK
Sbjct  179   RTHLQSMVSHDVRPNNLAEQINHALDCPLRRALPRVETRFFLSVYPRDDKHDKTLLKFAK  238

Query  824   LDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLML  1003
             LDFNL+Q  H++EL    RWWK+LDF T LPYARDR VE YFW +G YFE KY+ AR ++
Sbjct  239   LDFNLVQRIHQKELSAITRWWKDLDFTTKLPYARDRIVELYFWIVGTYFEPKYTLARKIM  298

Query  1004  AKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFD  1183
              K I  ASI DDT+D++G  +EL++F +A+Q+WDI   + LP +MK++YK L+D F E +
Sbjct  299   TKTIYTASIIDDTFDAYGFFEELKLFAEAVQRWDIGAMDILPEYMKVLYKALLDTFNEIE  358

Query  1184  KELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITA  1363
             ++L+KEGRS  + Y KE+++ELV  Y ++ KW +E   P   EY   G  S   ++L T 
Sbjct  359   QDLAKEGRSSYLPYGKEKMQELVQMYFVQAKWFSEGYVPTWDEYYPVGLVSCGYFMLATN  418

Query  1364  SFLGMKSVT-REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDY  1540
             SFLGM  V  +EAFEW S++P+I  A++++ R+ NDI S + E+     A+G++ Y+  Y
Sbjct  419   SFLGMCDVANKEAFEWISKDPKISTASSVICRLRNDIVSQQFEQKRGHIASGVECYIKQY  478

Query  1541  GVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGY  1720
             GV+ EE +  F E VENAWKD NE+ L+  P+A    ++    N AR+ + + K K D Y
Sbjct  479   GVSEEEVVTVFTEEVENAWKDMNEEFLK--PTAFPVALIERPFNIARVIEFLNK-KGDWY  535

Query  1721  TNPEKVLKPCIFSVLVNSFEI  1783
             T+   + K  I +VL +   I
Sbjct  536   THSHAI-KDQIAAVLRDPVTI  555



>ref|XP_002513334.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
 gb|EEF48737.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
Length=614

 Score =   439 bits (1130),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 228/564 (40%), Positives = 354/564 (63%), Gaps = 18/564 (3%)
 Frame = +2

Query  68    LPF*RSSTYSKISLLEQQTSEILKMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAE  247
             +PF   S++S  S+  +     L   +  E  RP+ +F   P++WG  F    F      
Sbjct  34    VPF---SSWSAKSVTNKSPQACLSTKSQQEF-RPLANF--PPTVWGSHFASPTFSESEFG  87

Query  248   RYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANP  427
              Y ++  VL+ ++  +L S RS  + EK+ FID + RLG+SYHF   I+E L  I++  P
Sbjct  88    TYDRQANVLQKKIRELLTSSRSDSV-EKIAFIDLLCRLGVSYHFENDIEEQLSQIFSCQP  146

Query  428   NF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEAS  598
                 +   DL T AL+FR+ RQHG+ +SS +F  F + +GKFK+SL +D KG+L+L+EAS
Sbjct  147   GLLDEKQYDLYTVALVFRVFRQHGFKMSSNVFHKFTDSHGKFKASLLSDAKGMLSLFEAS  206

Query  599   HLKGHNDANLKEAYTFSKTHLE--VIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFIT  772
             HL  H +  L EA+ F+K +LE   +   L   L K + +AL+Q  H GIPR+E+  +I 
Sbjct  207   HLSMHGEDILDEAFAFTKDYLESSAVDQYLCPNLQKHITNALEQPFHKGIPRLEARKYID  266

Query  773   VYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFW  952
             +YE DE +N+ +L FAKLD+N +Q+ H+QEL +   WWK+L+  + +PYARDR  E +FW
Sbjct  267   LYEGDECRNETVLEFAKLDYNRVQLLHQQELSQFSTWWKDLNLASEIPYARDRMAEIFFW  326

Query  953   ALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPR  1132
             A+ +YFE KY++AR+++AK++ + S+ DDT+D++   +E  +  +A ++WD    ++LP 
Sbjct  327   AVAMYFEPKYAQARMIIAKVVLLISLVDDTFDAYATIEETHLLAEAFERWDKSCLDQLPD  386

Query  1133  FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAE  1312
             +MK+IYK L++ F EF+ +L+KEG+S++V Y +E  +ELV  Y +E  W  E   P   E
Sbjct  387   YMKVIYKLLLNTFSEFENDLAKEGKSYSVRYGREAFQELVRGYYLEAMWRDEGKIPSFDE  446

Query  1313  YIKNGQASSTLYLLITASFLGMKSVT--REAFEWSSQNPRIIEANTLLARVINDIASYER  1486
             YI+NG  SS L L++TASF+G+K +T  RE F+W    P++   +  + R++NDI S+  
Sbjct  447   YIRNGSLSSGLPLVVTASFMGVKEITGIRE-FQWLRTKPKLNHFSGAVGRIMNDIMSHVS  505

Query  1487  EKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCI  1666
             E+     A+ ID YM  Y V+ EEA+ + ++M  +AWKD NE  +R  P+ VS   L+ +
Sbjct  506   EQNRGHVASCIDCYMKQYEVSKEEAIKEMQKMASDAWKDINEGYMR--PAQVSVSELMRV  563

Query  1667  LNFARIDDVVYKNKQDGYTNPEKV  1738
             +N AR+ DV YK   DGYT+P+ +
Sbjct  564   VNLARLTDVSYKYG-DGYTDPQHL  586



>ref|XP_006365530.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=587

 Score =   438 bits (1127),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 228/539 (42%), Positives = 348/539 (65%), Gaps = 11/539 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQE---IQVLKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             F  ++WG  + +  + +++ E   QE   +   K +VM+ML+ I      +KL  IDT++
Sbjct  54    FHSNVWG--YNFLSYTSQLTEITTQEKLEVDEYKEKVMNMLMEIHDNS-TQKLVLIDTIQ  110

Query  356   RLGISYHFHEMIDEMLENIYNANPNF-QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE  532
             RLG+SYHFH  I+  ++NI++A+    +  D+L   +L  RL+RQ G+ ISS +F  F E
Sbjct  111   RLGVSYHFHNEIETSIQNIFDASSQHSENNDNLHVVSLRIRLVRQQGHYISSDVFKQFVE  170

Query  533   -NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVR  709
              +GKFK +L+NDV+ LL+LYEA+ ++ H +  L+EA TF+ THLE + P L++ L  Q+ 
Sbjct  171   RDGKFKKTLNNDVQALLSLYEAAQMRVHGEDILEEALTFTTTHLESMIPMLNNPLKAQII  230

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
              AL   +H  IPR+ +  +I +YE  ES N +LL+F+KLDFN+LQ  H++EL E   WWK
Sbjct  231   EALSHPIHKVIPRLGARKYIDIYENMESHNHLLLKFSKLDFNMLQKQHQRELSELTSWWK  290

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             +LD  + +PYARD+ VE Y W LG+YFE KYS+AR ML K+  M SI DDTYD++   DE
Sbjct  291   DLDLASKVPYARDKLVEGYTWTLGLYFEPKYSRARRMLVKVFKMLSICDDTYDAYATFDE  350

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             L +FT+AIQ+WDI   + LP +M+  Y+ ++D+F+E ++EL+KEG+S  V+Y K  +K+L
Sbjct  351   LVLFTNAIQRWDINAMDSLPPYMRPFYQAILDIFDEMEEELTKEGKSDRVYYGKFEMKKL  410

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPR  1426
               +Y  E +W      P   +YIKN   S+T  +L T S +GM+  +T++ FEW +  P 
Sbjct  411   ARAYFKEAEWLNAGYIPNCDQYIKNAIVSTTFMVLGTTSLIGMEEFITKDTFEWITNEPS  470

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             I+ A++ + R+++DI+ +E ++     A+ I+ YMN+YG + +EA  KF + V+NAWKD 
Sbjct  471   ILRASSTICRLMDDISDHETDQQRGHVASVIECYMNEYGASKQEAYVKFRKEVKNAWKDI  530

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             N+ +LRPI   V   +L  ILN AR  D  +++++DGYTN     K  I  +LV+S  I
Sbjct  531   NKALLRPI--EVPIFVLERILNLARTMDTFFQDEEDGYTNSNSKCKDIITLLLVDSVTI  587



>gb|AGW18162.1| terpene synthase 4-2 [Copaifera langsdorffii]
Length=556

 Score =   436 bits (1121),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 233/554 (42%), Positives = 353/554 (64%), Gaps = 14/554 (3%)
 Frame = +2

Query  134   LKMVTNNEVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIR  310
             L + T+     P  S  + PS+WGD F +Y     EV E+    I  LK  V  MLV   
Sbjct  6     LAIATSTPSDVPRRSANYHPSVWGDHFLKYASQPLEVDEKMEDRIGTLKETVRKMLVPAT  65

Query  311   SAKLAEKLNFIDTMERLGISYHFHEMIDEML---ENIYNANPNFQLGDDLCTSALLFRLL  481
                L  K+  ID+M+RLG+ YHF   IDE+L   +N Y  +    L +DL + ALLFRLL
Sbjct  66    DKPLT-KVRLIDSMQRLGVDYHFESEIDEVLYQIQNNYVKDGIITLNEDLHSMALLFRLL  124

Query  482   RQHGYNISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTH  658
             RQ GY++S  +F+ F+ E GK   +++NDV+G+L+LYEA+HL+ H +  L EA  F+ TH
Sbjct  125   RQQGYHVSPDVFNKFKDEQGKISETIANDVEGMLSLYEAAHLRIHGEDILDEALDFTSTH  184

Query  659   LEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNL  838
             L+ +  QLS +   +V  +L   L   +PR+E+ ++ + Y+ED S  + LL FAK DFN 
Sbjct  185   LKFLTTQLSDSHAGKVIRSLKCPLRRRLPRLEAWHYFSTYQEDPSHIETLLAFAKSDFNG  244

Query  839   LQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIIT  1018
             +Q  H++E+    +WWK+LDF T LP+ARDR VE YFW LGVYFE  YS AR ++ K+I+
Sbjct  245   VQKLHQREIGNLSKWWKDLDFATKLPFARDRLVEAYFWILGVYFEPCYSLARRIMTKVIS  304

Query  1019  MASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSK  1198
             + SI DD YD +G  +EL++FT+AI KWDI   + LP +MK+IY+ L+D+++E ++E +K
Sbjct  305   LTSIIDDIYDVYGTLEELQLFTEAINKWDISCMDFLPEYMKLIYQPLLDVYDEIERETAK  364

Query  1199  EGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM  1378
             EGR+F V+Y KE+++++V +Y  E KW     TP   EY++    SS   +L T SF+G+
Sbjct  365   EGRAFCVNYGKEQMRKVVRAYLAEAKWFHNNYTPTFEEYMEVALVSSAYRMLTTVSFIGV  424

Query  1379  KSV-TREAFEWSSQNPRIIEANTLLARVINDIAS--YEREKYNRVNATGIDYYMNDYGVT  1549
              S+ T EAF+W +++P+I++A+ ++ R+++DI S  +E+E+ + V A  ++ YM  YG T
Sbjct  425   GSIATEEAFKWVTKDPKIVKASLVICRLMDDIVSRKFEQERGHVVPA--LECYMKQYGAT  482

Query  1550  AEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
              EE + +F   VENAWKD NED L+P    V+  +L+  LN +R+ +++Y +  D YT+ 
Sbjct  483   EEETIVEFRRRVENAWKDINEDCLQPF--KVAKPLLMRSLNLSRVINLLYTD-DDCYTHS  539

Query  1730  EKVLKPCIFSVLVN  1771
                 K  I ++L+N
Sbjct  540   AGNTKKNIEALLIN  553



>gb|AEM23828.1| sesquiterpene synthase [Solanum habrochaites]
Length=554

 Score =   436 bits (1121),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 231/547 (42%), Positives = 344/547 (63%), Gaps = 6/547 (1%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             +  ++EV+    S    P+LWGD F  +       E   ++ + LK +V  MLV   S  
Sbjct  8     VAADHEVIITRRSGSHHPTLWGDHFLAYADLRGANEGEEKQNEDLKEEVRKMLVMAPSNS  67

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
             L EKL  I+T++ LG++YHF   IDE L  +Y     + +GD L   AL FRLLRQ GY 
Sbjct  68    L-EKLELINTIQCLGLAYHFQSEIDESLSYMYTHYEEYSIGD-LHAIALCFRLLRQQGYY  125

Query  500   ISSGIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S   F  F  + G FK  L  DV+G+L+LYEA+  + H +  L EA  F+ T L+ I P
Sbjct  126   VSCDAFKKFTNDQGNFKEELVKDVEGMLSLYEAAQFRVHGEQILDEALNFTITKLKQILP  185

Query  677   QLS-STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHH  853
             +LS S L +Q+ +AL   + +GI RVE+  +I+ Y+++++ N VLL FAKLDFN+LQ  H
Sbjct  186   KLSNSQLAQQITNALKFPIKDGIVRVETRKYISFYQQNQNHNQVLLNFAKLDFNILQTLH  245

Query  854   KQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIF  1033
             K+EL +  RWWK+++ V TLPYARDR VECYFW LG YFE +YS AR ML KI    SI 
Sbjct  246   KKELSDMTRWWKKMELVNTLPYARDRLVECYFWCLGTYFEPQYSVARKMLTKISFFISII  305

Query  1034  DDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSF  1213
             DDTYD +GK DEL +FT AI++W+I  + +LP +MKIIY+ L+D+++E +KEL+ E +SF
Sbjct  306   DDTYDIYGKLDELTLFTQAIERWNIDASEQLPLYMKIIYRDLLDVYDEIEKELANENKSF  365

Query  1214  AVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-T  1390
              V+Y+   +K++V  Y  E KW   +  P + +Y+KN  ++S   LL T S+L M +V T
Sbjct  366   LVNYSINEMKKVVRGYFQEAKWYYGKKVPKMEQYMKNAISTSAYILLTTTSWLAMGNVAT  425

Query  1391  REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNK  1570
             ++ F+W +  P+++ A+  + R++ND+ S+E E+     A+ ++ YMN+Y VT EEA  K
Sbjct  426   KDVFDWVATEPKLVVASCHIIRLLNDLVSHEEEQKRGNAASAVECYMNEYSVTQEEAHVK  485

Query  1571  FEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
               +++EN WKD NE+  +     +   +L+CI+N  R+ + +YK+ +D YT  +  LK  
Sbjct  486   IRDIIENYWKDLNEEYFKVDMIIIPRVLLMCIINLTRVAEFIYKD-EDAYTFSKNNLKDV  544

Query  1751  IFSVLVN  1771
             I  +LV+
Sbjct  545   ISDILVD  551



>emb|CBI20287.3| unnamed protein product [Vitis vinifera]
Length=595

 Score =   437 bits (1124),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/532 (42%), Positives = 340/532 (64%), Gaps = 6/532 (1%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F P+ WGD F  ++ D+ V     ++      + +   +   + K ++ LNFID+++RLG
Sbjct  63    FVPNFWGDCFLTYIPDDTVTHACKEKELEGLKEEVRNELKATAGKSSQLLNFIDSIQRLG  122

Query  365   ISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENG  538
             ++YHF   I++ L+ +Y   N      DDL ++AL FRLLRQ GY+I S +F  F+ E G
Sbjct  123   LAYHFEREIEDALKVMYETYNLVDDDNDDLASAALRFRLLRQEGYHIPSDVFKKFKDEEG  182

Query  539   KFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHAL  718
              FK SL  D+ G+L LYEA+HL  H +  L EA  F+  HL+ + P   + L KQV HAL
Sbjct  183   NFKESLVGDLPGMLALYEATHLMVHGEDILDEAQAFTTAHLQSMAPDSDNPLKKQVIHAL  242

Query  719   DQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELD  898
             ++ +   + RVE+ ++I++Y+E +S N  LL+ AKLDFNLLQ  H++EL E  +WWK LD
Sbjct  243   ERPIRKSLIRVEARHYISIYQEYDSHNKSLLKLAKLDFNLLQSLHRKELSEITKWWKGLD  302

Query  899   FVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEI  1078
             F T LP+ARDR VE YFW LGVYFE +Y  AR +L K+  M SI DD YD+ G  +EL++
Sbjct  303   FATKLPFARDRIVEGYFWVLGVYFEPQYFLARRILLKVFAMTSIIDDIYDTHGTFEELKL  362

Query  1079  FTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSS  1258
             F +AI++WD    ++LP +MK+ Y+ L+D+FEE ++E++K+ + + VHY K+ +K+LV +
Sbjct  363   FAEAIERWDASSIDQLPDYMKLCYQALLDVFEEIEEEMTKQEKPYRVHYAKQAMKKLVQA  422

Query  1259  YNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPRIIE  1435
             Y +E KW  +   P + EY+ N   S   + L T SF+GM   VT++AF+W   +P+++ 
Sbjct  423   YFVEAKWLKQEYIPTIEEYMTNALVSCGYFQLATISFVGMGDMVTKKAFDWVFSDPKMVR  482

Query  1436  ANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNED  1615
             A+ ++ R+++DI  +E E+      +G+  YM  YGVT +EA  +F   + NAWKD NE+
Sbjct  483   ASAIICRLMDDIVDHEFEQKRGYVVSGVQCYMKQYGVTEQEACEEFINEIMNAWKDMNEE  542

Query  1616  ILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
              L+   + V   +L C++NFAR+ D++YKN QD YT+  K++K  I  +L++
Sbjct  543   CLK--RTQVPMPLLTCVVNFARVIDLLYKN-QDEYTHVGKLMKDLIAWMLID  591



>ref|XP_006370589.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 ref|XP_006370592.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67158.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67161.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=500

 Score =   433 bits (1114),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 215/494 (44%), Positives = 325/494 (66%), Gaps = 12/494 (2%)
 Frame = +2

Query  317   KLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNA-------NPNFQLGDDLCTSALLFR  475
             K ++ L+FID ++RLGISYHF   IDE+L  +Y +       + +    +DL   +L FR
Sbjct  6     KPSQTLDFIDAIQRLGISYHFEMEIDEILREMYRSPCDFDNGDDDDHHHNDLYAISLKFR  65

Query  476   LLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSK  652
             LLRQ GY IS  +F  F+ + G F  SL ND + +L+ YEA+HL+ H D  L+EA  F+ 
Sbjct  66    LLRQQGYKISCDVFGKFKNSQGNFNDSLVNDTRAILSFYEATHLRVHGDEVLEEALVFTT  125

Query  653   THLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDF  832
             +HLE +    SS L  ++ HAL Q +   IPR+E+  + +VY+ED S ++VLL FAKLDF
Sbjct  126   SHLEFLATHSSSPLRAKINHALKQPIRKNIPRLEARNYFSVYQEDPSCSEVLLNFAKLDF  185

Query  833   NLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKI  1012
             N+LQ  H++EL +  +WWKELDF   LP+ARDR +ECYFW LGVYFE ++  AR ML K+
Sbjct  186   NILQKQHQKELSDIAKWWKELDFAKKLPFARDRVIECYFWILGVYFEPEHFLARRMLTKV  245

Query  1013  ITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKEL  1192
             I M S+ DD YD +GKP+ELE+FTDAI++W+I   + LP +MK+ YK L+D++ E ++ +
Sbjct  246   IAMTSVIDDIYDVYGKPEELELFTDAIERWEITAVDLLPEYMKVTYKALLDVYTEIEENM  305

Query  1193  SKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFL  1372
               E RS+ V+Y KE +K  V +Y  E KW  ++ TP + EY+     +S   +L   SF+
Sbjct  306   VNEERSYRVYYAKEAMKNQVRAYYHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFV  365

Query  1373  GM-KSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVT  1549
             GM + VT+++F+W  + P+I++A+ ++ R+++DI S++ E+     A+ I+ YM  +G T
Sbjct  366   GMGRVVTKDSFDWLFRGPKILKASEIICRLMDDIVSHKFEQKRGHVASSIECYMKQHGTT  425

Query  1550  AEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNP  1729
              +E +++F + V +AWKD NE+ L   P+AV   +L  +LN AR+ DVVYK+ +DGYTN 
Sbjct  426   EQETVHEFRKQVTDAWKDVNEEFLH--PTAVPMPLLTRMLNLARVIDVVYKD-EDGYTNA  482

Query  1730  EKVLKPCIFSVLVN  1771
                LK  + ++L++
Sbjct  483   GTALKDLVSALLID  496



>dbj|BAM34474.1| casbene synthase [Jatropha curcas]
 gb|KDP42349.1| hypothetical protein JCGZ_02822 [Jatropha curcas]
Length=601

 Score =   437 bits (1123),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/558 (39%), Positives = 349/558 (63%), Gaps = 10/558 (2%)
 Frame = +2

Query  86    STYSKISLLEQQTSEILKMVTNNEV---VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA  256
             S ++  SL +  T   LK   + +     RP+    F P++WGD      F+    E  +
Sbjct  33    SRFASFSLAKPTTFRKLKACASTKSETEARPLA--YFPPTVWGDRLASLTFNQPAFELLS  90

Query  257   QEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF-  433
             +++++L  ++   ++++ ++ LAEK+  ID++ RLG+SYHF E I E L  I+N  PNF 
Sbjct  91    KQVELLNEKIKKEMLNVSTSDLAEKIILIDSLCRLGVSYHFEEEIQENLTRIFNTQPNFL  150

Query  434   -QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLK  607
              +   DL T A++FR+ RQHG+ ISS +F+ F++ +GKFK SL ND+KG+L+L+EA+H+ 
Sbjct  151   NEKDYDLFTVAVIFRVFRQHGFKISSDVFNKFKDSDGKFKESLLNDIKGILSLFEATHVS  210

Query  608   GHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEED  787
               N+  L EA  F+K  LE    +      K +  AL+Q +H GIPR+E+  +I +YE D
Sbjct  211   MPNEPILDEALAFTKAFLESSAVKSFPNFAKHISSALEQPVHKGIPRLEARKYIDLYEVD  270

Query  788   ESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY  967
             ES+N+ +L  AKLDFN +Q+ H++EL +  +WWK L+    +PYAR+R  E +FWA+ +Y
Sbjct  271   ESRNETVLELAKLDFNRVQLLHQEELSQFSKWWKSLNISAEVPYARNRMAEIFFWAVSMY  330

Query  968   FEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKII  1147
             FE +Y+KAR++++K++ + S+ DDT D++   DE+    DAI++WD+R  ++LP +MK+I
Sbjct  331   FEPQYAKARMIVSKVVLLISLIDDTIDAYATIDEIHRVADAIERWDMRLVDQLPNYMKVI  390

Query  1148  YKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNG  1327
             Y+ +I+ F+EF+K+L  EG+S++V Y +E  +ELV  Y +E  W  +   P   EYI NG
Sbjct  391   YRLIINTFDEFEKDLEAEGKSYSVKYGREAYQELVRGYYLEAIWKADGKVPSFDEYIYNG  450

Query  1328  QASSTLYLLITASFLGMKSVT-REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRV  1504
               ++ L L+ T SF+G+K +   +AF+W    P++ +A     R++ND+ S+E E+    
Sbjct  451   GVTTGLPLVATVSFMGVKEIKGTKAFQWLKTYPKLNQAGGEFIRLVNDVMSHETEQDRGH  510

Query  1505  NATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARI  1684
              A+ ID YM  YGV+ EEA+ + ++M  N WK  NE ++      V   +L+ I+N  R+
Sbjct  511   VASCIDCYMKQYGVSKEEAVEEIQKMATNEWKKLNEQLIVRSTEVVPVNLLMRIVNLVRL  570

Query  1685  DDVVYKNKQDGYTNPEKV  1738
              DV YK   DGYT+  ++
Sbjct  571   TDVSYKYG-DGYTDSSQL  587



>ref|XP_006358572.1| PREDICTED: vetispiradiene synthase 1-like [Solanum tuberosum]
Length=367

 Score =   428 bits (1100),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 261/332 (79%), Gaps = 2/332 (1%)
 Frame = +2

Query  788   ESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY  967
             +++NDVLLRFAKLDFNLLQM HKQEL E  RWWK+LDFVTTLPYARDRAVECYFW +GVY
Sbjct  38    DNQNDVLLRFAKLDFNLLQMLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYFWTMGVY  97

Query  968   FEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKII  1147
              E +YS+AR+MLAK I M SI DDT+D++G   ELEI+TDAIQ+WDI Q +RLP +MKI 
Sbjct  98    AEPQYSQARVMLAKTIAMISIVDDTFDAYGIVKELEIYTDAIQRWDINQIDRLPDYMKIS  157

Query  1148  YKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNG  1327
             YK L+DL+ +++ ELSK+GRS  VHY KER+KE+V +Y +E KW  E   PPV+EY+ N 
Sbjct  158   YKALLDLYNDYEMELSKDGRSDVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLSNA  217

Query  1328  QASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVN  1507
              A+ST YLL T S+LGMKS  +E FEW ++NP+I+EAN  L RVI+DIA+YE EK     
Sbjct  218   LATSTYYLLTTTSYLGMKSANKEDFEWLAKNPKILEANVTLCRVIDDIATYEVEKGRGQI  277

Query  1508  ATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARID  1687
             ATGI+ YM DYGV+ EEAM KF+EM E AWKD NE ILRP P  VSTEIL  ILN ARI 
Sbjct  278   ATGIECYMRDYGVSTEEAMEKFQEMAETAWKDVNEGILRPTP--VSTEILTRILNLARII  335

Query  1688  DVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             DV YK+ QDGYT+PEKVLKP I ++LV+S EI
Sbjct  336   DVTYKHNQDGYTHPEKVLKPHIIALLVDSIEI  367



>ref|XP_011035527.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   434 bits (1117),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 224/547 (41%), Positives = 350/547 (64%), Gaps = 12/547 (2%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             +NE++R   ++   PS+WGD+F   +  ++V E  A E+Q ++  +      I ++  ++
Sbjct  18    DNEIIRRTANYH--PSIWGDQFISHLPKDKVHE--AIELQEIEKLMERFKREILASNSSQ  73

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             KL+ ID ++RLG++YHF   I+E L +IYN   + +  DDL  +AL FRLLRQHGYN+S 
Sbjct  74    KLDLIDAIQRLGVAYHFETEIEEALLHIYNNRIDME-DDDLYNTALGFRLLRQHGYNVSC  132

Query  509   GIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              IF+ F+++ G FK +  NDV+G+L LYEA+HL  H +  L EA  F+   L+ I    +
Sbjct  133   DIFNKFKDDKGYFKQT--NDVRGILGLYEAAHLAVHGEDILDEALAFTTIQLKSIATSPN  190

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
               L  +V HAL Q +  G+PR+ES  + ++Y+++ S N  LLR AKL+FNL+Q  HK+EL
Sbjct  191   CPLTAKVSHALKQPIRRGVPRLESRRYFSIYQDEPSCNKTLLRLAKLNFNLVQELHKEEL  250

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              E  RWWK LDF   LP+ARDR  EC+FW +GVYFE +YS AR +L K+I M +I DD Y
Sbjct  251   SEITRWWKGLDFAGRLPFARDRVAECFFWIVGVYFEPQYSLARKILTKVIAMTTIIDDIY  310

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             D +G  +ELE+FT+AI +WD +  +RLP +MKI Y+ L++++ E +++++KEG S+ VHY
Sbjct  311   DVYGTLEELELFTEAIDRWDTKSMHRLPDYMKICYEALLNVYSEIEEKVAKEGWSYRVHY  370

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAF  1402
              KE +K  V +Y  E KW  E+  P + EY++    +    +L T SF+GM  V T +AF
Sbjct  371   GKEAMKVQVHAYFNEAKWFHEKHIPTMEEYMQVALVTIGYSMLATMSFIGMGDVATEQAF  430

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             +W    P+I+ A+  + R+++D+ S++ E+    NA+G++ Y+  YG++ +E   +F   
Sbjct  431   DWVFNRPKIVRASETICRLMDDVRSHKFEQERGHNASGVECYIKQYGLSEQEVYKEFHMQ  490

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             V NAWKD NE+ L+  P+ V   +L  ILN +R   V+Y+ ++DGY +  +V+K  + S+
Sbjct  491   VVNAWKDINEECLK--PTVVPMPLLERILNLSRAAGVIYE-EEDGYNHVGEVMKNNVASL  547

Query  1763  LVNSFEI  1783
              ++   I
Sbjct  548   FIDPVPI  554



>gb|KHG27356.1| delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=536

 Score =   434 bits (1115),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 232/545 (43%), Positives = 343/545 (63%), Gaps = 29/545 (5%)
 Frame = +2

Query  140   MVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAK  319
             + +N + +RP   FQ  PS+WGD F       ++     Q  Q LK +V  M+V+  +  
Sbjct  14    LTSNKDEMRPKADFQ--PSIWGDLF-LTCPKKDINAETEQRHQQLKEEVRKMIVAPMNNS  70

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
               +KLNFID+++RLG+SYHF + I++ LENIY+ N + +  +D+ T++L FRLLR+HG+N
Sbjct  71    -TQKLNFIDSIQRLGVSYHFTKEIEDELENIYHNNNDAE--NDIYTTSLRFRLLREHGFN  127

Query  500   ISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S  +F+ F+ E G FKSS+++DV GLL LYEAS+L+ H +  L EA +F+  HL ++  
Sbjct  128   VSCDVFNKFKDEQGNFKSSMTSDVPGLLELYEASYLRVHGEDILDEAISFTTNHLRLVVA  187

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
              L   L +QV HAL QS+  G+PR                   LL FAK+DFN+LQ+ H+
Sbjct  188   SLDYPLSEQVSHALKQSIRRGLPRA------------------LLEFAKIDFNMLQLLHR  229

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL E  RWWK+LDF   L YARDR VE YFW  GVYFE +YS  R ML K+I MASI D
Sbjct  230   KELSEICRWWKDLDFQRKLLYARDRVVEGYFWISGVYFEPQYSLGRKMLTKVIAMASIVD  289

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             DTYDS+   DEL  +T+AI++WDI+   +LP +MK  YK L+D++EE ++ ++K GR + 
Sbjct  290   DTYDSYATYDELIPYTNAIERWDIKCIEQLPEYMKPGYKALLDVYEEMEQLMAKHGRQYR  349

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTR  1393
             V Y K  +  L  SY +E KW  +   P   E+  N   +    +L   SF+GM   VT 
Sbjct  350   VEYAKNAMIRLAQSYLVEAKWTLQNYKPSFEEFKANALRTCGYAMLAITSFVGMGDIVTP  409

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             E F W++ +P+II+A+T++ R ++D+A ++ +     + + I+ Y+ +YGVTA+EA + F
Sbjct  410   ETFNWATNDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYIEEYGVTAQEAYDVF  469

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
              + VE+AWKD N++ ++  P+ + TE+L   LN AR+ DV+Y+ + DGYT   K  K  I
Sbjct  470   NKHVESAWKDVNQEFIK--PTEMPTEVLNRSLNLARVMDVLYR-EGDGYTYVGKAAKGGI  526

Query  1754  FSVLV  1768
              S+LV
Sbjct  527   TSLLV  531



>ref|XP_010683546.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=552

 Score =   434 bits (1116),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 221/548 (40%), Positives = 347/548 (63%), Gaps = 17/548 (3%)
 Frame = +2

Query  158   VVRPVTSFQFSPSLWGDEFRYF-VFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
              +RP+    F P +WGD F  F   D+ + E+YA+EI+ LK +V +ML+   SA  A+K+
Sbjct  10    AIRPLA--HFPPDIWGDRFVTFSTEDSLMMEKYAKEIEPLKEEVKTMLMIENSADFAKKM  67

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYN--ANPNFQLGDDLCTSALLFRLLRQHGYNISS  508
             + ID +ERLG+SY+F   I+E L +I+   A  NF +  DL  +A  FR+ RQHGY I  
Sbjct  68    SLIDAVERLGVSYYFENEIEEQLSHIFKELAAKNFDMEYDLYNTASQFRIFRQHGYKIPC  127

Query  509   GIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLS  685
              +F  F  E+GK K +LS +++ +++LYEASHL+ H +  L EA  F+   L+      S
Sbjct  128   DVFIKFTNEDGKMKETLSTNIRAIVSLYEASHLRIHGEPILDEASAFATDVLKS-----S  182

Query  686   STLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQEL  865
             +   +Q RHAL Q LH GI RVE+ +FI+ YE+DE +N+ LLR AK+DFN +Q+ H+QEL
Sbjct  183   ANFSEQARHALKQVLHFGIQRVENRHFISFYEQDEFRNETLLRLAKIDFNRVQLLHRQEL  242

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
              + ++WW +LDF T LPYAR R+VEC+FW+L +Y+E +YS AR++L K++ + SI DDTY
Sbjct  243   SQILKWWHDLDFKTKLPYARQRSVECHFWSLSMYYEPQYSFARMLLVKVLLVISILDDTY  302

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             D++G  +ELE+ T+A ++WD+    + P  +MK++++ + D + EF KE+++ G+ +A  
Sbjct  303   DAYGTFEELELLTEAFERWDLSAMEKFPADYMKLVFQFVYDTYGEFAKEMTERGKPYAAK  362

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE-A  1399
             + K+R+ +L+  Y  E KW   +  P   EY+ N + +    ++ T+S +GM+ +  E  
Sbjct  363   FAKDRVMDLIRCYYTEAKWYKAKYVPTFEEYMINARITGVAQIISTSSIMGMEEIAEEKP  422

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+   Q+PR++ A  ++ R+++DI S+E E+     A+G++ YM DY ++ EE +  F +
Sbjct  423   FQQIIQSPRVVRACEIIGRIMDDIVSHEEEQARGHVASGVECYMKDYNMSREEVVQIFNK  482

Query  1580  MVENAWKDTNEDIL---RPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPC  1750
             MVE+AWK+ NE+ L    P    +   +L  ILN AR+ D +YK   DGYT   K++K  
Sbjct  483   MVEDAWKELNEEFLIKSNPSDDDLPKPVLKRILNLARVVDALYKVI-DGYTYSAKLIKDD  541

Query  1751  IFSVLVNS  1774
             I S    S
Sbjct  542   IISTYTRS  549



>ref|XP_006592520.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Glycine 
max]
Length=579

 Score =   435 bits (1119),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 223/548 (41%), Positives = 346/548 (63%), Gaps = 22/548 (4%)
 Frame = +2

Query  185   FSPSLWGDEFRYFV------------FDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAE  328
             FSPS+WGD F Y+V             ++   + + ++ Q+ K +V  ML++        
Sbjct  28    FSPSVWGDYFLYYVPSSVDLLMYTPGRNHMEDDSHIKQAQLTKEEVRKMLIAPIDNNFYF  87

Query  329   KLNFIDTMERLGISYHFHEMIDEMLENIYNA----NPNFQLGDDLCTSALLFRLLRQHGY  496
             KL FID+++RLG+SYHF   ID  L  IYN     N      DDLC  ALLFRLLRQ GY
Sbjct  88    KLEFIDSVQRLGVSYHFEHEIDGALHQIYNISTKDNNIITHDDDLCHVALLFRLLRQQGY  147

Query  497   NISSGIFDNFQENGK-FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVI  670
             +ISS +F  F++  + F    +ND++G+L+LYEA+ L+ H +  L+EA+ F+   L + +
Sbjct  148   HISSNVFYKFKDQTRNFSEKAANDIQGMLSLYEAAELRMHGEDILEEAHNFALVQLTKSL  207

Query  671   GPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMH  850
               QLS ++  QV+H+L +SL  G+PR+E++Y+++ YEED S ++ LL FAKLDFN+LQ  
Sbjct  208   TTQLSPSMIAQVKHSLRRSLRKGLPRLEATYYMSFYEEDSSHDEKLLTFAKLDFNMLQEL  267

Query  851   HKQELYEHMRWW-KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMAS  1027
             H++E+    RWW K L+  T LP+ RDR  ECYFW LG+YFE +YS AR +  K+I + S
Sbjct  268   HQKEVNNVTRWWIKNLNVSTKLPFVRDRIAECYFWILGIYFEPQYSLARRITTKVIALCS  327

Query  1028  IFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGR  1207
             + DD YD++G  DELE+FT+AI++WDI   + LP +MK+ Y  +++++EE ++E+ K+G+
Sbjct  328   VIDDMYDAYGTIDELELFTNAIERWDICCLDDLPEYMKVCYIEILNVYEEIEEEMRKQGK  387

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV  1387
              + + Y K+ +K L+ ++  E +W     TP + EY++    SS   ++IT  F+GMK  
Sbjct  388   VYCIKYAKKEMKRLIKAHMAEARWLHCNHTPSIEEYMQVRNVSSGYSMVITICFVGMKDT  447

Query  1388  TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMN  1567
             T E   W++ +P II A +++ R+++DI   E E+  R  A+ I+ YM  +  + ++A+N
Sbjct  448   TEEVLIWATSDPIIIGAASIICRLMDDIVGNEFEQERRHVASSIESYMKQHNTSRQDAIN  507

Query  1568  KFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKP  1747
             K  EMV++AWKD NE  L   P+ V    LL ++N  R+ DV+YK+ +D YTN   ++K 
Sbjct  508   KLLEMVKSAWKDINEACLN--PTEVPMNFLLRVVNLVRMIDVLYKD-EDNYTNAGGLMKD  564

Query  1748  CIFSVLVN  1771
              I ++LVN
Sbjct  565   YIKTLLVN  572



>emb|CDP07835.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   434 bits (1116),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 223/534 (42%), Positives = 334/534 (63%), Gaps = 13/534 (2%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
              E VRP+ +F    ++W D    F  D E  E Y +EI++LK +V SML++     + E+
Sbjct  14    QETVRPLAAF--PENIWADRIAPFTPDKEEHEMYEREIEMLKAEVNSMLLAT-GKTMMER  70

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGD----DLCTSALLFRLLRQHGYN  499
              +FID +ERLG+S+HF   I+  L+  +N   NF  G+    DL ++AL FRL RQHG+N
Sbjct  71    FDFIDKIERLGVSHHFDIEIENQLQEFFNVYTNF--GEYSAYDLSSAALQFRLFRQHGFN  128

Query  500   ISSGIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             +S GIF  F    GKFK SL ND +GLL+LYEASH++ H D  L+EA  F+ THL   GP
Sbjct  129   VSCGIFGQFIDAEGKFKESLCNDTRGLLSLYEASHVRTHGDEILEEALAFTTTHLTSGGP  188

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
              L  TL KQV++AL+Q LH GIPR E+ ++I++Y EDES N +LLR AKL ++LLQM +K
Sbjct  189   HLDYTLAKQVKYALEQPLHKGIPRYEAWHYISIYGEDESNNKLLLRLAKLGYHLLQMSYK  248

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             QEL E + W K L+ V+  PYARDR VECYFWA+G  +E ++S AR+  AK+  + ++ D
Sbjct  249   QELCEIISWGKGLESVSKFPYARDRFVECYFWAVGTLYEPQHSLARMTFAKVAALITMID  308

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  DEL+I TD+ ++WD    ++L  +++  Y TL+   +E  ++L+K+ R++A
Sbjct  309   DIYDAYGTLDELQILTDSAERWDSSGADQLSDYIRASYTTLLKFNKEVGEKLAKKQRTYA  368

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
                  E  K+ +++   + +W  ++  P  A+YI NG  +  +YL  +A+FL M   + +
Sbjct  369   FDKYIEEWKQYMTTNLTQSRWFLKKELPSFADYISNGAITIGVYLTASAAFLDMDYASED  428

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
                W S  P+ + A +  AR+IND   ++ +K  R + T ++ YM DY V+ E A  K  
Sbjct  429   VINWMSTMPKHMFACSTHARLINDFGGHKFDK-ERGSGTALECYMKDYNVSEEVAAKKIR  487

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             EM E+ WK  NE+ LRP P  +  +IL  +LN AR+ + + K++ DG+T P  +
Sbjct  488   EMCEDIWKVMNEECLRPTP--IPRDILKMLLNIARVGETINKHRIDGFTQPHAI  539



>ref|XP_007028200.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY08702.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=556

 Score =   434 bits (1116),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 218/535 (41%), Positives = 341/535 (64%), Gaps = 7/535 (1%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F P++WG+ F     +  +        + LK +V SML +    K ++KL  ID ++RLG
Sbjct  27    FRPNIWGELFLSCPSEVNMNATTQLRFEELKQEVRSMLATPMD-KPSQKLYLIDAVQRLG  85

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGK  541
             ++YHF + I++ LE IY  N N +  DDLC++A+ FRLLR+HG+N+    F+ F+ E G 
Sbjct  86    VAYHFEKEIEDSLEIIY-PNCNVERDDDLCSTAVRFRLLREHGFNVHCESFNKFKDEKGN  144

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALD  721
             FK+SL +DV+GLL LYEA+HL+ H +  L+EA  F+ +HL+     +   L  Q+ +AL 
Sbjct  145   FKASLISDVRGLLELYEAAHLRVHGEQILEEALAFTSSHLKSAETMVEYPLSTQINNALK  204

Query  722   QSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDF  901
             + L   +PR+ +  +I++YE   ++ D LL FAKLDF LLQ  HK+E+ E  RWWK LD 
Sbjct  205   RPLRKSLPRLVARNYISIYERYVTQEDTLLEFAKLDFKLLQHLHKKEIKEVYRWWKGLDV  264

Query  902   VTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIF  1081
                 P+ RDR VECY W LGVYFE  YS AR  L K+  + SI DD YD++G  +EL+IF
Sbjct  265   AKNFPFIRDRLVECYLWMLGVYFEPHYSLARTFLTKVSALTSILDDIYDAYGTREELKIF  324

Query  1082  TDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSY  1261
             T+AIQ+WDI   N+LP +MK+ Y  L+ +++E ++ ++++G+S+ V   KE +K+ V ++
Sbjct  325   TNAIQRWDISCINQLPHYMKVCYSELLSVYKEMEELMAEQGKSYRVQLAKEAMKQQVQAF  384

Query  1262  NIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMK-SVTREAFEWSSQNPRIIEA  1438
               E KW  E  TP + EY+     +   ++L   SF+GM+ ++T+E F W+   P+I+ A
Sbjct  385   YAEAKWLHENYTPKLEEYMSIASVTCAYHMLTITSFVGMEDTITKETFIWAYNYPKILRA  444

Query  1439  NTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDI  1618
             +T+++R++NDIAS++ E+     A+ ++ YM  YGV+ +EA N+F++ ++NAWKD N++ 
Sbjct  445   STIISRLMNDIASHKFEQERGHVASAVECYMKQYGVSEQEAYNEFDKQIKNAWKDINQEF  504

Query  1619  LRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             L+  P+ V    L  ILN  R+ D++YK+ +D YTN  +  K  I S+L++   I
Sbjct  505   LK--PTVVPKPALNRILNLTRVIDLLYKD-EDAYTNAGEAAKTSITSLLIDQVPI  556



>gb|AGW18157.1| terpene synthase 4 [Copaifera officinalis]
Length=557

 Score =   434 bits (1116),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 230/543 (42%), Positives = 349/543 (64%), Gaps = 14/543 (3%)
 Frame = +2

Query  167   PVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFI  343
             P  S  + PS+WGD F +Y     EV E+    I  LK  V  MLV      L  K+  I
Sbjct  18    PRRSANYHPSVWGDHFLKYASQPLEVDEKMEDRIGTLKETVRKMLVPATDKPLT-KVRLI  76

Query  344   DTMERLGISYHFHEMIDEML---ENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             D+++RLG+ YHF   IDE+L   +N Y  +    L +DL + ALLFRLLRQ GY++S  +
Sbjct  77    DSIQRLGVDYHFESEIDEVLCQIQNNYVKDGIITLNEDLHSLALLFRLLRQQGYHVSPDV  136

Query  515   FDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F+ E GK   +++NDV+G+L+LYEA+HL+ H +  L EA  F+ THL+ +  QLS +
Sbjct  137   FNKFKDEQGKISETIANDVEGMLSLYEAAHLRIHGEDILDEALDFTSTHLKFLTTQLSDS  196

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYE  871
                 V  +L + L   +PR+E+ ++   Y+ED S  + LL FAKLDFN LQ  H++E+  
Sbjct  197   HAGNVIRSLKRPLRMRLPRLEARHYFFTYQEDPSHIETLLAFAKLDFNGLQKLHQREIGN  256

Query  872   HMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDS  1051
               +WWK+LDF T LP+AR+R VE YFW LGVYFE  YS AR ++ K+I++ SI DD YD 
Sbjct  257   LSKWWKDLDFATKLPFARNRLVEAYFWILGVYFEPCYSLARRIMTKVISLTSIIDDIYDV  316

Query  1052  FGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTK  1231
             +G  +EL++FT+AI KWDI   + LP +MK+IY+ L+D+++E ++E +KEGR+F V+Y K
Sbjct  317   YGTLEELQLFTEAIDKWDISCMDFLPEYMKLIYQPLLDVYDEIERETAKEGRAFCVNYGK  376

Query  1232  ERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEW  1408
             E+++++V +Y  E KW     TP + EY++  Q SS   +L T SF+G+ S+ T EAF+W
Sbjct  377   EQMRKVVRAYLAEAKWFHNNYTPTLEEYMEVAQVSSAYSMLTTVSFIGVGSIATEEAFKW  436

Query  1409  SSQNPRIIEANTLLARVINDIAS--YEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
              +++P+I++A+ ++ R+++DI S  +E+E+ + V+A  ++ YM  +G T EE + +F   
Sbjct  437   VTKDPKIVKASLIICRLMDDIVSSKFEQERGHVVSA--LECYMKQHGATEEETIVEFRRR  494

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             VENAWKD NE  L+P    V+  +L+  LN +R+  ++Y +  D YT      K  I ++
Sbjct  495   VENAWKDINEACLQPF--EVAKPLLMRSLNLSRVISLLYTD-DDCYTRSAGNTKKNIEAL  551

Query  1763  LVN  1771
             L+N
Sbjct  552   LIN  554



>ref|XP_007133005.1| hypothetical protein PHAVU_011G143200g [Phaseolus vulgaris]
 gb|ESW04999.1| hypothetical protein PHAVU_011G143200g [Phaseolus vulgaris]
Length=560

 Score =   434 bits (1116),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 234/549 (43%), Positives = 340/549 (62%), Gaps = 14/549 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYA--QEIQVLKGQVMSMLVSIRSAKLAEKLN  337
             +P  +  F PS+WGD F    +D+   E  +  +++ +LK  V  ++VS+       KLN
Sbjct  17    KPRHTANFHPSIWGDYF--LSYDSSFHEDDSDMKQVPLLKEYVRKIIVSLVDNNFLFKLN  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIY----NANPNFQLGDDLCTSALLFRLLRQHGYNIS  505
             FI++++RLG+SYHF   IDE L  IY      N      DDL   ALLFRLLRQ GY IS
Sbjct  75    FINSVQRLGVSYHFEHEIDEALHQIYEISTKENNIVSYDDDLHHLALLFRLLRQQGYRIS  134

Query  506   SGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL-EVIGPQ  679
             S +F  F++  GKFK S+ ND++G+L+L EA+ L  H +  L+EAY+F+ T L E +  +
Sbjct  135   SDVFCKFKDQEGKFKESILNDIEGMLSLCEATQLSFHGEEILQEAYSFTLTQLTESLTTK  194

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
             LS  L   + H+L QSL  G+PR+ES Y+I+ Y+ED S ++ LL FAKLDFN+LQ  H++
Sbjct  195   LSPFLSGLLHHSLGQSLRKGMPRLESRYYISFYQEDPSHDERLLTFAKLDFNMLQKLHQK  254

Query  860   ELYEHMRWW-KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             E+    +WW K+L+  T  P+ARDR VE YFW +GVY+E +Y  AR +L K+I + SI D
Sbjct  255   EVSNDTKWWVKDLNVSTNFPFARDRIVEGYFWVVGVYYEPQYFIARRILMKVIAITSIID  314

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  DE+EIFTDAI++WDI     LP +MK+ YK L+D+FEE ++EL  +G+   
Sbjct  315   DVYDAYGTIDEIEIFTDAIERWDISSLVDLPEYMKLCYKALLDIFEETEQELRNQGKENF  374

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTRE  1396
             V Y K  +K LV +Y  E +W  +  TP V EY++    S    LLIT SFLGM+    E
Sbjct  375   VKYAKNEVKRLVQAYRTESRWFHQNHTPTVEEYMEVATMSCGFALLITVSFLGMEDTAEE  434

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
                W++  P+ I A + + R+++DI   E E       + +D YM  Y  + E A+ +  
Sbjct  435   FLIWATSEPKTIVAASTICRIMDDIVGTEFEHERGHVVSSLDCYMKQYNSSKENAIKELL  494

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             +MVE++WKD NE+ L   P+ V  + L+ ++N AR+ DV+YK +QD YT+   +LK  I 
Sbjct  495   KMVESSWKDINEECLN--PTQVPMKFLMRVVNLARMMDVLYK-EQDSYTHSGGILKDYIN  551

Query  1757  SVLVNSFEI  1783
             ++LV+   I
Sbjct  552   TLLVHKVPI  560



>gb|AIM47562.1| casbene synthase 1 [Jatropha curcas]
Length=601

 Score =   435 bits (1119),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/558 (39%), Positives = 349/558 (63%), Gaps = 10/558 (2%)
 Frame = +2

Query  86    STYSKISLLEQQTSEILKMVTNNEV---VRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA  256
             S ++  SL +  T   LK   + +     RP+    F P++WGD      F+    E  +
Sbjct  33    SRFASFSLAKPTTFRKLKACASTKSETEARPLA--YFPPTVWGDRLASLTFNQPAFELLS  90

Query  257   QEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNF-  433
             +++++L  ++   ++++ ++ LAEK+  ID++ RLG+SYHF E I E L  I+N  PNF 
Sbjct  91    KQVELLNEKIKKEMLNVSTSDLAEKIILIDSLCRLGVSYHFEEEIQENLTRIFNTQPNFL  150

Query  434   -QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLK  607
              +   DL T A++FR+ RQHG+ ISS +F+ F++ +GKFK SL ND+KG+L+L+EA+H+ 
Sbjct  151   NEKDYDLFTVAVIFRVFRQHGFKISSDVFNKFKDSDGKFKESLLNDIKGILSLFEATHVS  210

Query  608   GHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEED  787
               N+  L EA  F+K  LE    +      K +  AL+Q +H GIPR+E+  +I +YE D
Sbjct  211   MPNEPILDEALAFTKAFLESSAVKSFPNFAKHISSALEQPVHKGIPRLEARKYIDLYEVD  270

Query  788   ESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVY  967
             ES+N+ +L  AKLDFN +Q+ H++EL +  +WWK L+    +PYAR+R  E +FWA+ +Y
Sbjct  271   ESRNETVLELAKLDFNRVQLLHQEELSQFSKWWKSLNISAEVPYARNRMAEIFFWAVSMY  330

Query  968   FEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKII  1147
             F+ +Y+KAR++++K++ + S+ DDT D++   DE+    DAI++WD+R  ++LP +MK+I
Sbjct  331   FKPQYAKARMIVSKVVLLISLIDDTIDAYATIDEIHRVADAIERWDMRLVDQLPNYMKVI  390

Query  1148  YKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNG  1327
             Y+ +I+ F+EF+K+L  EG+S++V Y +E  +ELV  Y +E  W  +   P   EYI NG
Sbjct  391   YRLIINTFDEFEKDLEAEGKSYSVKYGREAYQELVRGYYLEAIWKADGKVPSFDEYIYNG  450

Query  1328  QASSTLYLLITASFLGMKSVT-REAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRV  1504
               ++ L L+ T SF+G+K +   +AF+W    P++ +A     R++ND+ S+E E+    
Sbjct  451   GVTTGLPLVATVSFMGVKEIKGTKAFQWLKTYPKLNQAGGEFIRLVNDVMSHETEQDRGH  510

Query  1505  NATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARI  1684
              A+ ID YM  YGV+ EEA+ + ++M  N WK  NE ++      V   +L+ I+N  R+
Sbjct  511   VASCIDCYMKQYGVSKEEAVEEIQKMATNEWKKLNEQLIVRSTEVVPVNLLMRIVNLVRL  570

Query  1685  DDVVYKNKQDGYTNPEKV  1738
              DV YK   DGYT+  ++
Sbjct  571   TDVSYKYG-DGYTDSSQL  587



>ref|XP_009338866.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=555

 Score =   433 bits (1114),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 230/541 (43%), Positives = 347/541 (64%), Gaps = 12/541 (2%)
 Frame = +2

Query  155   EVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKL  334
             +V RP  S  FSPS+WGD F  +    EV     Q +Q LK +V  ML++     +++KL
Sbjct  19    DVHRPKPSATFSPSIWGDHFLSYA-SLEVDAELEQHVQELKEEVRRMLMT-SPENVSQKL  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGI  514
             N ID ++RLG+SYHF   I+E+L+ I+ ++ +    DDLCT+AL FRLLRQ GYN+S  +
Sbjct  77    NLIDDIQRLGVSYHFGNEIEEILQKIHESSYDL---DDLCTAALRFRLLRQQGYNVSCDL  133

Query  515   FDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSST  691
             F+ F++ NG FK SL +DV GLL+LYEA+HL+ H +  L EA  F+ T+LE    +LS  
Sbjct  134   FNKFKDGNGNFKESLVDDVVGLLSLYEATHLRIHGEEILDEALNFTTTNLESATFRLSPP  193

Query  692   LGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQELY  868
             L K V HAL+Q L  G+PRVE+ Y+++VY+E  ES N+ LL FAKLDFN LQ  H++EL 
Sbjct  194   LAKAVTHALNQPLRKGLPRVEARYYLSVYQELRESPNETLLTFAKLDFNRLQRVHQKELS  253

Query  869   EHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDTY  1045
             +  RWWK+LD    LP++RDR VE YF +++ V+F+ +YS AR    K+  + SI DD Y
Sbjct  254   KITRWWKDLDVPNKLPFSRDRLVEVYFCFSMSVHFQPQYSFARRTSCKVAAIVSIIDDIY  313

Query  1046  DSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHY  1225
             + +   +EL++FT+AI++WD+   ++L  +MK+ Y+ L+D++ E  ++L+ +G+   +H+
Sbjct  314   E-YDTNEELKLFTEAIERWDVSAMDQLTEYMKVCYRALLDVYSEIQEKLAHDGKLHQIHH  372

Query  1226  TKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFE  1405
              +E +K+ V  Y  E K   ++  P + EY+     +    LLIT SF+GM   T ++F+
Sbjct  373   AREAMKKQVRGYFDEAKLFRQKHMPSLDEYMSVSLVTGGCLLLITTSFVGMAEATIDSFD  432

Query  1406  WSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMV  1585
             W   +P +++A + + R+++DI  ++ E+        ++ YM  YG T EEA+ + +  V
Sbjct  433   WLLTSPPVVKATSTIIRLMDDIVEHKFEQEKEHFIGVVNCYMKKYGATEEEAITELQGQV  492

Query  1586  ENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVL  1765
              NAWKD NE  L   P+AV   +L+  LNFAR+ DVVYK+ +DGYTN + V+K  I S L
Sbjct  493   NNAWKDINEACLH--PTAVPMPLLIRFLNFARVMDVVYKH-EDGYTNAKGVVKDLIISTL  549

Query  1766  V  1768
             V
Sbjct  550   V  550



>emb|CAN72015.1| hypothetical protein VITISV_010524 [Vitis vinifera]
Length=545

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 232/540 (43%), Positives = 348/540 (64%), Gaps = 20/540 (4%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RP    +F PS+WGD+F  +  ++E   R  +E QV  LK +V   L++  +   ++ LN
Sbjct  19    RPXA--EFHPSIWGDQFIAYTPEDE-DTRACKEKQVEDLKEEVRRELMAA-ARNPSQLLN  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIF  517
             FID ++RLG       +I  + +  ++A+      D+L   AL FRLLRQ GYNIS GIF
Sbjct  75    FIDAVQRLG------RIIQHIYDRFHDADDT---DDNLYNIALQFRLLRQQGYNISCGIF  125

Query  518   DNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTL  694
             + F+ E G FK  L ++++G+L LYEA+HL+ H +  L+EA  F+ THL+     L   L
Sbjct  126   NKFKDEKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALAFTTTHLKATVESLGYPL  185

Query  695   GKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEH  874
              +QV HAL   +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+EL   
Sbjct  186   AEQVAHALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNL  245

Query  875   MRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSF  1054
              RW KELDF T LP+ARDR VE YFW LGVYFE +YS AR +L K+  MASI DD YD++
Sbjct  246   ARWXKELDFATKLPFARDRFVEGYFWILGVYFEPQYSXARRILTKLFAMASIIDDIYDAY  305

Query  1055  GKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKE  1234
             G  +EL+ FT+AI++WDI   + LP +MK+ Y TL+DL++E D+EL K+G  + V+Y KE
Sbjct  306   GTLEELQPFTEAIERWDIXSIDHLPEYMKLFYVTLLDLYKEIDQELEKDGNQYRVYYAKE  365

Query  1235  RIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TREAFEWS  1411
              +K  V  Y  E KW  E   P + EY+     ++   +L T SF+GM  + T+EAF+W 
Sbjct  366   VLKSQVRXYFAEAKWSHEGYIPTIEEYMLVALVTAGSCILATWSFIGMGEIMTKEAFDWV  425

Query  1412  SQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVEN  1591
               +P+II A+T++ R+++DI +++ E+     A+GI+ YM  YGV+ E+  ++F + VEN
Sbjct  426   ISDPKIITASTVIFRLMDDITTHKFEQKRGHVASGIECYMKQYGVSEEQVYSEFHKQVEN  485

Query  1592  AWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             AW D N++ L+  P+AV   +L  ++N +R+ DV+YK + DGYT+  KV+K  I SVL++
Sbjct  486   AWLDINQECLK--PTAVPMPLLTRVVNLSRVMDVIYK-EGDGYTHVGKVMKDNIGSVLID  542



>ref|XP_004308569.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=566

 Score =   433 bits (1114),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/534 (43%), Positives = 342/534 (64%), Gaps = 11/534 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             FSPS+WGD F  +        +  + +  LK ++  M+++  + + ++KL+FI+ ++RLG
Sbjct  37    FSPSVWGDHFLSYSSMEAADGKSKKHVHDLKEELKRMILA-PAERPSQKLHFINNIQRLG  95

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQEN-GK  541
             +SYHF   ID++LE ++    +     DLCT+AL FRLLRQ GYN S  +F+  +++ GK
Sbjct  96    VSYHFQNEIDKILEQVHREEDDDDA--DLCTTALKFRLLRQQGYNASCNMFNKLKDDDGK  153

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL--SSTLGKQVRHA  715
             FK S  NDV GLL+LYEASHL    +  L EA TF  THLE    +L  SS L KQV HA
Sbjct  154   FKESDINDVVGLLSLYEASHLLVPGEDALMEALTFCTTHLESAAHRLIPSSQLSKQVTHA  213

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L Q L  G+PR+E+ ++++VY+EDES N+ LL FAKLDFN +Q  H++EL E  RWWK+L
Sbjct  214   LYQPLWKGMPRIEARHYLSVYQEDESNNETLLNFAKLDFNFVQKVHQKELSEITRWWKDL  273

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             DF T LP+ARDR VE YFWALGVYFE +Y  AR++ AK  ++ ++ DD YD  G  +EL+
Sbjct  274   DFATKLPFARDRVVEAYFWALGVYFEPEYYFARMISAKATSIITVIDDIYDVHGTYEELK  333

Query  1076  IFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVS  1255
              FT+AI++WDI   ++LP +MK+ Y  L++ F E ++ L+ +G S+ +HY +E  K  V 
Sbjct  334   SFTEAIERWDISAVDQLPDYMKVCYTALLNFFTEIEESLANKGISYRLHYAREGFKVQVR  393

Query  1256  SYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPRII  1432
             +Y  E KW  ++ TP + EY+   + +S  +++   SF+G+ + VT ++ +W    P+I+
Sbjct  394   AYFQEAKWFKQKYTPTLEEYMSVERYTS-FFMVAIVSFVGLGAIVTEDSMDWVFSEPKIL  452

Query  1433  EANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNE  1612
             +A +++ R++ND+  ++ E+    NA+ I+ YM  YG T EEA  +  + V  AWKD NE
Sbjct  453   KATSIIGRLMNDLVGHKFEQKREHNASAIECYMKQYGATEEEAEVELTKQVNEAWKDINE  512

Query  1613  DILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNS  1774
             + L   P  +   +L  ILNFAR  +++YK  +D YT+   VLK  + S+ + S
Sbjct  513   EWLEATP--IPRLLLSLILNFARTSELLYKG-EDVYTHSGNVLKGYVASLFIES  563



>emb|CAN82172.1| hypothetical protein VITISV_040547 [Vitis vinifera]
 gb|ADR74221.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score =   433 bits (1113),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 353/535 (66%), Gaps = 10/535 (2%)
 Frame = +2

Query  182   QFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLNFIDTME  355
             +F PS+WGD+F  +  ++EV+ R  +E QV  LK +V   L++  +   ++ LNFID ++
Sbjct  23    EFHPSIWGDQFIAYTPEDEVS-RACKEKQVEDLKEEVRRELMAA-AGNPSQLLNFIDAVQ  80

Query  356   RLGISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-  529
             RLG++YHF   I+E L++IY+  +      DDL   AL FRLLRQ GYNIS GIF+ F+ 
Sbjct  81    RLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCGIFNKFKD  140

Query  530   ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVR  709
             E G FK  L ++++G+L LYEA+HL+ H +  L+EA +F+ THL+     L   L +QV 
Sbjct  141   EKGSFKEDLISNIQGMLGLYEAAHLRVHGEDILEEALSFTTTHLKATVESLGYPLAEQVS  200

Query  710   HALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWK  889
             HAL   +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+EL    RWWK
Sbjct  201   HALKHPIRKGLERLEARWYISLYQDEASHDKTLLKLAKLDFNLVQSLHKEELSNLARWWK  260

Query  890   ELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDE  1069
             EL F T LP+ARDR VE YFW +GVYFE +Y  A  +L KII M ++ DD YD++G  +E
Sbjct  261   ELGFATKLPFARDRLVEGYFWIVGVYFEPQYLWAIRILTKIIVMTTVIDDIYDAYGTLEE  320

Query  1070  LEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKEL  1249
             ++ FT+AI++WDI   + LP++MK+ Y  L+D+++E ++E+ KE   + VHY  + +K  
Sbjct  321   IKHFTEAIERWDINSIDHLPKYMKLFYVALLDVYKEIEEEMEKERHQYRVHYAIDAMKNQ  380

Query  1250  VSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTREAFEWSSQNPR  1426
             V +Y  E KW  E+  P + EY++    SS   LL T+SF+GM   V++EAF+W   +P+
Sbjct  381   VRAYFAEAKWFHEQHIPTMEEYMRVALLSSGYSLLATSSFIGMGEIVSKEAFDWVISDPK  440

Query  1427  IIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDT  1606
             II A+T++AR ++D+ S++ E+     A+GI+ YM   GV+ E+A  +F   + NAW D 
Sbjct  441   IIRASTVIARFMDDMTSHKFEQERGHVASGIECYMKQCGVSEEQAYKEFHNQIVNAWMDI  500

Query  1607  NEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVN  1771
             N++ L+  P+AV   +L  +LN +R+ DV+YK + DGYT+  KV+K  I SVL++
Sbjct  501   NQECLK--PTAVPMPLLTRVLNLSRVMDVIYK-EGDGYTHVGKVMKDNIGSVLID  552



>ref|XP_011009443.1| PREDICTED: probable terpene synthase 6 isoform X1 [Populus euphratica]
Length=558

 Score =   433 bits (1113),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/523 (42%), Positives = 334/523 (64%), Gaps = 8/523 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F PSLWG  F  F F     E Y ++++VLK  V  ML++  +   AE + FI+ + RLG
Sbjct  23    FPPSLWGCSFASFSFPQTEFESYNRKVEVLKENVKDMLMA-STKDPAEHIEFINLLCRLG  81

Query  365   ISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-N  535
             +SYHF + I+  L+ I++  P+   +   DL T +LLFR+LRQHG+ I   +FD F++ N
Sbjct  82    VSYHFDDEIENSLKQIFDDLPDLLEKHDFDLYTVSLLFRVLRQHGFKIPCVVFDKFKDTN  141

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHA  715
             G+FK ++ NDVK +L LYEAS L  H +  L EA  ++K +LE    Q S  L   +R+A
Sbjct  142   GEFKKTIINDVKSILGLYEASFLGVHGEQVLDEALVYTKANLESSAMQSSPRLADHIRNA  201

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L +  H G+PR+E+  +I+ YEE+ES+ND LL+FAK+DFN +Q+ H+QEL    RWW +L
Sbjct  202   LIRPFHKGVPRIEARKYISFYEEEESRNDTLLKFAKIDFNRVQLLHQQELSILSRWWNDL  261

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             +F    PYARDR VE YFWA G++FE +Y+ +R+M  K   + S+ DDTYD++   +E++
Sbjct  262   NFAEEFPYARDRIVEIYFWANGIHFEPQYAFSRMMATKYTKIVSLVDDTYDAYASFEEIQ  321

Query  1076  IFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELV  1252
              FT+AI++  +   ++LP  +MK++YK L++LF E + ++ K+GRS+A +Y KE  KELV
Sbjct  322   RFTNAIERCSMNAIDQLPADYMKVLYKALLNLFNETENDMGKQGRSYASNYVKEAFKELV  381

Query  1253  SSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVT-REAFEWSSQNPRI  1429
               Y+ E +W  +   P   EY++NG A+S   +++ ASFLGM+ V   E +EW   NP+I
Sbjct  382   RGYHAEAEWADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKCNPKI  441

Query  1430  IEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTN  1609
             I+A  ++ R++NDI  +E E+     A+G++ YM  Y  + ++A+ + E+M  NAWKD N
Sbjct  442   IKAGKMIGRLMNDIVGHEDEQKRGDCASGVECYMKQYDASEKKAIEEIEKMDVNAWKDIN  501

Query  1610  EDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             ED +RP  + +   +L   +N  R+ DV+Y N  D YT P  +
Sbjct  502   EDCMRPTNAPML--LLQHFVNLIRVTDVIYGNDDDAYTIPSSL  542



>ref|XP_003614996.1| (+)-delta-cadinene synthase isozyme A [Medicago truncatula]
 gb|AES97954.1| sesquiterpene synthase [Medicago truncatula]
Length=553

 Score =   432 bits (1112),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 229/540 (42%), Positives = 339/540 (63%), Gaps = 10/540 (2%)
 Frame = +2

Query  182   QFSPSLWGDEFRYFVFDN-EVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMER  358
             +F P++WG+ F  +  ++ E+ +  A +I  LK +V +ML+S     LA KL  ID++ R
Sbjct  18    EFHPNVWGEYFIQYASESMELDQNIAAQIVTLKDEVRNMLLSKTEMPLA-KLTLIDSICR  76

Query  359   LGISYHFHEMIDEMLENIYNA---NPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ  529
             LG+SYHF   IDE+L++I+N+   N    L D L + A+LFR+LRQ G+ +S  +F  F+
Sbjct  77    LGVSYHFENEIDEVLQHIHNSCVENGEIILKDSLYSLAVLFRVLRQQGFYVSPNVFTKFK  136

Query  530   -ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQV  706
              E G F   L+ DV+G+L+LYEASH+  H +  L+EA  F+ THLE I  Q+S  L  QV
Sbjct  137   DEEGNFNKGLTTDVEGMLSLYEASHMIIHGEEILEEALAFTSTHLESIATQMSHFLAAQV  196

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
             ++AL Q+LH  +PR+E+  +I++YE++ S +++LL  AKLDFNLLQ  H++E     +WW
Sbjct  197   KYALRQALHKNLPRLEARRYISIYEQNPSHDEILLTLAKLDFNLLQSLHQKEFGNICKWW  256

Query  887   KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPD  1066
             KELDF + LPYAR R VEC FW L  YFE +YS AR +  K+I M SI DDTYD++G  D
Sbjct  257   KELDFSSKLPYARHRIVECCFWILTAYFEPQYSLARKLATKVIAMLSIIDDTYDAYGTID  316

Query  1067  ELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKE  1246
             ELE+FT AI++WDI   + LP +MK+IY TL ++FEE ++E+ KEG+ + + Y  + +K 
Sbjct  317   ELELFTKAIERWDISILDDLPDYMKLIYGTLWNIFEEIEQEMRKEGKLYTMKYFIKELKV  376

Query  1247  LVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREAFEWSSQNP  1423
              V  +  E +W  E+  P + EY+     S    LLI  S++GM ++ T   F W + +P
Sbjct  377   AVQGFITEARWLNEKYIPTIEEYMLKSTKSCAYTLLILTSYIGMGENTTENIFNWVTNDP  436

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
             +I+ A   L R++++I S E E       + +D YM  Y ++ E A+ +  + +  AWKD
Sbjct  437   KIVSAAANLCRLMDEIVSSEFEHKREHVCSLLDCYMKQYDMSREAAIQECHKGIAIAWKD  496

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              NE+ LR  P+ V    L+  LNF+R  DV YK+K D YT+ E ++K  +  VLV S  I
Sbjct  497   INEECLR--PTKVPMPFLIRALNFSRFMDVNYKDK-DNYTHSEGLMKKYVKEVLVESVPI  553



>ref|XP_009346480.1| PREDICTED: (-)-alpha-pinene synthase-like [Pyrus x bretschneideri]
Length=560

 Score =   433 bits (1113),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 232/556 (42%), Positives = 341/556 (61%), Gaps = 10/556 (2%)
 Frame = +2

Query  131   ILKMVTNNEVVRPVTSFQFSPSLWGDEF-RYFVFDNEVAERYAQEIQVLKGQVMSMLVSI  307
             +L      E+VRP  +F   PS+WGD F  Y   D     R  QEI  LK  V S +   
Sbjct  9     VLSTNAKPEIVRPTANF--PPSIWGDRFINYDSQDITTHARNKQEIDELKEVVRSEVFKT  66

Query  308   RSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNA-NPNFQLGDDLCTSALLFRLLR  484
              ++  + +L  ID ++RLG++YHF   I+E L+ ++   N +  +G DL   AL FRLLR
Sbjct  67    MASDFSHQLKLIDAIQRLGVAYHFASEIEETLKRMHGTFNDHEDVGGDLHIVALGFRLLR  126

Query  485   QHGYNISSGIFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL  661
             QHGYN+S  IF+ F++ NGKFK  L+ D+ G+L+LYEA+HL    +  L EA  F+ THL
Sbjct  127   QHGYNVSCDIFNKFKDANGKFKGCLTADIPGMLSLYEAAHLGVRGEDILDEALVFTTTHL  186

Query  662   EVIGP-QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNL  838
             E      +S  L +Q   AL++ L   + RV +  ++++Y+++ + N+ LL+ AKLDFNL
Sbjct  187   ESASTTNVSYQLTEQTTQALERPLQKDLERVCARCYMSIYQDEAAHNEALLKLAKLDFNL  246

Query  839   LQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIIT  1018
             +Q  HK+EL E  RWWK+LDF   LP+ARDR VE Y W +GVYFE +Y +AR  L K+I 
Sbjct  247   VQSLHKKELSEITRWWKDLDFEKKLPFARDRIVELYLWIVGVYFEPQYVRARKFLTKVIA  306

Query  1019  MASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSK  1198
             + S+ DD YD++   +ELEIFT AI++WD+   + LP +M+I Y TL+ +  E ++E+ K
Sbjct  307   LVSVMDDIYDAYATFEELEIFTGAIERWDMNCLDELPDYMQIFYHTLLSVIYEIEEEMVK  366

Query  1199  EGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM  1378
             EGRS+ V+YTKE +K +  +Y  E KW  E  TP + EY+     S+   +L T S +GM
Sbjct  367   EGRSYRVYYTKESLKGIARAYLEEAKWLNEGYTPTMEEYLPVAIVSTGYPMLSTVSLVGM  426

Query  1379  KS-VTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAE  1555
                VT+E FEW   + +I+ A+T L R I+D+ + + EK     A+ +D YM  YGV+ +
Sbjct  427   GDIVTKETFEWLFNDAKIVRASTTLFRFIDDMVTTKFEKERGHVASSVDCYMKQYGVSEQ  486

Query  1556  EAMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEK  1735
             E +  F + V N WKD NE+  R  P+AV   +L+ +LN  R+ D++YK  +DGYT+  K
Sbjct  487   ETIEVFNKQVVNLWKDINEEFHR--PTAVPMPVLMRVLNLTRVVDLLYKG-EDGYTHVGK  543

Query  1736  VLKPCIFSVLVNSFEI  1783
             V+K  I ++ V+   I
Sbjct  544   VVKDIIAALFVDPVPI  559



>gb|KDO74408.1| hypothetical protein CISIN_1g008427mg [Citrus sinensis]
Length=566

 Score =   433 bits (1113),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 233/554 (42%), Positives = 353/554 (64%), Gaps = 26/554 (5%)
 Frame = +2

Query  176   SFQFSPSLWGDEFRYFVFDN-----EVAERYAQEIQVLKGQVMSMLVSIRSA--KLAEKL  334
             S  + PS+WGD F     ++     EV +R+    + LK +V  +L+S  +A   + E +
Sbjct  21    SSNYHPSIWGDHFINVSSNDKYPNAEVEKRF----ETLKAEVEKLLMSNNTAWKTIEEIV  76

Query  335   NFIDTMERLGISYHFHEMIDEMLENIYNA------NPNFQLGDDLCTSALLFRLLRQHGY  496
               +D ++RLG++YHF   I E L++IYN+      + N+   +DL T AL FRLLRQHGY
Sbjct  77    TLVDQLQRLGVAYHFENEIKEDLQSIYNSHVNSNCDVNYDHNNDLYTVALRFRLLRQHGY  136

Query  497   NISSGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIG  673
              +S+ IF  F+ E G+FK+ L+ND +GLL LYEAS+L+   +  L+EA  FS+ HL+ + 
Sbjct  137   KVSADIFKKFKDEKGEFKAMLTNDARGLLCLYEASYLRVQGENILEEACEFSRKHLKSLL  196

Query  674   PQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDES-KNDVLLRFAKLDFNLLQMH  850
             P +S++L  QV H+L+  LH G+PR+E+  +I++YE D S +N+++L  AKLDFNLLQ  
Sbjct  197   PHISTSLANQVEHSLEIPLHRGMPRLEARQYISIYEADNSTRNELILELAKLDFNLLQEL  256

Query  851   HKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASI  1030
             H++EL E  RWWK++DF T LP+ARDR VECYFW LGVYFE KYS  R  + KII +AS+
Sbjct  257   HRRELSEISRWWKDIDFATKLPFARDRLVECYFWILGVYFEPKYSITRKFMTKIIAIASV  316

Query  1031  FDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEF-DKELSKEGR  1207
              DD YD +G  +EL++FT AI++W++   N LP++M++ Y  L+D+ +E  DK ++KE  
Sbjct  317   IDDIYDVYGTLEELKLFTHAIERWEVAAANELPKYMQVCYFALLDVVKEMEDKPVNKEPP  376

Query  1208  SFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMK--  1381
                +HY KE IK LV +Y +E KW   +  P   EY++N   SS   +L   + +G++  
Sbjct  377   G-CMHYAKEAIKGLVRAYFVEAKWFNAKYVPTFEEYMENSTMSSGYPMLAVEALVGLEDM  435

Query  1382  SVTREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEA  1561
             ++T++A +W+   P+II  ++L+AR+ +D+ +Y+ E+      + ++ YM  YGV+ EEA
Sbjct  436   AITKQALDWAISVPKIIRYSSLIARLDDDVRTYKVEQERGDAPSSVECYMQQYGVSEEEA  495

Query  1562  MNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVL  1741
              NK +EMVE  W + NE+I    P+    + LL  LN AR+  V+Y+N  DGYTN     
Sbjct  496   CNKIKEMVEIEWMNINEEIQD--PNHPPLQWLLPSLNLARMMVVLYQNG-DGYTNSSGKT  552

Query  1742  KPCIFSVLVNSFEI  1783
             K  I S+LV+   +
Sbjct  553   KDRIASLLVDPLPM  566



>ref|XP_011080334.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=539

 Score =   432 bits (1110),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/530 (40%), Positives = 337/530 (64%), Gaps = 4/530 (1%)
 Frame = +2

Query  188   SPSLWGDEFRYFVFD-NEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             +P++W + F     D N++ E+YAQ+I+ L  +  SML++ + +  AE L  IDT+ERLG
Sbjct  11    APTMWDNTFTSSSVDVNQLQEKYAQDIEELTEEARSMLIA-KGSTAAETLILIDTLERLG  69

Query  365   ISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ-ENGK  541
             ++YHF + I++ L+ I+  +   +   DL T+AL FRLLRQH Y +SS +FD F+ E+ +
Sbjct  70    VAYHFEQEIEDQLQEIFQFHSKNENHYDLFTTALQFRLLRQHRYFVSSSVFDKFKNEDNE  129

Query  542   FKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHALD  721
             FK +L +DVKGLL+LYEA+ L+ H +  L+EA  F+  HL+++  QL   L  QV+ AL 
Sbjct  130   FKETLKSDVKGLLSLYEAAQLRIHGETILEEAVAFTTHHLKLMLQQLECPLQDQVKRALQ  189

Query  722   QSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKELDF  901
              SLH G+PR+++ +FI+ YE D+S N +LL+ A+LDFN LQ  +K+E ++  RWW E D 
Sbjct  190   HSLHRGVPRIQTRHFISFYETDDSNNQLLLKLARLDFNYLQNLYKKEFHDLTRWWNEFDL  249

Query  902   VTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELEIF  1081
              + LPYARDR VE YFW + ++F+ + S AR+ +AK + M +  +DTYDS+   ++  +F
Sbjct  250   KSKLPYARDRLVEAYFWGIALHFKPQDSYARVDIAKSVQMLTTINDTYDSYATLEDAHLF  309

Query  1082  TDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELVSSY  1261
             T+ +++WD+ + NRLP +MKI+YK L+ ++++++ E SK+ +S+AV Y KE +K+L  +Y
Sbjct  310   TEILERWDVNEINRLPNYMKIVYKFLLSIYDDYEVEASKQAKSYAVCYAKETMKQLCKAY  369

Query  1262  NIEVKWCTERC-TPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAFEWSSQNPRIIEA  1438
             +  +KW   +   P   EY+ N   +S +Y+L++ +    KS  +E  +W    P+I+ A
Sbjct  370   DKVLKWAMGQVQIPTFEEYVANMMVTSCVYVLLSPTISAAKSAPKETIDWLMGEPKIVAA  429

Query  1439  NTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNEDI  1618
                + R +ND+ SYERE         +  YM  YGV+ EEA++KF E VE+AWKD N + 
Sbjct  430   AAKIGRYLNDLGSYERESKGGNLPVAVRCYMKQYGVSKEEALDKFVEQVEDAWKDLNTEW  489

Query  1619  LRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLV  1768
             +          +   +L +AR  ++ Y+N +DG TNPEK     +  +L+
Sbjct  490   ITQTSILGRDIVAEQLLTYARAAEITYENCEDGITNPEKYTALFVDPILI  539



>ref|XP_011009444.1| PREDICTED: probable terpene synthase 6 isoform X2 [Populus euphratica]
Length=558

 Score =   432 bits (1112),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/523 (42%), Positives = 334/523 (64%), Gaps = 8/523 (2%)
 Frame = +2

Query  185   FSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDTMERLG  364
             F PSLWG  F  F F     E Y ++++VLK  V  ML++  +   AE + FI+ + RLG
Sbjct  23    FPPSLWGCSFASFSFPQTEFESYNRKVEVLKENVKDMLMA-STKDPAEHIEFINLLCRLG  81

Query  365   ISYHFHEMIDEMLENIYNANPNF--QLGDDLCTSALLFRLLRQHGYNISSGIFDNFQE-N  535
             +SYHF + I+  L+ I++  P+   +   DL T +LLFR+LRQHG+ I   +FD F++ N
Sbjct  82    VSYHFDDEIENSLKQIFDDLPDLLEKHDFDLYTVSLLFRVLRQHGFKIPCVVFDKFKDTN  141

Query  536   GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQVRHA  715
             G+FK ++ NDVK +L LYEAS L  H +  L EA  ++K +LE    Q S  L   +R+A
Sbjct  142   GEFKKTIINDVKSILGLYEASFLGVHGEQVLDEALVYTKANLESSAMQSSPRLADHIRNA  201

Query  716   LDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWWKEL  895
             L +  H G+PR+E+  +I+ YEE+ES+ND LL+FAK+DFN +Q+ H+QEL    RWW +L
Sbjct  202   LIRPFHKGVPRIEARKYISFYEEEESRNDTLLKFAKIDFNRVQLLHQQELSILSRWWNDL  261

Query  896   DFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPDELE  1075
             +F    PYARDR VE YFWA G++FE +Y+ +R+M  K   + S+ DDTYD++   +E++
Sbjct  262   NFAEEFPYARDRIVEIYFWANGIHFEPQYAFSRMMATKYTKIVSLVDDTYDAYASFEEIQ  321

Query  1076  IFTDAIQKWDIRQTNRLPR-FMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKELV  1252
              FT+AI++  +   ++LP  +MK++YK L++LF E + ++ K+GRS+A +Y KE  KELV
Sbjct  322   RFTNAIERCSMNAIDQLPADYMKVLYKALLNLFNETENDMGKQGRSYASNYVKEAFKELV  381

Query  1253  SSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVT-REAFEWSSQNPRI  1429
               Y+ E +W  +   P   EY++NG A+S   +++ ASFLGM+ V   E +EW   NP+I
Sbjct  382   RGYHAEAEWADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKCNPKI  441

Query  1430  IEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTN  1609
             I+A  ++ R++NDI  +E E+     A+G++ YM  Y  + ++A+ + E+M  NAWKD N
Sbjct  442   IKAGKMIGRLMNDIVGHEDEQKRGDCASGVECYMKQYDASEKKAIEEIEKMDVNAWKDIN  501

Query  1610  EDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
             ED +RP  + +   +L   +N  R+ DV+Y N  D YT P  +
Sbjct  502   EDCMRPTNAPML--LLQHFVNLIRVTDVIYGNDDDAYTIPSSL  542



>ref|XP_002274445.2| PREDICTED: valencene synthase-like [Vitis vinifera]
Length=559

 Score =   432 bits (1111),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 232/552 (42%), Positives = 352/552 (64%), Gaps = 18/552 (3%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYA-----QEIQVLKGQVMSMLVSI  307
             V N    R   ++Q  PS+WG+ F   +  N   +        Q+++ LK  V+  L++ 
Sbjct  16    VANPGTNRRTANYQ--PSIWGNSF---IVSNTPEDEITLAHKEQQLEDLKEVVIRELIAA  70

Query  308   RSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIY-NANPNFQLGDDLCTSALLFRLLR  484
              S  L E+L FID ++RLG++YHF + I+E L+N Y N +    + DDL   AL FRL R
Sbjct  71    ASHPL-EQLKFIDAVQRLGVAYHFEKEIEEALQNTYDNYHCIDDINDDLYDVALRFRL-R  128

Query  485   QHGYNISSGIFDNF-QENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHL  661
             Q G+NIS  IF+ F  E G+FK +L +DV+G+L LYEA+HL+ H +  L +A  F+ THL
Sbjct  129   QQGFNISCDIFNKFTDERGRFKEALISDVRGMLGLYEAAHLRVHGEDILAKALAFTTTHL  188

Query  662   EVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLL  841
             + +   L   L +QV HAL++ +  G+ R+E+ ++I+VY+++   +  LL   KLDFNL+
Sbjct  189   KAMVESLGYHLAEQVAHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELGKLDFNLV  248

Query  842   QMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITM  1021
             Q  HK+EL    RWWKELDF T LP+ARDR VE YFW  GVYFE +Y + R +L K+I M
Sbjct  249   QSLHKEELSNLARWWKELDFATKLPFARDRLVEGYFWMHGVYFEPQYLRGRRILTKVIAM  308

Query  1022  ASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKE  1201
              SI DD +D++G P+EL++F +AI++WDI   N+LP +MK+ Y  L+D+++E ++E+ KE
Sbjct  309   TSILDDIHDAYGTPEELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEEEMEKE  368

Query  1202  GRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMK  1381
             G  + VHY KE +K  V +Y  E KW  E   P   EY++   ASS   LL T SF+GM 
Sbjct  369   GNQYRVHYAKEVMKNQVRAYFAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMG  428

Query  1382  SV-TREAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEE  1558
              + T+EAF+W + +P+I+ ++  + R+++DI S++ E+     A+ ++ YM  YGV+ E+
Sbjct  429   EIATKEAFDWVTSDPKIMSSSNFITRLMDDIKSHKFEQKRGHVASAVECYMKQYGVSEEQ  488

Query  1559  AMNKFEEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKV  1738
               ++F + +ENAW D N++ L+  P+AVS  +L  +LN  R  DV+YK +QD YT+  KV
Sbjct  489   VYSEFRKQIENAWLDINQECLK--PTAVSMPLLARLLNLTRTMDVIYK-EQDSYTHVGKV  545

Query  1739  LKPCIFSVLVNS  1774
             ++  I SV +N+
Sbjct  546   MRDNIASVFINA  557



>ref|XP_002274781.1| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CAN64791.1| hypothetical protein VITISV_001915 [Vitis vinifera]
 gb|ADR74227.1| alpha-humulene synthase [synthetic construct]
Length=555

 Score =   432 bits (1111),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 232/544 (43%), Positives = 353/544 (65%), Gaps = 18/544 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV   ++ P++WGD+F     ++EV  R  +E Q+  LK ++   L++  +   +++L 
Sbjct  19    RPVV--KYHPNIWGDQFLSHTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQQLK  74

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL----CTSALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  75    FIDAVQRLGLAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNIS  131

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+   +  L EA  F+ THL  +   L
Sbjct  132   CGLFNEFKDEKGNFKKALISDVRGMLGLYEAAHLRVRGEDILDEALAFTTTHLRSMVEHL  191

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                  +QV HAL Q +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+E
Sbjct  192   EYPFAEQVVHALKQPIRRGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEE  251

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWK+LDF T LP+ARDR VECYFW LG YFE +Y  AR +L K I + S  DD 
Sbjct  252   LSNISRWWKKLDFATKLPFARDRLVECYFWILGFYFEPQYVWARRILTKTIALTSTMDDI  311

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD++G  +EL++FT AI++WDI   + LP +MK  Y  L+D+++E ++E+ KEG  + V 
Sbjct  312   YDAYGTFEELKLFTAAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQ  371

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREA  1399
             Y  E +K    +Y  E KW  E   P V EY+   Q SS   +L   SF+GM K VT+EA
Sbjct  372   YAIEAMKNQARAYFHEAKWLHEGRIPTVEEYMSVAQVSSGDSMLTITSFIGMGKIVTKEA  431

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W   NP+I+ A+++++R+++DI S++ E+     A+G++ YM  YG + EE  +KF++
Sbjct  432   FDWVITNPKIVTASSVISRLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQK  491

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              VE+A KD NE+ LR  P+AV   +L+ +LN +R+  V+Y    DGYT+  KV+K  + S
Sbjct  492   QVEDACKDINEEFLR--PTAVPMPLLMRVLNLSRVMYVIYTGG-DGYTHVGKVMKNNVAS  548

Query  1760  VLVN  1771
             +L++
Sbjct  549   LLIH  552



>ref|XP_002306399.2| hypothetical protein POPTR_0005s09830g [Populus trichocarpa]
 gb|EEE93395.2| hypothetical protein POPTR_0005s09830g [Populus trichocarpa]
Length=550

 Score =   432 bits (1111),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 224/542 (41%), Positives = 340/542 (63%), Gaps = 14/542 (3%)
 Frame = +2

Query  182   QFSPSLWGDEFRYFV----FDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEKLNFIDT  349
             +F PS+WGD   YF+     D  +   + +E++VLK +V +ML S  + K +EKL  +D 
Sbjct  17    EFHPSVWGD---YFINKTPCDEMLFSAWIKEVEVLKEEVRTMLTSA-TLKPSEKLKLMDI  72

Query  350   MERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSGIFDNFQ  529
             + RLGI YHF   I++++E+ YN        DDL T AL FRLLRQ+GYN+SS IF+ F+
Sbjct  73    VLRLGIGYHFEGEINDIIEHAYNTYHGNNFDDDLFTVALRFRLLRQYGYNVSSDIFNEFK  132

Query  530   EN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSSTLGKQV  706
             +  G FK +L +DV+GLL+LYEAS L GH +  L +A +F KTHLE     L S L  +V
Sbjct  133   DGKGNFKDNLIDDVEGLLSLYEASFLGGHGEDTLDKALSFCKTHLESAVAHLVSPLADKV  192

Query  707   RHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQELYEHMRWW  886
              HAL + L  G+P+ E  + I +Y++DE+    +L+ AKLDFN++Q  ++ EL    RWW
Sbjct  193   SHALKRPLLKGVPKHEQWHHILIYQQDEACTGAVLKLAKLDFNVVQKCYQDELRIISRWW  252

Query  887   KELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDTYDSFGKPD  1066
              +LDF T LP+ARDR +EC+FW LG + E ++  AR  + K++   SI DD YD  G  +
Sbjct  253   IDLDFATKLPFARDRVIECFFWGLGAFLEPQFVLARRFITKVLIFLSILDDIYDVHGTIE  312

Query  1067  ELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVHYTKERIKE  1246
             ELE+FT+ I++WD    + LP +MK+ ++ LI  F+E ++E  KEGR + VHY++E +K 
Sbjct  313   ELELFTEKIERWDTSMED-LPDYMKLFFEALIGFFDEIEQETGKEGRPYCVHYSREMLKN  371

Query  1247  LVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREAFEWSSQNP  1423
                +Y IE +W  + C P + EY + G  +S   +   A   GM ++ ++E FEW  +NP
Sbjct  372   QARAYLIEARWFNQDCVPQLEEYRRGGVYTSCYPMAAVAWLCGMAETGSKEVFEWMLKNP  431

Query  1424  RIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEMVENAWKD  1603
             +I+ A++ + R+++DI S+E E+     A+ ++  M  YGV+ +EA +   +MVE+ WKD
Sbjct  432   KIVVASSDIGRLMDDITSHEFEQERGHVASAVECCMKQYGVSKKEAYDMLNKMVESDWKD  491

Query  1604  TNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
              NE++L+  PS V  ++L+ +LN ARI DVVYK+  DGYT  +   K  + + LV+   +
Sbjct  492   INEELLK--PSTVPRQVLILMLNLARIIDVVYKD-YDGYTEAKNATKEMLTAFLVDPLPV  548

Query  1784  *A  1789
              A
Sbjct  549   VA  550



>ref|XP_002283070.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CAN76781.1| hypothetical protein VITISV_000919 [Vitis vinifera]
 emb|CBI20476.3| unnamed protein product [Vitis vinifera]
 gb|ADR74226.1| cubebol/delta-cadinene synthase [synthetic construct]
Length=559

 Score =   432 bits (1110),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 228/549 (42%), Positives = 350/549 (64%), Gaps = 10/549 (2%)
 Frame = +2

Query  149   NNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAE-RYAQEIQVLKGQVMSMLVSIRSAKLA  325
             N EV R   S  F P  WGD F  +  D+ V   R  Q+I+ LK ++ + L +  + K +
Sbjct  17    NPEVAR--RSANFRPCFWGDRFLTYTPDDPVTHARKVQQIEELKDELRNELKAT-ARKSS  73

Query  326   EKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSA-LLFRLLRQHGYNI  502
             + LNFID+++RLG++Y F   I E LE++Y         +D  T+A L FRLLRQ GY+I
Sbjct  74    QLLNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLTNASLRFRLLRQEGYHI  133

Query  503   SSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQ  679
                +F+ F+++ G FK SL+ D+ GLL LYEA+HL  H +A L+EA  FS  HL+ +   
Sbjct  134   PPDVFNKFKDDEGNFKESLTGDLPGLLALYEATHLMAHGEAILEEALAFSTAHLQSMATD  193

Query  680   LSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQ  859
              +  L  QV  AL + +   + RVE+ ++I+VY+ED   N  LL+ +KLDFNLLQ  H++
Sbjct  194   STHPLPAQVTRALKRPIRKCLTRVEARHYISVYQEDGPHNKTLLKLSKLDFNLLQSLHRK  253

Query  860   ELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDD  1039
             EL E  RWWK L+F   +P+ARDR VE YFW LGVYFE +YS AR +L K++ M SI DD
Sbjct  254   ELSEVTRWWKGLNFAKKMPFARDRLVEGYFWILGVYFEPQYSLARRILIKVLAMISIIDD  313

Query  1040  TYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAV  1219
              YD++G  +EL++FT+AI++WD    ++LP +MK  Y+ L+D++EE ++E++KEG  + V
Sbjct  314   IYDAYGTFEELKLFTEAIERWDASSVDQLPDYMKPCYQALLDVYEEMEEEIAKEGNLYRV  373

Query  1220  HYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSV-TRE  1396
              Y K  I+  + +Y +E KW  +  TP + EY+ N   SS   +LIT SF+GM  + T+E
Sbjct  374   QYAKAAIQRQIQAYFVEAKWLNQEYTPTLDEYMSNALVSSGYSMLITTSFVGMGDIATKE  433

Query  1397  AFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFE  1576
             AF+W   +P+++ A++++ R+++DI S+E E+     A+ ++ YM   GV  +EA ++  
Sbjct  434   AFDWVFSDPKMVRASSVICRLMDDIVSHEFEQKRGHVASAVECYMKQRGVCKQEAYDELN  493

Query  1577  EMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIF  1756
             + V N WKD NE+ L+  P+ V   +L  +LNF+R+ D++YK+ +D YT+  K++K  I 
Sbjct  494   KQVVNGWKDMNEECLK--PTQVPMPLLTRVLNFSRVIDILYKD-EDQYTHVGKLMKDLIA  550

Query  1757  SVLVNSFEI  1783
             S+L++   I
Sbjct  551   SILIDLVPI  559



>emb|CAN62603.1| hypothetical protein VITISV_009665 [Vitis vinifera]
Length=587

 Score =   432 bits (1112),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 226/550 (41%), Positives = 345/550 (63%), Gaps = 9/550 (2%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVA-ERYAQEIQVLKGQVMSMLVSIRSAK  319
             V + EV R  ++  + P++WGD F  +  D+ V  E  AQ+I+ LK +V   L +  + K
Sbjct  16    VHHQEVAR--STANYPPNIWGDRFLTYAPDDTVTQECKAQKIKELKEEVRKELKA-SAHK  72

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
               E L  ID+++ LG++YHF   I+E L+++Y         +DL  ++L FRLLRQ GY 
Sbjct  73    SPELLKLIDSIQLLGLTYHFEREIEEALKDMYGTYSLVDDNEDLTNASLRFRLLRQEGYX  132

Query  500   ISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             + S +F  F++  G FK SL  D+ G+L LYEA+HL  H +  L+EA  F+  HL+ +  
Sbjct  133   VPSDVFSKFKDKEGNFKXSLIGDLPGMLALYEATHLMVHGEDILEEALAFTTAHLQSVAT  192

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
               ++ L KQV  AL  S+HNG+  V + ++I++Y+ED S N+ LL+ AKLDFNLLQ  H+
Sbjct  193   DPNNPLSKQVIRALKLSIHNGVTSVGARHYISIYQEDGSHNESLLKLAKLDFNLLQSLHR  252

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL E  RWWK LDF T LP+ARDR VE YF ALGV FE +YS +   L K+  M ++ D
Sbjct  253   KELSEITRWWKGLDFATKLPFARDRLVEIYFSALGVCFEPQYSLSLRFLTKVAIMITMVD  312

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  +EL + T+AI++WD    ++LP +MK  Y+ L+DL+EE ++E++KEG+ + 
Sbjct  313   DIYDAYGTIEELTLLTEAIERWDASSIDQLPDYMKCFYRALLDLYEEMEQEMAKEGKLYR  372

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTR  1393
             VHY KE +K+ + SY +E KW  +   P   EY+ NG  S    LLI  SF+GM   VT+
Sbjct  373   VHYAKELMKKQIQSYFVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTK  432

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             E+F+W    P +I A+ ++ R+++D+AS+E E+     A+ ++ YM  YGV+ +EA ++ 
Sbjct  433   ESFQWVLSRPTMIGASQIICRLMDDMASHEFEQKRVHVASSVECYMKQYGVSKQEAYDEL  492

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
              + V  AWKD N++ L+P P  V   I+  +LN AR+ +++YK+  D +T+  K  K  I
Sbjct  493   NKQVVKAWKDINQECLKPTP--VLMPIITRVLNIARMMNILYKDG-DEFTHVGKQRKDLI  549

Query  1754  FSVLVNSFEI  1783
              S+L++   I
Sbjct  550   ASILIDPVPI  559



>ref|XP_008388200.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=553

 Score =   431 bits (1109),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 236/542 (44%), Positives = 344/542 (63%), Gaps = 11/542 (2%)
 Frame = +2

Query  152   NEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLKGQVMSMLVSIRSAKLAEK  331
             N+   P  S  FSPS+WGD F  +    EV     Q +Q LK +V   L++     +++K
Sbjct  15    NDTFDPKPSATFSPSIWGDHFLSYA-SLEVDXELEQHVQELKEEVRXXLMT-SXENVSQK  72

Query  332   LNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYNISSG  511
             LN ID ++RLG+SYHF   I+E+L+ I+ ++ N    DDL T AL FRLLRQ GYN+S  
Sbjct  73    LNLIDDIQRLGVSYHFGNEIEEILQKIHKSSYNL---DDLYTVALRFRLLRQQGYNVSCD  129

Query  512   IFDNFQE-NGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQLSS  688
             +F+  ++ +GKFK SL +DV GLL+LYEA+H + H +  L EA TF+ T LE    +LS 
Sbjct  130   LFNKLKDGDGKFKESLVDDVVGLLSLYEATHHRIHGEEILDEALTFTTTXLEXXXXRLSP  189

Query  689   TLGKQVRHALDQSLHNGIPRVESSYFITVYEE-DESKNDVLLRFAKLDFNLLQMHHKQEL  865
              L K V HAL+Q L  G+PRVE+ Y+++VYEE  ES N+ LL FAKLDFN LQ  H++EL
Sbjct  190   PLAKXVTHALNQXLRKGLPRVEARYYLSVYEELRESPNETLLTFAKLDFNRLQRVHQKEL  249

Query  866   YEHMRWWKELDFVTTLPYARDRAVECYF-WALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
              E  RWWK+LD    LP+ARDR VE YF W++ VYF+ +YS AR    K+  + SI DD 
Sbjct  250   SEITRWWKDLDVPNKLPFARDRLVEVYFCWSMSVYFQPQYSFARRTSCKVTAITSIMDDI  309

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD+ GK +ELE+FT+A+ +WD+   ++LP +MK+ Y+ L++++ E  ++L+ EG+ + + 
Sbjct  310   YDTHGKFEELELFTEALXRWDVSAIDQLPEYMKLCYRALLNIYSEIHEKLAHEGKLYRID  369

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKSVTREAF  1402
             + +E +K  V  +  E K   +   P + EY+     +    LLIT SF+GM+  T ++F
Sbjct  370   HAREAMKNQVRGFFDEAKXFRQNHMPSLDEYMSVSLMTCGYPLLITTSFVGMEEATIDSF  429

Query  1403  EWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEEM  1582
             +W   +P+ ++A + + R+++DIA ++ E+     A+ ++ YM  YG T EEA+ +    
Sbjct  430   DWLLTSPQAVKAASTVTRLMDDIADHKLEQEREHFASAVNCYMRKYGATEEEAIIELRRQ  489

Query  1583  VENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSV  1762
             V NAWKD NE  L   P+AV+  +L+ ILNFAR+ DVVYK  +DGY N +  LK  I S 
Sbjct  490   VNNAWKDINEACLH--PTAVAMPLLIRILNFARVMDVVYKC-EDGYNNADGGLKDFIVST  546

Query  1763  LV  1768
             LV
Sbjct  547   LV  548



>emb|CBI31294.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   432 bits (1112),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 232/544 (43%), Positives = 353/544 (65%), Gaps = 18/544 (3%)
 Frame = +2

Query  164   RPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQV--LKGQVMSMLVSIRSAKLAEKLN  337
             RPV   ++ P++WGD+F     ++EV  R  +E Q+  LK ++   L++  +   +++L 
Sbjct  48    RPVV--KYHPNIWGDQFLSHTPEDEVT-RACKEKQLEDLKEEIRRKLMNT-AGNTSQQLK  103

Query  338   FIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDL----CTSALLFRLLRQHGYNIS  505
             FID ++RLG++YHF   I+E+L++IY++ PN   GDD+       AL FRLLRQ G+NIS
Sbjct  104   FIDAVQRLGLAYHFEREIEEVLQHIYDSYPN---GDDMEGDIYNVALQFRLLRQAGFNIS  160

Query  506   SGIFDNFQ-ENGKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGPQL  682
              G+F+ F+ E G FK +L +DV+G+L LYEA+HL+   +  L EA  F+ THL  +   L
Sbjct  161   CGLFNEFKDEKGNFKKALISDVRGMLGLYEAAHLRVRGEDILDEALAFTTTHLRSMVEHL  220

Query  683   SSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHKQE  862
                  +QV HAL Q +  G+ R+E+ ++I++Y+++ S +  LL+ AKLDFNL+Q  HK+E
Sbjct  221   EYPFAEQVVHALKQPIRRGLERLEARWYISIYQDETSHDRTLLKLAKLDFNLVQSLHKEE  280

Query  863   LYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFDDT  1042
             L    RWWK+LDF T LP+ARDR VECYFW LG YFE +Y  AR +L K I + S  DD 
Sbjct  281   LSNISRWWKKLDFATKLPFARDRLVECYFWILGFYFEPQYVWARRILTKTIALTSTMDDI  340

Query  1043  YDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFAVH  1222
             YD++G  +EL++FT AI++WDI   + LP +MK  Y  L+D+++E ++E+ KEG  + V 
Sbjct  341   YDAYGTFEELKLFTAAIERWDINSIDHLPEYMKHFYVALLDVYKEIEEEMEKEGNQYRVQ  400

Query  1223  YTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGM-KSVTREA  1399
             Y  E +K    +Y  E KW  E   P V EY+   Q SS   +L   SF+GM K VT+EA
Sbjct  401   YAIEAMKNQARAYFHEAKWLHEGRIPTVEEYMSVAQVSSGDSMLTITSFIGMGKIVTKEA  460

Query  1400  FEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKFEE  1579
             F+W   NP+I+ A+++++R+++DI S++ E+     A+G++ YM  YG + EE  +KF++
Sbjct  461   FDWVITNPKIVTASSVISRLMDDITSHKFEQKRGHVASGVECYMKQYGASEEEVYDKFQK  520

Query  1580  MVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFS  1759
              VE+A KD NE+ LR  P+AV   +L+ +LN +R+  V+Y    DGYT+  KV+K  + S
Sbjct  521   QVEDACKDINEEFLR--PTAVPMPLLMRVLNLSRVMYVIYTGG-DGYTHVGKVMKNNVAS  577

Query  1760  VLVN  1771
             +L++
Sbjct  578   LLIH  581



>ref|XP_007021121.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12646.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=586

 Score =   432 bits (1111),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/597 (40%), Positives = 363/597 (61%), Gaps = 50/597 (8%)
 Frame = +2

Query  110   LEQQTSEIL----KMVTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVAERYAQEIQVLK  277
             +  Q S++L      +++N   RP   F   P +WGD F     D ++      + + LK
Sbjct  1     MASQVSQVLASTHNAISSNTENRPKADFH--PGIWGDVF-LNCPDKDIDATTELQYEELK  57

Query  278   GQVMSMLVSIRSAKLAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCT  457
              +V   L++       +KL  ID ++RLG++YHF + I++ LE IY+ + +    +DL T
Sbjct  58    EEVRRTLLAPMDDS-NQKLPLIDAVQRLGVNYHFEKEIEDALEQIYHDDND---ANDLYT  113

Query  458   SALLFRLLRQHGYNISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKE  634
             +AL FR+LR+HG+++S   F+ F+++ G FKSSL++DV+GLL LYEAS+L+ H +  L +
Sbjct  114   TALRFRILREHGFDVSCDAFNKFKDDKGNFKSSLTSDVRGLLELYEASYLRVHGEDLLDD  173

Query  635   AYTFSKTHLEVIGPQLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLR  814
             A +F+ THL ++ P L   L +QV HAL QS+  G+PRVE+  +I++Y++DES N  LL+
Sbjct  174   AISFATTHLTLVAPTLDYPLSEQVTHALKQSIRRGLPRVEARQYISLYQDDESHNKALLQ  233

Query  815   FAKLDFNLLQMHHKQELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKAR  994
             FAK+DFNLLQ+ H++EL E   WWK+LDF   LP+ARDR VE YFW +GVYFE +YS  R
Sbjct  234   FAKIDFNLLQLLHRKELSEICWWWKDLDFTKKLPFARDRVVEGYFWIMGVYFEPQYSLGR  293

Query  995   LMLAKIITMASIFDDTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFE  1174
              ML K+I MASI DDTYDS+G  DEL ++TDAI++WDI   ++LP +MKI YK L+D++E
Sbjct  294   RMLTKVIAMASIVDDTYDSYGTYDELILYTDAIERWDIECIDQLPDYMKISYKALLDVYE  353

Query  1175  EFDKELSKEGRSFAVHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLL  1354
             E ++ L +  + + V Y K+ +  L  +Y +E KW  E   P   EY  N   +S   +L
Sbjct  354   EMEQLLEQVNK-YRVEYAKKAMIRLAQAYLLEAKWMHENYKPTFEEYKSNALPTSGYAML  412

Query  1355  ITASFLGMKS-VTREAFEWSSQNPRIIEANTLLARVINDIAS----YEREKYNRVNA---  1510
                +F+GM   VT+E F W++ +P II A+T++ R ++DIA     Y   K +R  A   
Sbjct  413   AITAFVGMGDVVTQETFNWAANDPNIIRASTIICRFMDDIAEHKHYYPEFKPSRGRAAYL  472

Query  1511  --------------------------TGIDYYMNDYGVTAEEAMNKFEEMVENAWKDTNE  1612
                                       + I+ YM  YGV+A+EA ++F + +E++WKD N+
Sbjct  473   PSIRVSNTTRNVLYGWQFNQKREDDCSAIECYMEQYGVSAQEAYDEFNKHIESSWKDINK  532

Query  1613  DILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCIFSVLVNSFEI  1783
             + L+  P+ +   +L   LN AR+ DV+Y++  DGYT+  K  K  I S+L++   +
Sbjct  533   EFLK--PTEMPVRVLNRSLNLARVMDVLYRDG-DGYTHVGKAAKGGITSLLIDPVPL  586



>emb|CBI20174.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   431 bits (1109),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 225/546 (41%), Positives = 344/546 (63%), Gaps = 9/546 (2%)
 Frame = +2

Query  143   VTNNEVVRPVTSFQFSPSLWGDEFRYFVFDNEVA-ERYAQEIQVLKGQVMSMLVSIRSAK  319
             V + EV R  ++  + P++WGD F  +  D+ V  E  AQ+I+ LK +V   L +  + K
Sbjct  16    VHHQEVAR--STANYPPNIWGDRFLTYAPDDTVTQECKAQKIKELKEEVRKELKA-SAHK  72

Query  320   LAEKLNFIDTMERLGISYHFHEMIDEMLENIYNANPNFQLGDDLCTSALLFRLLRQHGYN  499
               E L  ID+++ LG++YHF   I+E L+++Y         +DL  ++L FRLLRQ GY 
Sbjct  73    SPELLKLIDSIQLLGLTYHFEREIEEALKDMYGTYSLVDDNEDLTNASLRFRLLRQEGYG  132

Query  500   ISSGIFDNFQEN-GKFKSSLSNDVKGLLNLYEASHLKGHNDANLKEAYTFSKTHLEVIGP  676
             + S +F  F++  G FK SL  D+ G+L LYEA+HL  H +  L+EA  F+  HL+ +  
Sbjct  133   VPSDVFSKFKDKEGNFKESLIGDLPGMLALYEATHLMVHGEDILEEALAFTTAHLQSVAT  192

Query  677   QLSSTLGKQVRHALDQSLHNGIPRVESSYFITVYEEDESKNDVLLRFAKLDFNLLQMHHK  856
               ++ L KQV  AL  S+HNG+  V + ++I++Y+ED S N+ LL+ AKLDFNLLQ  H+
Sbjct  193   DPNNPLSKQVIRALKLSIHNGVTSVGARHYISIYQEDGSHNESLLKLAKLDFNLLQSLHR  252

Query  857   QELYEHMRWWKELDFVTTLPYARDRAVECYFWALGVYFEAKYSKARLMLAKIITMASIFD  1036
             +EL E  RWWK LDF T LP+ARDR VE YF ALGV FE +YS +   L K+  M ++ D
Sbjct  253   KELSEITRWWKGLDFATKLPFARDRLVEIYFSALGVCFEPQYSLSLRFLTKVAIMITMVD  312

Query  1037  DTYDSFGKPDELEIFTDAIQKWDIRQTNRLPRFMKIIYKTLIDLFEEFDKELSKEGRSFA  1216
             D YD++G  +EL + T+AI++WD    ++LP +MK  Y+ L+DL+EE ++E++KEG+ + 
Sbjct  313   DIYDAYGTIEELTLLTEAIERWDASSIDQLPDYMKCFYRALLDLYEEMEQEMAKEGKLYR  372

Query  1217  VHYTKERIKELVSSYNIEVKWCTERCTPPVAEYIKNGQASSTLYLLITASFLGMKS-VTR  1393
             VHY KE +K+ + SY +E KW  +   P   EY+ NG  S    LLI  SF+GM   VT+
Sbjct  373   VHYAKELMKKQIQSYFVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTK  432

Query  1394  EAFEWSSQNPRIIEANTLLARVINDIASYEREKYNRVNATGIDYYMNDYGVTAEEAMNKF  1573
             E+F+W    P +I A+ ++ R+++D+AS+E E+     A+ ++ YM  YGV+ +EA ++ 
Sbjct  433   ESFQWVLSRPTMIGASQIICRLMDDMASHEFEQKRVHVASSVECYMKQYGVSKQEAYDEL  492

Query  1574  EEMVENAWKDTNEDILRPIPSAVSTEILLCILNFARIDDVVYKNKQDGYTNPEKVLKPCI  1753
              + V  AWKD N++ L+P P  V   I+  +LN AR+ +++YK+  D +T+  K  K  I
Sbjct  493   NKQVVKAWKDINQECLKPTP--VLMPIITRVLNIARMMNILYKDG-DEFTHVGKQRKDLI  549

Query  1754  FSVLVN  1771
              S+L++
Sbjct  550   ASILID  555



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5838964890442