BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21549_g1_i3 len=5734 path=[5919:0-3056 @8976@!:3057-3681
12522:3682-3682 @9601@!:3683-5442 38:5443-5612 12597:5613-5615
11532:5616-5733]

Length=5734
                                                                      Score     E

ref|XP_009777756.1|  PREDICTED: uncharacterized protein LOC104227...   1392   0.0      
ref|XP_009777758.1|  PREDICTED: uncharacterized protein LOC104227...   1391   0.0      
ref|XP_009588935.1|  PREDICTED: uncharacterized protein LOC104086...   1382   0.0      
ref|XP_009588932.1|  PREDICTED: uncharacterized protein LOC104086...   1382   0.0      
ref|XP_004241561.1|  PREDICTED: uncharacterized protein LOC101248307   1359   0.0      
ref|XP_009594415.1|  PREDICTED: uncharacterized protein LOC104090916   1359   0.0      
ref|XP_009790879.1|  PREDICTED: uncharacterized protein LOC104238260   1352   0.0      
emb|CDP14890.1|  unnamed protein product                               1352   0.0      
ref|XP_006354834.1|  PREDICTED: uncharacterized protein LOC102605106   1345   0.0      
ref|XP_011087202.1|  PREDICTED: uncharacterized protein LOC105168...   1301   0.0      
ref|XP_011087203.1|  PREDICTED: uncharacterized protein LOC105168...   1300   0.0      
ref|XP_011087199.1|  PREDICTED: uncharacterized protein LOC105168...   1300   0.0      
ref|XP_011071732.1|  PREDICTED: uncharacterized protein LOC105157...   1282   0.0      
ref|XP_011071733.1|  PREDICTED: uncharacterized protein LOC105157...   1278   0.0      
ref|XP_007037185.1|  Ubiquitin carboxyl-terminal hydrolase-relate...   1238   0.0      
ref|XP_007037186.1|  Ubiquitin carboxyl-terminal hydrolase-relate...   1236   0.0      
ref|XP_007037182.1|  Ubiquitin carboxyl-terminal hydrolase-relate...   1234   0.0      
ref|XP_006367707.1|  PREDICTED: uncharacterized protein LOC102592123   1219   0.0      
ref|XP_010663421.1|  PREDICTED: uncharacterized protein LOC100256...   1206   0.0      
ref|XP_002266656.1|  PREDICTED: uncharacterized protein LOC100256...   1205   0.0      Vitis vinifera
ref|XP_010318961.1|  PREDICTED: uncharacterized protein LOC101250879   1204   0.0      
ref|XP_007210436.1|  hypothetical protein PRUPE_ppa000140mg            1201   0.0      
ref|XP_008239780.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1181   0.0      
gb|KDO76022.1|  hypothetical protein CISIN_1g000306mg                  1176   0.0      
ref|XP_006476672.1|  PREDICTED: uncharacterized protein LOC102612...   1175   0.0      
gb|KDO76019.1|  hypothetical protein CISIN_1g000306mg                  1172   0.0      
ref|XP_006439669.1|  hypothetical protein CICLE_v10018472mg            1172   0.0      
gb|KDO76021.1|  hypothetical protein CISIN_1g000306mg                  1171   0.0      
gb|KDO76020.1|  hypothetical protein CISIN_1g000306mg                  1171   0.0      
gb|EYU35900.1|  hypothetical protein MIMGU_mgv1a000162mg               1171   0.0      
ref|XP_006476671.1|  PREDICTED: uncharacterized protein LOC102612...   1169   0.0      
emb|CBI15290.3|  unnamed protein product                               1168   0.0      
ref|XP_009369371.1|  PREDICTED: uncharacterized protein LOC103958...   1162   0.0      
ref|XP_009369372.1|  PREDICTED: uncharacterized protein LOC103958...   1162   0.0      
gb|KDP31191.1|  hypothetical protein JCGZ_11567                        1160   0.0      
ref|XP_008356674.1|  PREDICTED: uncharacterized protein LOC103420388   1158   0.0      
ref|XP_010272203.1|  PREDICTED: uncharacterized protein LOC104608...   1146   0.0      
ref|XP_010272205.1|  PREDICTED: uncharacterized protein LOC104608...   1144   0.0      
ref|XP_004301306.1|  PREDICTED: uncharacterized protein LOC101311291   1135   0.0      
ref|XP_009343438.1|  PREDICTED: uncharacterized protein LOC103935...   1134   0.0      
ref|XP_009343439.1|  PREDICTED: uncharacterized protein LOC103935...   1134   0.0      
ref|XP_002511504.1|  conserved hypothetical protein                    1122   0.0      Ricinus communis
ref|XP_010550646.1|  PREDICTED: uncharacterized protein LOC104821450   1108   0.0      
ref|XP_010546042.1|  PREDICTED: uncharacterized protein LOC104818...   1102   0.0      
ref|XP_010546039.1|  PREDICTED: uncharacterized protein LOC104818...   1101   0.0      
ref|XP_010256031.1|  PREDICTED: uncharacterized protein LOC104596...   1101   0.0      
ref|XP_010546041.1|  PREDICTED: uncharacterized protein LOC104818...   1101   0.0      
ref|XP_010256025.1|  PREDICTED: uncharacterized protein LOC104596...   1097   0.0      
ref|XP_010256018.1|  PREDICTED: uncharacterized protein LOC104596...   1097   0.0      
ref|XP_010256010.1|  PREDICTED: uncharacterized protein LOC104596...   1097   0.0      
ref|XP_011042623.1|  PREDICTED: uncharacterized protein LOC105138...   1090   0.0      
ref|XP_011042624.1|  PREDICTED: uncharacterized protein LOC105138...   1090   0.0      
ref|XP_010028652.1|  PREDICTED: uncharacterized protein LOC104418879   1090   0.0      
ref|XP_011042622.1|  PREDICTED: uncharacterized protein LOC105138...   1089   0.0      
ref|XP_002317996.2|  ubiquitin carboxyl-terminal hydrolase family...   1087   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010112586.1|  Inactive ubiquitin carboxyl-terminal hydrola...   1082   0.0      
ref|XP_011028696.1|  PREDICTED: uncharacterized protein LOC105128...   1081   0.0      
ref|XP_011028695.1|  PREDICTED: uncharacterized protein LOC105128...   1081   0.0      
ref|XP_006374498.1|  hypothetical protein POPTR_0015s07770g            1067   0.0      
ref|XP_004508792.1|  PREDICTED: uncharacterized protein LOC101496...   1048   0.0      
ref|XP_004508791.1|  PREDICTED: uncharacterized protein LOC101496...   1048   0.0      
gb|EPS61315.1|  hypothetical protein M569_13482                        1041   0.0      
ref|XP_008453169.1|  PREDICTED: uncharacterized protein LOC103493...   1036   0.0      
ref|XP_008453168.1|  PREDICTED: uncharacterized protein LOC103493...   1032   0.0      
ref|XP_006579548.1|  PREDICTED: uncharacterized protein LOC100799...   1031   0.0      
ref|XP_006579549.1|  PREDICTED: uncharacterized protein LOC100799...   1031   0.0      
ref|XP_004138296.1|  PREDICTED: uncharacterized protein LOC101212702   1028   0.0      
gb|KGN63643.1|  hypothetical protein Csa_1G008490                      1025   0.0      
ref|XP_006600667.1|  PREDICTED: uncharacterized protein LOC100800...   1018   0.0      
gb|KHG14770.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54      1018   0.0      
ref|XP_006600664.1|  PREDICTED: uncharacterized protein LOC100800...   1017   0.0      
ref|XP_010412621.1|  PREDICTED: uncharacterized protein LOC104698949   1016   0.0      
ref|XP_002877584.1|  predicted protein                                 1014   0.0      
ref|XP_006290495.1|  hypothetical protein CARUB_v10016569mg            1014   0.0      
gb|KFK34093.1|  hypothetical protein AALP_AA5G101100                   1013   0.0      
ref|XP_006404317.1|  hypothetical protein EUTSA_v10010059mg            1008   0.0      
ref|XP_007155356.1|  hypothetical protein PHAVU_003G194200g            1006   0.0      
ref|XP_010503406.1|  PREDICTED: uncharacterized protein LOC104780...   1005   0.0      
ref|XP_010503405.1|  PREDICTED: uncharacterized protein LOC104780...   1005   0.0      
ref|XP_010426256.1|  PREDICTED: uncharacterized protein LOC104711264   1004   0.0      
ref|XP_002877583.1|  hypothetical protein ARALYDRAFT_485153            1004   0.0      
emb|CAB41150.1|  putative protein                                      1001   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292726.1|  hypothetical protein CARUB_v10018972mg            1001   0.0      
ref|NP_190372.3|  ubiquitin carboxyl-terminal hydrolase-related p...   1000   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426263.1|  PREDICTED: uncharacterized protein LOC104711...    998   0.0      
ref|XP_010426262.1|  PREDICTED: uncharacterized protein LOC104711...    997   0.0      
ref|XP_010515104.1|  PREDICTED: uncharacterized protein LOC104791003    994   0.0      
emb|CAB41148.1|  putative protein                                       991   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH31899.1|  ubiquitin carboxyl-terminal hydrolase-like protein      991   0.0      
gb|KEH31898.1|  ubiquitin carboxyl-terminal hydrolase-like protein      990   0.0      
ref|NP_001118788.1|  ubiquitin carboxyl-terminal hydrolase-relate...    989   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149862.1|  PREDICTED: uncharacterized protein LOC103873189    989   0.0      
gb|KFK34092.1|  hypothetical protein AALP_AA5G101000                    989   0.0      
gb|KFK34091.1|  hypothetical protein AALP_AA5G101000                    989   0.0      
ref|NP_190374.4|  ubiquitin carboxyl-terminal hydrolase-related p...    989   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503407.1|  PREDICTED: uncharacterized protein LOC104780...    987   0.0      
ref|XP_010678607.1|  PREDICTED: uncharacterized protein LOC104894...    974   0.0      
ref|XP_010678606.1|  PREDICTED: uncharacterized protein LOC104894...    969   0.0      
ref|XP_009149858.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    969   0.0      
ref|XP_010678605.1|  PREDICTED: uncharacterized protein LOC104894...    967   0.0      
ref|XP_010678604.1|  PREDICTED: uncharacterized protein LOC104894...    967   0.0      
ref|XP_008809576.1|  PREDICTED: uncharacterized protein LOC103721...    961   0.0      
ref|XP_008809577.1|  PREDICTED: uncharacterized protein LOC103721...    960   0.0      
ref|XP_010907346.1|  PREDICTED: uncharacterized protein LOC105034...    959   0.0      
ref|XP_010907345.1|  PREDICTED: uncharacterized protein LOC105034...    958   0.0      
ref|XP_010907344.1|  PREDICTED: uncharacterized protein LOC105034...    958   0.0      
ref|XP_006404318.1|  hypothetical protein EUTSA_v10010060mg             954   0.0      
ref|XP_009386394.1|  PREDICTED: uncharacterized protein LOC103973...    936   0.0      
ref|XP_009386389.1|  PREDICTED: uncharacterized protein LOC103973...    936   0.0      
ref|XP_008374916.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    569   0.0      
ref|XP_006841144.1|  hypothetical protein AMTR_s00086p00132870          860   0.0      
gb|KHN48649.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       852   0.0      
ref|XP_010932991.1|  PREDICTED: uncharacterized protein LOC105053498    845   0.0      
gb|KHN18514.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       829   0.0      
emb|CDY72442.1|  BnaCnng77640D                                          679   0.0      
tpg|DAA43557.1|  TPA: hypothetical protein ZEAMMB73_116284              664   0.0      
ref|XP_008668323.1|  PREDICTED: uncharacterized protein LOC100274...    660   0.0      
gb|AFW89723.1|  hypothetical protein ZEAMMB73_873945                    642   0.0      
gb|AFW89722.1|  hypothetical protein ZEAMMB73_873945                    644   0.0      
ref|XP_010515103.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    612   0.0      
ref|XP_008658139.1|  PREDICTED: uncharacterized protein LOC100194...    642   0.0      
gb|AFW89724.1|  hypothetical protein ZEAMMB73_873945                    640   0.0      
ref|XP_004987161.1|  PREDICTED: uncharacterized protein LOC101782159    637   0.0      
ref|XP_008658138.1|  PREDICTED: uncharacterized protein LOC100194...    640   0.0      
ref|XP_008658140.1|  PREDICTED: uncharacterized protein LOC100194...    640   0.0      
ref|XP_008658137.1|  PREDICTED: uncharacterized protein LOC100194...    640   0.0      
dbj|BAE98837.1|  hypothetical protein                                   615   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465805.1|  hypothetical protein SORBIDRAFT_01g046140          639   0.0      Sorghum bicolor [broomcorn]
ref|XP_008346826.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    591   0.0      
ref|XP_010229142.1|  PREDICTED: uncharacterized protein LOC100846067    620   0.0      
emb|CDY61846.1|  BnaAnng17800D                                          567   0.0      
gb|ABL66740.1|  At3g47900                                               552   7e-177   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41149.1|  putative protein                                       543   2e-173   Arabidopsis thaliana [mouse-ear cress]
gb|EEC74581.1|  hypothetical protein OsI_10153                          581   1e-172   Oryza sativa Indica Group [Indian rice]
gb|ABF94151.1|  Ubiquitin carboxyl-terminal hydrolase family prot...    579   6e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010661023.1|  PREDICTED: uncharacterized protein LOC104881688    590   2e-171   
gb|EEE58383.1|  hypothetical protein OsJ_09540                          568   8e-168   Oryza sativa Japonica Group [Japonica rice]
emb|CDY36917.1|  BnaA06g17020D                                          543   3e-167   
dbj|BAK03191.1|  predicted protein                                      508   9e-156   
ref|NP_001049069.1|  Os03g0165600                                       498   7e-155   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52635.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       525   5e-153   
ref|XP_001762441.1|  predicted protein                                  516   8e-150   
emb|CDY25237.1|  BnaC02g30130D                                          462   6e-145   
ref|XP_006651069.1|  PREDICTED: uncharacterized protein LOC102718817    499   1e-144   
gb|AFW89587.1|  hypothetical protein ZEAMMB73_931714                    454   2e-131   
gb|EYU35899.1|  hypothetical protein MIMGU_mgv1a000927mg                446   9e-131   
emb|CBI35030.3|  unnamed protein product                                423   1e-120   
emb|CAB41871.1|  putative protein                                       360   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142026.1|  uncharacterized protein LOC100274180               356   5e-108   Zea mays [maize]
emb|CDP06267.1|  unnamed protein product                                354   6e-106   
ref|NP_001132623.1|  uncharacterized protein LOC100194097               342   5e-103   Zea mays [maize]
ref|XP_010661002.1|  PREDICTED: uncharacterized protein LOC104881...    352   7e-96    
ref|XP_010661001.1|  PREDICTED: uncharacterized protein LOC104881...    352   7e-96    
ref|XP_002324086.2|  hypothetical protein POPTR_0017s12500g             310   5e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006373344.1|  hypothetical protein POPTR_0017s12500g             308   2e-88    
ref|XP_010661005.1|  PREDICTED: uncharacterized protein LOC104881684    315   9e-87    
emb|CBI35029.3|  unnamed protein product                                323   3e-86    
ref|XP_011035827.1|  PREDICTED: uncharacterized protein LOC105133495    310   1e-81    
emb|CDP14893.1|  unnamed protein product                                275   7e-81    
ref|XP_002324087.2|  hypothetical protein POPTR_0017s12510g             298   4e-79    Populus trichocarpa [western balsam poplar]
emb|CDY36914.1|  BnaA06g16990D                                          268   1e-72    
ref|XP_006489588.1|  PREDICTED: uncharacterized protein LOC102612613    275   2e-71    
ref|XP_010039155.1|  PREDICTED: uncharacterized protein LOC104427830    270   5e-70    
gb|EMT28012.1|  hypothetical protein F775_25033                         245   4e-67    
ref|XP_006485856.1|  PREDICTED: putative leucine-rich repeat-cont...    254   5e-66    
ref|XP_006485802.1|  PREDICTED: uncharacterized protein LOC102630787    251   4e-64    
gb|KDO57470.1|  hypothetical protein CISIN_1g000686mg                   251   4e-64    
gb|KDO74622.1|  hypothetical protein CISIN_1g037237mg                   249   2e-63    
ref|XP_006419917.1|  hypothetical protein CICLE_v100070361mg            233   6e-59    
ref|XP_005650621.1|  hypothetical protein COCSUDRAFT_64969              231   2e-58    
ref|XP_006485855.1|  PREDICTED: uncharacterized protein LOC102624054    222   3e-57    
ref|XP_006477527.1|  PREDICTED: uncharacterized protein LOC102624774    207   2e-56    
ref|XP_006440992.1|  hypothetical protein CICLE_v10018876mg             223   3e-56    
emb|CDP14892.1|  unnamed protein product                                160   8e-51    
ref|XP_005650623.1|  hypothetical protein COCSUDRAFT_61074              209   9e-51    
gb|EMT03058.1|  hypothetical protein F775_01705                         189   2e-49    
ref|XP_002502922.1|  predicted protein                                  191   3e-48    Micromonas commoda
ref|XP_005835712.1|  hypothetical protein GUITHDRAFT_68514              179   2e-44    
ref|XP_010037628.1|  PREDICTED: uncharacterized protein LOC104426...    186   7e-44    
ref|XP_006431138.1|  hypothetical protein CICLE_v10013440mg             181   6e-43    
gb|KCW49366.1|  hypothetical protein EUGRSUZ_K02911                     174   4e-42    
ref|XP_010528656.1|  PREDICTED: uncharacterized protein LOC104805...    180   5e-42    
ref|XP_010528654.1|  PREDICTED: uncharacterized protein LOC104805...    179   7e-42    
ref|XP_010528655.1|  PREDICTED: uncharacterized protein LOC104805...    179   8e-42    
ref|XP_010528653.1|  PREDICTED: uncharacterized protein LOC104805...    179   8e-42    
ref|XP_010528659.1|  PREDICTED: uncharacterized protein LOC104805...    179   9e-42    
ref|XP_010037627.1|  PREDICTED: uncharacterized protein LOC104426...    177   2e-41    
ref|XP_008615509.1|  hypothetical protein SDRG_11256                    169   6e-40    
gb|KDO34017.1|  hypothetical protein SPRG_01291                         169   6e-40    
emb|CDQ71289.1|  unnamed protein product                                164   7e-39    
ref|XP_005814530.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    168   9e-39    
ref|XP_005851100.1|  hypothetical protein CHLNCDRAFT_137643             170   9e-39    
ref|XP_010528658.1|  PREDICTED: uncharacterized protein LOC104805...    169   1e-38    
ref|XP_008434012.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    167   2e-38    
ref|XP_005468261.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    166   9e-38    
ref|XP_007560032.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    166   9e-38    
ref|XP_005468262.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    165   1e-37    
ref|XP_008284260.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    165   1e-37    
ref|XP_010900269.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    165   2e-37    
emb|CDQ72790.1|  unnamed protein product                                164   2e-37    
ref|XP_010888540.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    164   2e-37    
ref|XP_010888543.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    164   2e-37    
ref|XP_005743061.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    164   3e-37    
ref|XP_004554494.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    164   3e-37    
ref|XP_004554493.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    164   3e-37    
ref|XP_008324795.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    162   9e-37    
ref|XP_004353141.1|  ubiquitin carboxyl-terminal hydrolase              159   9e-37    
ref|XP_006804206.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    162   1e-36    
ref|XP_008324788.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    162   1e-36    
ref|XP_005171014.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    161   2e-36    
ref|XP_010229155.1|  PREDICTED: uncharacterized protein LOC104581868    153   2e-36    
ref|XP_002948285.1|  hypothetical protein VOLCADRAFT_88476              162   2e-36    
ref|XP_003967035.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    161   2e-36    
ref|XP_002120975.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    159   2e-36    Ciona intestinalis [sea vase]
emb|CDQ64216.1|  unnamed protein product                                160   3e-36    
ref|XP_007889687.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    160   4e-36    
ref|XP_003972052.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    160   4e-36    
ref|XP_010789473.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    159   7e-36    
ref|XP_010789471.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    159   7e-36    
ref|XP_006630065.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    158   1e-35    
ref|XP_008315118.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    158   2e-35    
ref|XP_010774334.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   2e-35    
ref|XP_010551234.1|  PREDICTED: uncharacterized protein LOC104821...    158   2e-35    
ref|XP_010551215.1|  PREDICTED: uncharacterized protein LOC104821...    158   2e-35    
ref|XP_007255231.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    157   3e-35    
ref|XP_008947773.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-35    
gb|ELU08706.1|  hypothetical protein CAPTEDRAFT_136564                  152   3e-35    
ref|XP_005807237.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    154   4e-35    
ref|XP_010743237.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   5e-35    
ref|XP_008284913.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   7e-35    
ref|XP_010551225.1|  PREDICTED: uncharacterized protein LOC104821...    157   7e-35    
ref|XP_007166668.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   8e-35    
ref|XP_006787209.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   9e-35    
ref|XP_005726843.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   9e-35    
ref|XP_005726844.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   9e-35    
emb|CAE47747.1|  ubiquitin specific proteinase 54                       150   1e-34    Homo sapiens [man]
ref|XP_007166667.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   1e-34    
dbj|BAC33102.1|  unnamed protein product                                150   1e-34    Mus musculus [mouse]
ref|XP_005457080.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   1e-34    
ref|XP_005942098.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   1e-34    
ref|XP_004549620.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   1e-34    
ref|XP_007166665.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   1e-34    
ref|XP_007166663.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   1e-34    
ref|XP_010774333.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   1e-34    
ref|XP_001691026.1|  hypothetical protein CHLREDRAFT_144600             156   1e-34    Chlamydomonas reinhardtii
ref|XP_007166666.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    156   1e-34    
ref|XP_009924073.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-34    
ref|NP_570078.2|  echinus, isoform B                                    155   2e-34    Drosophila melanogaster
ref|XP_008320409.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   2e-34    
ref|XP_008409736.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    154   2e-34    
gb|ETE70259.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       154   2e-34    
ref|XP_005565558.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   2e-34    
ref|XP_005565560.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   2e-34    
ref|XP_010747760.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    154   3e-34    
ref|XP_005565557.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_002935811.2|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_005565553.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_003742022.1|  PREDICTED: uncharacterized protein LOC100900202    155   3e-34    
ref|XP_005565556.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_005565550.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_004915986.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_005565555.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    155   3e-34    
ref|XP_006112665.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    154   3e-34    
gb|KFW10249.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       152   3e-34    
ref|XP_009305611.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    153   4e-34    
ref|XP_008186681.1|  PREDICTED: uncharacterized protein LOC100161...    155   4e-34    
ref|XP_007551828.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    154   4e-34    
gb|KFM69585.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       148   5e-34    
ref|XP_009582024.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   5e-34    
emb|CAE47751.1|  ubiquitin specific proteinase 53                       153   6e-34    Homo sapiens [man]
ref|XP_010588826.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   6e-34    
ref|XP_004386864.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    153   7e-34    
ref|XP_009955176.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   7e-34    
ref|XP_006519772.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   7e-34    
ref|XP_009080980.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    147   8e-34    
ref|XP_003221824.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    153   8e-34    
ref|XP_003382597.1|  PREDICTED: hypothetical protein LOC100633619       152   8e-34    
tpe|CAE51895.1|  TPA: ubiquitin specific protease 54                    148   8e-34    
ref|XP_007258811.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    153   8e-34    
ref|XP_005263135.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   9e-34    
ref|XP_006519771.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   9e-34    
gb|KFP08590.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       152   1e-33    
gb|EGV97801.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       150   1e-33    
ref|XP_008208984.1|  PREDICTED: uncharacterized protein LOC100119...    153   1e-33    
ref|XP_001098826.2|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   1e-33    
ref|XP_008208979.1|  PREDICTED: uncharacterized protein LOC100119...    153   1e-33    
gb|KGL84349.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       151   1e-33    
ref|XP_003985110.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-33    
ref|NP_001188495.1|  inactive ubiquitin carboxyl-terminal hydrola...    152   1e-33    
gb|KFP82816.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       151   1e-33    
ref|XP_008112453.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_002406644.1|  ubiquitin specific proteinase, putative            152   2e-33    
ref|XP_008286551.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_004077289.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
gb|KFQ19692.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       150   2e-33    
ref|XP_010302769.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_006185575.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_008112450.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_005153920.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_006153164.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_007621601.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   2e-33    
ref|XP_006019804.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_010588823.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_004383284.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_007258808.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_006519770.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_008590380.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_003496785.2|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   2e-33    
ref|XP_007258810.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_005367685.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    152   2e-33    
ref|XP_004942145.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_006259723.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   2e-33    
ref|XP_009243747.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   2e-33    
ref|XP_006612357.1|  PREDICTED: mediator of RNA polymerase II tra...    152   2e-33    
gb|KFW90256.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   2e-33    
ref|XP_009243748.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   3e-33    
ref|XP_003395201.1|  PREDICTED: hypothetical protein LOC100646738       152   3e-33    
ref|XP_010181897.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   3e-33    
ref|XP_007621600.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   3e-33    
gb|EMP40832.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       151   3e-33    
ref|XP_003490765.1|  PREDICTED: hypothetical protein LOC100744780       152   3e-33    
ref|XP_006806954.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_007054512.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_781136.3|  PREDICTED: uncharacterized protein LOC575657          151   3e-33    
ref|XP_008065552.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_010712694.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_008167872.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    151   3e-33    
ref|XP_004624438.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    151   3e-33    
ref|XP_010566052.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_010712696.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   3e-33    
ref|XP_010862209.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_004084347.1|  PREDICTED: uncharacterized protein LOC101172628    151   4e-33    
ref|XP_005367684.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_010566051.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_005943095.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
gb|EMC81689.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   4e-33    
ref|XP_009939859.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_005156918.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_010750479.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
gb|KFP60773.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   4e-33    
gb|KFP95441.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   4e-33    
gb|KFP45790.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       150   4e-33    
ref|XP_006519767.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_005681337.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   4e-33    
ref|XP_421621.4|  PREDICTED: inactive ubiquitin carboxyl-terminal...    151   4e-33    
ref|XP_004942143.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_004942141.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|NP_084456.2|  inactive ubiquitin carboxyl-terminal hydrolase 54     151   4e-33    
gb|EEZ97283.1|  hypothetical protein TcasGA2_TC011087                   150   4e-33    
gb|KFU91967.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       150   4e-33    
ref|XP_004942144.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_005144179.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   4e-33    
ref|XP_006519764.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   4e-33    
ref|XP_004769498.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_006630960.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
gb|KFO91831.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   5e-33    
gb|KFP32562.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   5e-33    
ref|XP_009305609.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_006519766.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_005500110.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_008834810.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_970294.2|  PREDICTED: uncharacterized protein LOC658848 is...    150   5e-33    
ref|XP_009320715.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_004334106.1|  ubiquitin carboxyl-terminal hydrolase              149   5e-33    
ref|XP_005898127.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_009501592.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   5e-33    
ref|XP_010175010.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    151   5e-33    
ref|XP_009584486.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    151   5e-33    
ref|XP_005481494.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_010556181.1|  PREDICTED: uncharacterized protein LOC104825529    150   5e-33    
ref|XP_009926596.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   5e-33    
ref|XP_010202279.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   5e-33    
ref|XP_002193547.2|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
ref|XP_004769499.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_009275938.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    151   5e-33    
gb|EOB04153.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       150   5e-33    
ref|XP_008502218.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_009695280.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   5e-33    
ref|XP_010223224.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_009983908.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   5e-33    
ref|XP_005229793.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_007087672.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_005417283.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009640300.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_010016512.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_005433364.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009876730.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_007621598.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_005462258.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009887069.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_010287212.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
gb|KFP07004.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       150   6e-33    
ref|XP_006991937.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_005481492.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_008642093.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
gb|EFB15899.1|  hypothetical protein PANDA_017869                       150   6e-33    
ref|XP_005015735.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_010193417.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009569020.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009085691.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_008922549.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_008834806.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_010137786.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    148   6e-33    
ref|XP_004769497.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   6e-33    
ref|XP_009243744.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_007428074.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_009669542.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
gb|KFQ10601.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       148   7e-33    
ref|XP_004769496.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_009948758.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    148   7e-33    
ref|XP_004769486.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_009669549.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_009895961.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_010410491.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005015738.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_009243745.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_010605337.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   7e-33    
ref|XP_007520444.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005015739.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_008580413.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005481491.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_010159515.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005520587.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_007621599.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005263134.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   7e-33    
ref|XP_006731222.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_005015737.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_006170112.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
gb|KFV81260.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   7e-33    
ref|XP_004769494.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   7e-33    
ref|XP_010078398.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   7e-33    
gb|AAI66154.1|  LOC100158512 protein                                    149   8e-33    
ref|XP_004769493.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_009243743.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_005048292.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_006761049.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_004040371.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    148   8e-33    
ref|XP_004479090.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    148   8e-33    
ref|XP_004716006.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    149   8e-33    
ref|XP_005048297.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_009469261.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_005433821.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_003473840.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   8e-33    
ref|XP_010410474.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_005243187.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_004612828.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_006937938.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_005619086.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_007950564.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_002927995.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_005963125.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   8e-33    
ref|XP_006213985.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    149   8e-33    
ref|XP_003271194.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_005619085.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   8e-33    
ref|XP_009212956.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_005619084.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_003772830.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   9e-33    
ref|XP_008500027.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   9e-33    
ref|XP_008580409.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_010371411.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_009673151.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   9e-33    
ref|XP_004701225.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   9e-33    
ref|XP_006170110.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_009808226.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_009243734.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_005390028.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    150   9e-33    
ref|XP_007621597.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
ref|XP_009243741.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   9e-33    
gb|EOB05757.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53       149   1e-32    
ref|XP_007621596.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_006937937.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005325968.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_002815137.2|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
ref|XP_008580404.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_006874655.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...    149   1e-32    
ref|XP_008967279.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005199596.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_004657976.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_009007954.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
ref|XP_010797434.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_008580410.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_007938802.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005699269.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
gb|ELK09532.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       150   1e-32    
ref|XP_005269639.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005849431.1|  hypothetical protein CHLNCDRAFT_143978             145   1e-32    
ref|XP_005699270.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_004520049.1|  PREDICTED: uncharacterized protein LOC101463...    150   1e-32    
ref|XP_005226563.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005699268.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005699264.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_009673153.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
ref|XP_005013556.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
ref|XP_006067723.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
gb|ERE91943.1|  inactive ubiquitin carboxyl-terminal hydrolase 54...    150   1e-32    
ref|XP_005619082.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_005619083.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_010818962.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    
ref|XP_008580408.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    150   1e-32    
ref|XP_008580412.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    149   1e-32    



>ref|XP_009777756.1| PREDICTED: uncharacterized protein LOC104227244 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777757.1| PREDICTED: uncharacterized protein LOC104227244 isoform X1 [Nicotiana 
sylvestris]
Length=1623

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 765/1103 (69%), Positives = 902/1103 (82%), Gaps = 16/1103 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV-----QEKSLIRHDQA  527
             M HKKR +APRSKPS APV V  V  D       LESD + V V     ++ S  +   A
Sbjct  1     MVHKKRTVAPRSKPSAAPVAVLPVTDDAEIEL--LESDLNLVSVSPSVRKKPSSKKDASA  58

Query  528   VVESETNA-SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             V ESE NA S+SYA+IKLECERALTSLRRGNH KALRLMK+L +KH+NSP  ALI+RVQG
Sbjct  59    VAESEKNAFSASYASIKLECERALTSLRRGNHTKALRLMKELSSKHDNSPYTALIHRVQG  118

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K+RHLKNAI+SARK+V +SPNSIEFAHFYANLLYEAAN+GKEYEE
Sbjct  119   TVCVKVASVIDDPNAKHRHLKNAIESARKAVSLSPNSIEFAHFYANLLYEAANEGKEYEE  178

Query  885   VVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQE +QQKV TP ARI HVQ ELR LIQ+SN+ASISTW+
Sbjct  179   VVQECERALAIENPVDPAKESLQEESQQKVETPHARIEHVQNELRGLIQKSNIASISTWM  238

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             K+ G+GEEKFRLIPIRR+SEDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLL
Sbjct  239   KHIGNGEEKFRLIPIRRVSEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLL  298

Query  1242  QQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             QQKSE+ ++ ND +++ DL+ G+GQR  ERRKSG+ARKN SS ER++ V+SYWNSM+ D 
Sbjct  299   QQKSETVETDNDVDKASDLTTGSGQRIGERRKSGHARKNASSTERKNWVQSYWNSMTLDR  358

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLRI I DLK+H  + KD LANE+LSEALSFAE NK WKFW CC C E+F DSESH 
Sbjct  359   KKELLRITISDLKAHLNASKDRLANELLSEALSFAETNKDWKFWACCRCGEKFVDSESHN  418

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
              HV++EH+ +L PKLQSVLPQNVENEW EMLLNC WKPLD++AAAK+LE+Q + + HGFL
Sbjct  419   HHVVHEHIGTLLPKLQSVLPQNVENEWTEMLLNCPWKPLDVSAAAKMLEEQSRSQGHGFL  478

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDR  1958
             + T+ R + +ESKDD SD +CN   WD SP KK  GD  NG  V+SREYDK S++  MD 
Sbjct  479   DETHPRDNTEESKDDFSDVFCNEGEWDSSPRKKKLGDRTNGYGVESREYDKISDIELMDC  538

Query  1959  DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQ  2138
             DGN GTK C   + WP++DDP+RAKLLE+I+ +FQTLI NKYL SSHLSKV+HFAVEELQ
Sbjct  539   DGNNGTKNCFLPDKWPLSDDPDRAKLLEKIHAIFQTLIGNKYLASSHLSKVVHFAVEELQ  598

Query  2139  SLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTG  2318
              L +GSQLLNYN+DQTPLCICFL A ELKK+LKFLQELSH CGLGRY E+ +A D  S  
Sbjct  599   GLAFGSQLLNYNVDQTPLCICFLDAQELKKVLKFLQELSHCCGLGRYSEKISASDGASNA  658

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              QG D +EK+VFSEDGSCLLFDEHF PCKLTP +  D V  D    +A + S+ Q  NG 
Sbjct  659   SQGFDDLEKVVFSEDGSCLLFDEHFLPCKLTPSSCPDTVSID---RTAYVLSSNQYQNGA  715

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
              LDS  LLSWIF G SS EQL SW R+REEKAQQ MEI+R LEKEFY+LQGLCERK EHL
Sbjct  716   ELDSAALLSWIFTGPSSLEQLASWVRAREEKAQQGMEILRFLEKEFYDLQGLCERKYEHL  775

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC EEG+KREH I+FVRRSYD  L+KRR+EL+ES +E T    RFE++A
Sbjct  776   SYEEALQAVEDLCSEEGRKREHAIEFVRRSYDSVLRKRREELIESENEDTFIGSRFELDA  835

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AESLN ++FGFE+TY G +SHLCDLESGE++DWR+KDYL+Q DSCVEVA+QRQ
Sbjct  836   ISNVLKEAESLNGSRFGFEETYIGGTSHLCDLESGEEEDWRLKDYLHQVDSCVEVALQRQ  895

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEHVS+ELSKIDARIMRVV+GMQ+L+VKLE  S+ DYR+ILV L+KS++RA+LEDLAE+D
Sbjct  896   KEHVSIELSKIDARIMRVVAGMQRLKVKLEHASSQDYRRILVTLLKSFMRANLEDLAEKD  955

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAEL RDSK SS  G+  +KH+H+K +DKKK K+YRKTKD K ++GN 
Sbjct  956   ATEKSDAAREAFLAELDRDSKNSSGGGNGYSKHTHDKIKDKKKNKEYRKTKDSKPTSGNE  1015

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
             LH L H T  + SF+V HD G +  +++ G  +S+ +  +E RRRIELEAEERKLEETLE
Sbjct  1016  LHLLRHQTMADGSFTVTHD-GEDQGDVTVGNGDSLDE--QEYRRRIELEAEERKLEETLE  1072

Query  3579  YQRRIENEAKLKHLAEQHKKGAR  3647
             YQRR+ENEAKLKHLAEQ+K+  +
Sbjct  1073  YQRRMENEAKLKHLAEQNKRTTK  1095


 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/505 (73%), Positives = 406/505 (80%), Gaps = 9/505 (2%)
 Frame = +1

Query  3715  VNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrs  3888
             +N+Q  ++KK+    NG P  LE  PK+S          SN G  ED  L S RR+GRR 
Sbjct  1119  INEQWKSSKKK----NGFPDSLEV-PKHSAEGMTQNTRLSNEGIPEDSTLISARRSGRRG  1173

Query  3889  rrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEE  4068
             RRQK S   +  K    ++  EN EVGE R +D S E   +  SG KTLRQLHVEDDDEE
Sbjct  1174  RRQKDSKLIDG-KYQSASAERENSEVGEPRALDASPENNGSVNSGTKTLRQLHVEDDDEE  1232

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGT  4248
             RFQADL KAVRQSLDTFHAH+KLPL+P  G   I  + N G    +  TG V  +++YGT
Sbjct  1233  RFQADLKKAVRQSLDTFHAHEKLPLLPSLGNGHIL-LPNAGTLSNEKTTGDVTVMDLYGT  1291

Query  4249  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLAS  4428
             GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR++SEH+HVGDPCV+CALYDIFTALS AS
Sbjct  1292  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRTASEHVHVGDPCVICALYDIFTALSTAS  1351

Query  4429  SETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTE  4608
             +E  R  VAP+SLRIALSNLYPD   FQEGQMNDASEVLGVIF+CLH+SFTSASG SDTE
Sbjct  1352  TEICRKTVAPSSLRIALSNLYPDSNFFQEGQMNDASEVLGVIFDCLHRSFTSASGVSDTE  1411

Query  4609  SVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTM  4788
             S DSSCMG+WDC+N ACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTM
Sbjct  1412  SADSSCMGTWDCSNGACIVHSLFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTM  1471

Query  4789  KVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCES  4968
             KVMC +SSFDELLNLVEMNHQLACD +  GCGK N+IHH LSTPPHVFT VLGWQNTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  4969  VEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDD  5148
             V+DI ATL ALSTE+DI VLYRGLDPK+KH L+SVVCYYGQHYHCFAY HDH RW+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  5149  KTVKVIGNWADVLTMCERGHLQPQV  5223
             KTVKVIG W DVL MCERGHLQPQV
Sbjct  1592  KTVKVIGGWDDVLVMCERGHLQPQV  1616



>ref|XP_009777758.1| PREDICTED: uncharacterized protein LOC104227244 isoform X2 [Nicotiana 
sylvestris]
Length=1616

 Score =  1391 bits (3601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 765/1103 (69%), Positives = 902/1103 (82%), Gaps = 16/1103 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV-----QEKSLIRHDQA  527
             M HKKR +APRSKPS APV V  V  D       LESD + V V     ++ S  +   A
Sbjct  1     MVHKKRTVAPRSKPSAAPVAVLPVTDDAEIEL--LESDLNLVSVSPSVRKKPSSKKDASA  58

Query  528   VVESETNA-SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             V ESE NA S+SYA+IKLECERALTSLRRGNH KALRLMK+L +KH+NSP  ALI+RVQG
Sbjct  59    VAESEKNAFSASYASIKLECERALTSLRRGNHTKALRLMKELSSKHDNSPYTALIHRVQG  118

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K+RHLKNAI+SARK+V +SPNSIEFAHFYANLLYEAAN+GKEYEE
Sbjct  119   TVCVKVASVIDDPNAKHRHLKNAIESARKAVSLSPNSIEFAHFYANLLYEAANEGKEYEE  178

Query  885   VVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQE +QQKV TP ARI HVQ ELR LIQ+SN+ASISTW+
Sbjct  179   VVQECERALAIENPVDPAKESLQEESQQKVETPHARIEHVQNELRGLIQKSNIASISTWM  238

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             K+ G+GEEKFRLIPIRR+SEDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLL
Sbjct  239   KHIGNGEEKFRLIPIRRVSEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLL  298

Query  1242  QQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             QQKSE+ ++ ND +++ DL+ G+GQR  ERRKSG+ARKN SS ER++ V+SYWNSM+ D 
Sbjct  299   QQKSETVETDNDVDKASDLTTGSGQRIGERRKSGHARKNASSTERKNWVQSYWNSMTLDR  358

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLRI I DLK+H  + KD LANE+LSEALSFAE NK WKFW CC C E+F DSESH 
Sbjct  359   KKELLRITISDLKAHLNASKDRLANELLSEALSFAETNKDWKFWACCRCGEKFVDSESHN  418

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
              HV++EH+ +L PKLQSVLPQNVENEW EMLLNC WKPLD++AAAK+LE+Q + + HGFL
Sbjct  419   HHVVHEHIGTLLPKLQSVLPQNVENEWTEMLLNCPWKPLDVSAAAKMLEEQSRSQGHGFL  478

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDR  1958
             + T+ R + +ESKDD SD +CN   WD SP KK  GD  NG  V+SREYDK S++  MD 
Sbjct  479   DETHPRDNTEESKDDFSDVFCNEGEWDSSPRKKKLGDRTNGYGVESREYDKISDIELMDC  538

Query  1959  DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQ  2138
             DGN GTK C   + WP++DDP+RAKLLE+I+ +FQTLI NKYL SSHLSKV+HFAVEELQ
Sbjct  539   DGNNGTKNCFLPDKWPLSDDPDRAKLLEKIHAIFQTLIGNKYLASSHLSKVVHFAVEELQ  598

Query  2139  SLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTG  2318
              L +GSQLLNYN+DQTPLCICFL A ELKK+LKFLQELSH CGLGRY E+ +A D  S  
Sbjct  599   GLAFGSQLLNYNVDQTPLCICFLDAQELKKVLKFLQELSHCCGLGRYSEKISASDGASNA  658

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              QG D +EK+VFSEDGSCLLFDEHF PCKLTP +  D V  D    +A + S+ Q  NG 
Sbjct  659   SQGFDDLEKVVFSEDGSCLLFDEHFLPCKLTPSSCPDTVSID---RTAYVLSSNQYQNGA  715

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
              LDS  LLSWIF G SS EQL SW R+REEKAQQ MEI+R LEKEFY+LQGLCERK EHL
Sbjct  716   ELDSAALLSWIFTGPSSLEQLASWVRAREEKAQQGMEILRFLEKEFYDLQGLCERKYEHL  775

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC EEG+KREH I+FVRRSYD  L+KRR+EL+ES +E T    RFE++A
Sbjct  776   SYEEALQAVEDLCSEEGRKREHAIEFVRRSYDSVLRKRREELIESENEDTFIGSRFELDA  835

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AESLN ++FGFE+TY G +SHLCDLESGE++DWR+KDYL+Q DSCVEVA+QRQ
Sbjct  836   ISNVLKEAESLNGSRFGFEETYIGGTSHLCDLESGEEEDWRLKDYLHQVDSCVEVALQRQ  895

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEHVS+ELSKIDARIMRVV+GMQ+L+VKLE  S+ DYR+ILV L+KS++RA+LEDLAE+D
Sbjct  896   KEHVSIELSKIDARIMRVVAGMQRLKVKLEHASSQDYRRILVTLLKSFMRANLEDLAEKD  955

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAEL RDSK SS  G+  +KH+H+K +DKKK K+YRKTKD K ++GN 
Sbjct  956   ATEKSDAAREAFLAELDRDSKNSSGGGNGYSKHTHDKIKDKKKNKEYRKTKDSKPTSGNE  1015

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
             LH L H T  + SF+V HD G +  +++ G  +S+ +  +E RRRIELEAEERKLEETLE
Sbjct  1016  LHLLRHQTMADGSFTVTHD-GEDQGDVTVGNGDSLDE--QEYRRRIELEAEERKLEETLE  1072

Query  3579  YQRRIENEAKLKHLAEQHKKGAR  3647
             YQRR+ENEAKLKHLAEQ+K+  +
Sbjct  1073  YQRRMENEAKLKHLAEQNKRTTK  1095


 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/505 (72%), Positives = 406/505 (80%), Gaps = 9/505 (2%)
 Frame = +1

Query  3715  VNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrs  3888
             +N+Q  ++KK+    NG P  LE  PK+S          SN G  ED  L S RR+GRR 
Sbjct  1119  INEQWKSSKKK----NGFPDSLEV-PKHSAEGMTQNTRLSNEGIPEDSTLISARRSGRRG  1173

Query  3889  rrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEE  4068
             RRQK S   +  K    ++  EN EVGE R +D S E   +  SG KTLRQLHVEDDDEE
Sbjct  1174  RRQKDSKLIDG-KYQSASAERENSEVGEPRALDASPENNGSVNSGTKTLRQLHVEDDDEE  1232

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGT  4248
             RFQADL KAVRQSLDTFHAH+KLPL+P  G   I  + N G    +  TG V  +++YGT
Sbjct  1233  RFQADLKKAVRQSLDTFHAHEKLPLLPSLGNGHIL-LPNAGTLSNEKTTGDVTVMDLYGT  1291

Query  4249  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLAS  4428
             GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR++SEH+HVGDPCV+CALYDIFTALS AS
Sbjct  1292  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRTASEHVHVGDPCVICALYDIFTALSTAS  1351

Query  4429  SETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTE  4608
             +E  R  VAP+SLRIALSNLYPD   FQEGQMNDASEVLGVIF+CLH+SFTSASG SDTE
Sbjct  1352  TEICRKTVAPSSLRIALSNLYPDSNFFQEGQMNDASEVLGVIFDCLHRSFTSASGVSDTE  1411

Query  4609  SVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTM  4788
             S DSSCMG+WDC+N ACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTM
Sbjct  1412  SADSSCMGTWDCSNGACIVHSLFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTM  1471

Query  4789  KVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCES  4968
             KVMC +SSFDELLNLVEMNHQLACD +  GCGK N+IHH LSTPPHVFT VLGWQNTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  4969  VEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDD  5148
             V+DI ATL ALSTE+DI VLYRGLDPK+KH L+SVVCYYGQHYHCFAY HDH RW+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  5149  KTVKVIGNWADVLTMCERGHLQPQV  5223
             KTVKVIG W DVL MCERGHLQPQ+
Sbjct  1592  KTVKVIGGWDDVLVMCERGHLQPQM  1616



>ref|XP_009588935.1| PREDICTED: uncharacterized protein LOC104086396 isoform X2 [Nicotiana 
tomentosiformis]
Length=1616

 Score =  1382 bits (3578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1103 (69%), Positives = 891/1103 (81%), Gaps = 16/1103 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV-----QEKSLIRHDQA  527
             M HKKR +APRSKPS APV V  V  D       LESD + V V     ++ S  +   A
Sbjct  1     MVHKKRTVAPRSKPSAAPVAVLPVPDDAEIEL--LESDLNLVSVSPAGRKKPSSKKDASA  58

Query  528   VVESETNA-SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             V E E NA S+SYA+IKLECERALTSLRRGNH KALRLMK+L +KH+N P  ALI+RVQG
Sbjct  59    VAEGEKNAFSASYASIKLECERALTSLRRGNHTKALRLMKELSSKHDNLPYAALIHRVQG  118

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K+RHLKNAI+SARK+V MSPNSIEFAHFYANLLYEAAN+GKEYEE
Sbjct  119   TVCVKVASVIDDPNAKHRHLKNAIESARKAVSMSPNSIEFAHFYANLLYEAANEGKEYEE  178

Query  885   VVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQE +QQKV TP ARI HVQ ELR LIQ+SN+ASISTW+
Sbjct  179   VVQECERALAIENPVDPAKESLQEESQQKVETPHARIEHVQNELRGLIQKSNIASISTWM  238

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             K+ G+GEEKFRLIPIRR+ EDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLL
Sbjct  239   KHIGNGEEKFRLIPIRRVCEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLL  298

Query  1242  QQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             QQKSE+ ++ ND +++ DL+ G+GQR  ERRKSGNARKN SS ER++ V+SYWNSM+ D 
Sbjct  299   QQKSETVETDNDVDKASDLTTGSGQRIGERRKSGNARKNASSTERKNWVQSYWNSMTLDR  358

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLRI I DLK+H  + K GLANEVLSEALSFAE NK WKFW CC C E+F DSESH 
Sbjct  359   KKELLRITISDLKAHLNASKGGLANEVLSEALSFAETNKDWKFWACCRCGEKFIDSESHN  418

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
              HV++EH+ +L PKLQS+LPQNVENEW EMLLNC WKPLD++AAAK+L++Q + + HGFL
Sbjct  419   HHVVHEHIGTLLPKLQSILPQNVENEWAEMLLNCPWKPLDVSAAAKMLDEQSRSQEHGFL  478

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDR  1958
             + T+ R + +ESKDD+SD +CN   WD SP KK  GD  NG  V+SREYDK S++  MD 
Sbjct  479   DETHPRDNTEESKDDVSDVFCNEDEWDSSPRKKKLGDRTNGYRVESREYDKISDIELMDC  538

Query  1959  DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQ  2138
             DGN GTK C   + WP++DDP+RAKLLE I+ +FQ LI NKYL SSHLSKV+HFAVEELQ
Sbjct  539   DGNNGTKNCFLPDKWPLSDDPDRAKLLEGIHAIFQALIGNKYLASSHLSKVVHFAVEELQ  598

Query  2139  SLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTG  2318
              L +GSQLLNYN+DQTPLCICFL A ELKK+LKFLQELSH CGLG Y E+ +A D  S  
Sbjct  599   GLAFGSQLLNYNVDQTPLCICFLDAQELKKVLKFLQELSHCCGLGWYSEKISASDGASNA  658

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              QG D +EK+VFSED SCLLFDEHF PCKLTP +F D V  D    +A + S+ Q  NG 
Sbjct  659   SQGFDDLEKVVFSEDSSCLLFDEHFLPCKLTPSSFPDTVSID---RTAYVLSSNQYQNGA  715

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
              LD   LLSWIF G SS EQL SW R+REEKAQQ MEI+R LEKEFY+LQGLCERK EHL
Sbjct  716   ELDFAALLSWIFTGPSSLEQLASWVRAREEKAQQGMEILRFLEKEFYDLQGLCERKYEHL  775

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC EEG+KREH I+FVRRSYD  L+KRR+EL+ES +E T    RFE++A
Sbjct  776   SYEEALQAVEDLCSEEGRKREHAIEFVRRSYDSVLRKRREELIESENEVTFIGSRFELDA  835

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AESLN ++FGFE+TY G +SHLCDLESGE++DWR+KDYL+Q DSCVEVA+QRQ
Sbjct  836   ISNVLKEAESLNGSRFGFEETYIGGTSHLCDLESGEEEDWRLKDYLHQVDSCVEVALQRQ  895

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEHVS+ELSKIDARIMRVV+GMQ+L+VKLE  SA DYR+ILV L+KS++RA+LEDLAE+D
Sbjct  896   KEHVSIELSKIDARIMRVVAGMQRLKVKLEHASAQDYRRILVTLLKSFMRANLEDLAEKD  955

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAEL RDSK SS  G+  +KH+H+K +DKKK K+YRKTKD K ++GN 
Sbjct  956   ATEKSDAAREAFLAELDRDSKNSSGGGNGYSKHTHDKIKDKKKNKEYRKTKDSKPTSGNE  1015

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
             LH L H T  + SF+V HDG  +  E    G +   Q   E RRRIELEAEERKLEETLE
Sbjct  1016  LHLLRHQTMADGSFAVTHDGEDQGDETVGNGDSLDEQ---EYRRRIELEAEERKLEETLE  1072

Query  3579  YQRRIENEAKLKHLAEQHKKGAR  3647
             YQRR+ENEAKLKHLAEQ+K+  +
Sbjct  1073  YQRRMENEAKLKHLAEQNKRTTK  1095


 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/505 (72%), Positives = 410/505 (81%), Gaps = 9/505 (2%)
 Frame = +1

Query  3715  VNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrs  3888
             +N+Q  ++KK     NG P  LE  PK+S        G SN G  ED  L S RR+GRR 
Sbjct  1119  INEQWKSSKK----MNGFPDSLEV-PKHSAEGMTQNTGLSNEGIPEDSTLISARRSGRRG  1173

Query  3889  rrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEE  4068
             RRQK S   +  K    ++  EN EVGE R +D S E   +  SG KTLRQLHVE+DDEE
Sbjct  1174  RRQKDSKLIDG-KFQSASAERENTEVGEPRALDASPENNGSANSGTKTLRQLHVEEDDEE  1232

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGT  4248
             RFQADL KAVRQSLDTFHAH+KLPL+P  G   I  + N G    + +TG V  +++YGT
Sbjct  1233  RFQADLKKAVRQSLDTFHAHEKLPLLPSLGNGHIL-LPNAGTLSNEKSTGDVTVMDLYGT  1291

Query  4249  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLAS  4428
             GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR++SEH+HVGDPCV+CALYDIFTALS AS
Sbjct  1292  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRTASEHVHVGDPCVICALYDIFTALSTAS  1351

Query  4429  SETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTE  4608
             +ET R+ VAP+SLRIALSNLYPD   FQEGQMNDASEVLGVIF+CLH+SFTSASG SDTE
Sbjct  1352  TETCRETVAPSSLRIALSNLYPDNNFFQEGQMNDASEVLGVIFDCLHRSFTSASGVSDTE  1411

Query  4609  SVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTM  4788
             S DSSCMG+WDC+N AC+VHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRT+
Sbjct  1412  SADSSCMGTWDCSNGACVVHSLFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTL  1471

Query  4789  KVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCES  4968
             KVMC +SSFDELLNLVEMNHQLACD +  GCGK N+IHH LSTPPHVFT VLGWQNTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  4969  VEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDD  5148
             V+DI ATL ALSTE+DI VLYRGLDPK+KH L+SVVCYYGQHYHCFAY HDH RW+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  5149  KTVKVIGNWADVLTMCERGHLQPQV  5223
             KTVKVIG+W DVL MCERGHLQPQ+
Sbjct  1592  KTVKVIGSWDDVLVMCERGHLQPQM  1616



>ref|XP_009588932.1| PREDICTED: uncharacterized protein LOC104086396 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588933.1| PREDICTED: uncharacterized protein LOC104086396 isoform X1 [Nicotiana 
tomentosiformis]
Length=1623

 Score =  1382 bits (3578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1103 (69%), Positives = 891/1103 (81%), Gaps = 16/1103 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV-----QEKSLIRHDQA  527
             M HKKR +APRSKPS APV V  V  D       LESD + V V     ++ S  +   A
Sbjct  1     MVHKKRTVAPRSKPSAAPVAVLPVPDDAEIEL--LESDLNLVSVSPAGRKKPSSKKDASA  58

Query  528   VVESETNA-SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             V E E NA S+SYA+IKLECERALTSLRRGNH KALRLMK+L +KH+N P  ALI+RVQG
Sbjct  59    VAEGEKNAFSASYASIKLECERALTSLRRGNHTKALRLMKELSSKHDNLPYAALIHRVQG  118

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K+RHLKNAI+SARK+V MSPNSIEFAHFYANLLYEAAN+GKEYEE
Sbjct  119   TVCVKVASVIDDPNAKHRHLKNAIESARKAVSMSPNSIEFAHFYANLLYEAANEGKEYEE  178

Query  885   VVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQE +QQKV TP ARI HVQ ELR LIQ+SN+ASISTW+
Sbjct  179   VVQECERALAIENPVDPAKESLQEESQQKVETPHARIEHVQNELRGLIQKSNIASISTWM  238

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             K+ G+GEEKFRLIPIRR+ EDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLL
Sbjct  239   KHIGNGEEKFRLIPIRRVCEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLL  298

Query  1242  QQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             QQKSE+ ++ ND +++ DL+ G+GQR  ERRKSGNARKN SS ER++ V+SYWNSM+ D 
Sbjct  299   QQKSETVETDNDVDKASDLTTGSGQRIGERRKSGNARKNASSTERKNWVQSYWNSMTLDR  358

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLRI I DLK+H  + K GLANEVLSEALSFAE NK WKFW CC C E+F DSESH 
Sbjct  359   KKELLRITISDLKAHLNASKGGLANEVLSEALSFAETNKDWKFWACCRCGEKFIDSESHN  418

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
              HV++EH+ +L PKLQS+LPQNVENEW EMLLNC WKPLD++AAAK+L++Q + + HGFL
Sbjct  419   HHVVHEHIGTLLPKLQSILPQNVENEWAEMLLNCPWKPLDVSAAAKMLDEQSRSQEHGFL  478

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDR  1958
             + T+ R + +ESKDD+SD +CN   WD SP KK  GD  NG  V+SREYDK S++  MD 
Sbjct  479   DETHPRDNTEESKDDVSDVFCNEDEWDSSPRKKKLGDRTNGYRVESREYDKISDIELMDC  538

Query  1959  DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQ  2138
             DGN GTK C   + WP++DDP+RAKLLE I+ +FQ LI NKYL SSHLSKV+HFAVEELQ
Sbjct  539   DGNNGTKNCFLPDKWPLSDDPDRAKLLEGIHAIFQALIGNKYLASSHLSKVVHFAVEELQ  598

Query  2139  SLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTG  2318
              L +GSQLLNYN+DQTPLCICFL A ELKK+LKFLQELSH CGLG Y E+ +A D  S  
Sbjct  599   GLAFGSQLLNYNVDQTPLCICFLDAQELKKVLKFLQELSHCCGLGWYSEKISASDGASNA  658

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              QG D +EK+VFSED SCLLFDEHF PCKLTP +F D V  D    +A + S+ Q  NG 
Sbjct  659   SQGFDDLEKVVFSEDSSCLLFDEHFLPCKLTPSSFPDTVSID---RTAYVLSSNQYQNGA  715

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
              LD   LLSWIF G SS EQL SW R+REEKAQQ MEI+R LEKEFY+LQGLCERK EHL
Sbjct  716   ELDFAALLSWIFTGPSSLEQLASWVRAREEKAQQGMEILRFLEKEFYDLQGLCERKYEHL  775

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC EEG+KREH I+FVRRSYD  L+KRR+EL+ES +E T    RFE++A
Sbjct  776   SYEEALQAVEDLCSEEGRKREHAIEFVRRSYDSVLRKRREELIESENEVTFIGSRFELDA  835

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AESLN ++FGFE+TY G +SHLCDLESGE++DWR+KDYL+Q DSCVEVA+QRQ
Sbjct  836   ISNVLKEAESLNGSRFGFEETYIGGTSHLCDLESGEEEDWRLKDYLHQVDSCVEVALQRQ  895

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEHVS+ELSKIDARIMRVV+GMQ+L+VKLE  SA DYR+ILV L+KS++RA+LEDLAE+D
Sbjct  896   KEHVSIELSKIDARIMRVVAGMQRLKVKLEHASAQDYRRILVTLLKSFMRANLEDLAEKD  955

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAEL RDSK SS  G+  +KH+H+K +DKKK K+YRKTKD K ++GN 
Sbjct  956   ATEKSDAAREAFLAELDRDSKNSSGGGNGYSKHTHDKIKDKKKNKEYRKTKDSKPTSGNE  1015

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
             LH L H T  + SF+V HDG  +  E    G +   Q   E RRRIELEAEERKLEETLE
Sbjct  1016  LHLLRHQTMADGSFAVTHDGEDQGDETVGNGDSLDEQ---EYRRRIELEAEERKLEETLE  1072

Query  3579  YQRRIENEAKLKHLAEQHKKGAR  3647
             YQRR+ENEAKLKHLAEQ+K+  +
Sbjct  1073  YQRRMENEAKLKHLAEQNKRTTK  1095


 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/505 (72%), Positives = 410/505 (81%), Gaps = 9/505 (2%)
 Frame = +1

Query  3715  VNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrs  3888
             +N+Q  ++KK     NG P  LE  PK+S        G SN G  ED  L S RR+GRR 
Sbjct  1119  INEQWKSSKK----MNGFPDSLEV-PKHSAEGMTQNTGLSNEGIPEDSTLISARRSGRRG  1173

Query  3889  rrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEE  4068
             RRQK S   +  K    ++  EN EVGE R +D S E   +  SG KTLRQLHVE+DDEE
Sbjct  1174  RRQKDSKLIDG-KFQSASAERENTEVGEPRALDASPENNGSANSGTKTLRQLHVEEDDEE  1232

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGT  4248
             RFQADL KAVRQSLDTFHAH+KLPL+P  G   I  + N G    + +TG V  +++YGT
Sbjct  1233  RFQADLKKAVRQSLDTFHAHEKLPLLPSLGNGHIL-LPNAGTLSNEKSTGDVTVMDLYGT  1291

Query  4249  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLAS  4428
             GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR++SEH+HVGDPCV+CALYDIFTALS AS
Sbjct  1292  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRTASEHVHVGDPCVICALYDIFTALSTAS  1351

Query  4429  SETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTE  4608
             +ET R+ VAP+SLRIALSNLYPD   FQEGQMNDASEVLGVIF+CLH+SFTSASG SDTE
Sbjct  1352  TETCRETVAPSSLRIALSNLYPDNNFFQEGQMNDASEVLGVIFDCLHRSFTSASGVSDTE  1411

Query  4609  SVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTM  4788
             S DSSCMG+WDC+N AC+VHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRT+
Sbjct  1412  SADSSCMGTWDCSNGACVVHSLFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTL  1471

Query  4789  KVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCES  4968
             KVMC +SSFDELLNLVEMNHQLACD +  GCGK N+IHH LSTPPHVFT VLGWQNTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  4969  VEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDD  5148
             V+DI ATL ALSTE+DI VLYRGLDPK+KH L+SVVCYYGQHYHCFAY HDH RW+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  5149  KTVKVIGNWADVLTMCERGHLQPQV  5223
             KTVKVIG+W DVL MCERGHLQPQV
Sbjct  1592  KTVKVIGSWDDVLVMCERGHLQPQV  1616



>ref|XP_004241561.1| PREDICTED: uncharacterized protein LOC101248307 [Solanum lycopersicum]
Length=1638

 Score =  1359 bits (3518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/1101 (67%), Positives = 893/1101 (81%), Gaps = 11/1101 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR +APRSKP  +P  V+      +     L+  ++   +   SL R+D   V   
Sbjct  1     MGHKKRTVAPRSKPLSSPAAVSEDGSPPSIDAD-LKLVSTIPSITNGSLSRNDALAVNDY  59

Query  543   TNASSSYAN----IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
              N++SS +     IKLECERALTSLRRGNH KALRLMKDL  KHENSP+ ALI+RVQGTV
Sbjct  60    ENSTSSSSASYASIKLECERALTSLRRGNHTKALRLMKDLSTKHENSPHSALIHRVQGTV  119

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVASIIDDPN K RHL+NAI+SARK+V +SP S+EF+HFYANLLYEAANDGKEYEEVV
Sbjct  120   CVKVASIIDDPNTKQRHLRNAIESARKAVSLSPYSVEFSHFYANLLYEAANDGKEYEEVV  179

Query  891   QECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QECERALAIENPIDPAKESLQE +QQK+S+PEARI+H+ GEL NLIQ+SN ASISTW+KN
Sbjct  180   QECERALAIENPIDPAKESLQEESQQKISSPEARISHIHGELHNLIQKSNFASISTWMKN  239

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
              G+GEEKFRLIPIRR+SEDPMELRLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ
Sbjct  240   IGTGEEKFRLIPIRRVSEDPMELRLVQGRRPNEIKKATKTPEERRKEIEVRVAAARLLQQ  299

Query  1248  KSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKK  1427
             KSE+ +S ND ++ LD +AG+GQR  +RR SGNA+KN SS ERR  V+SYWNS+S D+KK
Sbjct  300   KSETVKSQNDVDKGLDSTAGSGQRARDRRSSGNAKKNTSSTERRKWVQSYWNSISLDVKK  359

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LLRIRI DLK+HF + KD LA EVLS+AL FAE +K W+FW CC C E FADS+SH+ H
Sbjct  360   ELLRIRISDLKTHFTASKDHLAIEVLSDALPFAETHKTWEFWRCCRCNENFADSQSHVHH  419

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLEN  1787
             V+++HM +L PK+QSVLPQNVENEW EMLLNCSWKPLDINAA K+L+KQ + + HGFL+ 
Sbjct  420   VVHDHMGALLPKMQSVLPQNVENEWAEMLLNCSWKPLDINAAVKMLDKQSRYQGHGFLDE  479

Query  1788  TYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDG  1964
             TY R D +  KDD  + +C+V  WD SP +K  GD  N   V+SR+ DK S++ +MD D 
Sbjct  480   TYGRDDGEGPKDDYLEAFCHVDEWDSSPRRKKVGDRLNVNMVESRKNDKISDIDYMDCDE  539

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
             + G+KIC   E  P++DDPERAKLLERI  VF+ LIKNKYL S+HLSKV+H+ VEELQSL
Sbjct  540   DGGSKICLLPEDMPLSDDPERAKLLERIRAVFEALIKNKYLASTHLSKVMHYVVEELQSL  599

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQ  2324
              +GSQLLNYNIDQ+PLCICFLG  ELKK+LK+LQELSHSCGLGRYPE+  A+D+ S G  
Sbjct  600   SFGSQLLNYNIDQSPLCICFLGPEELKKVLKYLQELSHSCGLGRYPEKVGAVDETSNGCH  659

Query  2325  GVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLL  2504
             G+D +EKIVFS+D SCLLFD++F    L+P ++ D V  D    + AI S  Q  +G L+
Sbjct  660   GIDNLEKIVFSDDSSCLLFDQYFLERNLSPSSYPDAVSND---RNTAILSGNQYQDGVLV  716

Query  2505  DSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNY  2684
             D D LLSW+F G SS   L SW+R+REEK QQ MEI+RLLEKE+Y+LQGLCERKCEHL+Y
Sbjct  717   DPDALLSWLFTGPSSVAALASWTRAREEKGQQGMEILRLLEKEYYDLQGLCERKCEHLSY  776

Query  2685  EEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAIS  2864
             EEALQVVEDLCLEEGKKREH  +FVR+SYD  L+KRR++L++S ++ T  + R E++AIS
Sbjct  777   EEALQVVEDLCLEEGKKREHETEFVRQSYDSILRKRREQLIDSDNDTTIISNRPELDAIS  836

Query  2865  SVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKE  3044
             +VLK+AESLNVNQFGF++TYGG +S  CDLESGE+DDWR+KDYL+Q DS VEVAIQRQKE
Sbjct  837   NVLKEAESLNVNQFGFDETYGGGTSQFCDLESGEEDDWRLKDYLHQVDSSVEVAIQRQKE  896

Query  3045  HVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDAT  3224
             H+S+ELSKIDARIMRVV+GMQQLE KLE  S+ DYR+ILVPL+KS+LRAHLEDLAE+DAT
Sbjct  897   HISIELSKIDARIMRVVTGMQQLESKLEPASSQDYRRILVPLLKSFLRAHLEDLAEKDAT  956

Query  3225  EKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLH  3404
             EKSDA REAFLAELARDS+KSS+ G+E +KH+HEKT+DKKK ++YRK KD K ++GN LH
Sbjct  957   EKSDATREAFLAELARDSEKSSSWGNEKSKHAHEKTKDKKKKQEYRKAKDSKPNSGNELH  1016

Query  3405  ALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQ  3584
              LHH+T +  S  + HDG  +++E+   G NS+  +EEE +R IELEAEERKLEETLEYQ
Sbjct  1017  VLHHETVDHVSSPLAHDGDDQESEIPQTG-NSLDLQEEEYKRMIELEAEERKLEETLEYQ  1075

Query  3585  RRIENEAKLKHLAEQHKKGAR  3647
             RRIENEAKLKHLAEQHK+  R
Sbjct  1076  RRIENEAKLKHLAEQHKRTVR  1096


 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/522 (69%), Positives = 408/522 (78%), Gaps = 8/522 (2%)
 Frame = +1

Query  3667  KQRPILFLNYNEQDHVVNKQQGTTKKELLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLE  3846
             K  P  +L   + D  VN+Q   ++K  +  N   +EG  KN       + G SN G  E
Sbjct  1115  KSSPDTYLKSCDIDQKVNEQWKRSEKNNVLLNS--VEGLSKNFPERMSQRDGLSNKGTPE  1172

Query  3847  DGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGP  4026
             DG L SD+R+GR+ RR K S+K++E      +S  EN +V E + +D S E     +SG 
Sbjct  1173  DGILMSDKRSGRKGRRPKDSSKFSEGNYQSGSSERENTQVSESKALDSSHENNGTRDSGT  1232

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQ-ISEMANLGVSCE  4203
             KTLRQLHVE+DDEERFQADL +AVRQSLD FHAHQK PL+  SG  + ISE  +L     
Sbjct  1233  KTLRQLHVEEDDEERFQADLKRAVRQSLDAFHAHQKFPLMASSGRQRMISETGDLS---N  1289

Query  4204  DVATGIVNGIE-VYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDP  4377
             +++ G V  ++ VYGTGLKNEVGEYNCFLNVIIQSLWHLR+FRD+FLR SSSEH HVGDP
Sbjct  1290  EISFGNVKEMDDVYGTGLKNEVGEYNCFLNVIIQSLWHLRQFRDDFLRRSSSEHDHVGDP  1349

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             CVVCALYDIFTAL+ AS+E +R+A+AP SLRIALSNLYP+   FQE QMND+SEVLGVIF
Sbjct  1350  CVVCALYDIFTALNTASTEMQREAIAPTSLRIALSNLYPNSNFFQEAQMNDSSEVLGVIF  1409

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
             +CLH+SFTS  G SD ES DSSC GSWDC +SAC VHSLFGMD+FERMNCY CGLESRHL
Sbjct  1410  DCLHRSFTSTLGGSDAESADSSCTGSWDCTSSACTVHSLFGMDIFERMNCYNCGLESRHL  1469

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+  GC K N+IHH LS 
Sbjct  1470  KYTSFFHNINASALRTMKVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSA  1529

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHY  5097
             PPH+FTTVLGWQNTCE V+DI ATL ALSTE+DI VLYRGLDPK+KHCL SVVCYYGQHY
Sbjct  1530  PPHIFTTVLGWQNTCEDVDDIKATLSALSTEVDIGVLYRGLDPKNKHCLTSVVCYYGQHY  1589

Query  5098  HCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HCFAYSHD  +WIMYDDKTVKVIG W DVL MCERGHLQPQV
Sbjct  1590  HCFAYSHDRGQWIMYDDKTVKVIGGWDDVLVMCERGHLQPQV  1631



>ref|XP_009594415.1| PREDICTED: uncharacterized protein LOC104090916 [Nicotiana tomentosiformis]
 ref|XP_009594416.1| PREDICTED: uncharacterized protein LOC104090916 [Nicotiana tomentosiformis]
Length=1641

 Score =  1359 bits (3517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1112 (69%), Positives = 902/1112 (81%), Gaps = 24/1112 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEK----SLIRHDQAV  530
             MGHKKR +APRSKPS++P  V +V+ D + P A L+++   VL+       SL ++D  V
Sbjct  1     MGHKKRTVAPRSKPSISPAAVPSVSDDGSPPSA-LDAEQKLVLINPSISNGSLSKNDAVV  59

Query  531   V-ESETNASSSYAN----IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYR  695
             V + E N SSS A     IKLECERALTSLRRGNH KALRLMKDL  KHE+SP  ALI+R
Sbjct  60    VFDCENNGSSSSAASYASIKLECERALTSLRRGNHTKALRLMKDLSTKHESSPYSALIHR  119

Query  696   VQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKE  875
             VQGTVCVK+ASIIDDPN K RHL+NAI+SAR++V +SP SIEFAHFYANLLYEAANDGKE
Sbjct  120   VQGTVCVKIASIIDDPNAKQRHLRNAIESARRAVSLSPYSIEFAHFYANLLYEAANDGKE  179

Query  876   YEEVVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASIS  1052
             YEEVVQECERA+AIENPIDPAKESLQE +QQK+S  EARI+H++GEL+NLIQ+SN ASIS
Sbjct  180   YEEVVQECERAMAIENPIDPAKESLQEESQQKISPAEARISHIRGELQNLIQKSNFASIS  239

Query  1053  TWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAA  1232
             +W+KN G+GEEKFRLIPIRR+SEDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAA
Sbjct  240   SWMKNIGTGEEKFRLIPIRRVSEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAA  299

Query  1233  RLLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             RLLQQKS + +S N+    LD +AG+GQR  ERRKSGNARK  SS ERR+ V+SYWNSMS
Sbjct  300   RLLQQKSGTVKSQNEEYTGLDSTAGSGQRAGERRKSGNARKTASSTERRNLVQSYWNSMS  359

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSE  1592
              D+KK+L  IRI DLK+HF S KD LA EVLSE+L+FA+ NK WKFWTCC C E+FA+SE
Sbjct  360   LDVKKELFSIRISDLKAHFSSSKDRLAIEVLSESLAFAKTNKTWKFWTCCRCSEKFANSE  419

Query  1593  SHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVH  1772
             SHI HV+++HM +L PK+QSVLPQ+VENEW EMLLNCSWKPLD+NAA ++L+KQ + + H
Sbjct  420   SHIHHVVHDHMGALLPKMQSVLPQSVENEWAEMLLNCSWKPLDVNAAVEILDKQSRSQGH  479

Query  1773  GFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-W  1949
             GFL+ +Y R D + SKDD  + +C+   WD S  KK  GD  N   V+SR+ DK S++ +
Sbjct  480   GFLDESYERDDGEGSKDDFLEAFCHEDEWDTSARKKKLGDRPNRDMVESRKNDKISDIDF  539

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
             MD DG+ G KI    E  P++DDPER KLLERI+ VF+TLIKNKYL SSHLSKV+HFAVE
Sbjct  540   MDCDGDGGPKIHLLPEGLPLSDDPERVKLLERIHAVFETLIKNKYLASSHLSKVMHFAVE  599

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPE------RS  2291
             ELQ L +GS+LLNYNIDQ+PLCICFLG  ELKKILK+LQELSHSCGLGRYPE        
Sbjct  600   ELQGLAFGSKLLNYNIDQSPLCICFLGPEELKKILKYLQELSHSCGLGRYPEGLGRYPER  659

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
             T  D+ S G  G D +EKIVFSED +CLLFD+ F    L+P +  + V  D     AAI 
Sbjct  660   TGFDETSNGCHGFDDLEKIVFSEDDTCLLFDKQFLQHNLSPSSCPNAVSND---RPAAIL  716

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
             S  Q  NG L+DSD LLSW+F G SS E L SW+R+REEKAQQ MEI+RLLEKE+Y+LQG
Sbjct  717   SGNQYQNGVLIDSDALLSWLFTGPSSVEALASWTRAREEKAQQGMEILRLLEKEYYDLQG  776

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LCERK EHL+YEEALQ VEDLCLEEGKKREH ++FVR+SYD  L+KRR+EL+ES  E T 
Sbjct  777   LCERKSEHLSYEEALQAVEDLCLEEGKKREHEVEFVRQSYDSVLRKRREELIESDSEVTI  836

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
              + RFE++AIS+VLK+AESLNVNQFGFE+TYGG +S  CDLESGE+DDWR+KDYL+Q DS
Sbjct  837   IS-RFELDAISNVLKEAESLNVNQFGFEETYGGGTSQFCDLESGEEDDWRLKDYLHQVDS  895

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
              VEVAIQRQKEHVS+ELSKIDARIMR+V+GMQQLEVKLE  SA DYRQILVPL+KS++RA
Sbjct  896   SVEVAIQRQKEHVSIELSKIDARIMRMVTGMQQLEVKLEPASAQDYRQILVPLLKSFMRA  955

Query  3192  HLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktk  3371
             HLEDLAE+DATEKSDAAR+AFLAELARDS+KSS+ G+E +KH+HEKT+DKKK K+YR+ K
Sbjct  956   HLEDLAEKDATEKSDAARDAFLAELARDSEKSSSGGNEKSKHAHEKTKDKKKNKEYRRAK  1015

Query  3372  dlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleae  3551
             D K ++GN  H LHH+  E+ASF+   DG  +++E+   G NS+  +EEE RR IELEAE
Sbjct  1016  DSKPNSGNESHVLHHEIVEDASFAAP-DGDDQESEIPQTG-NSLNLQEEEYRRMIELEAE  1073

Query  3552  erkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             ERKLEETLEYQRRIENEAKLKHLAEQHKK AR
Sbjct  1074  ERKLEETLEYQRRIENEAKLKHLAEQHKKSAR  1105


 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/521 (71%), Positives = 414/521 (79%), Gaps = 12/521 (2%)
 Frame = +1

Query  3667  KQRPILFLNYNEQDHVVNKQQGTTKKELLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLE  3846
             K  P  +LN  + D  +N+Q  +++K  +  N   LEG  KN       +         E
Sbjct  1124  KMYPDTYLNCCDIDQKINEQLKSSEKNNVLPNS--LEGPSKN-----FPEVMAQRDESPE  1176

Query  3847  DGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGP  4026
             DG L SD+R+ R+ RRQKGS K++E K    +S  EN  V E R +D S EK    +SG 
Sbjct  1177  DGVLISDKRSARKGRRQKGSTKFSEGKYQSGSSERENTAVSESRALDSSHEKNGTRDSGT  1236

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQI-SEMANLGVSCE  4203
             KTLRQLHVE+DDEERFQADL +AVRQSLD FHAHQKLPL   SG  ++ SE  ++G    
Sbjct  1237  KTLRQLHVEEDDEERFQADLKRAVRQSLDAFHAHQKLPLKASSGAQRMFSETGDMG---N  1293

Query  4204  DVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPC  4380
             +++ G VN ++VYGTGLKNEVGEYNCFLNVIIQSLWHLR+FRDEFLR +SSEH HVGDPC
Sbjct  1294  EISVGNVNEMDVYGTGLKNEVGEYNCFLNVIIQSLWHLRQFRDEFLRRTSSEHDHVGDPC  1353

Query  4381  VVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFE  4560
             VVCALYDIFTALS+AS+E RR+AVAP +LRIALSNLYPD   FQE QMNDASEVLGVIF+
Sbjct  1354  VVCALYDIFTALSMASTEMRREAVAPTTLRIALSNLYPDSNFFQEAQMNDASEVLGVIFD  1413

Query  4561  CLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLK  4740
             CLH+SF S SG SDTES DSSCMGSWDC++SACIVHSLFGMD+FERMNCY CGLESRHLK
Sbjct  1414  CLHRSFISTSGLSDTESADSSCMGSWDCSSSACIVHSLFGMDIFERMNCYNCGLESRHLK  1473

Query  4741  YTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTP  4920
             YTSFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+  GC K N+IHH LS P
Sbjct  1474  YTSFFHNINASALRTMKVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAP  1533

Query  4921  PHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYH  5100
             PHVFTTVLGWQNTCESV+DI ATL ALSTE+DI VLYRGLDPK+KH LVSVVCYYGQHYH
Sbjct  1534  PHVFTTVLGWQNTCESVDDIKATLSALSTEVDIGVLYRGLDPKNKHYLVSVVCYYGQHYH  1593

Query  5101  CFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CFAYS D  +WIMYDDKTVKVIG W DVL MCERGHLQPQV
Sbjct  1594  CFAYSRDRGQWIMYDDKTVKVIGGWDDVLVMCERGHLQPQV  1634



>ref|XP_009790879.1| PREDICTED: uncharacterized protein LOC104238260 [Nicotiana sylvestris]
 ref|XP_009790880.1| PREDICTED: uncharacterized protein LOC104238260 [Nicotiana sylvestris]
Length=1635

 Score =  1352 bits (3499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 755/1106 (68%), Positives = 899/1106 (81%), Gaps = 18/1106 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEK----SLIRHDQAV  530
             MG KKR +APRSKPS++P  V +V+ D + P A L+++   VL+       SL ++   +
Sbjct  1     MGPKKRTVAPRSKPSISPAAVPSVSDDGSPPSA-LDAEQKLVLINPSISNGSLSKNGAVL  59

Query  531   V-ESETNASSSYAN----IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYR  695
             V + E N SSS A     IKLECERALTSLRRGNH KALRLMKDL  KHE+SP  ALI+R
Sbjct  60    VFDCENNGSSSSAASYASIKLECERALTSLRRGNHTKALRLMKDLSTKHESSPYSALIHR  119

Query  696   VQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKE  875
             VQGTVCVKVASIIDDPN K RHL+NAI+SAR++V +SP SIEFAHFYANLLYEAANDGKE
Sbjct  120   VQGTVCVKVASIIDDPNAKQRHLRNAIESARRAVSLSPYSIEFAHFYANLLYEAANDGKE  179

Query  876   YEEVVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASIS  1052
             YEEVVQECERALAIENPIDPAKESLQE +QQK+S  EARI+H++GEL+NLIQ+SN ASIS
Sbjct  180   YEEVVQECERALAIENPIDPAKESLQEESQQKISPAEARISHIRGELQNLIQKSNFASIS  239

Query  1053  TWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAA  1232
             +W+KN G+GEEKFRLIPIRR+SEDPMELRLVQAR+PNEIKKATKTPEERRKEIEVRVAAA
Sbjct  240   SWMKNIGTGEEKFRLIPIRRVSEDPMELRLVQARRPNEIKKATKTPEERRKEIEVRVAAA  299

Query  1233  RLLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             RLLQQKS + +S N+ ++ LD +AG+GQR  ERRKSGNARK  SS ERR+ V+SYWNSMS
Sbjct  300   RLLQQKSGTVKSQNEVDKDLDSTAGSGQRAGERRKSGNARKTASSTERRNLVQSYWNSMS  359

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSE  1592
              D+KK+LL IRI DLK+HF S KD LA EVLSEAL+FA+ NK WKFWTCC C E+FA+SE
Sbjct  360   LDVKKELLSIRISDLKAHFSSSKDRLAIEVLSEALAFAKTNKTWKFWTCCRCSEKFANSE  419

Query  1593  SHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVH  1772
             SHI HV+++HM +L PK+QSVLPQ+VE EW EMLLNCSWKPLD+NAA ++L+KQ + + H
Sbjct  420   SHIHHVVHDHMGALLPKMQSVLPQSVEKEWAEMLLNCSWKPLDVNAAVEILDKQSRSQGH  479

Query  1773  GFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-W  1949
             GFL+ +Y R D + SKDD  + +C+   W  SP ++  GD  N   V+SR+ DK S++ +
Sbjct  480   GFLDESYERDDGEGSKDDFLEAFCHEDEWGTSPRRRKLGDRPNRDMVESRKNDKISDIDF  539

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
             MD DG  G KI    E  P++DDPER KLLERI+ VF+TLIKNKYL SSHLSKVIHFAVE
Sbjct  540   MDCDGEGGPKIHLLPEGLPLSDDPERVKLLERIHAVFETLIKNKYLASSHLSKVIHFAVE  599

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             ELQ L +GS+LLN NIDQ+PLCICFLG  ELKKILK+LQELSHSCGLGRYPER+  +D+ 
Sbjct  600   ELQGLAFGSKLLNCNIDQSPLCICFLGPEELKKILKYLQELSHSCGLGRYPERTGFLDET  659

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
             S G  G D +EKIVFSED +CLLFD+ F    L+P +  + V  D     AAI S  Q  
Sbjct  660   SNGCHGFDDLEKIVFSEDDTCLLFDKQFLQHNLSPSSCPNAVSND---RPAAILSGNQYQ  716

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
             NG ++DSD LLSW+F G SS E L SW+R+R+EKAQQ MEI+RLLEKE+Y+LQGLCERK 
Sbjct  717   NGVIIDSDALLSWLFTGPSSVEALASWTRARKEKAQQGMEILRLLEKEYYDLQGLCERKS  776

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             EHL+YEEALQ VEDLCLEEGKKREH I+FVR+SYD  L+KRR+EL+ES +E T  + RFE
Sbjct  777   EHLSYEEALQAVEDLCLEEGKKREHEIEFVRQSYDSVLRKRREELIESDNEVTIIS-RFE  835

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++AIS+VLK+AESLNVNQFGFE+TYGG +S  CDLESGE+DDWR+KDYL+Q DS VEVAI
Sbjct  836   LDAISNVLKEAESLNVNQFGFEETYGGGTSQFCDLESGEEDDWRLKDYLHQVDSSVEVAI  895

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             QRQKEHVS+ELSKID RIMR+V+GMQQLEVKLE  SA DYRQILVPL+KS++RAHLED+A
Sbjct  896   QRQKEHVSIELSKIDGRIMRMVTGMQQLEVKLEPASAQDYRQILVPLLKSFMRAHLEDVA  955

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAAR+AFLAEL RDS KSS+ G+E +KH+HEKT+DKKK K+YR+ KD K ++
Sbjct  956   EKDATEKSDAARDAFLAELVRDSAKSSSGGNEKSKHAHEKTKDKKKNKEYRRAKDSKPNS  1015

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
             GN  H L H+  E+ SF+  HDG  +D+++   G NS+  +EEE RR IELEAEERKLEE
Sbjct  1016  GNETHVLRHEIVEDVSFA-AHDGDDQDSQIPQIG-NSLNLQEEEYRRMIELEAEERKLEE  1073

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TLEYQRRIENEAKLKHLAEQHKK AR
Sbjct  1074  TLEYQRRIENEAKLKHLAEQHKKSAR  1099


 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/521 (69%), Positives = 415/521 (80%), Gaps = 12/521 (2%)
 Frame = +1

Query  3667  KQRPILFLNYNEQDHVVNKQQGTTKKELLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLE  3846
             K  P ++LN  + D  +++Q  +++K  +  N   LEG  KN       +         E
Sbjct  1118  KMYPDIYLNCCDIDQKISEQLKSSEKNNVLPNS--LEGPSKN-----FPEVMAQRDESPE  1170

Query  3847  DGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGP  4026
             DG L +D+R+ R+ RRQKGS K++E K    +S  EN  V E R +D S EK    +SG 
Sbjct  1171  DGVLIADKRSARKGRRQKGSTKFSEGKYQSGSSERENTAVSESRALDSSHEKNGTRDSGT  1230

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQI-SEMANLGVSCE  4203
             KTLRQLHVE+DDEERFQADL +AVRQSLD FHAHQKLPL   SG  ++ SE  ++G    
Sbjct  1231  KTLRQLHVEEDDEERFQADLKRAVRQSLDAFHAHQKLPLKASSGAQRMFSETRDMGG---  1287

Query  4204  DVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPC  4380
             +++ G VN ++VYGTGLKNE+GEYNCFLNVIIQSLWHLR+FRDEFLR + SEH HVGDPC
Sbjct  1288  EISVGNVNEMDVYGTGLKNEIGEYNCFLNVIIQSLWHLRQFRDEFLRRTPSEHDHVGDPC  1347

Query  4381  VVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFE  4560
             VVCALYDIFTALS+AS+E RR+AVAP++LRIALSNLYPD   FQE QMNDASEVLGVIF+
Sbjct  1348  VVCALYDIFTALSMASTEMRREAVAPSTLRIALSNLYPDSNFFQEAQMNDASEVLGVIFD  1407

Query  4561  CLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLK  4740
             CLH+SF S SG SDTES DSSCMGSWDC++SACIVHSLFGMD+FE+MNCY CGLESRHLK
Sbjct  1408  CLHRSFISTSGVSDTESADSSCMGSWDCSSSACIVHSLFGMDIFEQMNCYNCGLESRHLK  1467

Query  4741  YTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTP  4920
             YTSFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+  GC K N+IHH LS P
Sbjct  1468  YTSFFHNINASALRTMKVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAP  1527

Query  4921  PHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYH  5100
             PHVFTTVLGWQNTCESV+DI ATL ALSTE+DI +LYRGLDPK+KH LVSVVCYYGQHYH
Sbjct  1528  PHVFTTVLGWQNTCESVDDIKATLSALSTEVDIGILYRGLDPKNKHYLVSVVCYYGQHYH  1587

Query  5101  CFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CFAYS D  +WIMYDDKTVKVIG W DVL MCERGHLQPQV
Sbjct  1588  CFAYSRDRGQWIMYDDKTVKVIGGWDDVLVMCERGHLQPQV  1628



>emb|CDP14890.1| unnamed protein product [Coffea canephora]
Length=1704

 Score =  1352 bits (3499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/1115 (67%), Positives = 881/1115 (79%), Gaps = 28/1115 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  A RSKPSV+     + +       A   +  SA   Q ++LI  + ++  +E
Sbjct  65    MGHKKRNSAARSKPSVSSPAAVSPSPPAVVSAAGDGAVASAE--QPENLISLNPSINTAE  122

Query  543   TNASSSYAN--------------------IKLECERALTSLRRGNHNKALRLMKDLCAKH  662
                S+   N                    IK ECERALT+LRRGNH KALRLMK+L +KH
Sbjct  123   APLSTESENRSESLNSASSSSLASTSYASIKGECERALTALRRGNHTKALRLMKELSSKH  182

Query  663   ENSPNLALIYRVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYAN  842
             E+SP+ ALI+RVQGTVCVKVASIIDDPN K RHLKNAIDSARK+V +SPNSIEFAHFYAN
Sbjct  183   ESSPHSALIHRVQGTVCVKVASIIDDPNSKQRHLKNAIDSARKAVTLSPNSIEFAHFYAN  242

Query  843   LLYEAANDGKEYEEVVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRN  1019
             L+YEAAN+GKEYEEVVQECERALAIENP+DP KESLQ E+QQK++  EARIAHVQ ELR+
Sbjct  243   LMYEAANEGKEYEEVVQECERALAIENPVDPGKESLQDESQQKLTPAEARIAHVQSELRS  302

Query  1020  LIQRSNLASISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEER  1199
             LIQ+SN+ASISTW+KN G+GEEKFRLIPIRR+SEDPMELRLVQ R+PNEIKKATKTPEER
Sbjct  303   LIQKSNIASISTWMKNLGNGEEKFRLIPIRRVSEDPMELRLVQTRRPNEIKKATKTPEER  362

Query  1200  RKEIEVRVAAARLLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERR  1379
             RKEIEVRVAAARLLQQKSES  S  DG+R LD S+G+GQR  ERRKSG+ARKN SS ER+
Sbjct  363   RKEIEVRVAAARLLQQKSESPLSQADGDRILDSSSGSGQRMGERRKSGSARKNASSAERK  422

Query  1380  DCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTC  1559
             D VRS+WNSMS D KK LLR+R+ DLK+HF   KDG+ANEV+SEAL+FAEANK W F+ C
Sbjct  423   DWVRSFWNSMSLDKKKDLLRVRVSDLKAHFSLSKDGVANEVISEALTFAEANKDWNFFVC  482

Query  1560  CHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAK  1739
             C C E+FAD++SHI HV+ EHM  L PK++ V+P+ VENEW EMLLNC WKPLD++ A K
Sbjct  483   CRCNEKFADADSHIHHVLREHMGILLPKMERVIPKIVENEWAEMLLNCDWKPLDVSTAIK  542

Query  1740  LLEKQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDS  1919
              L +Q K     FL+ +Y R++ ++  +  +D YCN   WD SP KK  GD CNG+++ S
Sbjct  543   TLGEQSKAHGSEFLDESYPRNETEDFNECFADSYCNEDEWDSSPRKKESGDNCNGSSIKS  602

Query  1920  REYDKNSE-VWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSS  2096
             +EYDK S+ VWMD D N+ TK C P +SWP++DD ERAKLLERI+ +FQ LIK+KYL SS
Sbjct  603   KEYDKISDIVWMDCDDNQETKACFPQDSWPVSDDIERAKLLERIHTIFQALIKHKYLASS  662

Query  2097  HLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGR  2276
             HL+KV+ FAVEELQ L YGSQLLN+NIDQTPLCICFLGAPELKKILKF+QEL HSCGLGR
Sbjct  663   HLNKVMRFAVEELQGLAYGSQLLNHNIDQTPLCICFLGAPELKKILKFIQELYHSCGLGR  722

Query  2277  YPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpn  2456
             YP++  A+DD ++G QGV  +EK+V SED SCL  DEHF P K  P + H  V  D +  
Sbjct  723   YPDKGNAVDDANSGNQGVKVLEKLVLSEDASCLSLDEHFLPQKHIPSSCHSVVTGDISAA  782

Query  2457  saaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEF  2636
             +    SN   D+G LLDSD LLSWIF G SSGEQL SW R REEKAQQ +EI++LLEKEF
Sbjct  783   NLPDMSN---DSGNLLDSDALLSWIFFGPSSGEQLASWMRGREEKAQQGIEILQLLEKEF  839

Query  2637  YELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESH  2816
             Y LQGLCERK EHL+Y+EALQ VEDLCLEEGKKREH  +FVRRSY+  L+KRR++L+E  
Sbjct  840   YNLQGLCERKLEHLSYDEALQAVEDLCLEEGKKREHVTEFVRRSYESVLRKRREDLIECD  899

Query  2817  HEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYL  2996
             +E T  + RFE++AIS++LK+AESLNVNQFGFE+ YGG++S LCDLESGED+DWR +DYL
Sbjct  900   NELTIMSNRFELDAISNILKEAESLNVNQFGFEENYGGMTSQLCDLESGEDEDWRTRDYL  959

Query  2997  NQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVK  3176
             +Q DSCVEVAI RQKEHVSVELSKIDARIMRV++ MQQLE KL   SA DYR ILVPLVK
Sbjct  960   HQVDSCVEVAISRQKEHVSVELSKIDARIMRVIAAMQQLEAKLVPASAFDYRAILVPLVK  1019

Query  3177  SYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikd  3356
             SY+RAHLEDLAE+DATEKSDAAREAFLAELA DSKK S+ GS+NA+H HEKT+DKKK KD
Sbjct  1020  SYMRAHLEDLAEKDATEKSDAAREAFLAELALDSKKGSSGGSDNARHMHEKTKDKKKNKD  1079

Query  3357  yrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGS-NSITQeeeeqrrr  3533
             +RK KD K ++G+ LH L  +T +E S+ V H+G    AE+ N G+ +++ QEEEE RRR
Sbjct  1080  FRKAKDSKANSGSELHMLSSETTKEISYPVTHEGEDIHAEIVNAGNGDTLEQEEEEVRRR  1139

Query  3534  ieleaeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             IELEAEERKLEETLEYQRRIENEAK KHLAEQHK+
Sbjct  1140  IELEAEERKLEETLEYQRRIENEAKQKHLAEQHKR  1174


 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/519 (71%), Positives = 416/519 (80%), Gaps = 19/519 (4%)
 Frame = +1

Query  3685  FLNYNEQDHVVNKQQGTTKKE-LLQSNG--SPLEGHPKNSTVSDIHKAGFSNGGFLEDGA  3855
             +L   E DH VN Q    KKE ++Q NG  + +EG  ++       KAG  NGG +EDG 
Sbjct  1192  YLKQQEDDHDVNVQWKYRKKEPMVQKNGFSNAVEGFLEDGVEGVGQKAGLPNGGSIEDGL  1251

Query  3856  LTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTL  4035
             L SDRR+GRR+RRQKG+A+ N+    PV S  EN+E         SL++ H  + G KTL
Sbjct  1252  LPSDRRSGRRNRRQKGAARLNQ----PVLSEKENLEF-------KSLDEAH--DDGTKTL  1298

Query  4036  RQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG--VSCEDV  4209
             RQL  E+DDEERFQADL KAVRQSLD+FHAHQKLPL  + G    +  A     +S +++
Sbjct  1299  RQLQAEEDDEERFQADLKKAVRQSLDSFHAHQKLPLAAKLGMPPKTFPAATDSVISADEI  1358

Query  4210  ATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVV  4386
              T  ++ ++VYGTGLKNE+GEYNCFLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVV
Sbjct  1359  MTENLDQMDVYGTGLKNEIGEYNCFLNVIIQSLWHLRRFRDEFLKRSLSEHVHVGDPCVV  1418

Query  4387  CALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECL  4566
             CALYDIF AL+ AS + RR+AVAP SLRIALSNLYPD   FQEGQMNDASEVLGVIF+CL
Sbjct  1419  CALYDIFAALNTASVDARREAVAPTSLRIALSNLYPDSNFFQEGQMNDASEVLGVIFDCL  1478

Query  4567  HQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYT  4746
             H+SFTS    SD ES+DS+CMGSWDC N AC+ HSLFGMD+FERMNCY CGLESRHLKYT
Sbjct  1479  HRSFTSTMCTSDAESLDSNCMGSWDCTNGACVAHSLFGMDIFERMNCYNCGLESRHLKYT  1538

Query  4747  SFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPH  4926
             SFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+A GCGK N+IHH LSTPPH
Sbjct  1539  SFFHNINASALRTMKVMCPESSFDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPH  1598

Query  4927  VFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCF  5106
             VFTTVLGWQNTCE V+DI ATL AL TE+DISVLYRGLDPK++HCLVSVVCYYGQHYHCF
Sbjct  1599  VFTTVLGWQNTCEHVDDIKATLTALCTEMDISVLYRGLDPKNRHCLVSVVCYYGQHYHCF  1658

Query  5107  AYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             AYS DHERW+MYDDKTVKVIG W DVLTMCERGHLQPQV
Sbjct  1659  AYSQDHERWLMYDDKTVKVIGGWEDVLTMCERGHLQPQV  1697



>ref|XP_006354834.1| PREDICTED: uncharacterized protein LOC102605106 [Solanum tuberosum]
Length=1638

 Score =  1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/1101 (67%), Positives = 892/1101 (81%), Gaps = 11/1101 (1%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQ-AVVES  539
             MGHKKR +APRSKPS +P  V+      +     L+  ++   +   SL R+D  AV + 
Sbjct  1     MGHKKRTVAPRSKPSSSPAAVSEDGSPPSIDAD-LKLVSTIPSITNGSLSRNDALAVNDY  59

Query  540   ETNASSSYAN---IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
             E N+SSS A+   IKLECERALTSLRRGNH KALRLMKDL  KH NSP+ ALI+RVQGTV
Sbjct  60    ENNSSSSSASYASIKLECERALTSLRRGNHTKALRLMKDLSTKHGNSPHSALIHRVQGTV  119

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVASIIDDPN K RHL+NAI+SARK+V +SP S+EF+HFYANLLYEAANDGKEYEEVV
Sbjct  120   CVKVASIIDDPNTKQRHLRNAIESARKAVSLSPYSVEFSHFYANLLYEAANDGKEYEEVV  179

Query  891   QECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QEC+RALAIENPIDPAKESLQE +QQK+S+PEARI+H+ GEL NLIQ+SN ASISTW+KN
Sbjct  180   QECDRALAIENPIDPAKESLQEESQQKISSPEARISHIHGELHNLIQKSNFASISTWMKN  239

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
              G+GEEKFRLIPIRR+SEDPMELRLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ
Sbjct  240   IGTGEEKFRLIPIRRVSEDPMELRLVQGRRPNEIKKATKTPEERRKEIEVRVAAARLLQQ  299

Query  1248  KSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKK  1427
             KSE+ +S NDG++  D +AG+GQR  +RR+SGNA+KN SS ERR  V+SYWNS+S D+KK
Sbjct  300   KSETVKSQNDGDKGFDSTAGSGQRAGDRRRSGNAKKNASSTERRKWVQSYWNSISLDVKK  359

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LLRIRI DLK+HF   KD LA EVLS+AL FAE +K W+FW CC C E F+DS+SH+ H
Sbjct  360   ELLRIRISDLKTHFTVSKDHLAIEVLSDALPFAETHKTWEFWRCCRCNENFSDSQSHVHH  419

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLEN  1787
             V+++HM +L PK+QSVLPQNVENEW EMLLNCSWKPLDINAA K+L+KQ + + HGFL+ 
Sbjct  420   VVHDHMGALLPKMQSVLPQNVENEWAEMLLNCSWKPLDINAAVKMLDKQSRYQGHGFLDE  479

Query  1788  TYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDG  1964
             TY R D +  KD   + + +   WD SP +K  GD  N   V+SR+ DK S++ +MD D 
Sbjct  480   TYGRDDGEGPKDGYLEAFRHEDEWDSSPRRKQVGDRLNVNMVESRKNDKISDIDYMDCDE  539

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
             + G+KIC   E  P++DDPERAKLLERI  VF+ LIKNKYL S+HLSKV+H+ VEELQ L
Sbjct  540   DGGSKICLLPEDLPLSDDPERAKLLERIRAVFEALIKNKYLASTHLSKVMHYVVEELQGL  599

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQ  2324
              +GSQLLNYNIDQ+PLCICFLG  ELKK+LK+LQELSHSCGLGRYPE+  A+D+ S G  
Sbjct  600   PFGSQLLNYNIDQSPLCICFLGPEELKKVLKYLQELSHSCGLGRYPEKIGAVDETSNGCH  659

Query  2325  GVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLL  2504
             G+D +EKIVFSED SCLLFD+HF    L+P ++ D V  D    + AI S  Q  +G L+
Sbjct  660   GIDNLEKIVFSEDSSCLLFDQHFLERNLSPSSYPDAVSND---RNTAILSGNQYQDGVLV  716

Query  2505  DSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNY  2684
             D D LLSW+F G SS   L SW+R+REEK QQ MEI+RLLEKE+Y+LQGLCERKCEHL+Y
Sbjct  717   DPDALLSWLFTGPSSVAALASWTRAREEKGQQGMEILRLLEKEYYDLQGLCERKCEHLSY  776

Query  2685  EEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAIS  2864
             EEALQ VEDLCLEEGKKRE+  +FVR+SYD  L+KRR+EL++S ++ T  + R E++AIS
Sbjct  777   EEALQAVEDLCLEEGKKRENETEFVRQSYDSVLRKRREELIDSDNDTTIISNRPELDAIS  836

Query  2865  SVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKE  3044
             +VLK+AESLNVNQFGF++TYGG +S  CDLESGE+DDWR+KDYL+Q DS VEVAIQRQKE
Sbjct  837   NVLKEAESLNVNQFGFDETYGGGTSQFCDLESGEEDDWRLKDYLHQVDSSVEVAIQRQKE  896

Query  3045  HVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDAT  3224
             H+S+ELSKIDARIMRVV+GMQQLE KLE  SA DYR+ILVPL+KS+LRAHLEDLAE+DAT
Sbjct  897   HISIELSKIDARIMRVVTGMQQLESKLEPASAQDYRRILVPLLKSFLRAHLEDLAEKDAT  956

Query  3225  EKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLH  3404
             EKSDA REAFLAELARDS+KSS+ G+E +KH HEKT+DKKK ++YRK KD K ++GN LH
Sbjct  957   EKSDATREAFLAELARDSEKSSSGGNEKSKHGHEKTKDKKKKQEYRKAKDSKPNSGNELH  1016

Query  3405  ALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQ  3584
              LHH+T +  S  + HDG  +++E+   G NS+  +EEE +R IELEAEERKLEETLEYQ
Sbjct  1017  VLHHETVDHVSSPLAHDGDDQESEIPQTG-NSLDLQEEEYKRMIELEAEERKLEETLEYQ  1075

Query  3585  RRIENEAKLKHLAEQHKKGAR  3647
             RRIENEAKLKHLAEQHK+ AR
Sbjct  1076  RRIENEAKLKHLAEQHKRTAR  1096


 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/522 (69%), Positives = 410/522 (79%), Gaps = 8/522 (2%)
 Frame = +1

Query  3667  KQRPILFLNYNEQDHVVNKQQGTTKKELLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLE  3846
             K  P  +L   + D  +N+Q   +++  +  N   +EG  KN       + G SN G  E
Sbjct  1115  KMNPDTYLKSCDIDQKINEQWNCSEQNNVLLNS--VEGLSKNFPERMAQRDGLSNKGTPE  1172

Query  3847  DGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGP  4026
             DG L SD+R+GR+ RRQK S+K++E      +S  EN EV E + +D S E     +SG 
Sbjct  1173  DGILMSDKRSGRKGRRQKDSSKFSEVNYQSGSSERENTEVSESKALDSSHENNGTRDSGT  1232

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQ-ISEMANLGVSCE  4203
             KTLRQLHVE+DDEERFQADL +AVRQSLD FHAHQK PL+  SG  + ISE  +LG    
Sbjct  1233  KTLRQLHVEEDDEERFQADLKRAVRQSLDAFHAHQKFPLMASSGAQRMISETGDLG---N  1289

Query  4204  DVATGIVNGIE-VYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDP  4377
             +++ G V  ++ VYGTGLKNEVGEYNCFLNVIIQSLWHLR+FRD+FLR SSSEH HVGDP
Sbjct  1290  EISFGNVKEMDDVYGTGLKNEVGEYNCFLNVIIQSLWHLRQFRDDFLRRSSSEHDHVGDP  1349

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             CVVCALYDIFTAL+ AS+E +R+A+AP SLRIALSNLYPD   FQE QMNDASEVLGVIF
Sbjct  1350  CVVCALYDIFTALNTASTEMQREAIAPTSLRIALSNLYPDSNFFQEAQMNDASEVLGVIF  1409

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
              CLH+SFTS  G SD ES DSSC GSWDC++SAC VHSLFGMD+FERMNCY CGLESRHL
Sbjct  1410  NCLHRSFTSTLGRSDAESADSSCTGSWDCSSSACAVHSLFGMDIFERMNCYNCGLESRHL  1469

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+  GC K N+IHH LS 
Sbjct  1470  KYTSFFHNINASALRTMKVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSA  1529

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHY  5097
             PPH+FTTVLGWQNTCE V+DI ATL ALSTE+DI VLYRGLDPK+KH L+SVVCYYGQHY
Sbjct  1530  PPHIFTTVLGWQNTCEDVDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHY  1589

Query  5098  HCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HCFAYSHD  +W+MYDDKTVKVIG W DVL MCERGHLQPQV
Sbjct  1590  HCFAYSHDRGQWLMYDDKTVKVIGGWDDVLVMCERGHLQPQV  1631



>ref|XP_011087202.1| PREDICTED: uncharacterized protein LOC105168755 isoform X2 [Sesamum 
indicum]
Length=1622

 Score =  1301 bits (3367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1102 (65%), Positives = 869/1102 (79%), Gaps = 22/1102 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR +APRSKPS       A         A  E   +  +   K+  + D A +ES 
Sbjct  1     MGHKKRNVAPRSKPSQPQSAAGAEDAAADGGAANPEHSPNPCV---KTTAKSDAADLESS  57

Query  543   TNASSS--YANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
             +NA+ S  YA+IKLECERALT+LRRGNH KALRLMKDL  KHENSP+ ALI+RVQGTVCV
Sbjct  58    SNANFSSSYASIKLECERALTALRRGNHTKALRLMKDLGTKHENSPHSALIHRVQGTVCV  117

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVASIIDDPN K RHLKNAI+SAR++V +SP+SIEF+HFYANLLYEAA+DGKEYEEVVQE
Sbjct  118   KVASIIDDPNAKQRHLKNAIESARRAVSLSPSSIEFSHFYANLLYEAASDGKEYEEVVQE  177

Query  897   CERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERAL IENP+DPAKESLQE NQQK+ST EAR+AHVQ ELR+LIQ+SN+ASISTW+KN G
Sbjct  178   CERALMIENPVDPAKESLQEENQQKISTAEARVAHVQSELRSLIQKSNIASISTWMKNLG  237

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
             +GEEKFRLIPIRR+ EDPMELRL+QAR+PNEIKK  KTPEERRKEIEVRVAAARLLQQKS
Sbjct  238   NGEEKFRLIPIRRVPEDPMELRLIQARRPNEIKKVAKTPEERRKEIEVRVAAARLLQQKS  297

Query  1254  ESAQSFNDGE------RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             ES Q  NDG+      + LD     GQ+  ERRKSG  RKN SS ERRD V+SYWNSMS 
Sbjct  298   ESPQLGNDGDDSNKNNKGLDSYPIPGQKAGERRKSGTVRKNASSDERRDWVQSYWNSMSL  357

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D+KK LLRI+I+DL++HF S KDG  +EVL+EALSF E NKAWKFW CC C ++FAD+  
Sbjct  358   DVKKDLLRIKILDLQAHFSSSKDGSPSEVLNEALSFGETNKAWKFWLCCRCNDKFADAGL  417

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
              +QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPLD+NAA ++L KQ K     
Sbjct  418   FMQHVVQEHMGSLLPKMQSILPQNVENEWAEMLLNCSWKPLDLNAAIRMLGKQSKSDATD  477

Query  1776  FLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMD  1955
             FL+  + ++ +D+SK+   D YC+ Y W  SP KK  GD     T DSRE++     WMD
Sbjct  478   FLDEAHRKNGVDDSKECFIDTYCSEYEWVSSPRKKRSGDNFKVCTKDSREFEDVE--WMD  535

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DG++ +K     E+WP++DDPER K+LERI+ +FQ LIKNKYL + HLSKVIHFAVEEL
Sbjct  536   CDGDQRSKESLLHENWPLSDDPERTKILERIHAIFQALIKNKYLATGHLSKVIHFAVEEL  595

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             Q L  GS LLN N+++TPLCICFLGAPELKKILKFLQE+SHSCGL RY ++S A+DD +T
Sbjct  596   QGLACGSLLLNSNLERTPLCICFLGAPELKKILKFLQEISHSCGLSRYSDKSNAVDDTNT  655

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNG  2495
             G+QGV+ MEKI+FS+D S L+ DEHF PCK+  +++ D V   ++ + +A SS++  +NG
Sbjct  656   GVQGVEIMEKIIFSQDASFLVLDEHFLPCKVPRLSYDDAV---NDCSISATSSHVNYENG  712

Query  2496  GLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEH  2675
              +LDSD LLSWIF G SSGEQL SW   REEKAQ+ +EI++LLEKE Y LQGLCERKCEH
Sbjct  713   VILDSDALLSWIFTGPSSGEQLASWRHVREEKAQKGLEILQLLEKESYHLQGLCERKCEH  772

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             L+YEEALQ VEDLCLEEGKKREH  DF   SYD  L+KRR+EL+E+  ++   + RFE++
Sbjct  773   LSYEEALQAVEDLCLEEGKKREHAKDFAHHSYDSVLRKRREELIENDKDSNIISNRFELD  832

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AI++VLKDAESLNVNQFGFE++Y G++SHLCDLESGE +DWR K+YL+Q DSC+EVAIQR
Sbjct  833   AITNVLKDAESLNVNQFGFEESYSGVTSHLCDLESGE-EDWRRKEYLHQVDSCIEVAIQR  891

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKE VS+E+SKIDARIMR+V GMQQLEVKLE  S+HD+R +L+PLVKS+LRA LEDLAE+
Sbjct  892   QKEQVSIEISKIDARIMRIVVGMQQLEVKLEPASSHDFRSVLIPLVKSFLRARLEDLAEK  951

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DA EKSDAAREAFLAELA DSKK  + G +N++H HE+T+DKKK K+ R+ KDLK ++ +
Sbjct  952   DAREKSDAAREAFLAELALDSKKGVSAGVDNSRHVHERTKDKKKSKESRRNKDLKATHCD  1011

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQ-eeeeqrrrieleaeerkleet  3572
                 LH+ TAEE    V HD     AE+++  S+   Q +EEE +R+IELEAEERKLEET
Sbjct  1012  ---ELHNQTAEEILLQVGHDEDGPGAEIADPVSDDALQLQEEEYKRKIELEAEERKLEET  1068

Query  3573  leYQRRIENEAKLKHLAEQHKK  3638
             LEYQRRIENEAK KHLAEQHK+
Sbjct  1069  LEYQRRIENEAKQKHLAEQHKR  1090


 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/488 (72%), Positives = 392/488 (80%), Gaps = 9/488 (2%)
 Frame = +1

Query  3772  LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGA  3951
             LE  PK+       ++   NGG  ++G   SDRR GRR RRQKG    +  K  P+TS  
Sbjct  1133  LESVPKSFANGATLRSELVNGGIPQEGGSFSDRRPGRRGRRQKGPTNLSNGKNQPLTSEK  1192

Query  3952  ENIEVGEVRPVDDSLEKKHA-GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAH  4128
             E+   G+ R V +S    H  G++  KT RQL VE+DDEERFQADL KAVRQSLDTFHAH
Sbjct  1193  EDSNAGQPRYVQNS----HGDGDNAGKTFRQLQVEEDDEERFQADLKKAVRQSLDTFHAH  1248

Query  4129  QKLPLIPRSGTAQISEMANLGVSC--EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQ  4302
             + LPL   S      E+     SC   +     VNG++ YGTGLKNEVGEYNCFLNVIIQ
Sbjct  1249  RNLPLTSSSALPH-KELPETTDSCGSRNECVTDVNGMDAYGTGLKNEVGEYNCFLNVIIQ  1307

Query  4303  SLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIAL  4479
             SLWHLRRFRDEFLR SSSEH+HVGDPCV+CALYDIF ALS+   + RR+AVAP SLR+AL
Sbjct  1308  SLWHLRRFRDEFLRRSSSEHVHVGDPCVICALYDIFIALSMGPKDNRREAVAPTSLRVAL  1367

Query  4480  SNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSAC  4659
             SNLYPD   FQEGQMNDASEVLGVIF+CLHQSFT AS  SDTESVDSSC GSWDC NS+C
Sbjct  1368  SNLYPDSSFFQEGQMNDASEVLGVIFDCLHQSFTPASHVSDTESVDSSCTGSWDCTNSSC  1427

Query  4660  IVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVE  4839
             I HS+FGMD+FERMNCY CGLESR+LKYTSFFHNINASA+RTMKVMC ++SFDELLNLVE
Sbjct  1428  IAHSIFGMDIFERMNCYNCGLESRYLKYTSFFHNINASAVRTMKVMCPENSFDELLNLVE  1487

Query  4840  MNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDI  5019
             MNHQLACDPDA GCGK N+IHH LS+PPHVFTTVLGWQN+CESV+DITATL ALSTEIDI
Sbjct  1488  MNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNSCESVDDITATLAALSTEIDI  1547

Query  5020  SVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCE  5199
             SVLYRGLDP++K CLVSVVCYYGQHYHCFAYS DHE+WIMYDDKTVKVIG W DVLTMCE
Sbjct  1548  SVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIMYDDKTVKVIGGWNDVLTMCE  1607

Query  5200  RGHLQPQV  5223
             RGHLQPQV
Sbjct  1608  RGHLQPQV  1615



>ref|XP_011087203.1| PREDICTED: uncharacterized protein LOC105168755 isoform X3 [Sesamum 
indicum]
Length=1590

 Score =  1300 bits (3365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1102 (65%), Positives = 869/1102 (79%), Gaps = 22/1102 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR +APRSKPS       A         A  E   +  +   K+  + D A +ES 
Sbjct  1     MGHKKRNVAPRSKPSQPQSAAGAEDAAADGGAANPEHSPNPCV---KTTAKSDAADLESS  57

Query  543   TNASSS--YANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
             +NA+ S  YA+IKLECERALT+LRRGNH KALRLMKDL  KHENSP+ ALI+RVQGTVCV
Sbjct  58    SNANFSSSYASIKLECERALTALRRGNHTKALRLMKDLGTKHENSPHSALIHRVQGTVCV  117

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVASIIDDPN K RHLKNAI+SAR++V +SP+SIEF+HFYANLLYEAA+DGKEYEEVVQE
Sbjct  118   KVASIIDDPNAKQRHLKNAIESARRAVSLSPSSIEFSHFYANLLYEAASDGKEYEEVVQE  177

Query  897   CERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERAL IENP+DPAKESLQE NQQK+ST EAR+AHVQ ELR+LIQ+SN+ASISTW+KN G
Sbjct  178   CERALMIENPVDPAKESLQEENQQKISTAEARVAHVQSELRSLIQKSNIASISTWMKNLG  237

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
             +GEEKFRLIPIRR+ EDPMELRL+QAR+PNEIKK  KTPEERRKEIEVRVAAARLLQQKS
Sbjct  238   NGEEKFRLIPIRRVPEDPMELRLIQARRPNEIKKVAKTPEERRKEIEVRVAAARLLQQKS  297

Query  1254  ESAQSFNDGE------RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             ES Q  NDG+      + LD     GQ+  ERRKSG  RKN SS ERRD V+SYWNSMS 
Sbjct  298   ESPQLGNDGDDSNKNNKGLDSYPIPGQKAGERRKSGTVRKNASSDERRDWVQSYWNSMSL  357

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D+KK LLRI+I+DL++HF S KDG  +EVL+EALSF E NKAWKFW CC C ++FAD+  
Sbjct  358   DVKKDLLRIKILDLQAHFSSSKDGSPSEVLNEALSFGETNKAWKFWLCCRCNDKFADAGL  417

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
              +QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPLD+NAA ++L KQ K     
Sbjct  418   FMQHVVQEHMGSLLPKMQSILPQNVENEWAEMLLNCSWKPLDLNAAIRMLGKQSKSDATD  477

Query  1776  FLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMD  1955
             FL+  + ++ +D+SK+   D YC+ Y W  SP KK  GD     T DSRE++     WMD
Sbjct  478   FLDEAHRKNGVDDSKECFIDTYCSEYEWVSSPRKKRSGDNFKVCTKDSREFEDVE--WMD  535

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DG++ +K     E+WP++DDPER K+LERI+ +FQ LIKNKYL + HLSKVIHFAVEEL
Sbjct  536   CDGDQRSKESLLHENWPLSDDPERTKILERIHAIFQALIKNKYLATGHLSKVIHFAVEEL  595

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             Q L  GS LLN N+++TPLCICFLGAPELKKILKFLQE+SHSCGL RY ++S A+DD +T
Sbjct  596   QGLACGSLLLNSNLERTPLCICFLGAPELKKILKFLQEISHSCGLSRYSDKSNAVDDTNT  655

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNG  2495
             G+QGV+ MEKI+FS+D S L+ DEHF PCK+  +++ D V   ++ + +A SS++  +NG
Sbjct  656   GVQGVEIMEKIIFSQDASFLVLDEHFLPCKVPRLSYDDAV---NDCSISATSSHVNYENG  712

Query  2496  GLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEH  2675
              +LDSD LLSWIF G SSGEQL SW   REEKAQ+ +EI++LLEKE Y LQGLCERKCEH
Sbjct  713   VILDSDALLSWIFTGPSSGEQLASWRHVREEKAQKGLEILQLLEKESYHLQGLCERKCEH  772

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             L+YEEALQ VEDLCLEEGKKREH  DF   SYD  L+KRR+EL+E+  ++   + RFE++
Sbjct  773   LSYEEALQAVEDLCLEEGKKREHAKDFAHHSYDSVLRKRREELIENDKDSNIISNRFELD  832

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AI++VLKDAESLNVNQFGFE++Y G++SHLCDLESGE +DWR K+YL+Q DSC+EVAIQR
Sbjct  833   AITNVLKDAESLNVNQFGFEESYSGVTSHLCDLESGE-EDWRRKEYLHQVDSCIEVAIQR  891

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKE VS+E+SKIDARIMR+V GMQQLEVKLE  S+HD+R +L+PLVKS+LRA LEDLAE+
Sbjct  892   QKEQVSIEISKIDARIMRIVVGMQQLEVKLEPASSHDFRSVLIPLVKSFLRARLEDLAEK  951

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DA EKSDAAREAFLAELA DSKK  + G +N++H HE+T+DKKK K+ R+ KDLK ++ +
Sbjct  952   DAREKSDAAREAFLAELALDSKKGVSAGVDNSRHVHERTKDKKKSKESRRNKDLKATHCD  1011

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQ-eeeeqrrrieleaeerkleet  3572
                 LH+ TAEE    V HD     AE+++  S+   Q +EEE +R+IELEAEERKLEET
Sbjct  1012  ---ELHNQTAEEILLQVGHDEDGPGAEIADPVSDDALQLQEEEYKRKIELEAEERKLEET  1068

Query  3573  leYQRRIENEAKLKHLAEQHKK  3638
             LEYQRRIENEAK KHLAEQHK+
Sbjct  1069  LEYQRRIENEAKQKHLAEQHKR  1090


 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/506 (68%), Positives = 387/506 (76%), Gaps = 44/506 (9%)
 Frame = +1

Query  3718  NKQQGTTKKELLQSNG--SPLEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsr  3891
             N++    K+ L+Q +G    LE  PK+       ++   NGG  ++G   SDRR GRR R
Sbjct  1118  NEKWINRKESLMQKDGLAGGLESVPKSFANGATLRSELVNGGIPQEGGSFSDRRPGRRGR  1177

Query  3892  rqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA-GESGPKTLRQLHVEDDDEE  4068
             RQKG    +  K  P+TS  E+   G+ R V +S    H  G++  KT RQL VE+DDEE
Sbjct  1178  RQKGPTNLSNGKNQPLTSEKEDSNAGQPRYVQNS----HGDGDNAGKTFRQLQVEEDDEE  1233

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGT  4248
             RFQADL KAVRQSLD                                    VNG++ YGT
Sbjct  1234  RFQADLKKAVRQSLD------------------------------------VNGMDAYGT  1257

Query  4249  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLA  4425
             GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR SSSEH+HVGDPCV+CALYDIF ALS+ 
Sbjct  1258  GLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRRSSSEHVHVGDPCVICALYDIFIALSMG  1317

Query  4426  SSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDT  4605
               + RR+AVAP SLR+ALSNLYPD   FQEGQMNDASEVLGVIF+CLHQSFT AS  SDT
Sbjct  1318  PKDNRREAVAPTSLRVALSNLYPDSSFFQEGQMNDASEVLGVIFDCLHQSFTPASHVSDT  1377

Query  4606  ESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRT  4785
             ESVDSSC GSWDC NS+CI HS+FGMD+FERMNCY CGLESR+LKYTSFFHNINASA+RT
Sbjct  1378  ESVDSSCTGSWDCTNSSCIAHSIFGMDIFERMNCYNCGLESRYLKYTSFFHNINASAVRT  1437

Query  4786  MKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCE  4965
             MKVMC ++SFDELLNLVEMNHQLACDPDA GCGK N+IHH LS+PPHVFTTVLGWQN+CE
Sbjct  1438  MKVMCPENSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNSCE  1497

Query  4966  SVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYD  5145
             SV+DITATL ALSTEIDISVLYRGLDP++K CLVSVVCYYGQHYHCFAYS DHE+WIMYD
Sbjct  1498  SVDDITATLAALSTEIDISVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIMYD  1557

Query  5146  DKTVKVIGNWADVLTMCERGHLQPQV  5223
             DKTVKVIG W DVLTMCERGHLQPQV
Sbjct  1558  DKTVKVIGGWNDVLTMCERGHLQPQV  1583



>ref|XP_011087199.1| PREDICTED: uncharacterized protein LOC105168755 isoform X1 [Sesamum 
indicum]
 ref|XP_011087200.1| PREDICTED: uncharacterized protein LOC105168755 isoform X1 [Sesamum 
indicum]
Length=1627

 Score =  1300 bits (3365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1102 (65%), Positives = 869/1102 (79%), Gaps = 22/1102 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR +APRSKPS       A         A  E   +  +   K+  + D A +ES 
Sbjct  1     MGHKKRNVAPRSKPSQPQSAAGAEDAAADGGAANPEHSPNPCV---KTTAKSDAADLESS  57

Query  543   TNASSS--YANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
             +NA+ S  YA+IKLECERALT+LRRGNH KALRLMKDL  KHENSP+ ALI+RVQGTVCV
Sbjct  58    SNANFSSSYASIKLECERALTALRRGNHTKALRLMKDLGTKHENSPHSALIHRVQGTVCV  117

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVASIIDDPN K RHLKNAI+SAR++V +SP+SIEF+HFYANLLYEAA+DGKEYEEVVQE
Sbjct  118   KVASIIDDPNAKQRHLKNAIESARRAVSLSPSSIEFSHFYANLLYEAASDGKEYEEVVQE  177

Query  897   CERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERAL IENP+DPAKESLQE NQQK+ST EAR+AHVQ ELR+LIQ+SN+ASISTW+KN G
Sbjct  178   CERALMIENPVDPAKESLQEENQQKISTAEARVAHVQSELRSLIQKSNIASISTWMKNLG  237

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
             +GEEKFRLIPIRR+ EDPMELRL+QAR+PNEIKK  KTPEERRKEIEVRVAAARLLQQKS
Sbjct  238   NGEEKFRLIPIRRVPEDPMELRLIQARRPNEIKKVAKTPEERRKEIEVRVAAARLLQQKS  297

Query  1254  ESAQSFNDGE------RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             ES Q  NDG+      + LD     GQ+  ERRKSG  RKN SS ERRD V+SYWNSMS 
Sbjct  298   ESPQLGNDGDDSNKNNKGLDSYPIPGQKAGERRKSGTVRKNASSDERRDWVQSYWNSMSL  357

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D+KK LLRI+I+DL++HF S KDG  +EVL+EALSF E NKAWKFW CC C ++FAD+  
Sbjct  358   DVKKDLLRIKILDLQAHFSSSKDGSPSEVLNEALSFGETNKAWKFWLCCRCNDKFADAGL  417

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
              +QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPLD+NAA ++L KQ K     
Sbjct  418   FMQHVVQEHMGSLLPKMQSILPQNVENEWAEMLLNCSWKPLDLNAAIRMLGKQSKSDATD  477

Query  1776  FLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMD  1955
             FL+  + ++ +D+SK+   D YC+ Y W  SP KK  GD     T DSRE++     WMD
Sbjct  478   FLDEAHRKNGVDDSKECFIDTYCSEYEWVSSPRKKRSGDNFKVCTKDSREFEDVE--WMD  535

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DG++ +K     E+WP++DDPER K+LERI+ +FQ LIKNKYL + HLSKVIHFAVEEL
Sbjct  536   CDGDQRSKESLLHENWPLSDDPERTKILERIHAIFQALIKNKYLATGHLSKVIHFAVEEL  595

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             Q L  GS LLN N+++TPLCICFLGAPELKKILKFLQE+SHSCGL RY ++S A+DD +T
Sbjct  596   QGLACGSLLLNSNLERTPLCICFLGAPELKKILKFLQEISHSCGLSRYSDKSNAVDDTNT  655

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNG  2495
             G+QGV+ MEKI+FS+D S L+ DEHF PCK+  +++ D V   ++ + +A SS++  +NG
Sbjct  656   GVQGVEIMEKIIFSQDASFLVLDEHFLPCKVPRLSYDDAV---NDCSISATSSHVNYENG  712

Query  2496  GLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEH  2675
              +LDSD LLSWIF G SSGEQL SW   REEKAQ+ +EI++LLEKE Y LQGLCERKCEH
Sbjct  713   VILDSDALLSWIFTGPSSGEQLASWRHVREEKAQKGLEILQLLEKESYHLQGLCERKCEH  772

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             L+YEEALQ VEDLCLEEGKKREH  DF   SYD  L+KRR+EL+E+  ++   + RFE++
Sbjct  773   LSYEEALQAVEDLCLEEGKKREHAKDFAHHSYDSVLRKRREELIENDKDSNIISNRFELD  832

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AI++VLKDAESLNVNQFGFE++Y G++SHLCDLESGE +DWR K+YL+Q DSC+EVAIQR
Sbjct  833   AITNVLKDAESLNVNQFGFEESYSGVTSHLCDLESGE-EDWRRKEYLHQVDSCIEVAIQR  891

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKE VS+E+SKIDARIMR+V GMQQLEVKLE  S+HD+R +L+PLVKS+LRA LEDLAE+
Sbjct  892   QKEQVSIEISKIDARIMRIVVGMQQLEVKLEPASSHDFRSVLIPLVKSFLRARLEDLAEK  951

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DA EKSDAAREAFLAELA DSKK  + G +N++H HE+T+DKKK K+ R+ KDLK ++ +
Sbjct  952   DAREKSDAAREAFLAELALDSKKGVSAGVDNSRHVHERTKDKKKSKESRRNKDLKATHCD  1011

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQ-eeeeqrrrieleaeerkleet  3572
                 LH+ TAEE    V HD     AE+++  S+   Q +EEE +R+IELEAEERKLEET
Sbjct  1012  ---ELHNQTAEEILLQVGHDEDGPGAEIADPVSDDALQLQEEEYKRKIELEAEERKLEET  1068

Query  3573  leYQRRIENEAKLKHLAEQHKK  3638
             LEYQRRIENEAK KHLAEQHK+
Sbjct  1069  LEYQRRIENEAKQKHLAEQHKR  1090


 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/508 (70%), Positives = 402/508 (79%), Gaps = 11/508 (2%)
 Frame = +1

Query  3718  NKQQGTTKKELLQSNG--SPLEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsr  3891
             N++    K+ L+Q +G    LE  PK+       ++   NGG  ++G   SDRR GRR R
Sbjct  1118  NEKWINRKESLMQKDGLAGGLESVPKSFANGATLRSELVNGGIPQEGGSFSDRRPGRRGR  1177

Query  3892  rqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA-GESGPKTLRQLHVEDDDEE  4068
             RQKG    +  K  P+TS  E+   G+ R V +S    H  G++  KT RQL VE+DDEE
Sbjct  1178  RQKGPTNLSNGKNQPLTSEKEDSNAGQPRYVQNS----HGDGDNAGKTFRQLQVEEDDEE  1233

Query  4069  RFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSC--EDVATGIVNGIEVY  4242
             RFQADL KAVRQSLDTFHAH+ LPL   S      E+     SC   +     VNG++ Y
Sbjct  1234  RFQADLKKAVRQSLDTFHAHRNLPLTSSSALPH-KELPETTDSCGSRNECVTDVNGMDAY  1292

Query  4243  GTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALS  4419
             GTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR SSSEH+HVGDPCV+CALYDIF ALS
Sbjct  1293  GTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRRSSSEHVHVGDPCVICALYDIFIALS  1352

Query  4420  LASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGAS  4599
             +   + RR+AVAP SLR+ALSNLYPD   FQEGQMNDASEVLGVIF+CLHQSFT AS  S
Sbjct  1353  MGPKDNRREAVAPTSLRVALSNLYPDSSFFQEGQMNDASEVLGVIFDCLHQSFTPASHVS  1412

Query  4600  DTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASAL  4779
             DTESVDSSC GSWDC NS+CI HS+FGMD+FERMNCY CGLESR+LKYTSFFHNINASA+
Sbjct  1413  DTESVDSSCTGSWDCTNSSCIAHSIFGMDIFERMNCYNCGLESRYLKYTSFFHNINASAV  1472

Query  4780  RTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNT  4959
             RTMKVMC ++SFDELLNLVEMNHQLACDPDA GCGK N+IHH LS+PPHVFTTVLGWQN+
Sbjct  1473  RTMKVMCPENSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNS  1532

Query  4960  CESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIM  5139
             CESV+DITATL ALSTEIDISVLYRGLDP++K CLVSVVCYYGQHYHCFAYS DHE+WIM
Sbjct  1533  CESVDDITATLAALSTEIDISVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIM  1592

Query  5140  YDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YDDKTVKVIG W DVLTMCERGHLQPQV
Sbjct  1593  YDDKTVKVIGGWNDVLTMCERGHLQPQV  1620



>ref|XP_011071732.1| PREDICTED: uncharacterized protein LOC105157124 isoform X1 [Sesamum 
indicum]
Length=1594

 Score =  1282 bits (3317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1105 (65%), Positives = 862/1105 (78%), Gaps = 24/1105 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTS----AVLVQEKSLIRHDQAV  530
             MGHKKR +APRSKPS  P   A  A   +A  + ++   S    +     K   + +   
Sbjct  1     MGHKKRNVAPRSKPSQPPSAAAEAADGTSATGSVVDGGLSNLDHSADAGRKIPTKSEATD  60

Query  531   VE--SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             +E  S  N SSSYA+IKLECERALT+LRRGNH KALRLMKDLC+KHENSP+ ALI+RVQG
Sbjct  61    LESNSNANPSSSYASIKLECERALTALRRGNHTKALRLMKDLCSKHENSPHSALIHRVQG  120

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVASIIDD N K RHLKNAI+SA+++V+ SP+SIEFAHFYANLLYEAA +GKEYEE
Sbjct  121   TVCVKVASIIDDSNAKQRHLKNAIESAKRAVVSSPSSIEFAHFYANLLYEAATEGKEYEE  180

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQ ENQQK+ST EAR+AHVQ ELR+LIQ+SN+ASISTW+
Sbjct  181   VVQECERALAIENPVDPAKESLQDENQQKISTAEARVAHVQSELRSLIQKSNIASISTWM  240

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             KN G+GEEKFRLIPIRR+ EDPMELRLVQA++PNEIKK  KTPEERRKEIEVRVAAARLL
Sbjct  241   KNLGNGEEKFRLIPIRRVPEDPMELRLVQAKRPNEIKKVAKTPEERRKEIEVRVAAARLL  300

Query  1242  QQKSESAQ------SFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWN  1403
             QQKSES        + N+  + LD + G+G R  ERRKSGN +K+ SS ERRD VR YWN
Sbjct  301   QQKSESPHLRNDVDNNNNNSKGLDSTPGSGHRTGERRKSGNVKKSASSDERRDWVRLYWN  360

Query  1404  SMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             SMS D KK LLRI I DL++HF S KDGL +EVL+EALSF EANK W+FW CC C E+F 
Sbjct  361   SMSLDGKKDLLRINISDLRAHFSSSKDGLLSEVLNEALSFGEANKVWRFWMCCRCNEKFV  420

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D+ S +QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPL++NA  ++LEK+ K 
Sbjct  421   DAGSFMQHVVQEHMGSLLPKMQSILPQNVENEWAEMLLNCSWKPLELNATIRMLEKKSKS  480

Query  1764  RVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSE  1943
                  L+   +R + ++SK+   D YCN Y WD SP KK  GD  NGT  DSRE++    
Sbjct  481   NTPDLLDEC-SRHNAEDSKECFVDSYCNEYEWDSSPGKKKSGDNSNGTVQDSREFEDVE-  538

Query  1944  VWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFA  2123
              WMD DG++ +K     E+WP++DDPER KLLERI+ +F+ LIK+KYL SSHLSKVIHFA
Sbjct  539   -WMDCDGDQSSKESLIHENWPLSDDPERVKLLERIHAIFEALIKHKYLASSHLSKVIHFA  597

Query  2124  VEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAID  2303
             VEELQ +  GSQ LN  +DQTPLCICFLGA ELKKILKFLQE+S SCGL RY +++   D
Sbjct  598   VEELQGVACGSQ-LNSKMDQTPLCICFLGASELKKILKFLQEISQSCGLNRYTDKNNVGD  656

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D +TG+   D MEKI+FS+D S L+ DEHF PCK+ P    D   +D   +S  ISS+++
Sbjct  657   DSNTGMPVGDIMEKIIFSQDASFLVLDEHFLPCKV-PRLLCDTASSD--VSSPPISSHVK  713

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
              +NG +LDSD LLSWIF G SSGE LTSW R+REEKAQQ +EI++LLEKE Y LQGLCER
Sbjct  714   YENGVVLDSDALLSWIFTGASSGEHLTSWKRAREEKAQQGLEILQLLEKESYHLQGLCER  773

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             KCEHL+YEEALQ VEDLCLEEGKKREH  DFVRRSYD  LKKRR+EL+E+ +E +  + R
Sbjct  774   KCEHLSYEEALQAVEDLCLEEGKKREHAADFVRRSYDSVLKKRREELIENDNELSIISNR  833

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AI++VLKDAESLNV+QFGFE+TY G++S  CDLESGED DWR KDYL+Q DSC+EV
Sbjct  834   FELDAITNVLKDAESLNVSQFGFEETYSGVTSDFCDLESGEDGDWRTKDYLHQVDSCIEV  893

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQRQKE VS+E+SKIDARIMR+V+GMQQLEVKLE  S+HD+R IL+P+VKS++RA LED
Sbjct  894   AIQRQKEQVSIEISKIDARIMRIVAGMQQLEVKLEPASSHDFRSILIPIVKSFMRARLED  953

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DATEKSDAAREAFLAELA DSKK +  G E +KH HE+T+++KK K+ RK KD K 
Sbjct  954   LAEKDATEKSDAAREAFLAELALDSKKGAGAGVEGSKHMHERTKERKKSKENRKNKDPKA  1013

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             +N +    L   TAEE   S  +D     + +  G  +++  +EEE +RRIELEAEE+KL
Sbjct  1014  TNSD---ELQDQTAEEILLSNAYDSPVSGSAIP-GADDALRLQEEEYKRRIELEAEEKKL  1069

Query  3564  eetleYQRRIENEAKLKHLAEQHKK  3638
             EETLEYQRRIENEAK KHLAEQHKK
Sbjct  1070  EETLEYQRRIENEAKQKHLAEQHKK  1094


 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/523 (67%), Positives = 391/523 (75%), Gaps = 51/523 (10%)
 Frame = +1

Query  3676  PILFLNYNEQDHVVNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLED  3849
             P  +L+ +  D   N+Q    K+ L+  +GS   LE  PK +   D+ + G  N   +ED
Sbjct  1109  PDAYLSQSNDDMCANEQWKKRKEPLMHKDGSASILENVPKTAN-GDVLRTGLPNESIVED  1167

Query  3850  GALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVR----PVDDSLEKKHAGE  4017
             G L SDRR GRRSRR KG  K  + K  P+T   ++ + G+ R    P  D       GE
Sbjct  1168  GGLFSDRRTGRRSRRHKGPTKLGDGKYAPLTPDKQDSDPGQPRFGQNPRGD-------GE  1220

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G +T  QL  EDDDEERFQADL KAVRQSLD                            
Sbjct  1221  NGART-GQLQGEDDDEERFQADLKKAVRQSLDG---------------------------  1252

Query  4198  CEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGD  4374
                      N ++ YGTGL+NEVGEYNCFLNVIIQSLWHLRRFRDEFL RSSSEH+HVGD
Sbjct  1253  --------ANKMDAYGTGLRNEVGEYNCFLNVIIQSLWHLRRFRDEFLWRSSSEHVHVGD  1304

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PCV+CALYDIF ALS+AS + RR+AVAP SLR+ALSNLYPD   FQEGQMNDASEVLGVI
Sbjct  1305  PCVICALYDIFFALSMASKDNRREAVAPTSLRVALSNLYPDSNFFQEGQMNDASEVLGVI  1364

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             F CLH+SFT AS  SDTESVDSSCMGSWDC N +CI HS+FGMDVFERMNCY CGLESR+
Sbjct  1365  FNCLHRSFTPASVTSDTESVDSSCMGSWDCTNGSCIAHSIFGMDVFERMNCYNCGLESRY  1424

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINASALRTMKVM  D+SFDELLNLVEMNHQLACDP++ GCGK N+IHH LS
Sbjct  1425  LKYTSFFHNINASALRTMKVMYPDNSFDELLNLVEMNHQLACDPESGGCGKPNYIHHILS  1484

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
             TPPHVFTTVLGWQNTCE +EDITATL ALSTEID+SVLYRGLDP+++HCLVSVVCYYGQH
Sbjct  1485  TPPHVFTTVLGWQNTCERIEDITATLAALSTEIDVSVLYRGLDPQNRHCLVSVVCYYGQH  1544

Query  5095  YHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YHCFAYS DHE+WIMYDDKTVKVIG W DVLTMCERGHLQPQ+
Sbjct  1545  YHCFAYSRDHEQWIMYDDKTVKVIGGWNDVLTMCERGHLQPQL  1587



>ref|XP_011071733.1| PREDICTED: uncharacterized protein LOC105157124 isoform X2 [Sesamum 
indicum]
Length=1586

 Score =  1278 bits (3308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/1105 (65%), Positives = 860/1105 (78%), Gaps = 32/1105 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTS----AVLVQEKSLIRHDQAV  530
             MGHKKR +APRSKPS  P   A  A   +A  + ++   S    +     K   + +   
Sbjct  1     MGHKKRNVAPRSKPSQPPSAAAEAADGTSATGSVVDGGLSNLDHSADAGRKIPTKSEATD  60

Query  531   VE--SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             +E  S  N SSSYA+IKLECERALT+LRRGNH KALRLMKDLC+KHENSP+ ALI+RVQG
Sbjct  61    LESNSNANPSSSYASIKLECERALTALRRGNHTKALRLMKDLCSKHENSPHSALIHRVQG  120

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVASIIDD N K RHLKNAI+SA+++V+ SP+SIEFAHFYANLLYEAA +GKEYEE
Sbjct  121   TVCVKVASIIDDSNAKQRHLKNAIESAKRAVVSSPSSIEFAHFYANLLYEAATEGKEYEE  180

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERALAIENP+DPAKESLQ ENQQK+ST EAR+AHVQ ELR+LIQ+SN+ASISTW+
Sbjct  181   VVQECERALAIENPVDPAKESLQDENQQKISTAEARVAHVQSELRSLIQKSNIASISTWM  240

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             KN G+GEEKFRLIPIRR+ EDPMELRLVQA++PNEIKK  KTPEERRKEIEVRVAAARLL
Sbjct  241   KNLGNGEEKFRLIPIRRVPEDPMELRLVQAKRPNEIKKVAKTPEERRKEIEVRVAAARLL  300

Query  1242  QQKSESAQ------SFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWN  1403
             QQKSES        + N+  + LD + G+G R  ERRKSGN +K+ SS ERRD VR YWN
Sbjct  301   QQKSESPHLRNDVDNNNNNSKGLDSTPGSGHRTGERRKSGNVKKSASSDERRDWVRLYWN  360

Query  1404  SMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             SMS D KK LLRI I DL++HF S KDGL +EVL+EALSF EANK W+FW CC C E+F 
Sbjct  361   SMSLDGKKDLLRINISDLRAHFSSSKDGLLSEVLNEALSFGEANKVWRFWMCCRCNEKFV  420

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D+ S +QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPL++NA  ++LEK+ K 
Sbjct  421   DAGSFMQHVVQEHMGSLLPKMQSILPQNVENEWAEMLLNCSWKPLELNATIRMLEKKSKS  480

Query  1764  RVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSE  1943
                  L+   +R + ++SK+   D YCN Y WD SP KK  GD  NGT  DSRE++    
Sbjct  481   NTPDLLDEC-SRHNAEDSKECFVDSYCNEYEWDSSPGKKKSGDNSNGTVQDSREFEDVE-  538

Query  1944  VWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFA  2123
              WMD DG++ +K     E+WP++DDPER KLLERI+ +F+ LIK+KYL SSHLSKVIHFA
Sbjct  539   -WMDCDGDQSSKESLIHENWPLSDDPERVKLLERIHAIFEALIKHKYLASSHLSKVIHFA  597

Query  2124  VEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAID  2303
             VEELQ +  GSQ LN  +DQTPLCICFLGA ELKKILKFLQE+S SCGL RY +++   D
Sbjct  598   VEELQGVACGSQ-LNSKMDQTPLCICFLGASELKKILKFLQEISQSCGLNRYTDKNNVGD  656

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D +TG+   D MEKI+FS+D S L+ DEHF PCK+ P    D   +D   +S  ISS+++
Sbjct  657   DSNTGMPVGDIMEKIIFSQDASFLVLDEHFLPCKV-PRLLCDTASSD--VSSPPISSHVK  713

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
              +NG +LDSD LLSWIF G SSGE LTSW R+REEKAQQ +EI++LLEKE Y LQGLCER
Sbjct  714   YENGVVLDSDALLSWIFTGASSGEHLTSWKRAREEKAQQGLEILQLLEKESYHLQGLCER  773

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             KCEHL+YEEALQ VEDLCLEEGKKREH  DFVRRSYD  LKKRR+EL+E+ +E +  + R
Sbjct  774   KCEHLSYEEALQAVEDLCLEEGKKREHAADFVRRSYDSVLKKRREELIENDNELSIISNR  833

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AI++VLKDAESLNV+QFGFE+TY G++S  CDLESGED DWR KDYL+Q DSC+EV
Sbjct  834   FELDAITNVLKDAESLNVSQFGFEETYSGVTSDFCDLESGEDGDWRTKDYLHQVDSCIEV  893

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQRQKE VS+E+SKIDARIMR+V+GMQQLEVKLE  S+HD+R IL+P+VKS++RA LED
Sbjct  894   AIQRQKEQVSIEISKIDARIMRIVAGMQQLEVKLEPASSHDFRSILIPIVKSFMRARLED  953

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DATEKSDAAREAFLAELA DSKK +  G E +KH HE+T+++KK K+ RK KD K 
Sbjct  954   LAEKDATEKSDAAREAFLAELALDSKKGAGAGVEGSKHMHERTKERKKSKENRKNKDPKA  1013

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             +N +    L   TAEE   S     G++DA         +  +EEE +RRIELEAEE+KL
Sbjct  1014  TNSD---ELQDQTAEEIPVSGSAIPGADDA---------LRLQEEEYKRRIELEAEEKKL  1061

Query  3564  eetleYQRRIENEAKLKHLAEQHKK  3638
             EETLEYQRRIENEAK KHLAEQHKK
Sbjct  1062  EETLEYQRRIENEAKQKHLAEQHKK  1086


 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/523 (67%), Positives = 391/523 (75%), Gaps = 51/523 (10%)
 Frame = +1

Query  3676  PILFLNYNEQDHVVNKQQGTTKKELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLED  3849
             P  +L+ +  D   N+Q    K+ L+  +GS   LE  PK +   D+ + G  N   +ED
Sbjct  1101  PDAYLSQSNDDMCANEQWKKRKEPLMHKDGSASILENVPKTAN-GDVLRTGLPNESIVED  1159

Query  3850  GALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVR----PVDDSLEKKHAGE  4017
             G L SDRR GRRSRR KG  K  + K  P+T   ++ + G+ R    P  D       GE
Sbjct  1160  GGLFSDRRTGRRSRRHKGPTKLGDGKYAPLTPDKQDSDPGQPRFGQNPRGD-------GE  1212

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G +T  QL  EDDDEERFQADL KAVRQSLD                            
Sbjct  1213  NGART-GQLQGEDDDEERFQADLKKAVRQSLDG---------------------------  1244

Query  4198  CEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGD  4374
                      N ++ YGTGL+NEVGEYNCFLNVIIQSLWHLRRFRDEFL RSSSEH+HVGD
Sbjct  1245  --------ANKMDAYGTGLRNEVGEYNCFLNVIIQSLWHLRRFRDEFLWRSSSEHVHVGD  1296

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PCV+CALYDIF ALS+AS + RR+AVAP SLR+ALSNLYPD   FQEGQMNDASEVLGVI
Sbjct  1297  PCVICALYDIFFALSMASKDNRREAVAPTSLRVALSNLYPDSNFFQEGQMNDASEVLGVI  1356

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             F CLH+SFT AS  SDTESVDSSCMGSWDC N +CI HS+FGMDVFERMNCY CGLESR+
Sbjct  1357  FNCLHRSFTPASVTSDTESVDSSCMGSWDCTNGSCIAHSIFGMDVFERMNCYNCGLESRY  1416

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINASALRTMKVM  D+SFDELLNLVEMNHQLACDP++ GCGK N+IHH LS
Sbjct  1417  LKYTSFFHNINASALRTMKVMYPDNSFDELLNLVEMNHQLACDPESGGCGKPNYIHHILS  1476

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
             TPPHVFTTVLGWQNTCE +EDITATL ALSTEID+SVLYRGLDP+++HCLVSVVCYYGQH
Sbjct  1477  TPPHVFTTVLGWQNTCERIEDITATLAALSTEIDVSVLYRGLDPQNRHCLVSVVCYYGQH  1536

Query  5095  YHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YHCFAYS DHE+WIMYDDKTVKVIG W DVLTMCERGHLQPQ+
Sbjct  1537  YHCFAYSRDHEQWIMYDDKTVKVIGGWNDVLTMCERGHLQPQL  1579



>ref|XP_007037185.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
4 [Theobroma cacao]
 gb|EOY21686.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
4 [Theobroma cacao]
Length=1484

 Score =  1238 bits (3202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1099 (63%), Positives = 848/1099 (77%), Gaps = 34/1099 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK   +     A            E +    L    + I      VES+
Sbjct  1     MGHKKKNAAPRSKRPSSQPPPVAATTVVDVINDSAERE----LTGNNAKIEVAAVAVESD  56

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              ++SSSYA +K+ECERALT+LRRGNH KALRLMK+ C  HENS + ALI+RVQGTVCVKV
Sbjct  57    ASSSSSYAAVKIECERALTALRRGNHTKALRLMKESCTCHENSAHAALIHRVQGTVCVKV  116

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K+RHLKNAIDSA+K+V +SPNSIEF+HFYANLLYEAANDGKE+EEVVQECE
Sbjct  117   ASIIDDPNAKHRHLKNAIDSAKKAVELSPNSIEFSHFYANLLYEAANDGKEFEEVVQECE  176

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENP+DPAKESLQE +QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  177   RALAIENPVDPAKESLQEESQQKISTAEARILHVQSELRSLIQKSNIASISTWMKNLGNG  236

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSE  1256
             EEKFRLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ KSE
Sbjct  237   EEKFRLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQQKSE  296

Query  1257  SAQSF---NDGERS-LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             +A S    +DGER+ LDL++G+GQRG   R+    RK  S+ ER+D VRS+WNSMS D K
Sbjct  297   AASSALLQSDGERNGLDLTSGSGQRGGVERR----RKIGSTAERKDWVRSFWNSMSVDSK  352

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             K LLRIR+ DLK +FG LKDGLA+EVLSEAL+FAE NK WKFW CC C E+FA SESH+Q
Sbjct  353   KDLLRIRVSDLKEYFGLLKDGLASEVLSEALAFAELNKTWKFWVCCRCSEKFAVSESHMQ  412

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EHM +L PK+Q+VLPQ+V++EW+EMLLNCSW PLDI+AA K++  + KCR   F +
Sbjct  413   HVVQEHMGNLMPKMQTVLPQSVDSEWIEMLLNCSWNPLDISAAVKMIGNESKCRDSEFSK  472

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRD  1961
             + Y+ +  +E  D   D       W  SP K+  GD  N T+V+ +  DK S +   + D
Sbjct  473   DFYSDNHNEECDDCFKD------AWSSSPEKEHLGDQYNCTSVEGKNCDKVSSIECKECD  526

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+G+   P  + WP  DD ERAKLLERI+  F+ LI++KYL +SHL+KVI F ++ELQS
Sbjct  527   GNQGSVAYPHVDCWPTVDDAERAKLLERIHATFELLIRHKYLAASHLNKVIQFTMDELQS  586

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GSQLLN+ +DQTP+CICFLGA +L+KILKFLQ+LSHSCGL RY E++  +DD++   
Sbjct  587   LVSGSQLLNHGVDQTPMCICFLGAMQLRKILKFLQDLSHSCGLTRYSEKTAPVDDVNRAS  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             Q ++  EKIV + D SCLL DE   P     +   +  + ++N ++         + G +
Sbjct  647   QILEVKEKIVLNGDASCLLLDERLLP----DVAIQEAALANANGSN---------NYGFV  693

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D+D LLSWIF G SSG+QL SW R +EEK QQ +EI+++LEKEFY LQ LCE+KC+H++
Sbjct  694   QDADALLSWIFAGPSSGDQLASWIRKKEEKTQQGLEILQMLEKEFYHLQSLCEKKCDHIS  753

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ VEDLCLEEGKKRE   +FV RSY+  L+KRR+EL+ES ++    + RFE++AI
Sbjct  754   YEEALQAVEDLCLEEGKKRETATEFVYRSYESVLRKRREELIESENDVMFLSSRFELDAI  813

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLK+AE+LNVNQFG+EDTY G++S LCDLESGE DDWR KDYL+Q D+C+EVAIQRQK
Sbjct  814   SNVLKEAEALNVNQFGYEDTYAGVTSQLCDLESGEGDDWRTKDYLHQVDTCIEVAIQRQK  873

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +S+ELSKIDARIM+ V+GMQQLE+KLE  SAHDYR I++PLVKSYLRAHLEDLAE+DA
Sbjct  874   EQLSLELSKIDARIMQNVTGMQQLELKLEPASAHDYRLIMLPLVKSYLRAHLEDLAEKDA  933

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             TEKSDAAREAFLAELA DSKK S  GS+N++H+ EK++DKKK K+ RK+KD K S  N  
Sbjct  934   TEKSDAAREAFLAELACDSKKGSRGGSDNSRHAQEKSKDKKKNKELRKSKDSKASGANEQ  993

Query  3402  HALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleY  3581
             H L+ +TAE+ S +V  DG   D+E+ +  S+ + Q+EEE RR+IELEAEERKLEETLEY
Sbjct  994   HMLNDETAEQVSSAVASDGDHLDSEVVSVNSDDLKQQEEEFRRKIELEAEERKLEETLEY  1053

Query  3582  QRRIENEAKLKHLAEQHKK  3638
             QRRIENEAK KHLAEQHKK
Sbjct  1054  QRRIENEAKQKHLAEQHKK  1072


 Score =   403 bits (1036),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 265/363 (73%), Gaps = 16/363 (4%)
 Frame = +1

Query  3748  LLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEK  3927
             L  +NGS +      S      K G SNG   ED     DRRAGRR RR K S K+ + K
Sbjct  1116  LSTANGSAVAVTSNTSGTYAKFKQGLSNGAVPEDALFPGDRRAGRRGRRHKSSNKFLDGK  1175

Query  3928  CPPVTSGAENIEVG--------EVRPVD----DSLEKKHAGESGPKTLRQLHVEDDDEER  4071
                + S  E+I+VG        +VR VD    DS+      E G KTLRQL  E+DDEER
Sbjct  1176  YQVIPSEKESIQVGSSHGNVEEQVRYVDGFPMDSVAPISV-EGGTKTLRQLQAEEDDEER  1234

Query  4072  FQADLMKAVRQSLDTFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYG  4245
             FQADL +AVRQSLDT+ A QK+PL    R+      ++ N GVS  +V++  +N  +V G
Sbjct  1235  FQADLKQAVRQSLDTYQAQQKMPLGSSLRTAPRVPLQVNNHGVSPNEVSSENLNETDVLG  1294

Query  4246  TGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSL  4422
             TGL+NEVGEYNCFLNVIIQSLWHLRRFRDEFLR S+S+H+HVGDPCVVCALY+IF+AL++
Sbjct  1295  TGLQNEVGEYNCFLNVIIQSLWHLRRFRDEFLRRSTSDHVHVGDPCVVCALYEIFSALNI  1354

Query  4423  ASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASD  4602
             +S++ RR+ VAP SLR+ALSNLYPD   FQE QMNDASEVL VIF+CLH+SFTS S  S+
Sbjct  1355  SSTDARREPVAPTSLRVALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTSGSSVSN  1414

Query  4603  TESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALR  4782
              +S DS+C GSWDCANSAC+VHSLFGMD+FERMNCY+CG+ESR LKYTSFFHNINASALR
Sbjct  1415  ADSADSNCTGSWDCANSACMVHSLFGMDIFERMNCYKCGVESRRLKYTSFFHNINASALR  1474

Query  4783  TMK  4791
             TMK
Sbjct  1475  TMK  1477



>ref|XP_007037186.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
5 [Theobroma cacao]
 gb|EOY21687.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
5 [Theobroma cacao]
Length=1529

 Score =  1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1099 (63%), Positives = 848/1099 (77%), Gaps = 34/1099 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK   +     A            E +    L    + I      VES+
Sbjct  1     MGHKKKNAAPRSKRPSSQPPPVAATTVVDVINDSAERE----LTGNNAKIEVAAVAVESD  56

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              ++SSSYA +K+ECERALT+LRRGNH KALRLMK+ C  HENS + ALI+RVQGTVCVKV
Sbjct  57    ASSSSSYAAVKIECERALTALRRGNHTKALRLMKESCTCHENSAHAALIHRVQGTVCVKV  116

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K+RHLKNAIDSA+K+V +SPNSIEF+HFYANLLYEAANDGKE+EEVVQECE
Sbjct  117   ASIIDDPNAKHRHLKNAIDSAKKAVELSPNSIEFSHFYANLLYEAANDGKEFEEVVQECE  176

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENP+DPAKESLQE +QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  177   RALAIENPVDPAKESLQEESQQKISTAEARILHVQSELRSLIQKSNIASISTWMKNLGNG  236

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSE  1256
             EEKFRLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ KSE
Sbjct  237   EEKFRLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQQKSE  296

Query  1257  SAQSF---NDGERS-LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             +A S    +DGER+ LDL++G+GQRG   R+    RK  S+ ER+D VRS+WNSMS D K
Sbjct  297   AASSALLQSDGERNGLDLTSGSGQRGGVERR----RKIGSTAERKDWVRSFWNSMSVDSK  352

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             K LLRIR+ DLK +FG LKDGLA+EVLSEAL+FAE NK WKFW CC C E+FA SESH+Q
Sbjct  353   KDLLRIRVSDLKEYFGLLKDGLASEVLSEALAFAELNKTWKFWVCCRCSEKFAVSESHMQ  412

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EHM +L PK+Q+VLPQ+V++EW+EMLLNCSW PLDI+AA K++  + KCR   F +
Sbjct  413   HVVQEHMGNLMPKMQTVLPQSVDSEWIEMLLNCSWNPLDISAAVKMIGNESKCRDSEFSK  472

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRD  1961
             + Y+ +  +E  D   D       W  SP K+  GD  N T+V+ +  DK S +   + D
Sbjct  473   DFYSDNHNEECDDCFKD------AWSSSPEKEHLGDQYNCTSVEGKNCDKVSSIECKECD  526

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+G+   P  + WP  DD ERAKLLERI+  F+ LI++KYL +SHL+KVI F ++ELQS
Sbjct  527   GNQGSVAYPHVDCWPTVDDAERAKLLERIHATFELLIRHKYLAASHLNKVIQFTMDELQS  586

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GSQLLN+ +DQTP+CICFLGA +L+KILKFLQ+LSHSCGL RY E++  +DD++   
Sbjct  587   LVSGSQLLNHGVDQTPMCICFLGAMQLRKILKFLQDLSHSCGLTRYSEKTAPVDDVNRAS  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             Q ++  EKIV + D SCLL DE   P     +   +  + ++N ++         + G +
Sbjct  647   QILEVKEKIVLNGDASCLLLDERLLP----DVAIQEAALANANGSN---------NYGFV  693

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D+D LLSWIF G SSG+QL SW R +EEK QQ +EI+++LEKEFY LQ LCE+KC+H++
Sbjct  694   QDADALLSWIFAGPSSGDQLASWIRKKEEKTQQGLEILQMLEKEFYHLQSLCEKKCDHIS  753

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ VEDLCLEEGKKRE   +FV RSY+  L+KRR+EL+ES ++    + RFE++AI
Sbjct  754   YEEALQAVEDLCLEEGKKRETATEFVYRSYESVLRKRREELIESENDVMFLSSRFELDAI  813

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLK+AE+LNVNQFG+EDTY G++S LCDLESGE DDWR KDYL+Q D+C+EVAIQRQK
Sbjct  814   SNVLKEAEALNVNQFGYEDTYAGVTSQLCDLESGEGDDWRTKDYLHQVDTCIEVAIQRQK  873

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +S+ELSKIDARIM+ V+GMQQLE+KLE  SAHDYR I++PLVKSYLRAHLEDLAE+DA
Sbjct  874   EQLSLELSKIDARIMQNVTGMQQLELKLEPASAHDYRLIMLPLVKSYLRAHLEDLAEKDA  933

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             TEKSDAAREAFLAELA DSKK S  GS+N++H+ EK++DKKK K+ RK+KD K S  N  
Sbjct  934   TEKSDAAREAFLAELACDSKKGSRGGSDNSRHAQEKSKDKKKNKELRKSKDSKASGANEQ  993

Query  3402  HALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleY  3581
             H L+ +TAE+ S +V  DG   D+E+ +  S+ + Q+EEE RR+IELEAEERKLEETLEY
Sbjct  994   HMLNDETAEQVSSAVASDGDHLDSEVVSVNSDDLKQQEEEFRRKIELEAEERKLEETLEY  1053

Query  3582  QRRIENEAKLKHLAEQHKK  3638
             QRRIENEAK KHLAEQHKK
Sbjct  1054  QRRIENEAKQKHLAEQHKK  1072


 Score =   483 bits (1242),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 259/412 (63%), Positives = 306/412 (74%), Gaps = 16/412 (4%)
 Frame = +1

Query  3748  LLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEK  3927
             L  +NGS +      S      K G SNG   ED     DRRAGRR RR K S K+ + K
Sbjct  1116  LSTANGSAVAVTSNTSGTYAKFKQGLSNGAVPEDALFPGDRRAGRRGRRHKSSNKFLDGK  1175

Query  3928  CPPVTSGAENIEVG--------EVRPVD----DSLEKKHAGESGPKTLRQLHVEDDDEER  4071
                + S  E+I+VG        +VR VD    DS+      E G KTLRQL  E+DDEER
Sbjct  1176  YQVIPSEKESIQVGSSHGNVEEQVRYVDGFPMDSVAPISV-EGGTKTLRQLQAEEDDEER  1234

Query  4072  FQADLMKAVRQSLDTFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYG  4245
             FQADL +AVRQSLDT+ A QK+PL    R+      ++ N GVS  +V++  +N  +V G
Sbjct  1235  FQADLKQAVRQSLDTYQAQQKMPLGSSLRTAPRVPLQVNNHGVSPNEVSSENLNETDVLG  1294

Query  4246  TGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSL  4422
             TGL+NEVGEYNCFLNVIIQSLWHLRRFRDEFLR S+S+H+HVGDPCVVCALY+IF+AL++
Sbjct  1295  TGLQNEVGEYNCFLNVIIQSLWHLRRFRDEFLRRSTSDHVHVGDPCVVCALYEIFSALNI  1354

Query  4423  ASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASD  4602
             +S++ RR+ VAP SLR+ALSNLYPD   FQE QMNDASEVL VIF+CLH+SFTS S  S+
Sbjct  1355  SSTDARREPVAPTSLRVALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTSGSSVSN  1414

Query  4603  TESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALR  4782
              +S DS+C GSWDCANSAC+VHSLFGMD+FERMNCY+CG+ESR LKYTSFFHNINASALR
Sbjct  1415  ADSADSNCTGSWDCANSACMVHSLFGMDIFERMNCYKCGVESRRLKYTSFFHNINASALR  1474

Query  4783  TMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTT  4938
             TMKV+C +SSFDELLNLVE NHQLACDP+A GC + N IHH LS PPHVFTT
Sbjct  1475  TMKVLCAESSFDELLNLVERNHQLACDPEAGGCRRLNCIHHILSNPPHVFTT  1526



>ref|XP_007037182.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 ref|XP_007037183.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 ref|XP_007037184.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21683.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21684.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21685.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
Length=1628

 Score =  1234 bits (3193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1100 (63%), Positives = 847/1100 (77%), Gaps = 36/1100 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK   +     A            E +    L    + I      VES+
Sbjct  1     MGHKKKNAAPRSKRPSSQPPPVAATTVVDVINDSAERE----LTGNNAKIEVAAVAVESD  56

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              ++SSSYA +K+ECERALT+LRRGNH KALRLMK+ C  HENS + ALI+RVQGTVCVKV
Sbjct  57    ASSSSSYAAVKIECERALTALRRGNHTKALRLMKESCTCHENSAHAALIHRVQGTVCVKV  116

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K+RHLKNAIDSA+K+V +SPNSIEF+HFYANLLYEAANDGKE+EEVVQECE
Sbjct  117   ASIIDDPNAKHRHLKNAIDSAKKAVELSPNSIEFSHFYANLLYEAANDGKEFEEVVQECE  176

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENP+DPAKESLQE +QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  177   RALAIENPVDPAKESLQEESQQKISTAEARILHVQSELRSLIQKSNIASISTWMKNLGNG  236

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSE  1256
             EEKFRLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ KSE
Sbjct  237   EEKFRLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQQKSE  296

Query  1257  SAQSF---NDGERS-LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             +A S    +DGER+ LDL++G+GQRG   R+    RK  S+ ER+D VRS+WNSMS D K
Sbjct  297   AASSALLQSDGERNGLDLTSGSGQRGGVERR----RKIGSTAERKDWVRSFWNSMSVDSK  352

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             K LLRIR+ DLK +FG LKDGLA+EVLSEAL+FAE NK WKFW CC C E+FA SESH+Q
Sbjct  353   KDLLRIRVSDLKEYFGLLKDGLASEVLSEALAFAELNKTWKFWVCCRCSEKFAVSESHMQ  412

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EHM +L PK+Q+VLPQ+V++EW+EMLLNCSW PLDI+AA K++  + KCR   F +
Sbjct  413   HVVQEHMGNLMPKMQTVLPQSVDSEWIEMLLNCSWNPLDISAAVKMIGNESKCRDSEFSK  472

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRD  1961
             + Y+ +  +E  D   D       W  SP K+  GD  N T+V+ +  DK S +   + D
Sbjct  473   DFYSDNHNEECDDCFKD------AWSSSPEKEHLGDQYNCTSVEGKNCDKVSSIECKECD  526

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+G+   P  + WP  DD ERAKLLERI+  F+ LI++KYL +SHL+KVI F ++ELQS
Sbjct  527   GNQGSVAYPHVDCWPTVDDAERAKLLERIHATFELLIRHKYLAASHLNKVIQFTMDELQS  586

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GSQLLN+ +DQTP+CICFLGA +L+KILKFLQ+LSHSCGL RY E++  +DD++   
Sbjct  587   LVSGSQLLNHGVDQTPMCICFLGAMQLRKILKFLQDLSHSCGLTRYSEKTAPVDDVNRAS  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             Q ++  EKIV + D SCLL DE   P              D     AA+++    +N G 
Sbjct  647   QILEVKEKIVLNGDASCLLLDERLLP--------------DVAIQEAALANANGSNNYGF  692

Query  2502  L-DSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
             + D+D LLSWIF G SSG+QL SW R +EEK QQ +EI+++LEKEFY LQ LCE+KC+H+
Sbjct  693   VQDADALLSWIFAGPSSGDQLASWIRKKEEKTQQGLEILQMLEKEFYHLQSLCEKKCDHI  752

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLCLEEGKKRE   +FV RSY+  L+KRR+EL+ES ++    + RFE++A
Sbjct  753   SYEEALQAVEDLCLEEGKKRETATEFVYRSYESVLRKRREELIESENDVMFLSSRFELDA  812

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AE+LNVNQFG+EDTY G++S LCDLESGE DDWR KDYL+Q D+C+EVAIQRQ
Sbjct  813   ISNVLKEAEALNVNQFGYEDTYAGVTSQLCDLESGEGDDWRTKDYLHQVDTCIEVAIQRQ  872

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +S+ELSKIDARIM+ V+GMQQLE+KLE  SAHDYR I++PLVKSYLRAHLEDLAE+D
Sbjct  873   KEQLSLELSKIDARIMQNVTGMQQLELKLEPASAHDYRLIMLPLVKSYLRAHLEDLAEKD  932

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK S  GS+N++H+ EK++DKKK K+ RK+KD K S  N 
Sbjct  933   ATEKSDAAREAFLAELACDSKKGSRGGSDNSRHAQEKSKDKKKNKELRKSKDSKASGANE  992

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
              H L+ +TAE+ S +V  DG   D+E+ +  S+ + Q+EEE RR+IELEAEERKLEETLE
Sbjct  993   QHMLNDETAEQVSSAVASDGDHLDSEVVSVNSDDLKQQEEEFRRKIELEAEERKLEETLE  1052

Query  3579  YQRRIENEAKLKHLAEQHKK  3638
             YQRRIENEAK KHLAEQHKK
Sbjct  1053  YQRRIENEAKQKHLAEQHKK  1072


 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/507 (67%), Positives = 390/507 (77%), Gaps = 16/507 (3%)
 Frame = +1

Query  3748  LLQSNGSPLEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEK  3927
             L  +NGS +      S      K G SNG   ED     DRRAGRR RR K S K+ + K
Sbjct  1116  LSTANGSAVAVTSNTSGTYAKFKQGLSNGAVPEDALFPGDRRAGRRGRRHKSSNKFLDGK  1175

Query  3928  CPPVTSGAENIEVG--------EVRPVD----DSLEKKHAGESGPKTLRQLHVEDDDEER  4071
                + S  E+I+VG        +VR VD    DS+      E G KTLRQL  E+DDEER
Sbjct  1176  YQVIPSEKESIQVGSSHGNVEEQVRYVDGFPMDSVAPISV-EGGTKTLRQLQAEEDDEER  1234

Query  4072  FQADLMKAVRQSLDTFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYG  4245
             FQADL +AVRQSLDT+ A QK+PL    R+      ++ N GVS  +V++  +N  +V G
Sbjct  1235  FQADLKQAVRQSLDTYQAQQKMPLGSSLRTAPRVPLQVNNHGVSPNEVSSENLNETDVLG  1294

Query  4246  TGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSL  4422
             TGL+NEVGEYNCFLNVIIQSLWHLRRFRDEFLR S+S+H+HVGDPCVVCALY+IF+AL++
Sbjct  1295  TGLQNEVGEYNCFLNVIIQSLWHLRRFRDEFLRRSTSDHVHVGDPCVVCALYEIFSALNI  1354

Query  4423  ASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASD  4602
             +S++ RR+ VAP SLR+ALSNLYPD   FQE QMNDASEVL VIF+CLH+SFTS S  S+
Sbjct  1355  SSTDARREPVAPTSLRVALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTSGSSVSN  1414

Query  4603  TESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALR  4782
              +S DS+C GSWDCANSAC+VHSLFGMD+FERMNCY+CG+ESR LKYTSFFHNINASALR
Sbjct  1415  ADSADSNCTGSWDCANSACMVHSLFGMDIFERMNCYKCGVESRRLKYTSFFHNINASALR  1474

Query  4783  TMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTC  4962
             TMKV+C +SSFDELLNLVE NHQLACDP+A GC + N IHH LS PPHVFTTVLGWQNT 
Sbjct  1475  TMKVLCAESSFDELLNLVERNHQLACDPEAGGCRRLNCIHHILSNPPHVFTTVLGWQNTS  1534

Query  4963  ESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMY  5142
             E  +DI ATL AL+ EIDISVLYRGLDPK+KH LVSVVCYYGQHYHCFAYSHDHERWI Y
Sbjct  1535  ECADDIAATLAALNNEIDISVLYRGLDPKNKHHLVSVVCYYGQHYHCFAYSHDHERWIKY  1594

Query  5143  DDKTVKVIGNWADVLTMCERGHLQPQV  5223
             DDKTVKVIG WADV+ MCE+G LQPQV
Sbjct  1595  DDKTVKVIGGWADVVKMCEQGRLQPQV  1621



>ref|XP_006367707.1| PREDICTED: uncharacterized protein LOC102592123 [Solanum tuberosum]
Length=1606

 Score =  1219 bits (3153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1105 (62%), Positives = 843/1105 (76%), Gaps = 27/1105 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV---QEKSLIRHD--QA  527
             M HKKR +APR K S    + A            LES+ + V V    +K L R +   A
Sbjct  1     MVHKKRTVAPRPKQSAVTEDAAIPL---------LESEQNLVSVCTSVQKKLSRKNDTSA  51

Query  528   VVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             VVE ETNA S  A+IKL CER L+SLRRGNH KALRL+K+L +KHENSP+  LI+RVQG+
Sbjct  52    VVEGETNALS--ASIKLGCERVLSSLRRGNHTKALRLIKELASKHENSPHAPLIHRVQGS  109

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             VC K+AS+IDDPN K+RHLKNAI+SARK+V +SPNSIEFAHFYA+LLYEAAN+GKEYEEV
Sbjct  110   VCAKMASMIDDPNAKHRHLKNAIESARKAVSLSPNSIEFAHFYASLLYEAANEGKEYEEV  169

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             VQECE+ALAIENPIDPAK++LQE +QQK  TP ARI HV+ EL++LIQ+SN ASIS WV 
Sbjct  170   VQECEKALAIENPIDPAKQNLQEESQQKDETPNARIDHVRIELQSLIQKSNFASISAWVN  229

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
               G+GEEK RLIPIRR+ EDPME+RLVQAR+P EIKK TK PEERRKEIEVRVAAARLLQ
Sbjct  230   QIGNGEEKIRLIPIRRVPEDPMEMRLVQARRPIEIKKVTKMPEERRKEIEVRVAAARLLQ  289

Query  1245  QKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             +KSE+ Q+  DG+++LDL+ G+ QR  ERRKS NARKN SS ERRD V+SYWNS++ D K
Sbjct  290   KKSETVQTHKDGDKALDLTTGSAQRIGERRKSRNARKNSSSTERRDRVQSYWNSLTLDKK  349

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             K+LLRI+I DLK+H  + KDGLA EVLSEALS  E NK WKFWTC  C ++  DS SH  
Sbjct  350   KELLRIKISDLKAHLSASKDGLAIEVLSEALSLYETNKDWKFWTCYRCNKKITDSVSHNY  409

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV++EH+ +L PKLQSVLPQNVENEW EMLLNCSW+PLD  AAAK+L+KQ + +  GFL+
Sbjct  410   HVVHEHIGTLHPKLQSVLPQNVENEWAEMLLNCSWEPLDGCAAAKMLDKQSRSQEQGFLD  469

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRD  1961
               + R + +ESK   S+ +CN    D S   K FGD  N  TV+SR +DK S++  MD D
Sbjct  470   EKHQRDNTEESKYGFSEVFCNEDKLDSSLRNKKFGDIPNSDTVESRVHDKISDIELMDCD  529

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
              N GTK     + WP++DDP+RA LLERI+ VFQTLI++KYL SSHLSKVI FAVEELQ 
Sbjct  530   RNYGTKNGFLPDKWPLSDDPDRANLLERISAVFQTLIESKYLASSHLSKVIDFAVEELQG  589

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L +GSQLL+YN+DQTPLCICFLGA ELK +LKFLQ+LS+SCGLGRY E++++ D  S   
Sbjct  590   LAFGSQLLSYNVDQTPLCICFLGAEELKNVLKFLQDLSYSCGLGRYSEKTSSRDGASNAS  649

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG D +EK++ SEDGSCLLFDE F PC L   T  D +  D    +A + S+ Q  N   
Sbjct  650   QGFDDLEKLIVSEDGSCLLFDERFLPCNLARSTCPDIISID---RTAYVLSSNQYQNEAE  706

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRL--LEKEFYELQGLCERKCEH  2675
             LD +  LSWIF  +SS EQL SW+ +REEKAQQ +EI R   LEKEFY+LQ LCERK EH
Sbjct  707   LDPEAFLSWIFTDSSSVEQLASWTCAREEKAQQDIEIFRFLELEKEFYDLQCLCERKIEH  766

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             LNYEEAL  +E +CL+EG++R+H  + V RSYD  L+KRR++L+ES ++ T   YR E+ 
Sbjct  767   LNYEEALLAIEVICLKEGRRRDHGTEIVGRSYDSLLRKRREDLIESDNDVTVIAYRLELN  826

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AIS+VLK+AESLN N FGFE+TY G +S LCD++S ++DDWR+KDYL+Q DSCVEVA+QR
Sbjct  827   AISNVLKEAESLNANWFGFEETYSGGTSQLCDIKSSKEDDWRLKDYLHQVDSCVEVALQR  886

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKE VS+ELSK+DARIMRVV+GMQQL V +E   A D+R+ILV L+KSY+RAHLEDLAE+
Sbjct  887   QKERVSIELSKVDARIMRVVAGMQQLRVDIEHACAQDHRRILVTLLKSYIRAHLEDLAEK  946

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG-  3392
             DAT+KSDAA EA LAELA DSK SS  G+  +KH+HEK +DKKK K+YRK K  K ++G 
Sbjct  947   DATKKSDAASEALLAELAHDSKNSSGGGNGCSKHTHEKIKDKKKSKEYRKAKGSKPTSGS  1006

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleet  3572
             N LH L + T E+ SF+V H GG    + + G  +S+ +  +E RR IELEAEERKLEET
Sbjct  1007  NELHLLRYQTMEDVSFAVTH-GGENQGDKTAGNGDSLNE--QEYRRTIELEAEERKLEET  1063

Query  3573  leYQRRIENEAKLKHLAEQHKKGAR  3647
             LEYQR++EN+AKLKHLAEQ K+ A+
Sbjct  1064  LEYQRQMENDAKLKHLAEQTKRTAK  1088


 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/440 (74%), Positives = 360/440 (82%), Gaps = 9/440 (2%)
 Frame = +1

Query  3916  NEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKA  4095
             N+   P  +   EN EVGE R +  S       +SG KTLRQLHVEDDDE RFQADL KA
Sbjct  1165  NDGNFPSASDEKENTEVGEPRALHSSHGNSVPADSGTKTLRQLHVEDDDEGRFQADLQKA  1224

Query  4096  VRQSLDTFHAHQKLPLIPRSGTAQ--ISEMANLGV--SCEDVATGIVNGIEVYGTGLKNE  4263
             VRQSLD FHAH+KLPL+P  G  Q    +   LG   S EDV     N ++ YGTGLKNE
Sbjct  1225  VRQSLDMFHAHKKLPLLPSPGNEQKVFPKAGTLGNANSFEDV-----NKMDAYGTGLKNE  1279

Query  4264  VGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLASSETRR  4443
             VGEYNCFLNVIIQSLWH+RRFRDEFLR+SSEH+HVGDPC +CALYDIFTALS AS+ET R
Sbjct  1280  VGEYNCFLNVIIQSLWHVRRFRDEFLRTSSEHVHVGDPCAICALYDIFTALSTASTETCR  1339

Query  4444  DAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSS  4623
               V P SLRI+LSNLYPD   FQEGQMNDASEVLGVIF+ LH+SFTSASG SDTES DSS
Sbjct  1340  KTVDPTSLRISLSNLYPDSNFFQEGQMNDASEVLGVIFDSLHRSFTSASGISDTESADSS  1399

Query  4624  CMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQ  4803
             CMG+WDC+N ACIVHSLFGMD FE+M CY CGLESRHLKYTSFFHNINASALRT+KV+  
Sbjct  1400  CMGTWDCSNGACIVHSLFGMDTFEQMVCYNCGLESRHLKYTSFFHNINASALRTIKVVSP  1459

Query  4804  DSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDIT  4983
             +SSFD LLNLVEMNHQL+C+ +  GCGK N+IHH LSTPPHVFTTVLGWQNTCESV DIT
Sbjct  1460  ESSFDALLNLVEMNHQLSCNSEVGGCGKLNYIHHILSTPPHVFTTVLGWQNTCESVGDIT  1519

Query  4984  ATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKV  5163
             ATL ALSTE+DI VLY GL PK+KHCL+S+VCYYGQHYHCFAY+ DH +W+MYDDKTVKV
Sbjct  1520  ATLSALSTEVDIGVLYHGLAPKNKHCLISMVCYYGQHYHCFAYNWDHGQWVMYDDKTVKV  1579

Query  5164  IGNWADVLTMCERGHLQPQV  5223
             IG+W DVL MCERGHLQPQV
Sbjct  1580  IGSWDDVLVMCERGHLQPQV  1599



>ref|XP_010663421.1| PREDICTED: uncharacterized protein LOC100256959 isoform X2 [Vitis 
vinifera]
Length=1649

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1101 (62%), Positives = 848/1101 (77%), Gaps = 27/1101 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLES-DTSAVLVQEKSLIRHDQAVVES  539
             MGHKKR +APRSK S      AAV  D A      +S + +     EKS +      VES
Sbjct  1     MGHKKRNLAPRSKGSQGSPGGAAVGGDGANSAEAEQSLNLNVGNSSEKSKM---VTGVES  57

Query  540   ETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVK  719
             E    S+Y+ IKLECER+LT+LRRGNHNKALR+MK+L  +H+NS + ALI+RVQGTVCVK
Sbjct  58    E---GSAYSAIKLECERSLTALRRGNHNKALRIMKELSVRHDNSVHSALIHRVQGTVCVK  114

Query  720   VASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQEC  899
             VASIIDDPN K RHLKNAI++A+K+V +SPNSIEFAHFYANLLYEAA++GKEYEEVV EC
Sbjct  115   VASIIDDPNAKQRHLKNAIETAKKAVELSPNSIEFAHFYANLLYEAASEGKEYEEVVHEC  174

Query  900   ERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS  1076
             ERAL+I++P+DPAKESLQ E+QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+
Sbjct  175   ERALSIDSPVDPAKESLQDESQQKISTVEARIGHVQNELRSLIQKSNIASISTWMKNLGN  234

Query  1077  GEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  1256
             GEEKFRLIPIRR+SEDPME+RLVQ+++PNEIKKATKT EERRKEIEVRVAAARLLQQKS+
Sbjct  235   GEEKFRLIPIRRVSEDPMEVRLVQSKRPNEIKKATKTQEERRKEIEVRVAAARLLQQKSD  294

Query  1257  SAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKK  1427
             + QS ++G+R+    + S+G GQR  ERRK  NARK  S++ER+  VRSYWNSMS +M+K
Sbjct  295   APQSQSEGDRTDKASETSSGPGQRVGERRK--NARKFGSTVERKVRVRSYWNSMSFNMRK  352

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
              LL+IRI DLK+HF S+KDGLA+ VLSEALSF E NK WKFW CC C E+F DSE H+QH
Sbjct  353   DLLKIRISDLKAHFSSVKDGLASGVLSEALSFVEVNKVWKFWVCCRCGEKFKDSELHMQH  412

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLEN  1787
             V+ EHM +L PK+QSVLPQN++NEW+EM++NCSWKPLDI+AA K+L+ + KC+ +  ++ 
Sbjct  413   VVQEHMGNLLPKMQSVLPQNIDNEWIEMIVNCSWKPLDISAAVKMLKNESKCQQNELIDE  472

Query  1788  TYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCN-GTTVDSREYDKNSEVWMDRDG  1964
              YT ++ +E  D   D       W+ SP K   GDGC+ G  V S      ++   + DG
Sbjct  473   FYTGNNTEECIDCFKD------AWESSPEKGMLGDGCSCGNLVKSDSDKIPNQGSRECDG  526

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
             NEG+K    + SWP+ADD ERAKLLE+I+V+F+ LIK+K L  SHLSKV+ F  +ELQ +
Sbjct  527   NEGSKAYLLANSWPLADDSERAKLLEKIHVLFEMLIKHKCLAGSHLSKVMQFTTDELQGI  586

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPER-STAIDDISTGI  2321
               GSQLLNY +DQTP CICFLGA +L+K+LKFLQELSH+CGL R  ++ S+A+DD ++  
Sbjct  587   ASGSQLLNYGVDQTPTCICFLGASQLRKLLKFLQELSHACGLARSSDKTSSAMDDANSLN  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             +  D  E ++ + D SCLL DEH  P + T    H  V  D+   ++ I  N   +NG  
Sbjct  647   RDFDIKENVLLNGDASCLLLDEHLLPTENTSTASHVAVTDDAATETSPIICN---ENGVQ  703

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D   LLSWIF G SS EQL SW R REEK+ Q MEI+++LEKEFY LQ LCERKCEHL+
Sbjct  704   PDGGSLLSWIFTGPSSVEQLASWMRIREEKSNQGMEILQMLEKEFYHLQSLCERKCEHLS  763

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ VEDLCLEEGKKRE+  DF  RS +  L+KRR+EL ES +E    + RFE++A+
Sbjct  764   YEEALQAVEDLCLEEGKKRENVTDFGSRSLESVLRKRREELRESENEVMLISNRFELDAV  823

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
              +VLK+AESLN+NQFG+E+ Y G++SHLCDLESGEDDDWR KD+L+Q D+C+EVAIQRQK
Sbjct  824   INVLKEAESLNMNQFGYEEHYNGVTSHLCDLESGEDDDWRSKDFLHQMDACIEVAIQRQK  883

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +SVELSKIDARIMR V+GMQQLE+ LE VSA DYR I++PL+KS++RAHLEDLAE+DA
Sbjct  884   EQLSVELSKIDARIMRNVTGMQQLELTLEPVSAFDYRSIILPLLKSFMRAHLEDLAEKDA  943

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             T+KSDAAREAFLAELA DSKKS+  GS+N++H+H+KT++KKK K+YRK KD KG+ G+  
Sbjct  944   TQKSDAAREAFLAELALDSKKSAIGGSDNSRHNHDKTKEKKKGKEYRKMKDSKGTGGSEQ  1003

Query  3402  HALHHDTAEEASFSVVHDGGSEDAE--LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
             H LHH T E+ S  V  DG   D+E  +S    NS  Q EEE RR+IELEAEERKLEETL
Sbjct  1004  HVLHHVTTEQDSSPVASDGEHPDSEPVVSVNDDNSKHQ-EEELRRKIELEAEERKLEETL  1062

Query  3576  eYQRRIENEAKLKHLAEQHKK  3638
             EYQRRIENEAK KHLAEQ KK
Sbjct  1063  EYQRRIENEAKQKHLAEQRKK  1083


 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/493 (70%), Positives = 407/493 (83%), Gaps = 21/493 (4%)
 Frame = +1

Query  3793  STVSDIH---KAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIE  3963
             ST S  H   + G  NGG   DG L S+RR GR+++RQK S K  + K   V+SG EN+E
Sbjct  1155  STPSQYHAKVEQGLPNGGSPVDGVLLSERRIGRKTKRQKNSTKLIDGKYQAVSSGKENVE  1214

Query  3964  VGEVRPVDDSLEKK----------HAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLD  4113
             VG +  ++D ++++          H G++G KTLRQL  E+DDEERFQADL +AVRQSLD
Sbjct  1215  VG-ISHIEDRVKEQIKIHGSGVNLHLGDNGTKTLRQLQAEEDDEERFQADLKQAVRQSLD  1273

Query  4114  TFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFL  4287
              + AHQKLPL+   R       E+ ++G+S +DV    ++G ++ GTGLKNEVGEYNCFL
Sbjct  1274  AYQAHQKLPLVSSLRMPQRMSHEVDDVGLSPDDVVIKNMSGADMLGTGLKNEVGEYNCFL  1333

Query  4288  NVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNS  4464
             N    SLWHLRRFR+EFL RS+SEH+HVGDPCVVCALY+IFTALS+AS++TRR+AVAP++
Sbjct  1334  N----SLWHLRRFRNEFLGRSTSEHVHVGDPCVVCALYEIFTALSVASTDTRREAVAPSA  1389

Query  4465  LRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDC  4644
             LRIALSNLYPD   FQE QMNDASEVLGVIF+CLH+SFTS+S  SDTESV+S+CMGSWDC
Sbjct  1390  LRIALSNLYPDSNFFQEAQMNDASEVLGVIFDCLHRSFTSSSSISDTESVESNCMGSWDC  1449

Query  4645  ANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDEL  4824
             ANS C+ HSLFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMKVMC +SSFDEL
Sbjct  1450  ANSICLAHSLFGMDIFERMNCYNCSLESRHLKYTSFFHNINASALRTMKVMCAESSFDEL  1509

Query  4825  LNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALS  5004
             LNLVEMNHQLACDP+A GCGK N+IHH LSTPPHVFT VLGWQNTCES +DITATL AL+
Sbjct  1510  LNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCESADDITATLAALN  1569

Query  5005  TEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADV  5184
             TEID+SVLYRGLDPK+++CLVSVVCYYGQHYHCFAYSH+HERW+MYDDKTVKVIG+W +V
Sbjct  1570  TEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDDKTVKVIGSWDNV  1629

Query  5185  LTMCERGHLQPQV  5223
             LTMCERGHLQPQV
Sbjct  1630  LTMCERGHLQPQV  1642



>ref|XP_002266656.1| PREDICTED: uncharacterized protein LOC100256959 isoform X1 [Vitis 
vinifera]
Length=1653

 Score =  1205 bits (3118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1101 (62%), Positives = 848/1101 (77%), Gaps = 27/1101 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLES-DTSAVLVQEKSLIRHDQAVVES  539
             MGHKKR +APRSK S      AAV  D A      +S + +     EKS +      VES
Sbjct  1     MGHKKRNLAPRSKGSQGSPGGAAVGGDGANSAEAEQSLNLNVGNSSEKSKM---VTGVES  57

Query  540   ETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVK  719
             E    S+Y+ IKLECER+LT+LRRGNHNKALR+MK+L  +H+NS + ALI+RVQGTVCVK
Sbjct  58    E---GSAYSAIKLECERSLTALRRGNHNKALRIMKELSVRHDNSVHSALIHRVQGTVCVK  114

Query  720   VASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQEC  899
             VASIIDDPN K RHLKNAI++A+K+V +SPNSIEFAHFYANLLYEAA++GKEYEEVV EC
Sbjct  115   VASIIDDPNAKQRHLKNAIETAKKAVELSPNSIEFAHFYANLLYEAASEGKEYEEVVHEC  174

Query  900   ERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS  1076
             ERAL+I++P+DPAKESLQ E+QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+
Sbjct  175   ERALSIDSPVDPAKESLQDESQQKISTVEARIGHVQNELRSLIQKSNIASISTWMKNLGN  234

Query  1077  GEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  1256
             GEEKFRLIPIRR+SEDPME+RLVQ+++PNEIKKATKT EERRKEIEVRVAAARLLQQKS+
Sbjct  235   GEEKFRLIPIRRVSEDPMEVRLVQSKRPNEIKKATKTQEERRKEIEVRVAAARLLQQKSD  294

Query  1257  SAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKK  1427
             + QS ++G+R+    + S+G GQR  ERRK  NARK  S++ER+  VRSYWNSMS +M+K
Sbjct  295   APQSQSEGDRTDKASETSSGPGQRVGERRK--NARKFGSTVERKVRVRSYWNSMSFNMRK  352

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
              LL+IRI DLK+HF S+KDGLA+ VLSEALSF E NK WKFW CC C E+F DSE H+QH
Sbjct  353   DLLKIRISDLKAHFSSVKDGLASGVLSEALSFVEVNKVWKFWVCCRCGEKFKDSELHMQH  412

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLEN  1787
             V+ EHM +L PK+QSVLPQN++NEW+EM++NCSWKPLDI+AA K+L+ + KC+ +  ++ 
Sbjct  413   VVQEHMGNLLPKMQSVLPQNIDNEWIEMIVNCSWKPLDISAAVKMLKNESKCQQNELIDE  472

Query  1788  TYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCN-GTTVDSREYDKNSEVWMDRDG  1964
              YT ++ +E  D   D       W+ SP K   GDGC+ G  V S      ++   + DG
Sbjct  473   FYTGNNTEECIDCFKD------AWESSPEKGMLGDGCSCGNLVKSDSDKIPNQGSRECDG  526

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
             NEG+K    + SWP+ADD ERAKLLE+I+V+F+ LIK+K L  SHLSKV+ F  +ELQ +
Sbjct  527   NEGSKAYLLANSWPLADDSERAKLLEKIHVLFEMLIKHKCLAGSHLSKVMQFTTDELQGI  586

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPER-STAIDDISTGI  2321
               GSQLLNY +DQTP CICFLGA +L+K+LKFLQELSH+CGL R  ++ S+A+DD ++  
Sbjct  587   ASGSQLLNYGVDQTPTCICFLGASQLRKLLKFLQELSHACGLARSSDKTSSAMDDANSLN  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             +  D  E ++ + D SCLL DEH  P + T    H  V  D+   ++ I  N   +NG  
Sbjct  647   RDFDIKENVLLNGDASCLLLDEHLLPTENTSTASHVAVTDDAATETSPIICN---ENGVQ  703

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D   LLSWIF G SS EQL SW R REEK+ Q MEI+++LEKEFY LQ LCERKCEHL+
Sbjct  704   PDGGSLLSWIFTGPSSVEQLASWMRIREEKSNQGMEILQMLEKEFYHLQSLCERKCEHLS  763

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ VEDLCLEEGKKRE+  DF  RS +  L+KRR+EL ES +E    + RFE++A+
Sbjct  764   YEEALQAVEDLCLEEGKKRENVTDFGSRSLESVLRKRREELRESENEVMLISNRFELDAV  823

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
              +VLK+AESLN+NQFG+E+ Y G++SHLCDLESGEDDDWR KD+L+Q D+C+EVAIQRQK
Sbjct  824   INVLKEAESLNMNQFGYEEHYNGVTSHLCDLESGEDDDWRSKDFLHQMDACIEVAIQRQK  883

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +SVELSKIDARIMR V+GMQQLE+ LE VSA DYR I++PL+KS++RAHLEDLAE+DA
Sbjct  884   EQLSVELSKIDARIMRNVTGMQQLELTLEPVSAFDYRSIILPLLKSFMRAHLEDLAEKDA  943

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             T+KSDAAREAFLAELA DSKKS+  GS+N++H+H+KT++KKK K+YRK KD KG+ G+  
Sbjct  944   TQKSDAAREAFLAELALDSKKSAIGGSDNSRHNHDKTKEKKKGKEYRKMKDSKGTGGSEQ  1003

Query  3402  HALHHDTAEEASFSVVHDGGSEDAE--LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
             H LHH T E+ S  V  DG   D+E  +S    NS  Q EEE RR+IELEAEERKLEETL
Sbjct  1004  HVLHHVTTEQDSSPVASDGEHPDSEPVVSVNDDNSKHQ-EEELRRKIELEAEERKLEETL  1062

Query  3576  eYQRRIENEAKLKHLAEQHKK  3638
             EYQRRIENEAK KHLAEQ KK
Sbjct  1063  EYQRRIENEAKQKHLAEQRKK  1083


 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 411/493 (83%), Gaps = 17/493 (3%)
 Frame = +1

Query  3793  STVSDIH---KAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIE  3963
             ST S  H   + G  NGG   DG L S+RR GR+++RQK S K  + K   V+SG EN+E
Sbjct  1155  STPSQYHAKVEQGLPNGGSPVDGVLLSERRIGRKTKRQKNSTKLIDGKYQAVSSGKENVE  1214

Query  3964  VGEVRPVDDSLEKK----------HAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLD  4113
             VG +  ++D ++++          H G++G KTLRQL  E+DDEERFQADL +AVRQSLD
Sbjct  1215  VG-ISHIEDRVKEQIKIHGSGVNLHLGDNGTKTLRQLQAEEDDEERFQADLKQAVRQSLD  1273

Query  4114  TFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFL  4287
              + AHQKLPL+   R       E+ ++G+S +DV    ++G ++ GTGLKNEVGEYNCFL
Sbjct  1274  AYQAHQKLPLVSSLRMPQRMSHEVDDVGLSPDDVVIKNMSGADMLGTGLKNEVGEYNCFL  1333

Query  4288  NVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNS  4464
             NVIIQSLWHLRRFR+EFL RS+SEH+HVGDPCVVCALY+IFTALS+AS++TRR+AVAP++
Sbjct  1334  NVIIQSLWHLRRFRNEFLGRSTSEHVHVGDPCVVCALYEIFTALSVASTDTRREAVAPSA  1393

Query  4465  LRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDC  4644
             LRIALSNLYPD   FQE QMNDASEVLGVIF+CLH+SFTS+S  SDTESV+S+CMGSWDC
Sbjct  1394  LRIALSNLYPDSNFFQEAQMNDASEVLGVIFDCLHRSFTSSSSISDTESVESNCMGSWDC  1453

Query  4645  ANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDEL  4824
             ANS C+ HSLFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMKVMC +SSFDEL
Sbjct  1454  ANSICLAHSLFGMDIFERMNCYNCSLESRHLKYTSFFHNINASALRTMKVMCAESSFDEL  1513

Query  4825  LNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALS  5004
             LNLVEMNHQLACDP+A GCGK N+IHH LSTPPHVFT VLGWQNTCES +DITATL AL+
Sbjct  1514  LNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCESADDITATLAALN  1573

Query  5005  TEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADV  5184
             TEID+SVLYRGLDPK+++CLVSVVCYYGQHYHCFAYSH+HERW+MYDDKTVKVIG+W +V
Sbjct  1574  TEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDDKTVKVIGSWDNV  1633

Query  5185  LTMCERGHLQPQV  5223
             LTMCERGHLQPQV
Sbjct  1634  LTMCERGHLQPQV  1646



>ref|XP_010318961.1| PREDICTED: uncharacterized protein LOC101250879 [Solanum lycopersicum]
Length=1593

 Score =  1204 bits (3114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/1098 (62%), Positives = 838/1098 (76%), Gaps = 30/1098 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLV----QEKSLIRHD-QA  527
             M HK+R +APR K S A  + A            LESD + V V    Q+K   ++D  A
Sbjct  1     MVHKRRTVAPRPKHSAATEDAAIPL---------LESDLNLVSVCPSVQKKISRKNDTSA  51

Query  528   VVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             VVE E NA S   +IKLECERALTSLR+GNH KALRL+K+L +KHENSP+  LI+RV+G+
Sbjct  52    VVEGEKNALS--PSIKLECERALTSLRKGNHTKALRLIKELASKHENSPHAPLIHRVEGS  109

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             V  K+AS+IDDPN K+RHLKNAI+SARK+V +SPNSIEFA+FYA+LLYEAAN+GKEYEEV
Sbjct  110   VYAKMASMIDDPNAKHRHLKNAIESARKAVSLSPNSIEFAYFYASLLYEAANEGKEYEEV  169

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             VQECERALAIENPIDPAK++LQE +QQK  TP ARI HV+ EL++LIQ+SN ASIS WV 
Sbjct  170   VQECERALAIENPIDPAKQNLQEESQQKDDTPNARIDHVRIELQSLIQKSNFASISAWVN  229

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
               G+G+EK RLIPIRR+ EDPME+RLVQAR P EIKK TKT EERRKEIEVRVAAARLLQ
Sbjct  230   QLGNGQEKIRLIPIRRVPEDPMEMRLVQARGPTEIKKVTKTSEERRKEIEVRVAAARLLQ  289

Query  1245  QKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             + SE+ Q+ NDG+++LDL+ G+ QR  ERRKSGNARKN SS ERRD V+SYWNS++ D K
Sbjct  290   KTSETVQTHNDGDKALDLTTGSAQRIGERRKSGNARKNSSSTERRDWVQSYWNSLTLDKK  349

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             ++ LRI+I DLK+H  + KDGLA EVLSEALSF E NK WKFWTC  C E+F DS SH  
Sbjct  350   REFLRIKISDLKAHLSASKDGLAIEVLSEALSFYETNKDWKFWTCYRCNEKFTDSVSHNY  409

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV++EH  +L PKLQSVLPQNVENEW EMLLNCSW+PLD  AAAK+L+KQ + +  GFL+
Sbjct  410   HVVHEHFGTLHPKLQSVLPQNVENEWAEMLLNCSWEPLDGCAAAKMLDKQSRYQEQGFLD  469

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRD  1961
               + R + +ESK   S+ +CN    D S   + FGD  NG T++SR +DK S++  MD D
Sbjct  470   EKHQRDETEESKYGFSEVFCNEDRLDSSARNRKFGDIPNGDTIESRVHDKISDMELMDSD  529

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
              N GTK     + WP++DDP+RA LLERI+ VFQTLI++KYL SSHLSKVI FAVE+LQ 
Sbjct  530   RNYGTKNGFLPDKWPLSDDPDRANLLERISAVFQTLIESKYLASSHLSKVIDFAVEQLQG  589

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L +GSQLL+YN+DQTPLCICFLGA ELK +LKFLQ+LS+SCGLGR+ E++ + D  S   
Sbjct  590   LAFGSQLLSYNVDQTPLCICFLGAQELKTVLKFLQDLSYSCGLGRFSEKTNSRDGASNAS  649

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG D +EK++ SEDGSCLLFDE F P  L   +  D +  D      + +   Q  +G  
Sbjct  650   QGFDDLEKLIVSEDGSCLLFDERFLPFNLARSSCPDIISIDRTAYVLSSN---QYQDGAE  706

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLE--KEFYELQGLCERKCEH  2675
             LD + LLSWIF G SS E L SW+ +REEKAQQ  EI R LE  KEFY+LQ LCERK EH
Sbjct  707   LDPEALLSWIFTGPSSVEHLASWTCAREEKAQQD-EIFRFLELEKEFYDLQCLCERKIEH  765

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             LNYE AL  +E++CL+EG++R+H  + V +SYD  L+KRR++L+ES ++ T   YRFE+ 
Sbjct  766   LNYEVALLAIEEICLKEGRRRDHATEIVGQSYDSLLRKRREDLIESDNDVTVIGYRFELN  825

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AIS+VLK+AESL+VN+  FE+TY G +S LCD++S ++DDWR+KDYL+Q DSCVEVAIQR
Sbjct  826   AISNVLKEAESLSVNRISFEETYSGGTSQLCDIKSSKEDDWRLKDYLHQVDSCVEVAIQR  885

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKE VS+ELSK+DARIMRVV+GMQQL V+LE   A DYR+ILV L+KSY+RAHLEDLAE+
Sbjct  886   QKERVSIELSKLDARIMRVVAGMQQLRVELEHACAQDYRRILVTLLKSYIRAHLEDLAEK  945

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DAT+KSDAA EA LAELA DSKKSS  G+  +KH+HEK +DKKK K+YRK K  K ++GN
Sbjct  946   DATKKSDAASEALLAELAHDSKKSSRRGNGCSKHTHEKMKDKKKSKEYRKAKGSKPASGN  1005

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              L  LHH T E+ SF+   + G E AE  NG S     +E+E RR IELEAEERKLEETL
Sbjct  1006  KLPLLHHRTMEDVSFADGENQGDETAE--NGDS----LKEQEYRRTIELEAEERKLEETL  1059

Query  3576  eYQRRIENEAKLKHLAEQ  3629
             EYQR++EN+AKLKHL+E+
Sbjct  1060  EYQRQMENDAKLKHLSEK  1077


 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/424 (75%), Positives = 352/424 (83%), Gaps = 7/424 (2%)
 Frame = +1

Query  3952  ENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQ  4131
             EN EVGE R +  S       +SG KTLRQLHVE DDEERF+ADL KAVRQSLD FHAH+
Sbjct  1170  ENTEVGEPRALHSSHGNSVPADSGTKTLRQLHVEYDDEERFRADLQKAVRQSLDMFHAHK  1229

Query  4132  KLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLW  4311
             KLPL+P SG  Q        V  +    G V+ I+ YGTGLKNE+GEYNCFLNVIIQSLW
Sbjct  1230  KLPLLPSSGNEQ-------KVFPKAGTLGDVSKIDAYGTGLKNEIGEYNCFLNVIIQSLW  1282

Query  4312  HLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLY  4491
             H+RRFRDEFLR+SSEH+HVGDPCV+CALYDIFTALS  S+ET R  V P SLRI+LSNLY
Sbjct  1283  HIRRFRDEFLRTSSEHVHVGDPCVICALYDIFTALSTPSTETCRKTVDPTSLRISLSNLY  1342

Query  4492  PDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHS  4671
             PD   FQEGQMNDASEVLGVIF+ LH+SFTSASG S TES DSSCMG+WDC+N ACIVHS
Sbjct  1343  PDSNFFQEGQMNDASEVLGVIFDSLHRSFTSASGISGTESADSSCMGTWDCSNGACIVHS  1402

Query  4672  LFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQ  4851
             LFGMD FE+M CY CGLESRHLKYTSFFHNINASALRT+KV+C +SSFD LLNLVEMNHQ
Sbjct  1403  LFGMDTFEQMVCYNCGLESRHLKYTSFFHNINASALRTIKVVCPESSFDALLNLVEMNHQ  1462

Query  4852  LACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLY  5031
             L+C+ +  GCGK N+IHH LSTPPHVFTTVLGWQNTCESV DITATL ALSTE+DI VLY
Sbjct  1463  LSCNSEVGGCGKLNYIHHILSTPPHVFTTVLGWQNTCESVGDITATLSALSTEVDIGVLY  1522

Query  5032  RGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHL  5211
              GL PK+KH L+S+VCYYGQHY+CFAY+ DH +W+MYDDKTVKVIG W DVL MCERGHL
Sbjct  1523  HGLAPKNKHRLISMVCYYGQHYYCFAYNCDHGQWVMYDDKTVKVIGGWDDVLVMCERGHL  1582

Query  5212  QPQV  5223
             QPQV
Sbjct  1583  QPQV  1586



>ref|XP_007210436.1| hypothetical protein PRUPE_ppa000140mg [Prunus persica]
 gb|EMJ11635.1| hypothetical protein PRUPE_ppa000140mg [Prunus persica]
Length=1649

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1112 (62%), Positives = 841/1112 (76%), Gaps = 44/1112 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APR K S A V+  A   D       + +DT+  LV+  S   +D   ++ E
Sbjct  1     MGHKKRNAAPRPKQSPAAVKPLAGEGDAVVS---VPADTTLALVEADS---NDALSIKIE  54

Query  543   TNA-----SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             ++       SSY+  KLECERALT+LRRGNH KALRLMK+ C ++ENS + ALI+RVQGT
Sbjct  55    SSPPIESDGSSYSAAKLECERALTALRRGNHTKALRLMKESCQRYENSAHSALIHRVQGT  114

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             V VKVA+IIDDPN K RHL+NAIDSAR++V +SPNSIEF+HFYANLLYEAANDGKEYEEV
Sbjct  115   VGVKVAAIIDDPNAKQRHLRNAIDSARRAVELSPNSIEFSHFYANLLYEAANDGKEYEEV  174

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             V ECERALAIE P+DPAKESLQE +QQK+ST EARI HV  ELR LIQ+SN+ASISTW+K
Sbjct  175   VTECERALAIEKPVDPAKESLQEESQQKISTTEARIGHVHNELRQLIQKSNIASISTWMK  234

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
             N G+GEEKFRLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  235   NLGNGEEKFRLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  294

Query  1245  QKSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             QKSE  Q  NDGE+S   LD S+G+ QRG+ERRK GN RKN SS ER+D VRSYW SMS 
Sbjct  295   QKSEVPQLGNDGEKSDRGLDSSSGSSQRGSERRKFGNLRKNGSSAERKDWVRSYWKSMSI  354

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             DMKK+LLRIR+ DLK+ F S KDGLANEVLSEAL+FAE+N++WKFW CC C E+F DSES
Sbjct  355   DMKKELLRIRVSDLKAKFSSSKDGLANEVLSEALAFAESNRSWKFWVCCRCNEKFVDSES  414

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             H+ HV+ EHM +L PK+QSVLPQNV+NEW+EMLLNCSWKPLD++AA  +L  Q KC+   
Sbjct  415   HMHHVVQEHMGNLMPKMQSVLPQNVDNEWIEMLLNCSWKPLDVSAAVGMLRDQRKCKDPE  474

Query  1776  FLENTYT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV  1946
              +E+ Y+     D DE         C    WD SP K+  GD  +  T++    +K + V
Sbjct  475   VVEDFYSGIHTKDCDE---------CFKDAWDSSPEKEVLGDSPSDCTIEGNNQEKIANV  525

Query  1947  -WMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFA  2123
              + + + N        +  WPI+DD ER KLLERI+  F+ LI++KYL +SHL++VI F 
Sbjct  526   EFGECEDNGLIAYSSIANGWPISDDSERTKLLERIHASFEVLIRHKYLAASHLNRVIQFT  585

Query  2124  VEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-I  2300
             ++ELQ+   GSQLLN+ ++QTP+CICFLGA +L+KILKFLQ+LSH+CGLGRY E+S++ +
Sbjct  586   MDELQA--SGSQLLNHGVEQTPMCICFLGANQLRKILKFLQDLSHACGLGRYSEKSSSPM  643

Query  2301  DDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissni  2480
             DD++   QGV+  E+IV + D SCLL DE     + T    H   VTD+   +       
Sbjct  644   DDVNNTNQGVEIKERIVLNGDASCLLLDECLLSSECTCGAGHH-TVTDAASAAVGN----  698

Query  2481  QCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCE  2660
                N  L DSD LLSWIF G +SGEQLTSW R++EEK QQ MEI+++LEKEFY LQ LCE
Sbjct  699   --GNWVLPDSDALLSWIFAGPTSGEQLTSWVRTKEEKTQQGMEILQMLEKEFYHLQSLCE  756

Query  2661  RKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNY  2840
             RKCEHL+YEEALQ VEDLC+EEGKKRE+  DF  RS++  L+KRR+EL+E  ++    + 
Sbjct  757   RKCEHLSYEEALQAVEDLCVEEGKKRENVSDFSHRSFESVLRKRREELLERENDVMFLSS  816

Query  2841  RFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVE  3020
             R E++AIS+VLK++E LN+NQFG+E+TYGG++S LCDLESGEDDDWR KDY++Q D+CVE
Sbjct  817   RIELDAISNVLKESEHLNINQFGYEETYGGVTSQLCDLESGEDDDWRAKDYVHQVDTCVE  876

Query  3021  VAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLE  3200
             VAIQRQKE + VELS IDARIMR V+GMQQLE+KLE VSAHDYR IL+PLVKSYLRAHLE
Sbjct  877   VAIQRQKEQLYVELSTIDARIMRNVTGMQQLEIKLEPVSAHDYRSILLPLVKSYLRAHLE  936

Query  3201  DLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlk  3380
             DLAERDATEKSDAAREAFLAELA DSKK+   G+++ +H+ EKT+DKKK K+ RK KD K
Sbjct  937   DLAERDATEKSDAAREAFLAELALDSKKAVRGGNDSLRHTQEKTKDKKKNKECRKAKDSK  996

Query  3381  GSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrieleae  3551
               NG     +HHD   E SF V  DG   D+E+    NG  N + Q EEE +RRIELEAE
Sbjct  997   -VNGVSDEYMHHDETSELSFPVASDGDLLDSEIIVSVNG--NDLKQLEEESKRRIELEAE  1053

Query  3552  erkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             ERKLEETLEYQR+IE EAK KHLAEQ KK  +
Sbjct  1054  ERKLEETLEYQRQIEKEAKQKHLAEQSKKSTQ  1085


 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/505 (69%), Positives = 397/505 (79%), Gaps = 20/505 (4%)
 Frame = +1

Query  3757  SNGSPLEGHPKNSTV------SDIHKA----GFSNGGFLE-DGALTSDrragrrsrrqkg  3903
             +NGSP+   P  S++      S  H+A    G  NGG LE DG   SDRR GR++RRQ+ 
Sbjct  1142  ANGSPV---PVKSSIVGAQMISGAHQAKVNQGLPNGGILEEDGYFPSDRRTGRKNRRQRS  1198

Query  3904  sakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAG--ESGPKTLRQLHVEDDDEERFQ  4077
             S K  + K   +++  EN++VG    V+  L ++      +G   LRQ   E+DDEERFQ
Sbjct  1199  STKVPDGKSQALSTEKENVDVGR-STVEGHLREQSRSHDNNGTNELRQQRAEEDDEERFQ  1257

Query  4078  ADLMKAVRQSLDTFHAHQKLPLIPRSGTAQ--ISEMANLGVSCEDVATGIVNGIEVYGTG  4251
             ADL KAVRQSLDTF  HQKLP++  S   +   +E+    V   D+     +  +++GTG
Sbjct  1258  ADLKKAVRQSLDTFQEHQKLPIVSNSRMLKRISTEVDGGAVLHNDITNENASETDIFGTG  1317

Query  4252  LKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLAS  4428
             LKNEVGEYNCFLNVIIQSLWH+R FRDEFLR S+SEH+HVGDPCVVCALY+IFTALS AS
Sbjct  1318  LKNEVGEYNCFLNVIIQSLWHIRLFRDEFLRRSTSEHVHVGDPCVVCALYEIFTALSNAS  1377

Query  4429  SETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTE  4608
             ++ RR+AVAP SLRIALSNLYP+   FQE QMNDASEVL VIFECLH++FT  S  SD E
Sbjct  1378  ADMRREAVAPTSLRIALSNLYPESNFFQEAQMNDASEVLVVIFECLHRAFTPGSSVSDAE  1437

Query  4609  SVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTM  4788
             SV+SSC GSWDC+N+ACIVHS+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTM
Sbjct  1438  SVESSCPGSWDCSNNACIVHSIFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTM  1497

Query  4789  KVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCES  4968
             KVMC +SS+DELLNLVEMNHQLACDP+A GCGK N+IHH LSTPPHVFTTVLGWQ TCES
Sbjct  1498  KVMCAESSYDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVLGWQKTCES  1557

Query  4969  VEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDD  5148
              +DITATL AL+TEIDISVLYRGLDPKS H LVSVVCYYGQHYHCFAYSHD E WIMYDD
Sbjct  1558  ADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDRECWIMYDD  1617

Query  5149  KTVKVIGNWADVLTMCERGHLQPQV  5223
             KTVKVIG WADVLTMCE+GHLQPQV
Sbjct  1618  KTVKVIGGWADVLTMCEKGHLQPQV  1642



>ref|XP_008239780.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338359 
[Prunus mume]
Length=1580

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1043 (64%), Positives = 808/1043 (77%), Gaps = 34/1043 (3%)
 Frame = +3

Query  555   SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASII  734
             SSY+  KLECERALT+LRRGNH KALRLMK+ C ++ENS + ALI+RVQGTVCVKVA+II
Sbjct  12    SSYSAAKLECERALTALRRGNHTKALRLMKESCQRYENSAHSALIHRVQGTVCVKVAAII  71

Query  735   DDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALA  914
             DDPN K RHL+NAIDSAR++V +SPNSIEF+H +ANLLYEA NDG+E  +VV ECERALA
Sbjct  72    DDPNAKQRHLRNAIDSARRAVELSPNSIEFSHLHANLLYEADNDGQE-XKVVTECERALA  130

Query  915   IENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IE P+DPAKESLQE +QQK+ST EARI HV  ELR LIQ+SN+ASISTW+KN G+GEEKF
Sbjct  131   IEKPVDPAKESLQEESQQKISTTEARIGHVHNELRQLIQKSNIASISTWMKNLGNGEEKF  190

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             RLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  Q  
Sbjct  191   RLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSEVPQLG  250

Query  1272  NDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRI  1442
             NDGE+S   LD S+G+ QRG+ERRK GN RKN SS ER+D VRSYW SMS DMKK+LLRI
Sbjct  251   NDGEKSDRGLDSSSGSSQRGSERRKFGNLRKNGSSAERKDWVRSYWKSMSIDMKKELLRI  310

Query  1443  RIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEH  1622
             R+ DLK+ F S KDGLANEVLSEAL+FAE+N++WKFW CC C E+F DSESH+ HV+ EH
Sbjct  311   RVSDLKAKFSSSKDGLANEVLSEALAFAESNRSWKFWVCCRCNEKFVDSESHMHHVVQEH  370

Query  1623  MCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYT--  1796
             M +L PK+QSVLPQNV+NEW+EMLLNCSWKPLD++AA  +L  Q KC+     E+ Y+  
Sbjct  371   MGNLMPKMQSVLPQNVDNEWIEMLLNCSWKPLDVSAAVGMLRDQRKCKDPEVFEDFYSGI  430

Query  1797  -RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGNE  1970
                D DE         C    WD SP K+  GD  +  T++    +K + V + + + N 
Sbjct  431   HTKDCDE---------CFKDAWDSSPEKEVLGDSPSDCTIEGNNQEKIAHVEFGECEDNG  481

Query  1971  GTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGY  2150
                    +  WPI+DD ER KLLERI+  F+ LI++KYL +SHL++VI F ++ELQ+   
Sbjct  482   SIAYSSVANGWPISDDSERTKLLERIHASFEVLIRHKYLAASHLNRVIQFTMDELQA--S  539

Query  2151  GSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-IDDISTGIQG  2327
             GSQLLN+ ++QTP+CICFLGA +L+KILKFLQ+LSH+CGLGRY E+S++ +DD++   QG
Sbjct  540   GSQLLNHGVEQTPMCICFLGANQLRKILKFLQDLSHACGLGRYSEKSSSPMDDVNNTNQG  599

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
             V+  E+IV + D SCLL DE     + T    H   VTD+ P +          NG L D
Sbjct  600   VEIKERIVLNGDASCLLLDECLLSSECTCGAGHH-TVTDAAPAAVGN------GNGVLPD  652

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
             SD LLSWIF G +SGEQLTSW R++EEK QQ MEI+++LEKEFY LQ LCERKCEHL+YE
Sbjct  653   SDALLSWIFAGPTSGEQLTSWVRTKEEKTQQGMEILQMLEKEFYHLQSLCERKCEHLSYE  712

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
             EALQ VEDLC+EEGKKRE+  DF  RS++  L+KRR+EL+E  ++    + R E++AIS+
Sbjct  713   EALQAVEDLCVEEGKKRENVSDFSHRSFESVLRKRREELLERENDVMFLSSRIELDAISN  772

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VLK++E LN+NQFG+E+TYGG++S LCDLESGEDDDWR KDY++Q D+CVEVAIQRQKE 
Sbjct  773   VLKESEHLNINQFGYEETYGGVTSQLCDLESGEDDDWRAKDYVHQVDTCVEVAIQRQKEQ  832

Query  3048  VSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATE  3227
             + VELS IDARIMR V+GMQQLE+KLE VSAHDYR IL+PLVKSYLRAHLEDLAERDATE
Sbjct  833   LYVELSTIDARIMRNVTGMQQLEIKLEPVSAHDYRSILLPLVKSYLRAHLEDLAERDATE  892

Query  3228  KSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHA  3407
             KSDAAREAFLAELA DSKK+   G+++ +H+ EKT+DKKK K+YRK KD K  NG     
Sbjct  893   KSDAAREAFLAELALDSKKAVRGGNDSLRHTQEKTKDKKKNKEYRKAKDSK-VNGVSDEH  951

Query  3408  LHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrieleaeerkleetle  3578
             +HHD   E SF V  DG   D+E+    NG  N + Q EEE +RRIELEAEERKLEETLE
Sbjct  952   MHHDETSELSFPVASDGDLLDSEIIVSVNG--NDLKQLEEESKRRIELEAEERKLEETLE  1009

Query  3579  YQRRIENEAKLKHLAEQHKKGAR  3647
             YQR+IE EAK KHLAEQ KK  +
Sbjct  1010  YQRQIEKEAKQKHLAEQSKKSTQ  1032


 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/512 (67%), Positives = 390/512 (76%), Gaps = 15/512 (3%)
 Frame = +1

Query  3733  TTKKELLQSNGSPLEGHPKNSTVSDIHKA----GFSNGGFLE-DGALTSDrragrrsrrq  3897
             + ++ L Q  G P         +   H+A    G  NGG LE DG L SDRR  R++RRQ
Sbjct  1062  SMQEPLAQKTGFPNNVEGGAQMIGGAHQAKVNQGLPNGGILEEDGYLPSDRRTVRKNRRQ  1121

Query  3898  kgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGES-------GPKTLRQLHVED  4056
             + S K  + K   + S  EN++VG         E+  + +S       G   LRQ   E+
Sbjct  1122  RSSTKVPDGKSQALASEKENVDVGRSTVEGHLREQSRSHDSLLADSNNGTNELRQQRAEE  1181

Query  4057  DDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQ--ISEMANLGVSCEDVATGIVNG  4230
             DDEERFQADL KAVRQSLDTF  HQKLP++  S   +   +E+    V   D+     + 
Sbjct  1182  DDEERFQADLKKAVRQSLDTFQEHQKLPIVSNSRMLKRISTEVDGGAVLHNDITNENASE  1241

Query  4231  IEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIF  4407
              +++GTGLKNEVGEYNCFLNVIIQSLWH+R FRDEFL RS+SEH+HVGDPCVVCALY+IF
Sbjct  1242  TDIFGTGLKNEVGEYNCFLNVIIQSLWHIRLFRDEFLQRSTSEHVHVGDPCVVCALYEIF  1301

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
              ALS AS++ RR+AVAP SLRIALSNLYP+   FQE QMNDASEVL VIFECLH++FT  
Sbjct  1302  IALSNASADMRREAVAPTSLRIALSNLYPESNFFQEAQMNDASEVLVVIFECLHRAFTPG  1361

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             S  SD ESV+SSC GSWDC+N+ACIVHS+FGMD+FERMNCY C LESRHLKYTSFFHNIN
Sbjct  1362  SSVSDAESVESSCPGSWDCSNNACIVHSIFGMDIFERMNCYNCSLESRHLKYTSFFHNIN  1421

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             ASALRTMKVMC +SS+DELLNLVEMNHQLACDP+A GCGK N+IHH LSTPPHVFTTVLG
Sbjct  1422  ASALRTMKVMCAESSYDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVLG  1481

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQ TCES +DITATL AL+TEIDISVLYRGLDPKS H LVSVVCYYGQHYHCFAYSHD E
Sbjct  1482  WQKTCESADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDRE  1541

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
              WIMYDDKTVKVIG WADVLTMCE+GHLQPQV
Sbjct  1542  CWIMYDDKTVKVIGGWADVLTMCEKGHLQPQV  1573



>gb|KDO76022.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1229

 Score =  1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1104 (61%), Positives = 834/1104 (76%), Gaps = 39/1104 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK S A    A       A      ++ S             +A V   
Sbjct  1     MGHKKKNTAPRSKQSPAAAVEAEPCATPDATSNQTNTEPS-------------EADVVVG  47

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCVKV
Sbjct  48    GGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQECE
Sbjct  108   ASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQECE  167

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  168   RALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLGTG  227

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  228   EEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSET  287

Query  1260  AQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDMKK  1427
              Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +MK+
Sbjct  288   GQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEMKR  347

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LL++++ D+K+H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+ H
Sbjct  348   ELLKVKVCDIKAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHMHH  407

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLE  1784
             V+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R     E
Sbjct  408   VVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEVSE  467

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR-D  1961
             + Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +     D
Sbjct  468   DFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRECD  521

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+ + + P  +SWP+ADD ER KLLERI+ +F+ L+++K L +SHLSKVI + ++ELQS
Sbjct  522   GNQVSAVYPLIDSWPVADDTERVKLLERIHALFELLLRHKCLSASHLSKVIQYTMDELQS  581

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++  
Sbjct  582   LASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANSVS  641

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDNGG  2498
               ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +NG 
Sbjct  642   PSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHENGV  691

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCEHL
Sbjct  692   AEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCEHL  751

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE +A
Sbjct  752   SYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFESDA  810

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQRQ
Sbjct  811   ILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQRQ  870

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DY+ IL+PLV+SYLRAHLEDLAE+D
Sbjct  871   KEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYQSILLPLVQSYLRAHLEDLAEKD  930

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   GN 
Sbjct  931   ATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGGNE  990

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEETL
Sbjct  991   RHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEETL  1050

Query  3576  eYQRRIENEAKLKHLAEQHKKGAR  3647
              YQRRIENEAKLKHLAEQ KK A+
Sbjct  1051  AYQRRIENEAKLKHLAEQSKKSAQ  1074



>ref|XP_006476672.1| PREDICTED: uncharacterized protein LOC102612465 isoform X2 [Citrus 
sinensis]
Length=1315

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1106 (60%), Positives = 837/1106 (76%), Gaps = 43/1106 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAV--LVQEKSLIRHDQAVVE  536
             MGHKK+  APRSK S A                 +E++  A       ++     +A V 
Sbjct  1     MGHKKKNTAPRSKQSPAAA---------------VEAEPCATPDATSNQTNTEPWEADVV  45

Query  537   SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
                  +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCV
Sbjct  46    VGGGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCV  105

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQE
Sbjct  106   KVASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQE  165

Query  897   CERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G
Sbjct  166   CERALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLG  225

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
             +GEEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKS
Sbjct  226   TGEEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  285

Query  1254  ESAQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDM  1421
             E+ Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +M
Sbjct  286   ETGQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEM  345

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             K++LL++++ D+++H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+
Sbjct  346   KRELLKVKVCDIEAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHM  405

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGF  1778
              HV+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R    
Sbjct  406   HHVVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEV  465

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
              E+ Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +    
Sbjct  466   SEDFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRE  519

Query  1959  -DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DGN+ + + P  +SWP+ADD ERAKLLERI+ +F+ L+++K L +SHLSKVI + ++EL
Sbjct  520   CDGNQVSAVYPLIDSWPVADDTERAKLLERIHALFELLLRHKCLSASHLSKVIQYTMDEL  579

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             QSL  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++
Sbjct  580   QSLASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANS  639

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDN  2492
                 ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +N
Sbjct  640   VSPSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHEN  689

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
             G   D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCE
Sbjct  690   GVAEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCE  749

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HL+YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE 
Sbjct  750   HLSYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFES  808

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             +AI +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQ
Sbjct  809   DAILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQ  868

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DYR IL+PLV+SYLRAHLEDLAE
Sbjct  869   RQKEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYRSILLPLVQSYLRAHLEDLAE  928

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   G
Sbjct  929   KDATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGG  988

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerklee  3569
             N  H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEE
Sbjct  989   NERHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEE  1048

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TL YQRRIENEAKLKHLAEQ KK A+
Sbjct  1049  TLAYQRRIENEAKLKHLAEQSKKSAQ  1074


 Score =   110 bits (276),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 16/183 (9%)
 Frame = +1

Query  3757  SNGS--PLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsak  3912
             +NG+  P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +
Sbjct  1128  ANGAAVPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNR  1187

Query  3913  YNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQAD  4083
               + K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQAD
Sbjct  1188  SQDWKNQALSSEKENIGV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQAD  1244

Query  4084  LMKAVRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLK  4257
             L +AVRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLK
Sbjct  1245  LKQAVRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLK  1304

Query  4258  NEV  4266
             NEV
Sbjct  1305  NEV  1307



>gb|KDO76019.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1691

 Score =  1172 bits (3033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1104 (61%), Positives = 835/1104 (76%), Gaps = 39/1104 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK S A    A       A      ++ S             +A V   
Sbjct  1     MGHKKKNTAPRSKQSPAAAVEAEPCATPDATSNQTNTEPS-------------EADVVVG  47

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCVKV
Sbjct  48    GGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQECE
Sbjct  108   ASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQECE  167

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  168   RALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLGTG  227

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  228   EEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSET  287

Query  1260  AQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDMKK  1427
              Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +MK+
Sbjct  288   GQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEMKR  347

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LL++++ D+K+H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+ H
Sbjct  348   ELLKVKVCDIKAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHMHH  407

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLE  1784
             V+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R     E
Sbjct  408   VVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEVSE  467

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM-DRD  1961
             + Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +   + D
Sbjct  468   DFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRECD  521

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+ + + P  +SWP+ADD ER KLLERI+ +F+ L+++K L +SHLSKVI + ++ELQS
Sbjct  522   GNQVSAVYPLIDSWPVADDTERVKLLERIHALFELLLRHKCLSASHLSKVIQYTMDELQS  581

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++  
Sbjct  582   LASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANSVS  641

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDNGG  2498
               ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +NG 
Sbjct  642   PSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHENGV  691

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCEHL
Sbjct  692   AEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCEHL  751

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE +A
Sbjct  752   SYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFESDA  810

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQRQ
Sbjct  811   ILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQRQ  870

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DY+ IL+PLV+SYLRAHLEDLAE+D
Sbjct  871   KEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYQSILLPLVQSYLRAHLEDLAEKD  930

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   GN 
Sbjct  931   ATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGGNE  990

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEETL
Sbjct  991   RHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEETL  1050

Query  3576  eYQRRIENEAKLKHLAEQHKKGAR  3647
              YQRRIENEAKLKHLAEQ KK A+
Sbjct  1051  AYQRRIENEAKLKHLAEQSKKSAQ  1074


 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/502 (71%), Positives = 400/502 (80%), Gaps = 17/502 (3%)
 Frame = +1

Query  3757  SNGS--PLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsak  3912
             +NG+  P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +
Sbjct  1128  ANGAAVPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNR  1187

Query  3913  YNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQAD  4083
               + K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQAD
Sbjct  1188  SQDWKNQALSSEKENIGV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQAD  1244

Query  4084  LMKAVRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLK  4257
             L +AVRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLK
Sbjct  1245  LKQAVRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLK  1304

Query  4258  NEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSE  4434
             NEVGEYNCFLNVIIQSLWHLRRFR+EF R S SEHIHVG+PCVVCALY+IFTALS+AS++
Sbjct  1305  NEVGEYNCFLNVIIQSLWHLRRFREEFSRRSPSEHIHVGEPCVVCALYEIFTALSIASTD  1364

Query  4435  TRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESV  4614
             TR++AVAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SFT  S  SDTESV
Sbjct  1365  TRKEAVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTPGSNVSDTESV  1424

Query  4615  DSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKV  4794
             +S+CMGSWDC NSACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKV
Sbjct  1425  ESNCMGSWDCTNSACIVHSLFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKV  1484

Query  4795  MCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVE  4974
             MC +SS DELLNLVEMNHQLACDP A GC K N+IHH LSTPPHVFTTVLGWQNTCES +
Sbjct  1485  MCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCESFD  1544

Query  4975  DITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKT  5154
             DITATL ALS EIDIS+LYRGLDPK +H LVSVVCYYGQHYHCFAYSHD ERWIMYDDKT
Sbjct  1545  DITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDDKT  1604

Query  5155  VKVIGNWADVLTMCERGHLQPQ  5220
             VKV+G+W+DVL+MCERGHLQPQ
Sbjct  1605  VKVVGSWSDVLSMCERGHLQPQ  1626



>ref|XP_006439669.1| hypothetical protein CICLE_v10018472mg [Citrus clementina]
 gb|ESR52909.1| hypothetical protein CICLE_v10018472mg [Citrus clementina]
Length=1634

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1103 (61%), Positives = 834/1103 (76%), Gaps = 39/1103 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK S A    A       A      ++ S             +A V   
Sbjct  1     MGHKKKNTAPRSKQSPAAAVEAEPCATPDATSNQTNTEPS-------------EADVVVG  47

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCVKV
Sbjct  48    GGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQECE
Sbjct  108   ASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQECE  167

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  168   RALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLGTG  227

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  228   EEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSET  287

Query  1260  AQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDMKK  1427
              Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +MK+
Sbjct  288   GQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEMKR  347

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LL++++ D+K+H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+ H
Sbjct  348   ELLKVKVCDIKAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHMHH  407

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLE  1784
             V+ EHM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R     E
Sbjct  408   VVQEHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEVSE  467

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM-DRD  1961
             + Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +   + D
Sbjct  468   DFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRECD  521

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+ + + P  +SWP+ADD ER KLLERI+ +F+ L+++K L +SHLSKVI + ++ELQS
Sbjct  522   GNQVSAVYPLIDSWPVADDTERVKLLERIHALFELLLRHKCLSASHLSKVIQYTMDELQS  581

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++  
Sbjct  582   LASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANSVS  641

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDNGG  2498
               ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +NG 
Sbjct  642   PSLEIKETIVLNGDASCLLLDERLLSTELVSSDAFIDNVTS----------ANIRHENGV  691

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCEHL
Sbjct  692   AEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCEHL  751

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE +A
Sbjct  752   SYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFESDA  810

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQRQ
Sbjct  811   ILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQRQ  870

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DY+ IL+PLV+SYLRAHLEDLAE+D
Sbjct  871   KEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYQSILLPLVQSYLRAHLEDLAEKD  930

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   GN 
Sbjct  931   ATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGGNE  990

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEETL
Sbjct  991   RHIVHDKTADLVSFPVESDGDNPDSEPVVSANGDDLKLQEEEFRRKIELEAEERKLEETL  1050

Query  3576  eYQRRIENEAKLKHLAEQHKKGA  3644
              YQRRIENEAKLKHLAEQ KK A
Sbjct  1051  AYQRRIENEAKLKHLAEQSKKSA  1073


 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/499 (71%), Positives = 398/499 (80%), Gaps = 15/499 (3%)
 Frame = +1

Query  3763  GSPLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEE  3924
              +P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +  + 
Sbjct  1132  AAPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNRSQDW  1191

Query  3925  KCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQADLMKA  4095
             K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQADL +A
Sbjct  1192  KNQALSSEKENIAV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQADLKQA  1248

Query  4096  VRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLKNEVG  4269
             VRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLKNEVG
Sbjct  1249  VRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLKNEVG  1308

Query  4270  EYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSETRRD  4446
             EYNCFLNVIIQSLWHLRRFR+EF R S SEHIHVG+PCVVCALY+IFTALS+AS++TR++
Sbjct  1309  EYNCFLNVIIQSLWHLRRFREEFSRRSPSEHIHVGEPCVVCALYEIFTALSIASTDTRKE  1368

Query  4447  AVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSC  4626
             AVAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SFT  S  SDTESV+S+C
Sbjct  1369  AVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTPGSNVSDTESVESNC  1428

Query  4627  MGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQD  4806
             MGSWDC NSACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +
Sbjct  1429  MGSWDCTNSACIVHSLFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKVMCAE  1488

Query  4807  SSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITA  4986
             SS DELLNLVEMNHQLACDP A GC K N+IHH LSTPPHVFTTVLGWQNTCES +DITA
Sbjct  1489  SSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCESFDDITA  1548

Query  4987  TLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVI  5166
             TL ALS EIDIS+LYRGLDPK +H LVSVVCYYGQHYHCFAYSHD ERWIMYDDKTVKV+
Sbjct  1549  TLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDDKTVKVV  1608

Query  5167  GNWADVLTMCERGHLQPQV  5223
             G+W+DVL+MCERGHLQPQV
Sbjct  1609  GSWSDVLSMCERGHLQPQV  1627



>gb|KDO76021.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1634

 Score =  1171 bits (3030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1104 (61%), Positives = 835/1104 (76%), Gaps = 39/1104 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK S A    A       A      ++ S             +A V   
Sbjct  1     MGHKKKNTAPRSKQSPAAAVEAEPCATPDATSNQTNTEPS-------------EADVVVG  47

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCVKV
Sbjct  48    GGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQECE
Sbjct  108   ASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQECE  167

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  168   RALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLGTG  227

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  228   EEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSET  287

Query  1260  AQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDMKK  1427
              Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +MK+
Sbjct  288   GQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEMKR  347

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LL++++ D+K+H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+ H
Sbjct  348   ELLKVKVCDIKAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHMHH  407

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLE  1784
             V+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R     E
Sbjct  408   VVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEVSE  467

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM-DRD  1961
             + Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +   + D
Sbjct  468   DFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRECD  521

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+ + + P  +SWP+ADD ER KLLERI+ +F+ L+++K L +SHLSKVI + ++ELQS
Sbjct  522   GNQVSAVYPLIDSWPVADDTERVKLLERIHALFELLLRHKCLSASHLSKVIQYTMDELQS  581

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++  
Sbjct  582   LASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANSVS  641

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDNGG  2498
               ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +NG 
Sbjct  642   PSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHENGV  691

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCEHL
Sbjct  692   AEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCEHL  751

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE +A
Sbjct  752   SYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFESDA  810

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQRQ
Sbjct  811   ILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQRQ  870

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DY+ IL+PLV+SYLRAHLEDLAE+D
Sbjct  871   KEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYQSILLPLVQSYLRAHLEDLAEKD  930

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   GN 
Sbjct  931   ATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGGNE  990

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEETL
Sbjct  991   RHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEETL  1050

Query  3576  eYQRRIENEAKLKHLAEQHKKGAR  3647
              YQRRIENEAKLKHLAEQ KK A+
Sbjct  1051  AYQRRIENEAKLKHLAEQSKKSAQ  1074


 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/503 (71%), Positives = 401/503 (80%), Gaps = 17/503 (3%)
 Frame = +1

Query  3757  SNGS--PLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsak  3912
             +NG+  P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +
Sbjct  1128  ANGAAVPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNR  1187

Query  3913  YNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQAD  4083
               + K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQAD
Sbjct  1188  SQDWKNQALSSEKENIGV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQAD  1244

Query  4084  LMKAVRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLK  4257
             L +AVRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLK
Sbjct  1245  LKQAVRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLK  1304

Query  4258  NEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSE  4434
             NEVGEYNCFLNVIIQSLWHLRRFR+EF R S SEHIHVG+PCVVCALY+IFTALS+AS++
Sbjct  1305  NEVGEYNCFLNVIIQSLWHLRRFREEFSRRSPSEHIHVGEPCVVCALYEIFTALSIASTD  1364

Query  4435  TRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESV  4614
             TR++AVAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SFT  S  SDTESV
Sbjct  1365  TRKEAVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTPGSNVSDTESV  1424

Query  4615  DSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKV  4794
             +S+CMGSWDC NSACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKV
Sbjct  1425  ESNCMGSWDCTNSACIVHSLFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKV  1484

Query  4795  MCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVE  4974
             MC +SS DELLNLVEMNHQLACDP A GC K N+IHH LSTPPHVFTTVLGWQNTCES +
Sbjct  1485  MCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCESFD  1544

Query  4975  DITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKT  5154
             DITATL ALS EIDIS+LYRGLDPK +H LVSVVCYYGQHYHCFAYSHD ERWIMYDDKT
Sbjct  1545  DITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDDKT  1604

Query  5155  VKVIGNWADVLTMCERGHLQPQV  5223
             VKV+G+W+DVL+MCERGHLQPQV
Sbjct  1605  VKVVGSWSDVLSMCERGHLQPQV  1627



>gb|KDO76020.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1630

 Score =  1171 bits (3030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1104 (61%), Positives = 835/1104 (76%), Gaps = 39/1104 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APRSK S A    A       A      ++ S             +A V   
Sbjct  1     MGHKKKNTAPRSKQSPAAAVEAEPCATPDATSNQTNTEPS-------------EADVVVG  47

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCVKV
Sbjct  48    GGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQECE
Sbjct  108   ASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQECE  167

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  168   RALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLGTG  227

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  228   EEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSET  287

Query  1260  AQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDMKK  1427
              Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +MK+
Sbjct  288   GQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEMKR  347

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
             +LL++++ D+K+H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+ H
Sbjct  348   ELLKVKVCDIKAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHMHH  407

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLE  1784
             V+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R     E
Sbjct  408   VVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEVSE  467

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM-DRD  1961
             + Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +   + D
Sbjct  468   DFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRECD  521

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             GN+ + + P  +SWP+ADD ER KLLERI+ +F+ L+++K L +SHLSKVI + ++ELQS
Sbjct  522   GNQVSAVYPLIDSWPVADDTERVKLLERIHALFELLLRHKCLSASHLSKVIQYTMDELQS  581

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             L  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++  
Sbjct  582   LASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANSVS  641

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDNGG  2498
               ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +NG 
Sbjct  642   PSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHENGV  691

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCEHL
Sbjct  692   AEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCEHL  751

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE +A
Sbjct  752   SYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFESDA  810

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQRQ
Sbjct  811   ILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQRQ  870

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DY+ IL+PLV+SYLRAHLEDLAE+D
Sbjct  871   KEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYQSILLPLVQSYLRAHLEDLAEKD  930

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   GN 
Sbjct  931   ATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGGNE  990

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEETL
Sbjct  991   RHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEETL  1050

Query  3576  eYQRRIENEAKLKHLAEQHKKGAR  3647
              YQRRIENEAKLKHLAEQ KK A+
Sbjct  1051  AYQRRIENEAKLKHLAEQSKKSAQ  1074


 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/502 (71%), Positives = 400/502 (80%), Gaps = 17/502 (3%)
 Frame = +1

Query  3757  SNGS--PLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsak  3912
             +NG+  P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +
Sbjct  1128  ANGAAVPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNR  1187

Query  3913  YNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQAD  4083
               + K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQAD
Sbjct  1188  SQDWKNQALSSEKENIGV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQAD  1244

Query  4084  LMKAVRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLK  4257
             L +AVRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLK
Sbjct  1245  LKQAVRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLK  1304

Query  4258  NEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSE  4434
             NEVGEYNCFLNVIIQSLWHLRRFR+EF R S SEHIHVG+PCVVCALY+IFTALS+AS++
Sbjct  1305  NEVGEYNCFLNVIIQSLWHLRRFREEFSRRSPSEHIHVGEPCVVCALYEIFTALSIASTD  1364

Query  4435  TRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESV  4614
             TR++AVAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SFT  S  SDTESV
Sbjct  1365  TRKEAVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTPGSNVSDTESV  1424

Query  4615  DSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKV  4794
             +S+CMGSWDC NSACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKV
Sbjct  1425  ESNCMGSWDCTNSACIVHSLFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKV  1484

Query  4795  MCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVE  4974
             MC +SS DELLNLVEMNHQLACDP A GC K N+IHH LSTPPHVFTTVLGWQNTCES +
Sbjct  1485  MCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCESFD  1544

Query  4975  DITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKT  5154
             DITATL ALS EIDIS+LYRGLDPK +H LVSVVCYYGQHYHCFAYSHD ERWIMYDDKT
Sbjct  1545  DITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDDKT  1604

Query  5155  VKVIGNWADVLTMCERGHLQPQ  5220
             VKV+G+W+DVL+MCERGHLQPQ
Sbjct  1605  VKVVGSWSDVLSMCERGHLQPQ  1626



>gb|EYU35900.1| hypothetical protein MIMGU_mgv1a000162mg [Erythranthe guttata]
Length=1526

 Score =  1171 bits (3030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/995 (62%), Positives = 761/995 (76%), Gaps = 27/995 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR + PRSKPS  P    A A             T+     +++  + D     S 
Sbjct  1     MGHKKRNVVPRSKPSKPPSSPPADAPITNG------GGTNTDHSPDRAAAKSDH----SS  50

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              N S SY+ +K+ECERALT+LRRGN+ +ALR+MKDL +K ENSP+ ALI+RVQGTVCVKV
Sbjct  51    ANPSPSYSAVKVECERALTALRRGNYTRALRVMKDLTSKQENSPHSALIHRVQGTVCVKV  110

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             AS+IDD N K RHL+NAI+SAR +V +SPNS+EF HFYANL+YEAAN+ KEYEEVVQECE
Sbjct  111   ASLIDDTNAKQRHLRNAIESARTAVTLSPNSVEFGHFYANLMYEAANEAKEYEEVVQECE  170

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENP+DPAKESLQE NQQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN G+G
Sbjct  171   RALAIENPVDPAKESLQEENQQKISTAEARIVHVQNELRSLIQKSNIASISTWMKNLGNG  230

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             +EKFRLIPIRR+ +DPME  LVQAR+PNEIKK  KTPEERRKEIEVRV AAR +QQ SES
Sbjct  231   DEKFRLIPIRRVPDDPMEQGLVQARRPNEIKKVAKTPEERRKEIEVRVTAARFVQQNSES  290

Query  1260  AQSFNDGERSLDLS------AGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             AQ   +G+ + + S       G+G R  ERRKSGNARKN S+ ERRD VR++WNSM+ D 
Sbjct  291   AQLKKEGDNTKNNSKGPENGPGSGSRVGERRKSGNARKNTSTDERRDLVRTFWNSMNLDG  350

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+ LRI+I DLK+HF S KDGL +E+L EALSF E NK W+FW CC C E+FAD+   +
Sbjct  351   KKECLRIKISDLKAHFSSSKDGLPSEMLDEALSFGETNKVWRFWECCRCNEKFADAGLLM  410

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
             QHV+ EHM SL PK+QS+LPQNVENEW EMLLNCSWKPLD+NA+ ++L+KQ K      L
Sbjct  411   QHVVQEHMGSLVPKMQSILPQNVENEWAEMLLNCSWKPLDLNASIRMLQKQPKPDSPDLL  470

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             + +    + D+SK+   D Y N Y WD SP K   GD  NG   +S+E++     WMD D
Sbjct  471   DESCNSHNADDSKECFVDTYSNEYEWDASPGKNKSGDNGNGIVQNSKEFEDVE--WMDCD  528

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
             G+  +K    +++WP++DD ERAKLLERI+ +F+TLI+NKY+ SSHLSK+++FAVEEL +
Sbjct  529   GDLSSKESLLNKNWPLSDDAERAKLLERIHSIFETLIRNKYMASSHLSKIMNFAVEELHA  588

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
             +  GSQL N  +DQTPL ICFLGAP+LKKIL FLQE+S +C   RY ++S   DD +T +
Sbjct  589   IASGSQL-NSKVDQTPLSICFLGAPDLKKILIFLQEISQACAFNRYSDKSNRGDDTNTVM  647

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
               VD +EKIVFS D S L+ DEHF PCK   I   DGV   +N +SA  SS+   DNGG+
Sbjct  648   HSVDTLEKIVFSSDASFLVLDEHFIPCK---IPRGDGV---NNVSSALTSSHGSYDNGGI  701

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
             LDSD LLSWIF G SS EQL SW + R EKAQQ +E+++LLEKE Y LQGLC+RKCEH++
Sbjct  702   LDSDALLSWIFTGPSSSEQLASWQQERAEKAQQGLEVLQLLEKESYHLQGLCDRKCEHVS  761

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ V DLCLEEGKKREH  DFV +SYD  LKKRR+EL+E+ +E T    RFE++AI
Sbjct  762   YEEALQAVGDLCLEEGKKREHVADFVFQSYDSVLKKRREELIENENELTIMCNRFELDAI  821

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLKDA+SLN+NQFGFE+TY  ++SHLCDLESGEDD+WR KDY++Q DS +E AIQRQK
Sbjct  822   SNVLKDADSLNINQFGFEETYSSVTSHLCDLESGEDDEWRTKDYIHQVDSYIEAAIQRQK  881

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E VS+E+SKIDAR+MR+++ MQQLEVKL+  S+HD+R IL+PLVKS++RA LEDLAE+DA
Sbjct  882   ETVSIEISKIDARLMRIIAEMQQLEVKLDPASSHDFRSILIPLVKSFMRARLEDLAEKDA  941

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHE  3326
             TEKSDA REA LAEL RDSKK S  G ++++HSH+
Sbjct  942   TEKSDAVREALLAELDRDSKKVS-AGVDSSRHSHD  975


 Score =   561 bits (1445),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 272/406 (67%), Positives = 312/406 (77%), Gaps = 40/406 (10%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++  KTLR+L  EDDDEERFQADL KAV QSL                           
Sbjct  1151  GDNEAKTLRELQAEDDDEERFQADLKKAVDQSL---------------------------  1183

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHV  4368
                  V T      + YGTGLKNEVG+YNCFLNVIIQSLWHLRRFRDEFL RS S+H+HV
Sbjct  1184  -----VMTDGDIRKDTYGTGLKNEVGQYNCFLNVIIQSLWHLRRFRDEFLSRSLSKHVHV  1238

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCV+CALYDI  AL++AS++  ++AVAP SLRIALSNLYP+   FQ+GQMNDASEVL 
Sbjct  1239  GDPCVICALYDILIALNMASTDKTKEAVAPTSLRIALSNLYPNSNFFQQGQMNDASEVLA  1298

Query  4549  VIFECLHQSFTSASG-ASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
             VIF CLHQSFTS +  AS  ESVDS      +C +S+C+ HS+FGM + ERMNCY CG E
Sbjct  1299  VIFSCLHQSFTSTTSVASGMESVDS------NCTSSSCVAHSIFGMGILERMNCYNCGFE  1352

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SR +KYTSFFHNINASALRTMKVM  ++SFD+LL+LVEMNHQL CDP+A GCG+ N+IHH
Sbjct  1353  SRRMKYTSFFHNINASALRTMKVMHPENSFDKLLSLVEMNHQLTCDPEAGGCGERNYIHH  1412

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              LSTPPHVFT VLGWQN  ESVEDITATL A STEID+SVLYRGLDP++ H LVS+VCYY
Sbjct  1413  ILSTPPHVFTIVLGWQNKRESVEDITATLAAFSTEIDVSVLYRGLDPQNHHRLVSMVCYY  1472

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFA S +H+RW MYDD+TVKV+G W DV+TMCERGHLQPQV
Sbjct  1473  GQHYHCFACSGEHDRWTMYDDQTVKVVGGWNDVITMCERGHLQPQV  1518



>ref|XP_006476671.1| PREDICTED: uncharacterized protein LOC102612465 isoform X1 [Citrus 
sinensis]
Length=1634

 Score =  1169 bits (3025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1106 (60%), Positives = 838/1106 (76%), Gaps = 43/1106 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAV--LVQEKSLIRHDQAVVE  536
             MGHKK+  APRSK S A                 +E++  A       ++     +A V 
Sbjct  1     MGHKKKNTAPRSKQSPAAA---------------VEAEPCATPDATSNQTNTEPWEADVV  45

Query  537   SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
                  +S+Y  IKLECERALT+LRRGNH KALRLMK+L ++HENS  +ALI+RVQGTVCV
Sbjct  46    VGGGGASTYGAIKLECERALTALRRGNHKKALRLMKELSSRHENSAYVALIHRVQGTVCV  105

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVASIIDD N K RHLKNAI+SA+K+  +SP+S+EFAHFYANLLYEAANDGKEYEEVVQE
Sbjct  106   KVASIIDDLNSKQRHLKNAIESAKKAAELSPHSVEFAHFYANLLYEAANDGKEYEEVVQE  165

Query  897   CERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERALAIENPIDPAKESLQ E+QQK+ T +ARIAHVQ ELR+LIQ+SN+ASISTW+KN G
Sbjct  166   CERALAIENPIDPAKESLQDESQQKILTADARIAHVQSELRSLIQKSNIASISTWMKNLG  225

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
             +GEEKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKS
Sbjct  226   TGEEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  285

Query  1254  ESAQSF--NDGERSLDL-SAGTGQRGNERRKSG-NARKNVSSMERRDCVRSYWNSMSTDM  1421
             E+ Q +  N+GER++D  S G  +R  ERRK G N R+N S  ERRD VRSYWNSMS +M
Sbjct  286   ETGQLYQNNEGERNVDSGSGGLEKRERERRKHGSNLRRNRSKEERRDFVRSYWNSMSLEM  345

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             K++LL++++ D+++H  SLKDGLA++VL+EAL+FAE NK W+FW CC C E+FADSESH+
Sbjct  346   KRELLKVKVCDIEAHSASLKDGLASDVLAEALAFAEENKTWRFWVCCRCNEKFADSESHM  405

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGF  1778
              HV+ +HM +L PK+Q+VLPQ+V+NEW EM+ NCSWKPLDI AA K+L + + K R    
Sbjct  406   HHVVQQHMGNLLPKMQAVLPQSVDNEWNEMIDNCSWKPLDIVAAVKMLGRDKTKSRDTEV  465

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM-D  1955
              E+ Y+ + ++E  D   D        D SP K+  G   N ++V+  + +K   +   +
Sbjct  466   SEDFYSGNHIEECDDCFKD------ALDSSPEKENLGHSYNSSSVEGNDCEKVVSIQCRE  519

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DGN+ + + P  +SWP+ADD ERAKLLERI+ +F+ L+++K L +SHLSKVI + ++EL
Sbjct  520   CDGNQVSAVYPLIDSWPVADDTERAKLLERIHALFELLLRHKCLSASHLSKVIQYTMDEL  579

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             QSL  GS LLN+ + QTP+CICFLG  +L+KI+KFLQELSH+C LGRY ER  +IDD ++
Sbjct  580   QSLASGSLLLNHGVGQTPMCICFLGVHQLRKIVKFLQELSHACSLGRYSERINSIDDANS  639

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKL-TPITFHDGVVTDsnpnsaaissniQCDN  2492
                 ++  E IV + D SCLL DE     +L +   F D V +          +NI+ +N
Sbjct  640   VSPSLEIKETIVLNGDASCLLLDERLLSTELISGDAFIDNVTS----------ANIRHEN  689

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
             G   D+D LL+WIF G SSGE LT+W  S+EEK  Q MEI++ LEKEFY LQ LCERKCE
Sbjct  690   GVAEDADALLTWIFAGPSSGEHLTTWMHSKEEKTHQGMEILQTLEKEFYHLQSLCERKCE  749

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HL+YEEALQ +EDLCLEEGKKRE   +F  RSY+  L+KRR+EL+ES ++   ++ RFE 
Sbjct  750   HLSYEEALQALEDLCLEEGKKRETVAEFGHRSYESVLRKRREELLESENDMFISS-RFES  808

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             +AI +VLK+AE+LNVNQFG+EDTY G++S LCDLESGEDDDWR KD L+Q D+C+EVAIQ
Sbjct  809   DAILNVLKEAEALNVNQFGYEDTYSGMTSQLCDLESGEDDDWRNKDCLHQVDTCIEVAIQ  868

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE +SVELSKIDARIMR V+ MQQLE+KLE VSA+DYR IL+PLV+SYLRAHLEDLAE
Sbjct  869   RQKEQLSVELSKIDARIMRNVTSMQQLELKLEPVSAYDYRSILLPLVQSYLRAHLEDLAE  928

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DATEKSDAAREAFLAELA DSKK +  GS+ +KH+++KT++K+K K+YRKTKD K   G
Sbjct  929   KDATEKSDAAREAFLAELALDSKKVARGGSDISKHTNDKTKEKRKHKEYRKTKDSKPVGG  988

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerklee  3569
             N  H +H  TA+  SF V  DG + D+E + +   + +  +EEE RR+IELEAEERKLEE
Sbjct  989   NERHIVHDKTADLVSFPVESDGDNPDSETVVSANGDDLKLQEEEFRRKIELEAEERKLEE  1048

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TL YQRRIENEAKLKHLAEQ KK A+
Sbjct  1049  TLAYQRRIENEAKLKHLAEQSKKSAQ  1074


 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/503 (71%), Positives = 401/503 (80%), Gaps = 17/503 (3%)
 Frame = +1

Query  3757  SNGS--PLEGHPKNS--TVSDIH----KAGFSNGGFLEDGALTSDrragrrsrrqkgsak  3912
             +NG+  P+   P +S   ++  H    K G  NG   EDG L +DRR GRR RR + S +
Sbjct  1128  ANGAAVPIRSSPTSSFQNINTAHHLSIKQGLPNGETPEDGFLPTDRRTGRRGRRHRSSNR  1187

Query  3913  YNEEKCPPVTSGAENIEVGEVRPVDDSLEKKHA---GESGPKTLRQLHVEDDDEERFQAD  4083
               + K   ++S  ENI V   R  D  L    A   G+ G KTLRQLH E+DDEERFQAD
Sbjct  1188  SQDWKNQALSSEKENIGV---RSDDSHLTGAAAPYLGDGGTKTLRQLHAEEDDEERFQAD  1244

Query  4084  LMKAVRQSLDTFHAHQKLPLIPR-SGTAQISEMAN-LGVSCEDVATGIVNGIEVYGTGLK  4257
             L +AVRQSLDTF AHQK+PL+     T  +S  AN + V   +V +  VNGI+VYG GLK
Sbjct  1245  LKQAVRQSLDTFQAHQKMPLVSSLRMTQNVSLEANKVAVLSNEVRSENVNGIDVYGAGLK  1304

Query  4258  NEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSE  4434
             NEVGEYNCFLNVIIQSLWHLRRFR+EF R S SEHIHVG+PCVVCALY+IFTALS+AS++
Sbjct  1305  NEVGEYNCFLNVIIQSLWHLRRFREEFSRRSPSEHIHVGEPCVVCALYEIFTALSIASTD  1364

Query  4435  TRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESV  4614
             TR++AVAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SFT  S  SDTESV
Sbjct  1365  TRKEAVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLAVIFDCLHRSFTPGSNVSDTESV  1424

Query  4615  DSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKV  4794
             +S+CMGSWDC NSACIVHSLFGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKV
Sbjct  1425  ESNCMGSWDCTNSACIVHSLFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKV  1484

Query  4795  MCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVE  4974
             MC +SS DELLNLVEMNHQLACDP A GC K N+IHH LSTPPHVFTTVLGWQNTCES +
Sbjct  1485  MCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCESFD  1544

Query  4975  DITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKT  5154
             DITATL ALS EIDIS+LYRGLDPK +H LVSVVCYYGQHYHCFAYSHD ERWIMYDDKT
Sbjct  1545  DITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDDKT  1604

Query  5155  VKVIGNWADVLTMCERGHLQPQV  5223
             VKV+G+W+DVL+MCERGHLQPQV
Sbjct  1605  VKVVGSWSDVLSMCERGHLQPQV  1627



>emb|CBI15290.3| unnamed protein product [Vitis vinifera]
Length=1552

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 654/1044 (63%), Positives = 801/1044 (77%), Gaps = 74/1044 (7%)
 Frame = +3

Query  531   VESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
             VESE    S+Y+ IKLECER+LT+LRRGNHNKALR+MK+L  +H+NS + ALI+RVQGTV
Sbjct  5     VESE---GSAYSAIKLECERSLTALRRGNHNKALRIMKELSVRHDNSVHSALIHRVQGTV  61

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVASIIDDPN K RHLKNAI++A+K+V +SPNSIEFAHFYANLLYEAA++GKEYEEVV
Sbjct  62    CVKVASIIDDPNAKQRHLKNAIETAKKAVELSPNSIEFAHFYANLLYEAASEGKEYEEVV  121

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
              ECERAL+I++P+DPAKESLQ E+QQK+ST EARI HVQ ELR+LIQ+SN+ASISTW+KN
Sbjct  122   HECERALSIDSPVDPAKESLQDESQQKISTVEARIGHVQNELRSLIQKSNIASISTWMKN  181

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
              G+GEEKFRLIPIRR+SEDPME+RLVQ+++PNEIKKATKT EERRKEIEVRVAAARLLQQ
Sbjct  182   LGNGEEKFRLIPIRRVSEDPMEVRLVQSKRPNEIKKATKTQEERRKEIEVRVAAARLLQQ  241

Query  1248  KSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KS++ QS ++G+R+    + S+G GQR  ERRK  NARK  S++ER+  VRSYWNSMS +
Sbjct  242   KSDAPQSQSEGDRTDKASETSSGPGQRVGERRK--NARKFGSTVERKVRVRSYWNSMSFN  299

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             M+K LL+IRI DLK+HF S+KDGLA+ VLSEALSF E NK WKFW CC C E+F DSE H
Sbjct  300   MRKDLLKIRISDLKAHFSSVKDGLASGVLSEALSFVEVNKVWKFWVCCRCGEKFKDSELH  359

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QHV+ EHM +L PK+QSVLPQN++NEW+EM++NCSWKPLDI+AA K+L+          
Sbjct  360   MQHVVQEHMGNLLPKMQSVLPQNIDNEWIEMIVNCSWKPLDISAAVKMLK----------  409

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCN-GTTVDSREYDKNSEVWMD  1955
                       +ESK          Y W+ SP K   GDGC+ G  V S      ++   +
Sbjct  410   ----------NESK----------YAWESSPEKGMLGDGCSCGNLVKSDSDKIPNQGSRE  449

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
              DGNEG+K    + SWP+ADD ERAKLLE+I+V+F+ LIK+K L  SHLSKV+ F  +EL
Sbjct  450   CDGNEGSKAYLLANSWPLADDSERAKLLEKIHVLFEMLIKHKCLAGSHLSKVMQFTTDEL  509

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPER-STAIDDIS  2312
             Q +  GSQLLNY +DQTP CICFLGA +L+K+LKFLQELSH+CGL R  ++ S+A+DD +
Sbjct  510   QGIASGSQLLNYGVDQTPTCICFLGASQLRKLLKFLQELSHACGLARSSDKTSSAMDDAN  569

Query  2313  TGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDN  2492
             +  +  D  E ++ + D SCLL DEH  P + T                           
Sbjct  570   SLNRDFDIKENVLLNGDASCLLLDEHLLPTENTST-------------------------  604

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
                  +  LLSWIF G SS EQL SW R REEK+ Q MEI+++LEKEFY LQ LCERKCE
Sbjct  605   -----ASSLLSWIFTGPSSVEQLASWMRIREEKSNQGMEILQMLEKEFYHLQSLCERKCE  659

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HL+YEEALQ VEDLCLEEGKKRE+  DF  RS +  L+KRR+EL ES +E    + RFE+
Sbjct  660   HLSYEEALQAVEDLCLEEGKKRENVTDFGSRSLESVLRKRREELRESENEVMLISNRFEL  719

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             +A+ +VLK+AESLN+NQFG+E+ Y G++SHLCDLESGEDDDWR KD+L+Q D+C+EVAIQ
Sbjct  720   DAVINVLKEAESLNMNQFGYEEHYNGVTSHLCDLESGEDDDWRSKDFLHQMDACIEVAIQ  779

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE +SVELSKIDARIMR V+GMQQLE+ LE VSA DYR I++PL+KS++RAHLEDLAE
Sbjct  780   RQKEQLSVELSKIDARIMRNVTGMQQLELTLEPVSAFDYRSIILPLLKSFMRAHLEDLAE  839

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DAT+KSDAAREAFLAELA DSKKS+  GS+N++H+H+KT++KKK K+YRK KD KG+ G
Sbjct  840   KDATQKSDAAREAFLAELALDSKKSAIGGSDNSRHNHDKTKEKKKGKEYRKMKDSKGTGG  899

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAE--LSNGGSNSITQeeeeqrrrieleaeerkle  3566
             +  H LHH T E+ S  V  DG   D+E  +S    NS  Q EEE RR+IELEAEERKLE
Sbjct  900   SEQHVLHHVTTEQDSSPVASDGEHPDSEPVVSVNDDNSKHQ-EEELRRKIELEAEERKLE  958

Query  3567  etleYQRRIENEAKLKHLAEQHKK  3638
             ETLEYQRRIENEAK KHLAEQ KK
Sbjct  959   ETLEYQRRIENEAKQKHLAEQRKK  982


 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 411/493 (83%), Gaps = 17/493 (3%)
 Frame = +1

Query  3793  STVSDIH---KAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIE  3963
             ST S  H   + G  NGG   DG L S+RR GR+++RQK S K  + K   V+SG EN+E
Sbjct  1054  STPSQYHAKVEQGLPNGGSPVDGVLLSERRIGRKTKRQKNSTKLIDGKYQAVSSGKENVE  1113

Query  3964  VGEVRPVDDSLEKK----------HAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLD  4113
             VG +  ++D ++++          H G++G KTLRQL  E+DDEERFQADL +AVRQSLD
Sbjct  1114  VG-ISHIEDRVKEQIKIHGSGVNLHLGDNGTKTLRQLQAEEDDEERFQADLKQAVRQSLD  1172

Query  4114  TFHAHQKLPLIP--RSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFL  4287
              + AHQKLPL+   R       E+ ++G+S +DV    ++G ++ GTGLKNEVGEYNCFL
Sbjct  1173  AYQAHQKLPLVSSLRMPQRMSHEVDDVGLSPDDVVIKNMSGADMLGTGLKNEVGEYNCFL  1232

Query  4288  NVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNS  4464
             NVIIQSLWHLRRFR+EFL RS+SEH+HVGDPCVVCALY+IFTALS+AS++TRR+AVAP++
Sbjct  1233  NVIIQSLWHLRRFRNEFLGRSTSEHVHVGDPCVVCALYEIFTALSVASTDTRREAVAPSA  1292

Query  4465  LRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDC  4644
             LRIALSNLYPD   FQE QMNDASEVLGVIF+CLH+SFTS+S  SDTESV+S+CMGSWDC
Sbjct  1293  LRIALSNLYPDSNFFQEAQMNDASEVLGVIFDCLHRSFTSSSSISDTESVESNCMGSWDC  1352

Query  4645  ANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDEL  4824
             ANS C+ HSLFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMKVMC +SSFDEL
Sbjct  1353  ANSICLAHSLFGMDIFERMNCYNCSLESRHLKYTSFFHNINASALRTMKVMCAESSFDEL  1412

Query  4825  LNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALS  5004
             LNLVEMNHQLACDP+A GCGK N+IHH LSTPPHVFT VLGWQNTCES +DITATL AL+
Sbjct  1413  LNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCESADDITATLAALN  1472

Query  5005  TEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADV  5184
             TEID+SVLYRGLDPK+++CLVSVVCYYGQHYHCFAYSH+HERW+MYDDKTVKVIG+W +V
Sbjct  1473  TEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDDKTVKVIGSWDNV  1532

Query  5185  LTMCERGHLQPQV  5223
             LTMCERGHLQPQV
Sbjct  1533  LTMCERGHLQPQV  1545



>ref|XP_009369371.1| PREDICTED: uncharacterized protein LOC103958773 isoform X1 [Pyrus 
x bretschneideri]
Length=1631

 Score =  1162 bits (3006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1106 (60%), Positives = 822/1106 (74%), Gaps = 40/1106 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR   PR K S A    A V+       A  E+D    L+    +      ++ES+
Sbjct  1     MGHKKRNAGPRPKQSPAADGDAVVSSQSDTTLAAAETDVP--LLSNNKIESSPLPMIESD  58

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +A+      K+ECERALT+LRRGNH KALRLMK+ C ++ENS   ALI+RVQGTVCVKV
Sbjct  59    GSAA------KVECERALTALRRGNHTKALRLMKESCQRYENSAQSALIHRVQGTVCVKV  112

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K RHL+NAIDSAR++V +SP+SIEFAHFYANLLYEAANDGKEYEEVV ECE
Sbjct  113   ASIIDDPNSKQRHLRNAIDSARRAVELSPSSIEFAHFYANLLYEAANDGKEYEEVVAECE  172

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIE P+DPA+ESLQE +QQK+ T EARI HVQ ELR LIQ+SN+ASISTW+KN G+G
Sbjct  173   RALAIEKPVDPARESLQEESQQKILTAEARIGHVQNELRQLIQKSNIASISTWMKNLGNG  232

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR +EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE 
Sbjct  233   EEKFRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSEV  292

Query  1260  AQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              Q  N+GE   R LD  +G  QRG+ERRK GN RKN SS ER+D V SYW SMS DMKK+
Sbjct  293   PQLGNEGEKGDRGLDSLSGFSQRGSERRKFGNLRKNGSSAERKDWVLSYWKSMSVDMKKE  352

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL++R+ DLK+ F S KDGLANEVLSEAL+FAE+ ++WKFW CC C E+F D ESH+QHV
Sbjct  353   LLKVRVSDLKAKFSSSKDGLANEVLSEALAFAESKRSWKFWVCCRCNEKFVDGESHMQHV  412

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM +L PK+QS+LPQNV+NEW EMLLN SWKPLD ++A  +L+ Q KC+ H F+E+ 
Sbjct  413   VQEHMGNLMPKMQSILPQNVDNEWTEMLLNSSWKPLDASSAVGMLKDQRKCKEHEFVEDF  472

Query  1791  YT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y+     D DE         C    WD SP K+  GD  +   V+   ++K + V  + +
Sbjct  473   YSGNQNKDCDE---------CFKDAWDSSPEKEMLGDSPSNCIVEGNNHEKLARVECEEE  523

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
                 T     +  WP++DD ER KLLERI+ +F+ LI++KYL +SHL++VI F ++ELQ+
Sbjct  524   TGLLT-YSSVANGWPVSDDSERQKLLERIHALFEVLIRHKYLAASHLNRVIQFTMDELQA  582

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-IDDISTG  2318
                 SQLLN+ ++QTP+CI FLGA +L+KILKFLQ+LSH+CGLGRY ++S++  DD ++ 
Sbjct  583   --SCSQLLNHGVEQTPMCIFFLGATQLRKILKFLQDLSHACGLGRYSDKSSSPADDANST  640

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              +GV+  E+IV + D SCL+ DE    C L+     D  V     + AA ++ +   NG 
Sbjct  641   NKGVEIKERIVLNGDASCLILDE----CLLSSECTCD--VGHLTVSEAAPAAVVGNGNGV  694

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               DSD LLSW+F G +SGEQLTSW  +REEK QQ MEI+++LEKEFY+LQ LC+RKCEHL
Sbjct  695   PPDSDALLSWMFAGPTSGEQLTSWVHAREEKTQQGMEILQMLEKEFYDLQSLCDRKCEHL  754

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC+EEGKKRE+  +F  RS++  L+KRR+EL+E  ++    + RFE++A
Sbjct  755   SYEEALQAVEDLCIEEGKKRENVTEFGHRSFESVLRKRREELLERENDVMFLSNRFELDA  814

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+ E+LN+NQFG+E+TYG ++S LCDLE GE DDWR KDY +Q D+ VEVAIQRQ
Sbjct  815   ISNVLKEYEALNINQFGYEETYGRVTSQLCDLEYGEYDDWRAKDYAHQVDTYVEVAIQRQ  874

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE + VELSKID RIMR V+GMQQLEVKLE VSAHDYR IL+PLVKSYLRAHLEDLAE+D
Sbjct  875   KEQLYVELSKIDVRIMRNVTGMQQLEVKLEPVSAHDYRSILLPLVKSYLRAHLEDLAEKD  934

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK     ++N +H+ EKT+DKKK K++RK KD KG NG  
Sbjct  935   ATEKSDAAREAFLAELALDSKKGVRGENDNLRHTQEKTKDKKKNKEFRKAKDSKG-NGVS  993

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrieleaeerklee  3569
                 HHD A E SF    DG   D EL    NG  + + Q EEE +RRIELE EERKLEE
Sbjct  994   DEYFHHDEASELSFPEASDGELPDPELVISVNG--DDLKQREEESKRRIELEEEERKLEE  1051

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TLEYQR+IE EAK KHLAEQ+KK  +
Sbjct  1052  TLEYQRQIEKEAKQKHLAEQNKKSTQ  1077


 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/526 (67%), Positives = 400/526 (76%), Gaps = 38/526 (7%)
 Frame = +1

Query  3733  TTKKELLQSNGSP--LEGHPKN-----------STVSDIHKA----GFSNGGFLE-DGAL  3858
             + +++L Q  G P  LEG P N           ST S  H+A    G +NGG +E DG L
Sbjct  1108  SVQEQLTQKTGFPNNLEGLPVNMANGSVVPANSSTASGAHQAKVNQGLANGGIVEEDGYL  1167

Query  3859  TSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKH-----AGESG  4023
              SDRR GR++RRQ+ S K  + K   ++SG +N+EVG       S+E  H        +G
Sbjct  1168  PSDRRTGRKNRRQRSSTKVPDGKSQGLSSGNKNVEVGR-----SSVEGSHDNLLMNNNNG  1222

Query  4024  PKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLI-----PRSGTAQISEMANL  4188
              + LRQ   E+DDEERFQADL KAVRQSLDTF  HQK P++     PR    +IS   + 
Sbjct  1223  IQELRQKRAEEDDEERFQADLKKAVRQSLDTFEEHQKFPVVSSLRMPR----RISADVDN  1278

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIH  4365
              V   D+     +  +++GTGLKNEVGEYNCFLNVIIQSLWH+R FRDE+LR S SEH+H
Sbjct  1279  SVLHNDITNENASETDIFGTGLKNEVGEYNCFLNVIIQSLWHVRLFRDEYLRRSISEHVH  1338

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVCALY+IFTALS AS++TRR+AVAP SLRIALSNLYP+   FQE QMNDASEVL
Sbjct  1339  VGDPCVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQMNDASEVL  1398

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF CLH+SFT  S  S+ ESV+SSC GSWDC+N+ACIVHS+FGMD+FERMNCY CGLE
Sbjct  1399  VVIFNCLHRSFTPGSSLSNAESVESSCPGSWDCSNNACIVHSIFGMDIFERMNCYYCGLE  1458

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINAS+LRTMKVM  +SS+DELLN VEMNHQLACDP+A GCGK NHIHH
Sbjct  1459  SRHLKYTSFFHNINASSLRTMKVMSTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHH  1518

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              LSTPPHVFTTVLGWQ TCES +DI ATL AL+TEIDISVLYRGLDPK+ H LVSVVCYY
Sbjct  1519  ILSTPPHVFTTVLGWQKTCESADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYY  1578

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFAYSHD   WIMYDDKTVKVIG WADVLTMCERGHLQPQV
Sbjct  1579  GQHYHCFAYSHDRGCWIMYDDKTVKVIGGWADVLTMCERGHLQPQV  1624



>ref|XP_009369372.1| PREDICTED: uncharacterized protein LOC103958773 isoform X2 [Pyrus 
x bretschneideri]
Length=1629

 Score =  1162 bits (3005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1106 (60%), Positives = 822/1106 (74%), Gaps = 40/1106 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR   PR K S A    A V+       A  E+D    L+    +      ++ES+
Sbjct  1     MGHKKRNAGPRPKQSPAADGDAVVSSQSDTTLAAAETDVP--LLSNNKIESSPLPMIESD  58

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +A+      K+ECERALT+LRRGNH KALRLMK+ C ++ENS   ALI+RVQGTVCVKV
Sbjct  59    GSAA------KVECERALTALRRGNHTKALRLMKESCQRYENSAQSALIHRVQGTVCVKV  112

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K RHL+NAIDSAR++V +SP+SIEFAHFYANLLYEAANDGKEYEEVV ECE
Sbjct  113   ASIIDDPNSKQRHLRNAIDSARRAVELSPSSIEFAHFYANLLYEAANDGKEYEEVVAECE  172

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIE P+DPA+ESLQE +QQK+ T EARI HVQ ELR LIQ+SN+ASISTW+KN G+G
Sbjct  173   RALAIEKPVDPARESLQEESQQKILTAEARIGHVQNELRQLIQKSNIASISTWMKNLGNG  232

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EEKFRLIPIRR +EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE 
Sbjct  233   EEKFRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSEV  292

Query  1260  AQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              Q  N+GE   R LD  +G  QRG+ERRK GN RKN SS ER+D V SYW SMS DMKK+
Sbjct  293   PQLGNEGEKGDRGLDSLSGFSQRGSERRKFGNLRKNGSSAERKDWVLSYWKSMSVDMKKE  352

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL++R+ DLK+ F S KDGLANEVLSEAL+FAE+ ++WKFW CC C E+F D ESH+QHV
Sbjct  353   LLKVRVSDLKAKFSSSKDGLANEVLSEALAFAESKRSWKFWVCCRCNEKFVDGESHMQHV  412

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM +L PK+QS+LPQNV+NEW EMLLN SWKPLD ++A  +L+ Q KC+ H F+E+ 
Sbjct  413   VQEHMGNLMPKMQSILPQNVDNEWTEMLLNSSWKPLDASSAVGMLKDQRKCKEHEFVEDF  472

Query  1791  YT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y+     D DE         C    WD SP K+  GD  +   V+   ++K + V  + +
Sbjct  473   YSGNQNKDCDE---------CFKDAWDSSPEKEMLGDSPSNCIVEGNNHEKLARVECEEE  523

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
                 T     +  WP++DD ER KLLERI+ +F+ LI++KYL +SHL++VI F ++ELQ+
Sbjct  524   TGLLT-YSSVANGWPVSDDSERQKLLERIHALFEVLIRHKYLAASHLNRVIQFTMDELQA  582

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-IDDISTG  2318
                 SQLLN+ ++QTP+CI FLGA +L+KILKFLQ+LSH+CGLGRY ++S++  DD ++ 
Sbjct  583   --SCSQLLNHGVEQTPMCIFFLGATQLRKILKFLQDLSHACGLGRYSDKSSSPADDANST  640

Query  2319  IQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG  2498
              +GV+  E+IV + D SCL+ DE    C L+     D  V     + AA ++ +   NG 
Sbjct  641   NKGVEIKERIVLNGDASCLILDE----CLLSSECTCD--VGHLTVSEAAPAAVVGNGNGV  694

Query  2499  LLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
               DSD LLSW+F G +SGEQLTSW  +REEK QQ MEI+++LEKEFY+LQ LC+RKCEHL
Sbjct  695   PPDSDALLSWMFAGPTSGEQLTSWVHAREEKTQQGMEILQMLEKEFYDLQSLCDRKCEHL  754

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YEEALQ VEDLC+EEGKKRE+  +F  RS++  L+KRR+EL+E  ++    + RFE++A
Sbjct  755   SYEEALQAVEDLCIEEGKKRENVTEFGHRSFESVLRKRREELLERENDVMFLSNRFELDA  814

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+ E+LN+NQFG+E+TYG ++S LCDLE GE DDWR KDY +Q D+ VEVAIQRQ
Sbjct  815   ISNVLKEYEALNINQFGYEETYGRVTSQLCDLEYGEYDDWRAKDYAHQVDTYVEVAIQRQ  874

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE + VELSKID RIMR V+GMQQLEVKLE VSAHDYR IL+PLVKSYLRAHLEDLAE+D
Sbjct  875   KEQLYVELSKIDVRIMRNVTGMQQLEVKLEPVSAHDYRSILLPLVKSYLRAHLEDLAEKD  934

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK     ++N +H+ EKT+DKKK K++RK KD KG NG  
Sbjct  935   ATEKSDAAREAFLAELALDSKKGVRGENDNLRHTQEKTKDKKKNKEFRKAKDSKG-NGVS  993

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrieleaeerklee  3569
                 HHD A E SF    DG   D EL    NG  + + Q EEE +RRIELE EERKLEE
Sbjct  994   DEYFHHDEASELSFPEASDGELPDPELVISVNG--DDLKQREEESKRRIELEEEERKLEE  1051

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TLEYQR+IE EAK KHLAEQ+KK  +
Sbjct  1052  TLEYQRQIEKEAKQKHLAEQNKKSTQ  1077


 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/522 (67%), Positives = 397/522 (76%), Gaps = 38/522 (7%)
 Frame = +1

Query  3745  ELLQSNGSP--LEGHPKN-----------STVSDIHKA----GFSNGGFLE-DGALTSDr  3870
             +L Q  G P  LEG P N           ST S  H+A    G +NGG +E DG L SDR
Sbjct  1110  QLTQKTGFPNNLEGLPVNMANGSVVPANSSTASGAHQAKVNQGLANGGIVEEDGYLPSDR  1169

Query  3871  ragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKH-----AGESGPKTL  4035
             R GR++RRQ+ S K  + K   ++SG +N+EVG       S+E  H        +G + L
Sbjct  1170  RTGRKNRRQRSSTKVPDGKSQGLSSGNKNVEVGR-----SSVEGSHDNLLMNNNNGIQEL  1224

Query  4036  RQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLI-----PRSGTAQISEMANLGVSC  4200
             RQ   E+DDEERFQADL KAVRQSLDTF  HQK P++     PR    +IS   +  V  
Sbjct  1225  RQKRAEEDDEERFQADLKKAVRQSLDTFEEHQKFPVVSSLRMPR----RISADVDNSVLH  1280

Query  4201  EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVGDP  4377
              D+     +  +++GTGLKNEVGEYNCFLNVIIQSLWH+R FRDE+LR S SEH+HVGDP
Sbjct  1281  NDITNENASETDIFGTGLKNEVGEYNCFLNVIIQSLWHVRLFRDEYLRRSISEHVHVGDP  1340

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             CVVCALY+IFTALS AS++TRR+AVAP SLRIALSNLYP+   FQE QMNDASEVL VIF
Sbjct  1341  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQMNDASEVLVVIF  1400

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
              CLH+SFT  S  S+ ESV+SSC GSWDC+N+ACIVHS+FGMD+FERMNCY CGLESRHL
Sbjct  1401  NCLHRSFTPGSSLSNAESVESSCPGSWDCSNNACIVHSIFGMDIFERMNCYYCGLESRHL  1460

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINAS+LRTMKVM  +SS+DELLN VEMNHQLACDP+A GCGK NHIHH LST
Sbjct  1461  KYTSFFHNINASSLRTMKVMSTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILST  1520

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHY  5097
             PPHVFTTVLGWQ TCES +DI ATL AL+TEIDISVLYRGLDPK+ H LVSVVCYYGQHY
Sbjct  1521  PPHVFTTVLGWQKTCESADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHY  1580

Query  5098  HCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HCFAYSHD   WIMYDDKTVKVIG WADVLTMCERGHLQPQV
Sbjct  1581  HCFAYSHDRGCWIMYDDKTVKVIGGWADVLTMCERGHLQPQV  1622



>gb|KDP31191.1| hypothetical protein JCGZ_11567 [Jatropha curcas]
Length=1615

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/1101 (60%), Positives = 830/1101 (75%), Gaps = 42/1101 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR    RSK   +   V +            E++TS   V    L + + ++  S 
Sbjct  1     MGHKKRTPTSRSKQLPSATTVPSD-----------EAETSPNPVN-LPLAKIEPSI--SP  46

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALIYRVQGTVCVK  719
              +  S+Y+ IKLECERALT+LRRG+H KALRLMK+ CAKH +NSP+ ALI+RVQGTVCVK
Sbjct  47    ESDGSTYSGIKLECERALTALRRGHHTKALRLMKESCAKHGDNSPHSALIHRVQGTVCVK  106

Query  720   VASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQEC  899
             VASIIDDPN K RHLKNAIDSAR++  +SPNSIEFAHFYANLLYEAANDGKEYEEV++EC
Sbjct  107   VASIIDDPNRKQRHLKNAIDSARRAAELSPNSIEFAHFYANLLYEAANDGKEYEEVMREC  166

Query  900   ERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS  1076
             ERAL I NP+DPAKESLQ E+QQK++T EARIAHVQ ELR+L Q+S++ASISTW+KN G+
Sbjct  167   ERALEILNPVDPAKESLQDESQQKITTAEARIAHVQNELRSLKQKSSIASISTWMKNLGT  226

Query  1077  GEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  1256
             GEE  RLIPIRR +EDPME+RL+QAR+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE
Sbjct  227   GEE-IRLIPIRRAAEDPMEVRLMQARRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  285

Query  1257  SAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKK  1427
             S    N+GERS   ++  +G+ +RG  R+   N RK+ S+ ER+D V+SYWNSMS +MK+
Sbjct  286   SNSGQNEGERSDKGMEAPSGSDKRGERRKYGNNVRKSGSNKERKDWVQSYWNSMSIEMKR  345

Query  1428  KLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQH  1607
              LL++ + D KS+FGS KDGLA+EVL+E L+FAE NK W+FW CC C E+FADSESHI H
Sbjct  346   DLLKLNVSDFKSYFGSSKDGLASEVLNELLTFAEENKTWRFWMCCRCHEKFADSESHIHH  405

Query  1608  VINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLEN  1787
             V+ EHM +L PK+Q+VLPQ+V+NEW+EM+LNCSWKP DI++A K+L  + KC+    +E+
Sbjct  406   VVQEHMGNLMPKMQAVLPQSVDNEWIEMILNCSWKPFDISSAVKMLGSRGKCQDADLVED  465

Query  1788  TYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDG  1964
              Y+ +  +E  D   D       WD SP K+   D  +  T  S   D+ S +   + DG
Sbjct  466   FYSGNHNEECDDCFKD------AWDSSPEKENLRDSYDDCTTGSNNADRVSSIECKECDG  519

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
             N+G+ +  P +SWP+++D ER KLL++I+ VF+ LIK+K L +SHL+KVI   ++ELQ+L
Sbjct  520   NQGS-MAYPIDSWPLSEDLERGKLLKKIHAVFEALIKHKCLAASHLNKVIQLTMDELQTL  578

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQ  2324
               GSQLLN+ +DQTPLCICFLGA +L KILKFLQELSHSCGLGRY E+S+ IDD++   Q
Sbjct  579   ASGSQLLNHGVDQTPLCICFLGASQLGKILKFLQELSHSCGLGRYSEKSS-IDDVNAA-Q  636

Query  2325  GVDAMEKIVFSEDGSCLLFDEHFKPCKLTPIT-FHDGVVTDsnpnsaaissniQCDNGGL  2501
             G D  EKIV + D S L  +E     + +P T  HDG  T ++ N           NG L
Sbjct  637   GPDMKEKIVLNGDASYLYLNEFLLQSECSPGTCTHDGKATATSTNIGYG-------NGVL  689

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D D LLSWIF G SSGEQL SW R++EEK  Q MEI++ LEKEFY LQ LCERK EHL+
Sbjct  690   PDVDALLSWIFAGPSSGEQLQSWVRTKEEKVHQGMEILQTLEKEFYHLQNLCERKGEHLS  749

Query  2682  YEEALQVVEDLCLEEGKKREH-TIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             YEE LQ +EDLCLEE KKR+  T D  R  Y+ AL+KRR++L+ + ++A  ++ R E++ 
Sbjct  750   YEETLQALEDLCLEETKKRDSDTRD--RSCYESALRKRREDLVNNENDALFSSSRIELDV  807

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             IS+VLK+AE LN NQFG+EDTYGG++S LCDLESGED+DWR KDY +Q D+C++VAIQRQ
Sbjct  808   ISNVLKEAEDLNGNQFGYEDTYGGMNSQLCDLESGEDNDWRTKDYAHQMDTCIQVAIQRQ  867

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             K  +S+EL KIDARIMR VSGMQQLE+KLE +SAHDYR IL+PLVKSY+RAHLEDLAE+D
Sbjct  868   KHQISLELMKIDARIMRNVSGMQQLELKLEPISAHDYRSILLPLVKSYMRAHLEDLAEKD  927

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFLAELA DSKK +  G++N +++ EK+++KKK ++YRK KD K + GN 
Sbjct  928   ATEKSDAAREAFLAELALDSKKGTRGGTDNLRNTQEKSKEKKKNREYRKPKDSKATFGNE  987

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
              H LH +TAE++SF V  DG   D++ L +   + + Q +EE RR+IELEAEERKLEETL
Sbjct  988   QHLLHDETAEQSSFPVASDGDLPDSDTLLSFNDDDLKQLDEEVRRKIELEAEERKLEETL  1047

Query  3576  eYQRRIENEAKLKHLAEQHKK  3638
             EYQRRIENEAKLKHLAEQ  K
Sbjct  1048  EYQRRIENEAKLKHLAEQQYK  1068


 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/471 (74%), Positives = 388/471 (82%), Gaps = 11/471 (2%)
 Frame = +1

Query  3820  GFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLE  3999
             G SNG   EDG L SDRR GRRSRRQK S +  + K P  +S   N+E G +        
Sbjct  1146  GLSNGVISEDGLLPSDRRIGRRSRRQKSSTRSFDGKYPAFSSEKNNVEGGNI--------  1197

Query  4000  KKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIP--RSGTAQIS  4173
                 G+SG KTLRQL  E+DDEERFQADL KAVRQSLDTF A QK+PLI   R       
Sbjct  1198  TLSMGDSGTKTLRQLQAEEDDEERFQADLKKAVRQSLDTFEARQKMPLISSMRIPLNTPL  1257

Query  4174  EMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSS  4350
             E  N+ VS  +VA+  V G ++ GTGL+N++GEYNCFLNVIIQSLWHLRRFR+EFL RS+
Sbjct  1258  EANNVDVSPNEVASENVEGTDMVGTGLQNDIGEYNCFLNVIIQSLWHLRRFREEFLQRST  1317

Query  4351  SEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMND  4530
             SEH+HVG+PCVVCALYDIFTALS+AS++ RR+ VAP SLRIALSNLYPD   FQE QMND
Sbjct  1318  SEHVHVGEPCVVCALYDIFTALSIASTDMRREPVAPTSLRIALSNLYPDSNFFQEAQMND  1377

Query  4531  ASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCY  4710
             ASEVL VIF+CLH++FTS S  SD+ESV+S+C+GSWDCAN+ACIVHSLFGMD+FERMNCY
Sbjct  1378  ASEVLAVIFDCLHRAFTSGSSVSDSESVESNCLGSWDCANNACIVHSLFGMDIFERMNCY  1437

Query  4711  ECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKH  4890
              CGLESRHLKYTSFFHNINASALRTMK MC +SSFDELLNLVEMNHQLACDP++ GCGK 
Sbjct  1438  SCGLESRHLKYTSFFHNINASALRTMKAMCAESSFDELLNLVEMNHQLACDPESGGCGKL  1497

Query  4891  NHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVS  5070
             N+IHH LSTPPHVFTTVLGWQNTCES +DI ATL ALSTEIDISVLYRGLDPKS H LVS
Sbjct  1498  NYIHHILSTPPHVFTTVLGWQNTCESADDIAATLAALSTEIDISVLYRGLDPKSTHTLVS  1557

Query  5071  VVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             VVCYYGQHYHCFAYS DHE WIMYDD+TVKV+GNWADVL+MCERGHLQPQV
Sbjct  1558  VVCYYGQHYHCFAYSQDHEWWIMYDDRTVKVVGNWADVLSMCERGHLQPQV  1608



>ref|XP_008356674.1| PREDICTED: uncharacterized protein LOC103420388 [Malus domestica]
Length=1271

 Score =  1158 bits (2995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/1111 (60%), Positives = 816/1111 (73%), Gaps = 44/1111 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvap-----vevaavavdeaappapLESDTSAVLVQEKSLIRHDQA  527
             MG+KKR  APR K S A                 +      ++T A+L+    +      
Sbjct  1     MGNKKRNAAPRPKQSPAAVQPLPAADGDAVXXSQSDTTLAAAETDALLLSNNKIESSPLP  60

Query  528   VVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             ++ES+ +A+      K+ECERALT+LRRGNH KALRLMK+ C ++ENS + ALI+RVQGT
Sbjct  61    MIESDGSAA------KVECERALTALRRGNHTKALRLMKESCQRYENSGHSALIHRVQGT  114

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             VCVKVASIIDDPN K RHL+NAIDSAR++V +SP+SIEFAHFYANLLYEAANDGKEYEEV
Sbjct  115   VCVKVASIIDDPNSKQRHLRNAIDSARRAVELSPSSIEFAHFYANLLYEAANDGKEYEEV  174

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             V ECERALAIE P+DPA+ESLQE +QQK+ T +ARI HVQ ELR LIQ+SN+ASISTW+K
Sbjct  175   VAECERALAIEKPVDPARESLQEESQQKILTADARIGHVQNELRQLIQKSNIASISTWMK  234

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
             N G+GEEKFRLIPIRR +EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  235   NLGNGEEKFRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  294

Query  1245  QKSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             QKSE  Q  N+GE+S   LD S+G  QRG+ERRK GN RKN SS ER+D VRSYW SMS 
Sbjct  295   QKSEVPQLGNEGEKSDRGLDSSSGFXQRGSERRKFGNLRKNGSSAERKDLVRSYWKSMSV  354

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             DMKK+LL++R+ DLK+ F S KDGLANEVLSEAL+FAE  ++WKFW CC C E+F D ES
Sbjct  355   DMKKELLKVRVSDLKAKFSSSKDGLANEVLSEALAFAEGKRSWKFWVCCRCNEKFVDGES  414

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             H+ HV+ EHM +L PK+QSVLPQNV+NEW EMLLN SW+PLD ++A  +L  Q KC+ H 
Sbjct  415   HMHHVVQEHMGNLMPKMQSVLPQNVDNEWTEMLLNSSWRPLDASSAVGMLRDQRKCKEHE  474

Query  1776  FLENTYT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV  1946
             F+E+ Y+     D DE         C    WD SP K+  GD  +   V+   ++K + V
Sbjct  475   FVEDFYSGNQNKDCDE---------CFKDAWDSSPEKEMLGDSPSDCIVEGNNHEKLARV  525

Query  1947  WMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
               + + N        +  WP++DD ER KLLERI+ +F+ LI++KYL +SHL++VI F +
Sbjct  526   VCEEE-NGLIAYSSVANGWPVSDDSEREKLLERIHALFEVLIRHKYLAASHLNRVIQFTM  584

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPER-STAID  2303
             +ELQ+    SQLLN+ ++QTP+CI FLGA +L+KILKFLQ+LSH+CGLGRY ++ S   D
Sbjct  585   DELQA--SCSQLLNHGVEQTPMCIXFLGATQLRKILKFLQDLSHACGLGRYSDKXSXPAD  642

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D +   +GV+  E+IV + D SCL+ DE     + T    H   V+D+ P +   +    
Sbjct  643   DANXTNKGVEIKERIVLNGDASCLILDEXLLSSECTCDVGH-LTVSDAAPAAVVGNG---  698

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               NG   DSD LLSWIF G +SGEQLTSW  ++EEK QQ MEI+++LEKEFY+LQ LCER
Sbjct  699   --NGVPPDSDALLSWIFAGPTSGEQLTSWVHAKEEKTQQGMEILQMLEKEFYDLQSLCER  756

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             KCEHL+YEEALQ VEDLC+EEGKKRE+  +F  RS++  L+KRR+EL+E  ++    + R
Sbjct  757   KCEHLSYEEALQAVEDLCIEEGKKRENVTEFGHRSFESVLRKRREELLERENDVMFLSNR  816

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
              E++AIS+VLK+ E+LN+NQFG+E+TYG ++S L DLE G DDDWR KDY +Q D CVEV
Sbjct  817   IELDAISNVLKEYEALNINQFGYEETYGRVTSQLFDLEYG-DDDWRAKDYAHQVDXCVEV  875

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AI+RQKE + VELSKID RIMR V+GMQQLEVKLE VSAHDYR IL+PLVKSYLRAHLED
Sbjct  876   AIRRQKEQLYVELSKIDVRIMRNVTGMQQLEVKLEPVSAHDYRSILLPLVKSYLRAHLED  935

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE DATEKSDAAREAFLAELA DSKK     ++N +H+ EKT+DKKK K++RK KD KG
Sbjct  936   LAEXDATEKSDAAREAFLAELALDSKKGVRGENDNLRHTQEKTKDKKKNKEFRKAKDSKG  995

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrieleaee  3554
              NG      HHD   E +F    DG   D EL    NG  N + Q+EEE +RRIELE EE
Sbjct  996   -NGVSDEYFHHDETSELTFPEASDGELPDPELVISVNG--NDLKQQEEECKRRIELEEEE  1052

Query  3555  rkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             RKLEETLEYQR+IE EAK KHLAEQ+KK  +
Sbjct  1053  RKLEETLEYQRQIEKEAKQKHLAEQNKKSTQ  1083


 Score = 68.9 bits (167),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 83/147 (56%), Gaps = 28/147 (19%)
 Frame = +1

Query  3745  ELLQSNGSP--LEGHPKN-----------STVSDIHKA----GFSNGGFLE-DGALTSDr  3870
             +L Q  G P  LEG P N           ST S  H+A    G +NGG +E DG L SDR
Sbjct  1116  QLTQKTGFPNNLEGLPVNMANGSAVPANSSTASGAHQAKVNQGXANGGIVEEDGCLPSDR  1175

Query  3871  ragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKH-----AGESGPKTL  4035
             R GR++RRQ+ S K  + K   +++G EN+EVG       S+E  H        +G + L
Sbjct  1176  RTGRKNRRQRSSTKVPDGKSQGLSTGNENVEVGR-----SSVEGSHDNLLMNNHNGIQEL  1230

Query  4036  RQLHVEDDDEERFQADLMKAVRQSLDT  4116
             RQ   E+DDEERFQADL KAVRQSL++
Sbjct  1231  RQKRAEEDDEERFQADLKKAVRQSLES  1257



>ref|XP_010272203.1| PREDICTED: uncharacterized protein LOC104608045 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010272204.1| PREDICTED: uncharacterized protein LOC104608045 isoform X1 [Nelumbo 
nucifera]
Length=1745

 Score =  1146 bits (2964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1110 (60%), Positives = 838/1110 (75%), Gaps = 28/1110 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDT---SAVLVQEKSLIRHDQAVV  533
             MGHKKR  +PRSKPS     V   A D         S     S    QE S I   +A V
Sbjct  1     MGHKKRNFSPRSKPSAPATVVPTDAADGLGSAEEERSTNLGPSDDSRQEPSKI---EATV  57

Query  534   ESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVC  713
             +S+   +SSY+ +KLECERALT+LRRGNH KALRLMK+ C +HENS   AL++RVQGTVC
Sbjct  58    QSD---ASSYSAVKLECERALTALRRGNHTKALRLMKESCLRHENS---ALLHRVQGTVC  111

Query  714   VKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQ  893
             VKVAS+I+DPN K RHLKNAI+SAR++V++SPNSIEF+HFYANLLYEA+ND K YEEVVQ
Sbjct  112   VKVASLIEDPNAKQRHLKNAIESARRAVLLSPNSIEFSHFYANLLYEASNDSKGYEEVVQ  171

Query  894   ECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNF  1070
             ECERAL+I NP+DPAKESLQ E+QQK+STPEARIAHVQ ELR+LIQ+SN+ASISTW+KN 
Sbjct  172   ECERALSILNPVDPAKESLQDESQQKLSTPEARIAHVQQELRSLIQKSNIASISTWMKNL  231

Query  1071  --GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
               G+GEEKFRLIP+RR+ EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  232   GNGTGEEKFRLIPMRRLPEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  291

Query  1245  QKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             QKS S+QS ND E+  + S+G+  R  ERRK  N RK  SS +R D VRSYWNSMS D K
Sbjct  292   QKSGSSQSQNDEEKPSESSSGSSHRVGERRKYANLRKISSSADRMDQVRSYWNSMSLDKK  351

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             + LL I + DLK+HF S KDGLA+EVLSEAL FAE++K WKFW+CC C E+F D +SH+Q
Sbjct  352   QSLLEISVRDLKAHFSSSKDGLASEVLSEALFFAESHKTWKFWSCCRCNEKFTDCDSHMQ  411

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EHM +LSPKLQSVLPQ V+ +W+EML+N SWKP++  AA  +LE QLKC+    L+
Sbjct  412   HVVREHMGNLSPKLQSVLPQEVDTDWLEMLVNGSWKPINAPAALNMLEDQLKCQSPRALD  471

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTF--------GDGCNGTTVDSREYDKNS  1940
              + TR+    +K+ + D +C    WD SP ++          G+  NG  ++SR +D  S
Sbjct  472   GSDTRNHKHGNKECLDDGWCFKDTWDSSPGEEKLQPDEESKAGEISNGIHLESRIHDDLS  531

Query  1941  EVWM-DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                + + DGN  +K    ++SWP++DD ERAKLLERI+ +FQ L+++KYL +SHL+KVI 
Sbjct  532   NFELREYDGNRWSKEYYLAQSWPLSDDSERAKLLERIHGMFQLLLRHKYLAASHLNKVIQ  591

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             + ++ELQSL  GSQ+LN+ +DQTPLCICFLGA +L+KI KFLQELSHSCGLGRY E++ +
Sbjct  592   YTMDELQSLAPGSQILNHGLDQTPLCICFLGASQLRKIFKFLQELSHSCGLGRYSEKNIS  651

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
              DD   G  G +  E+IV + D S LL DE     +LTP+ +H     D +  +  +  +
Sbjct  652   GDDTHGGTPGSEIKERIVLTGDSSSLLLDERLLQGELTPVRYHSAHADDGSAATPVLIRD  711

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                 +G L DSD LLSWIF G SSGEQLTSW+R REEK  Q ME++++LEKEFY LQ LC
Sbjct  712   H--GDGVLPDSDALLSWIFTGPSSGEQLTSWTRLREEKTNQGMEVLQMLEKEFYLLQSLC  769

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERKCEHL+YEEALQ VE LCLEE KKREH   F  +SY+  L+KR++EL+E  ++ T  N
Sbjct  770   ERKCEHLSYEEALQAVESLCLEEFKKREHITKFASQSYEAVLRKRQEELVERDNDVTLIN  829

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              RFE++AI++VLK+A++LNVNQFG+E+   G+++ LCDL+ GEDDDWR++DY++Q D+C+
Sbjct  830   SRFELDAITNVLKEAQNLNVNQFGYEEPLTGVTTRLCDLDCGEDDDWRMQDYVHQTDTCI  889

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             EVAIQ+QKE +SVELSKIDARIMR V+GMQQLE+KL  +SAHDYR I++PLVKS++RAHL
Sbjct  890   EVAIQKQKEQLSVELSKIDARIMRNVTGMQQLELKLGPLSAHDYRAIVLPLVKSFMRAHL  949

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             E+L ++DATEKSDAAREAFLAELA DSKK+ + G ++ K   EK +DKKK KDYRK KDL
Sbjct  950   EELVDKDATEKSDAAREAFLAELALDSKKNVSRGGDHLKQLQEKPKDKKKSKDYRKPKDL  1009

Query  3378  kGSNGNGLHALHHDTAEEASFS-VVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaee  3554
             K + G G   LH +T E+AS+S V  D      E  +   +++ Q+EEE RRRIELEAEE
Sbjct  1010  KAT-GVGGQLLHQETEEQASYSPVASDENHLGFEAVSVSCDALKQQEEEFRRRIELEAEE  1068

Query  3555  rkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             RKLEETLEYQRRIENEAK KHLAEQ +K +
Sbjct  1069  RKLEETLEYQRRIENEAKQKHLAEQQRKAS  1098


 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/429 (75%), Positives = 367/429 (86%), Gaps = 11/429 (3%)
 Frame = +1

Query  3946  GAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHA  4125
             G EN++ G +    DS    + G++  KTLRQLH E+DDEERFQADL KAV QSLDTF A
Sbjct  1318  GLENLQSGNI----DS----YPGDNATKTLRQLHAEEDDEERFQADLQKAVLQSLDTFQA  1369

Query  4126  HQKLPLIPRSGTAQIS--EMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVII  4299
             H+ LP +PR    Q +  ++ + G S  DV    +NG +V+G GLKNEVGEYNCFLNVII
Sbjct  1370  HKNLPHVPRPRVPQKTSLQVEDFGSSPNDVMVNNINGTDVFGMGLKNEVGEYNCFLNVII  1429

Query  4300  QSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIA  4476
             QSLWHLRRFRDEFLR S S H+HVGDPCVVCALYDIFTALS+AS++TRR+AVAP  LRIA
Sbjct  1430  QSLWHLRRFRDEFLRRSESTHVHVGDPCVVCALYDIFTALSMASTDTRREAVAPTCLRIA  1489

Query  4477  LSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSA  4656
             LSNLYPD   FQEGQMNDASEVL VIF+CLH+SFTS SGASD +S +S+C+GSWDCA++A
Sbjct  1490  LSNLYPDSNFFQEGQMNDASEVLAVIFDCLHRSFTSGSGASDVDSEESNCLGSWDCASNA  1549

Query  4657  CIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLV  4836
             CIVH+LFGMD+FERMNCY CG+ESRHLKYTSFFHNINASALRTMK+MC DSSFDELL LV
Sbjct  1550  CIVHTLFGMDIFERMNCYSCGVESRHLKYTSFFHNINASALRTMKIMCADSSFDELLKLV  1609

Query  4837  EMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEID  5016
             EMNHQLACDP+A GCGK N+IHH LS+PPHVFTTVLGWQNT ESV+DI+ATL ALSTE+D
Sbjct  1610  EMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTSESVDDISATLAALSTELD  1669

Query  5017  ISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMC  5196
             I VLYRGLDP ++HCL+SVVCYYGQHYHCFAYSH+HERWIMYDDKTVKVIG+W DVL MC
Sbjct  1670  IGVLYRGLDPGNRHCLISVVCYYGQHYHCFAYSHEHERWIMYDDKTVKVIGSWHDVLVMC  1729

Query  5197  ERGHLQPQV  5223
             ERGHLQPQV
Sbjct  1730  ERGHLQPQV  1738



>ref|XP_010272205.1| PREDICTED: uncharacterized protein LOC104608045 isoform X2 [Nelumbo 
nucifera]
Length=1744

 Score =  1144 bits (2960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1109 (60%), Positives = 835/1109 (75%), Gaps = 27/1109 (2%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDT---SAVLVQEKSLIRHDQAVV  533
             MGHKKR  +PRSKPS     V   A D         S     S    QE S I   +A V
Sbjct  1     MGHKKRNFSPRSKPSAPATVVPTDAADGLGSAEEERSTNLGPSDDSRQEPSKI---EATV  57

Query  534   ESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVC  713
             +S+   +SSY+ +KLECERALT+LRRGNH KALRLMK+ C +HENS   AL++RVQGTVC
Sbjct  58    QSD---ASSYSAVKLECERALTALRRGNHTKALRLMKESCLRHENS---ALLHRVQGTVC  111

Query  714   VKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQ  893
             VKVAS+I+DPN K RHLKNAI+SAR++V++SPNSIEF+HFYANLLYEA+ND K YEEVVQ
Sbjct  112   VKVASLIEDPNAKQRHLKNAIESARRAVLLSPNSIEFSHFYANLLYEASNDSKGYEEVVQ  171

Query  894   ECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNF  1070
             ECERAL+I NP+DPAKESLQ E+QQK+STPEARIAHVQ ELR+LIQ+SN+ASISTW+KN 
Sbjct  172   ECERALSILNPVDPAKESLQDESQQKLSTPEARIAHVQQELRSLIQKSNIASISTWMKNL  231

Query  1071  --GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
               G+GEEKFRLIP+RR+ EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  232   GNGTGEEKFRLIPMRRLPEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  291

Query  1245  QKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             QKS S+QS ND E+  + S+G+  R  ERRK  N RK  SS +R D VRSYWNSMS D K
Sbjct  292   QKSGSSQSQNDEEKPSESSSGSSHRVGERRKYANLRKISSSADRMDQVRSYWNSMSLDKK  351

Query  1425  KKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
             + LL I + DLK+HF S KDGLA+EVLSEAL FAE++K WKFW+CC C E+F D +SH+Q
Sbjct  352   QSLLEISVRDLKAHFSSSKDGLASEVLSEALFFAESHKTWKFWSCCRCNEKFTDCDSHMQ  411

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EHM +LSPKLQSVLPQ V+ +W+EML+N SWKP++  AA  +LE QLKC+    L+
Sbjct  412   HVVREHMGNLSPKLQSVLPQEVDTDWLEMLVNGSWKPINAPAALNMLEDQLKCQSPRALD  471

Query  1785  NTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTF--------GDGCNGTTVDSREYDKNS  1940
              + TR+    +K+ + D +C    WD SP ++          G+  NG  ++SR +D  S
Sbjct  472   GSDTRNHKHGNKECLDDGWCFKDTWDSSPGEEKLQPDEESKAGEISNGIHLESRIHDDLS  531

Query  1941  EVWM-DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                + + DGN  +K    ++SWP++DD ERAKLLERI+ +FQ L+++KYL +SHL+KVI 
Sbjct  532   NFELREYDGNRWSKEYYLAQSWPLSDDSERAKLLERIHGMFQLLLRHKYLAASHLNKVIQ  591

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             + ++ELQSL  GSQ+LN+ +DQTPLCICFLGA +L+KI KFLQELSHSCGLGRY E++ +
Sbjct  592   YTMDELQSLAPGSQILNHGLDQTPLCICFLGASQLRKIFKFLQELSHSCGLGRYSEKNIS  651

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
              DD   G  G +  E+IV + D S LL DE     +LTP+ +H     D +  +  +  +
Sbjct  652   GDDTHGGTPGSEIKERIVLTGDSSSLLLDERLLQGELTPVRYHSAHADDGSAATPVLIRD  711

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                 +G L DSD LLSWIF G SSGEQLTSW+R REEK  Q ME++++LEKEFY LQ LC
Sbjct  712   H--GDGVLPDSDALLSWIFTGPSSGEQLTSWTRLREEKTNQGMEVLQMLEKEFYLLQSLC  769

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERKCEHL+YEEALQ VE LCLEE KKREH   F  +SY+  L+KR++EL+E  ++ T  N
Sbjct  770   ERKCEHLSYEEALQAVESLCLEEFKKREHITKFASQSYEAVLRKRQEELVERDNDVTLIN  829

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              RFE++AI++VLK+A++LNVNQFG+E+   G+++ LCDL+ GEDDDWR++DY++Q D+C+
Sbjct  830   SRFELDAITNVLKEAQNLNVNQFGYEEPLTGVTTRLCDLDCGEDDDWRMQDYVHQTDTCI  889

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             EVAIQ+QKE +SVELSKIDARIMR V+GMQQLE+KL  +SAHDYR I++PLVKS++RAHL
Sbjct  890   EVAIQKQKEQLSVELSKIDARIMRNVTGMQQLELKLGPLSAHDYRAIVLPLVKSFMRAHL  949

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             E+L ++DATEKSDAAREAFLAELA DSKK+ + G ++ K   EK +DKKK KDYRK KDL
Sbjct  950   EELVDKDATEKSDAAREAFLAELALDSKKNVSRGGDHLKQLQEKPKDKKKSKDYRKPKDL  1009

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeer  3557
             K + G G   LH +T E+A   V  D      E  +   +++ Q+EEE RRRIELEAEER
Sbjct  1010  KAT-GVGGQLLHQETEEQAYSPVASDENHLGFEAVSVSCDALKQQEEEFRRRIELEAEER  1068

Query  3558  kleetleYQRRIENEAKLKHLAEQHKKGA  3644
             KLEETLEYQRRIENEAK KHLAEQ +K +
Sbjct  1069  KLEETLEYQRRIENEAKQKHLAEQQRKAS  1097


 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/429 (75%), Positives = 367/429 (86%), Gaps = 11/429 (3%)
 Frame = +1

Query  3946  GAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHA  4125
             G EN++ G +    DS    + G++  KTLRQLH E+DDEERFQADL KAV QSLDTF A
Sbjct  1317  GLENLQSGNI----DS----YPGDNATKTLRQLHAEEDDEERFQADLQKAVLQSLDTFQA  1368

Query  4126  HQKLPLIPRSGTAQIS--EMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVII  4299
             H+ LP +PR    Q +  ++ + G S  DV    +NG +V+G GLKNEVGEYNCFLNVII
Sbjct  1369  HKNLPHVPRPRVPQKTSLQVEDFGSSPNDVMVNNINGTDVFGMGLKNEVGEYNCFLNVII  1428

Query  4300  QSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIA  4476
             QSLWHLRRFRDEFLR S S H+HVGDPCVVCALYDIFTALS+AS++TRR+AVAP  LRIA
Sbjct  1429  QSLWHLRRFRDEFLRRSESTHVHVGDPCVVCALYDIFTALSMASTDTRREAVAPTCLRIA  1488

Query  4477  LSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSA  4656
             LSNLYPD   FQEGQMNDASEVL VIF+CLH+SFTS SGASD +S +S+C+GSWDCA++A
Sbjct  1489  LSNLYPDSNFFQEGQMNDASEVLAVIFDCLHRSFTSGSGASDVDSEESNCLGSWDCASNA  1548

Query  4657  CIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLV  4836
             CIVH+LFGMD+FERMNCY CG+ESRHLKYTSFFHNINASALRTMK+MC DSSFDELL LV
Sbjct  1549  CIVHTLFGMDIFERMNCYSCGVESRHLKYTSFFHNINASALRTMKIMCADSSFDELLKLV  1608

Query  4837  EMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEID  5016
             EMNHQLACDP+A GCGK N+IHH LS+PPHVFTTVLGWQNT ESV+DI+ATL ALSTE+D
Sbjct  1609  EMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTSESVDDISATLAALSTELD  1668

Query  5017  ISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMC  5196
             I VLYRGLDP ++HCL+SVVCYYGQHYHCFAYSH+HERWIMYDDKTVKVIG+W DVL MC
Sbjct  1669  IGVLYRGLDPGNRHCLISVVCYYGQHYHCFAYSHEHERWIMYDDKTVKVIGSWHDVLVMC  1728

Query  5197  ERGHLQPQV  5223
             ERGHLQPQV
Sbjct  1729  ERGHLQPQV  1737



>ref|XP_004301306.1| PREDICTED: uncharacterized protein LOC101311291 [Fragaria vesca 
subsp. vesca]
Length=1635

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1116 (60%), Positives = 811/1116 (73%), Gaps = 68/1116 (6%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvev-----aavavdeaappapLESDTSAVLVQEKSLIRHDQ-  524
             MGHKKR  APRSK S A V        AV + +        +D  A       ++ H++ 
Sbjct  1     MGHKKRNAAPRSKQSPAAVAPIVDGGDAVVLAQPGAAPLTLADAEANSPNSSLVVLHNKI  60

Query  525   ---AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYR  695
                  +ES    S S A  KLECERALT+LRRGNHNKALRLMK+ C KHENS + ALI+R
Sbjct  61    ESSPSIESGVFDSESSAAAKLECERALTALRRGNHNKALRLMKESCQKHENSAHSALIHR  120

Query  696   VQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKE  875
             VQGTVCVKVASIIDDPN K RHL+NA +SAR++V +SPNSIEFAHFYANLLYEAANDGKE
Sbjct  121   VQGTVCVKVASIIDDPNAKQRHLRNAAESARRAVELSPNSIEFAHFYANLLYEAANDGKE  180

Query  876   YEEVVQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASIS  1052
             Y+EVV ECERALAIE P+DPAKESLQE +QQK+ T EARI HVQ ELR LIQ+SN+ASIS
Sbjct  181   YDEVVAECERALAIEKPVDPAKESLQEESQQKLPTAEARIGHVQNELRQLIQKSNIASIS  240

Query  1053  TWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAA  1232
             TW+KN G+GEEKFRLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAA
Sbjct  241   TWMKNLGTGEEKFRLIPIRRVTEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAA  300

Query  1233  RLLQQKSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWN  1403
             RLLQQKSE  Q  N+ E+S   +D  +G+GQRG+ERRK G  RKN SS ER+D VRSYW 
Sbjct  301   RLLQQKSEVPQLNNESEKSDRGVDSLSGSGQRGSERRKHGGLRKNGSSSERKDWVRSYWK  360

Query  1404  SMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             SMS DMKK+LLRIR+ DLK+ F S KDGLANEVLSEA++FAE++++W +W CC C E+F 
Sbjct  361   SMSVDMKKELLRIRVSDLKAKFSSSKDGLANEVLSEAVAFAESSRSWNYWVCCRCNEKFV  420

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D ESH+ HV+NEHM +L PK+QSVLP NV+NEW+EMLL CSWKPLD++AA ++L  Q KC
Sbjct  421   DPESHMHHVVNEHMGNLMPKMQSVLPPNVDNEWIEMLLTCSWKPLDVSAAIRMLRDQRKC  480

Query  1764  RVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSE  1943
             R    +E+ Y+ +   E +D   D       WD SP K+  GDG +  TVD   +++   
Sbjct  481   RDPELVEDFYSGNHNKECEDCFKD------AWDESPEKEIIGDGPSNCTVDGNIHEQVDH  534

Query  1944  V---WMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVI  2114
             V     D D         P   WP++DDPER KLLERI+  F+ LI++KYL ++HL++VI
Sbjct  535   VECTECDEDNGPIAYSSLPG-GWPLSDDPERMKLLERIHASFEVLIRHKYLAATHLNRVI  593

Query  2115  HFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST  2294
              F +++LQ+    S+LLN+ ++QTP+CICFLGA  L KILKFLQ+LSH+CGLGRY E+S+
Sbjct  594   QFTMDKLQT----SELLNHGVEQTPMCICFLGATHLTKILKFLQDLSHACGLGRYSEKSS  649

Query  2295  -AIDDISTGIQGVDAM-EKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaai  2468
              A+DD +   QGV+ + E+I+ S D SCLL D     C  +     +G  TD        
Sbjct  650   CAMDDGNNTNQGVELIKERIILSGDASCLLLD--ISDCTSSA---GNGTPTD--------  696

Query  2469  ssniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQ  2648
                     G L DSD LLSWIF G SS EQLTSW +++EEK QQ MEI+++LEKEFY LQ
Sbjct  697   ------GTGLLSDSDALLSWIFAGPSSAEQLTSWMQTKEEKTQQGMEILQMLEKEFYHLQ  750

Query  2649  GLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEAT  2828
              LCERKCEHL YEEALQ VEDLC+EEGKKRE+  +F  RSY+  L+KR++EL E  ++  
Sbjct  751   SLCERKCEHLKYEEALQAVEDLCVEEGKKRENATEFSNRSYEYVLRKRKEEL-ERENDMM  809

Query  2829  STNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQAD  3008
                 R +++AI++VL+D       QFG+E+TYGG++S L DLESGEDDDWR KDYL+Q  
Sbjct  810   FNASRIDLDAITNVLRDY------QFGYEETYGGVTSQLYDLESGEDDDWRAKDYLHQ--  861

Query  3009  SCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLR  3188
                   IQ QKE + VELSKIDARIMR V+GMQQLEVKLE VSAHDYR I++PLVKSYLR
Sbjct  862   -----VIQTQKEQLYVELSKIDARIMRNVTGMQQLEVKLEPVSAHDYRSIVLPLVKSYLR  916

Query  3189  AHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrkt  3368
             AHLEDLAE+DATEKSDAAREAFLAELA DSKK    G++NA+H+ EK +DKKK K+YRK 
Sbjct  917   AHLEDLAEKDATEKSDAAREAFLAELALDSKKGVKGGNDNARHTQEKVKDKKKNKEYRKA  976

Query  3369  kdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL---SNGGSNSITQeeeeqrrrie  3539
             KD KG NG     +HHD + E S  V   G   D+EL    NG  + + Q++EE RRRIE
Sbjct  977   KDTKG-NGLSDEHMHHDESAEHSCPVASYGDPLDSELVVSVNG--DDLKQQDEESRRRIE  1033

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             LE EERKLEETLEYQR+IE EAK K LAEQ+KK  +
Sbjct  1034  LEEEERKLEETLEYQRQIEKEAKQKQLAEQNKKSTQ  1069


 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/532 (66%), Positives = 401/532 (75%), Gaps = 30/532 (6%)
 Frame = +1

Query  3703  QDHVVNKQQGTTKKE---LLQSNGSPLEGHPKNSTVS---------DIHKAGFSNGGFLE  3846
             QDH+V K       E   +  +NGSP     K STVS         D    G  NGG LE
Sbjct  1102  QDHLVQKTGSPNNLEGVPINMANGSP--ASLKASTVSGPQMINGAQDKVHPGIPNGGILE  1159

Query  3847  DGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGE----------VRPVDDSL  3996
             DG   SDRR GR++RRQ+ S K  + K   + S  ENIE G           V+  D  L
Sbjct  1160  DGYPPSDRRTGRKNRRQRSSTKVPDGKSQALLSERENIEAGRSNVESHLSTHVQSNDYLL  1219

Query  3997  EKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIP--RSGTAQI  4170
              + +    G + LRQ H E+DDEERFQADL KAVRQSLDTF   +K PL+   R+     
Sbjct  1220  AESN---KGTRELRQQHAEEDDEERFQADLKKAVRQSLDTFQEQRKCPLVSSLRTPKRIS  1276

Query  4171  SEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RS  4347
             ++    GV   ++     + I+V GTGLKNEVGEYNCFLNVIIQSLWH++ FRDEFL RS
Sbjct  1277  ADFDKGGVLHNEIRVETASDIDVLGTGLKNEVGEYNCFLNVIIQSLWHIKLFRDEFLQRS  1336

Query  4348  SSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMN  4527
             +S H+HVGDPCV+CALY+IFTALS AS++TRR+AVAP SLRIALSNLYP+   FQE QMN
Sbjct  1337  TSVHVHVGDPCVICALYEIFTALSNASTDTRREAVAPTSLRIALSNLYPESNFFQEAQMN  1396

Query  4528  DASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNC  4707
             DASEVLGVIF+CLH+SFT     SDTESV+S+C+GSWDC+N+ACIVHS+FGM++FERMNC
Sbjct  1397  DASEVLGVIFDCLHRSFTPCLSVSDTESVESNCLGSWDCSNNACIVHSMFGMNIFERMNC  1456

Query  4708  YECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGK  4887
             Y CGLESRHLKYTSFFHNINASALRTMKVMC +SSFDELLNLVEMNHQLACDP+A GCGK
Sbjct  1457  YNCGLESRHLKYTSFFHNINASALRTMKVMCAESSFDELLNLVEMNHQLACDPEAGGCGK  1516

Query  4888  HNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLV  5067
              N+IHH LSTPPHVFTTV+GWQNTCES EDI ATL AL+TEIDISVLYRGLDPKS H LV
Sbjct  1517  LNYIHHILSTPPHVFTTVMGWQNTCESAEDIKATLAALNTEIDISVLYRGLDPKSTHNLV  1576

Query  5068  SVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             SVVCYYGQHYHCFAYSH+ E W+MYDD TVKVIG WADVLTMCERGHLQPQV
Sbjct  1577  SVVCYYGQHYHCFAYSHERECWVMYDDNTVKVIGGWADVLTMCERGHLQPQV  1628



>ref|XP_009343438.1| PREDICTED: uncharacterized protein LOC103935400 isoform X1 [Pyrus 
x bretschneideri]
Length=1580

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1053 (61%), Positives = 801/1053 (76%), Gaps = 40/1053 (4%)
 Frame = +3

Query  528   VVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             ++ES+  A+      K+ECERALT+LRRGNH KALRLMK+ C ++ENS + ALI+RVQGT
Sbjct  1     MIESDGGAA------KVECERALTALRRGNHTKALRLMKESCQRYENSAHSALIHRVQGT  54

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             VCVKVASIIDDPN K RHL+NA+DSAR++V +SPNSIEFAHFYANLLYEAANDGKEYEEV
Sbjct  55    VCVKVASIIDDPNSKQRHLRNAMDSARRAVELSPNSIEFAHFYANLLYEAANDGKEYEEV  114

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             V ECERALAIE P+DPA+ESLQE +QQK+ST +ARIAHVQ ELR LIQ+SN+ASISTW+K
Sbjct  115   VAECERALAIEKPVDPARESLQEESQQKISTTDARIAHVQNELRQLIQKSNIASISTWMK  174

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
             N G+GEEKFRLIPIRR +EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  175   NLGNGEEKFRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  234

Query  1245  QKSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             QKS+  Q   +GE+S   LD S+G+ QRG+ERRK GN RKN SS ER+D VRS+W S++ 
Sbjct  235   QKSDVPQLGKEGEKSDRGLDSSSGSSQRGSERRKFGNLRKNGSSAERKDLVRSFWKSLTV  294

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             DMKK+LL++R+ DLK+ F S KDGLANEVLSEAL+FAE+N++WKFW CC C E+F D ES
Sbjct  295   DMKKELLKVRVSDLKAKFSSSKDGLANEVLSEALTFAESNRSWKFWVCCRCNEKFMDCES  354

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             H+ HV+ EH+ +L PK+QSVLPQ VENEW EMLL+ SWKPLD ++A  +L  Q KC    
Sbjct  355   HMHHVVQEHVGNLIPKMQSVLPQKVENEWTEMLLSSSWKPLDASSAVGMLTDQRKCMEPE  414

Query  1776  FLENTYT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV  1946
              +E+ Y+     D DE   D          WD SP K+  GD  +G TV+   + K + V
Sbjct  415   VVEDFYSGNHNKDCDECFKD---------AWDSSPEKEMLGDSPSGCTVEGNNHKKLAHV  465

Query  1947  WMDR--DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHF  2120
                   + N        +  WP++DD ER KLLERI+ +F+ LI++KYL +SHL++VI F
Sbjct  466   ECGECEEDNGSIAYSSVANGWPVSDDSEREKLLERIHALFEVLIRHKYLAASHLNRVIQF  525

Query  2121  AVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-  2297
              ++ELQ+    SQLLN+ ++QTP+CICFLGA +L+KILKFLQ+LSH+CGLGRY ++S++ 
Sbjct  526   TMDELQA--SCSQLLNHGVEQTPMCICFLGATQLRKILKFLQDLSHACGLGRYSDKSSSP  583

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
              DD +   +GV+  E+IV + D SCL+ DE     + T    H  V TD+ P +   +  
Sbjct  584   ADDANNANKGVEIKERIVLNGDASCLILDECLLSSECTCDVGHHPV-TDAAPVAVVGN--  640

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                +NG   DSD LLSWIF G +SGEQLTSW  ++EEK +Q MEI+++LEKEFY LQ LC
Sbjct  641   ---ENGVPPDSDALLSWIFAGPTSGEQLTSWVHTKEEKTKQGMEILQMLEKEFYHLQSLC  697

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             E+KCEHLNYEEALQ VEDLC+EEGKKRE   +F  RS++  LKKRR+EL+   ++    +
Sbjct  698   EKKCEHLNYEEALQAVEDLCIEEGKKRESVTEFAHRSFESILKKRREELLRRENDVMFPS  757

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R E++AIS+VLK++E+LN+NQFG+E+TYGG++S LCDLE GEDDD R KDY++Q D+CV
Sbjct  758   NRTELDAISNVLKESEALNINQFGYEETYGGVTSQLCDLELGEDDDPRAKDYVHQVDTCV  817

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             EVAIQR+KE + VELSKIDARIM+ V+GMQQ+EVKLE +SAHDYR IL+PLVKSYLRAH 
Sbjct  818   EVAIQRRKEQLYVELSKIDARIMQNVTGMQQMEVKLEHISAHDYRLILLPLVKSYLRAHF  877

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             EDLAE+DATEKSDAAREAFLAELA DSKK    G++N +HS EKT+DKKK K++RK KD 
Sbjct  878   EDLAEKDATEKSDAAREAFLAELALDSKKGVR-GNDNLRHSQEKTKDKKKNKEFRKAKDS  936

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS---NGGSNSITQeeeeqrrrielea  3548
             KGS G      HHD   E SF    D    D+EL    NG  N + Q EEE +RRIELE 
Sbjct  937   KGS-GVSDEFYHHDETSELSFPGASDSAFPDSELVISLNG--NDLKQLEEECKRRIELEE  993

Query  3549  eerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             EERKLEETL++QR+IE EAK KHLAEQ+KK  +
Sbjct  994   EERKLEETLKFQRQIEKEAKQKHLAEQNKKSTQ  1026


 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/497 (69%), Positives = 388/497 (78%), Gaps = 11/497 (2%)
 Frame = +1

Query  3757  SNGSPLEGHPKNS-TVSDIHKA----GFSNGGFLEDGA-LTSDrragrrsrrqkgsakYN  3918
             +NGS +   P NS TVS  H+A    G  NGG LED   L SDRR GR++RRQ+ S K  
Sbjct  1080  ANGSAV---PVNSPTVSSAHQAKVNQGLPNGGILEDDCYLPSDRRTGRKNRRQRSSTKVL  1136

Query  3919  EEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAV  4098
             + K   ++SG EN+EVG       +        +G K LRQ   E+ DEERFQADL KAV
Sbjct  1137  DGKSQGLSSGKENVEVGRSSVEGSNDNLLTNNNNGTKELRQQRAEEVDEERFQADLKKAV  1196

Query  4099  RQSLDTFHAHQKLPLIPRSGTAQ-ISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             RQSLDTF   QK P++     A+ IS   + GV   D+     N  +++GTGLKNEVGEY
Sbjct  1197  RQSLDTFQERQKFPVVSNLRMARRISPDVDNGVLHNDIVNENANETDIFGTGLKNEVGEY  1256

Query  4276  NCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWH+R FRDE LR S+S+H+HVG PCVVCALY+IFTALS AS++TRR+AV
Sbjct  1257  NCFLNVIIQSLWHIRLFRDELLRRSTSKHVHVGSPCVVCALYEIFTALSNASADTRREAV  1316

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQE QMNDASEVL VIF+CLH+SFT  S  SD ESV+S C G
Sbjct  1317  APTSLRIALSNLYPESNFFQEAQMNDASEVLVVIFDCLHRSFTPGSSVSDAESVESGCPG  1376

Query  4633  SWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSS  4812
             SWDC+N+ACIVHS+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +SS
Sbjct  1377  SWDCSNNACIVHSIFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTMKVMCAESS  1436

Query  4813  FDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATL  4992
             +DELLN VEMNHQLACD +ARGCGK NHIHH LSTPPHVFTTVLGWQ TCES +DI ATL
Sbjct  1437  YDELLNHVEMNHQLACDSEARGCGKLNHIHHILSTPPHVFTTVLGWQKTCESADDIKATL  1496

Query  4993  VALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGN  5172
              AL+TEIDISVLYRGLDPK+ H LVSVVCYYGQHYHCFAYSH+   WIMYDDKTVKVIG 
Sbjct  1497  AALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHNRGCWIMYDDKTVKVIGG  1556

Query  5173  WADVLTMCERGHLQPQV  5223
             WADVLTMCERGHLQPQV
Sbjct  1557  WADVLTMCERGHLQPQV  1573



>ref|XP_009343439.1| PREDICTED: uncharacterized protein LOC103935400 isoform X2 [Pyrus 
x bretschneideri]
Length=1578

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1053 (61%), Positives = 801/1053 (76%), Gaps = 40/1053 (4%)
 Frame = +3

Query  528   VVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGT  707
             ++ES+  A+      K+ECERALT+LRRGNH KALRLMK+ C ++ENS + ALI+RVQGT
Sbjct  1     MIESDGGAA------KVECERALTALRRGNHTKALRLMKESCQRYENSAHSALIHRVQGT  54

Query  708   VCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEV  887
             VCVKVASIIDDPN K RHL+NA+DSAR++V +SPNSIEFAHFYANLLYEAANDGKEYEEV
Sbjct  55    VCVKVASIIDDPNSKQRHLRNAMDSARRAVELSPNSIEFAHFYANLLYEAANDGKEYEEV  114

Query  888   VQECERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             V ECERALAIE P+DPA+ESLQE +QQK+ST +ARIAHVQ ELR LIQ+SN+ASISTW+K
Sbjct  115   VAECERALAIEKPVDPARESLQEESQQKISTTDARIAHVQNELRQLIQKSNIASISTWMK  174

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQ  1244
             N G+GEEKFRLIPIRR +EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQ
Sbjct  175   NLGNGEEKFRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQ  234

Query  1245  QKSESAQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             QKS+  Q   +GE+S   LD S+G+ QRG+ERRK GN RKN SS ER+D VRS+W S++ 
Sbjct  235   QKSDVPQLGKEGEKSDRGLDSSSGSSQRGSERRKFGNLRKNGSSAERKDLVRSFWKSLTV  294

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             DMKK+LL++R+ DLK+ F S KDGLANEVLSEAL+FAE+N++WKFW CC C E+F D ES
Sbjct  295   DMKKELLKVRVSDLKAKFSSSKDGLANEVLSEALTFAESNRSWKFWVCCRCNEKFMDCES  354

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             H+ HV+ EH+ +L PK+QSVLPQ VENEW EMLL+ SWKPLD ++A  +L  Q KC    
Sbjct  355   HMHHVVQEHVGNLIPKMQSVLPQKVENEWTEMLLSSSWKPLDASSAVGMLTDQRKCMEPE  414

Query  1776  FLENTYT---RSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV  1946
              +E+ Y+     D DE   D          WD SP K+  GD  +G TV+   + K + V
Sbjct  415   VVEDFYSGNHNKDCDECFKD---------AWDSSPEKEMLGDSPSGCTVEGNNHKKLAHV  465

Query  1947  WMDR--DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHF  2120
                   + N        +  WP++DD ER KLLERI+ +F+ LI++KYL +SHL++VI F
Sbjct  466   ECGECEEDNGSIAYSSVANGWPVSDDSEREKLLERIHALFEVLIRHKYLAASHLNRVIQF  525

Query  2121  AVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-  2297
              ++ELQ+    SQLLN+ ++QTP+CICFLGA +L+KILKFLQ+LSH+CGLGRY ++S++ 
Sbjct  526   TMDELQA--SCSQLLNHGVEQTPMCICFLGATQLRKILKFLQDLSHACGLGRYSDKSSSP  583

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
              DD +   +GV+  E+IV + D SCL+ DE     + T    H  V TD+ P +   +  
Sbjct  584   ADDANNANKGVEIKERIVLNGDASCLILDECLLSSECTCDVGHHPV-TDAAPVAVVGN--  640

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                +NG   DSD LLSWIF G +SGEQLTSW  ++EEK +Q MEI+++LEKEFY LQ LC
Sbjct  641   ---ENGVPPDSDALLSWIFAGPTSGEQLTSWVHTKEEKTKQGMEILQMLEKEFYHLQSLC  697

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             E+KCEHLNYEEALQ VEDLC+EEGKKRE   +F  RS++  LKKRR+EL+   ++    +
Sbjct  698   EKKCEHLNYEEALQAVEDLCIEEGKKRESVTEFAHRSFESILKKRREELLRRENDVMFPS  757

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R E++AIS+VLK++E+LN+NQFG+E+TYGG++S LCDLE GEDDD R KDY++Q D+CV
Sbjct  758   NRTELDAISNVLKESEALNINQFGYEETYGGVTSQLCDLELGEDDDPRAKDYVHQVDTCV  817

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             EVAIQR+KE + VELSKIDARIM+ V+GMQQ+EVKLE +SAHDYR IL+PLVKSYLRAH 
Sbjct  818   EVAIQRRKEQLYVELSKIDARIMQNVTGMQQMEVKLEHISAHDYRLILLPLVKSYLRAHF  877

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             EDLAE+DATEKSDAAREAFLAELA DSKK    G++N +HS EKT+DKKK K++RK KD 
Sbjct  878   EDLAEKDATEKSDAAREAFLAELALDSKKGVR-GNDNLRHSQEKTKDKKKNKEFRKAKDS  936

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS---NGGSNSITQeeeeqrrrielea  3548
             KGS G      HHD   E SF    D    D+EL    NG  N + Q EEE +RRIELE 
Sbjct  937   KGS-GVSDEFYHHDETSELSFPGASDSAFPDSELVISLNG--NDLKQLEEECKRRIELEE  993

Query  3549  eerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             EERKLEETL++QR+IE EAK KHLAEQ+KK  +
Sbjct  994   EERKLEETLKFQRQIEKEAKQKHLAEQNKKSTQ  1026


 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/497 (69%), Positives = 388/497 (78%), Gaps = 11/497 (2%)
 Frame = +1

Query  3757  SNGSPLEGHPKNS-TVSDIHKA----GFSNGGFLEDGA-LTSDrragrrsrrqkgsakYN  3918
             +NGS +   P NS TVS  H+A    G  NGG LED   L SDRR GR++RRQ+ S K  
Sbjct  1078  ANGSAV---PVNSPTVSSAHQAKVNQGLPNGGILEDDCYLPSDRRTGRKNRRQRSSTKVL  1134

Query  3919  EEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAV  4098
             + K   ++SG EN+EVG       +        +G K LRQ   E+ DEERFQADL KAV
Sbjct  1135  DGKSQGLSSGKENVEVGRSSVEGSNDNLLTNNNNGTKELRQQRAEEVDEERFQADLKKAV  1194

Query  4099  RQSLDTFHAHQKLPLIPRSGTAQ-ISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             RQSLDTF   QK P++     A+ IS   + GV   D+     N  +++GTGLKNEVGEY
Sbjct  1195  RQSLDTFQERQKFPVVSNLRMARRISPDVDNGVLHNDIVNENANETDIFGTGLKNEVGEY  1254

Query  4276  NCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWH+R FRDE LR S+S+H+HVG PCVVCALY+IFTALS AS++TRR+AV
Sbjct  1255  NCFLNVIIQSLWHIRLFRDELLRRSTSKHVHVGSPCVVCALYEIFTALSNASADTRREAV  1314

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQE QMNDASEVL VIF+CLH+SFT  S  SD ESV+S C G
Sbjct  1315  APTSLRIALSNLYPESNFFQEAQMNDASEVLVVIFDCLHRSFTPGSSVSDAESVESGCPG  1374

Query  4633  SWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSS  4812
             SWDC+N+ACIVHS+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +SS
Sbjct  1375  SWDCSNNACIVHSIFGMDIFERMNCYNCGLESRHLKYTSFFHNINASALRTMKVMCAESS  1434

Query  4813  FDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATL  4992
             +DELLN VEMNHQLACD +ARGCGK NHIHH LSTPPHVFTTVLGWQ TCES +DI ATL
Sbjct  1435  YDELLNHVEMNHQLACDSEARGCGKLNHIHHILSTPPHVFTTVLGWQKTCESADDIKATL  1494

Query  4993  VALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGN  5172
              AL+TEIDISVLYRGLDPK+ H LVSVVCYYGQHYHCFAYSH+   WIMYDDKTVKVIG 
Sbjct  1495  AALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHNRGCWIMYDDKTVKVIGG  1554

Query  5173  WADVLTMCERGHLQPQV  5223
             WADVLTMCERGHLQPQV
Sbjct  1555  WADVLTMCERGHLQPQV  1571



>ref|XP_002511504.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52106.1| conserved hypothetical protein [Ricinus communis]
Length=1617

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1105 (59%), Positives = 806/1105 (73%), Gaps = 49/1105 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  A RSK +  P   A  A ++       +S+ S  LV+ +  I        S 
Sbjct  1     MGHKKRLPASRSKNTPPPSATAPTAAND-------DSEFSPNLVKIEPSI--------SL  45

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPN-------LALIYRVQ  701
              +  SSY++IK+ECERALT+LRRGNH KALRLMK+ CAKH    N        ALI+RVQ
Sbjct  46    QSDGSSYSSIKVECERALTALRRGNHTKALRLMKESCAKHGGGDNSNSTSHSAALIHRVQ  105

Query  702   GTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYE  881
             GTVCVKVASIIDDPN K RHLKNAIDSARK+  +SPNSIEFAHFYANLLYEAAND K+YE
Sbjct  106   GTVCVKVASIIDDPNAKQRHLKNAIDSARKAAELSPNSIEFAHFYANLLYEAANDSKDYE  165

Query  882   EVVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTW  1058
             +V++ECERAL IENPIDPAKESLQ E+QQK++TPEARIAHVQ ELR+L Q+S++ASISTW
Sbjct  166   DVLKECERALEIENPIDPAKESLQDESQQKITTPEARIAHVQNELRSLKQKSSIASISTW  225

Query  1059  VKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARL  1238
             +KN G+GEE  RLIPIRR +EDPME+R+VQ R+PNEIKKATKTPEERRKEIEVRVAAARL
Sbjct  226   MKNLGTGEE-IRLIPIRRAAEDPMEMRIVQTRRPNEIKKATKTPEERRKEIEVRVAAARL  284

Query  1239  LQQKSESAQSFN--DGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             LQQKSES+ SF+    ++  ++ AG+ +RG ERRK GN RK+ S+ ER+D V SYWNSM+
Sbjct  285   LQQKSESSTSFSVERSDKGAEMPAGSDKRGGERRKYGNFRKSGSNKERKDWVLSYWNSMT  344

Query  1413  TDMKKKLLRIRIVDLKSHFG-SLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADS  1589
              +MK+ LL+IR+ DLK++FG S KD LA+EVL+E L+FAE NK WKFW CC C+E+F DS
Sbjct  345   VEMKRDLLKIRVSDLKNYFGSSSKDALASEVLNEVLAFAEENKTWKFWMCCRCLEKFVDS  404

Query  1590  ESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRV  1769
              SHI HV+ EHM +L PK+Q+VLPQ+V+NEW+EM+LNCSWKPLDI++A K+L  + KC+ 
Sbjct  405   GSHIHHVVQEHMGNLMPKMQAVLPQSVDNEWIEMILNCSWKPLDISSAIKMLGSRGKCQD  464

Query  1770  HGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVW  1949
               F+ + Y+ S  +E  D   D       WD SP K+   DG +   V S   D +  V 
Sbjct  465   ADFVGDLYSGSSNEECDDCFKD------AWDSSPEKENLRDGYSDCIVGSN--DASKIVC  516

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
              + D N+ + +    +SWP+++DPER KLLE+I+ VF+ LIK+KYL +SHL+KVI  A+ 
Sbjct  517   KECDDNQSS-MAYSIDSWPLSEDPERGKLLEKIHAVFEALIKHKYLAASHLNKVIQLAMH  575

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             EL     GSQLLN+ +DQTPLCICFL AP+L+KILKFLQELSH+CGLGRY E+++  DD+
Sbjct  576   ELHISANGSQLLNHGVDQTPLCICFLEAPQLRKILKFLQELSHTCGLGRYSEKNSITDDV  635

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITF-HDGVVTDsnpnsaaissniQC  2486
             S      +  +KIV + D SCL  DE   P +  P  +  D V T          +++  
Sbjct  636   SAA-NSSEIKDKIVLNGDASCLYLDESLLPSECAPRKYPQDDVAT-------INPTHVGF  687

Query  2487  DNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERK  2666
              NG + D D LLSWIF G SSG+QL  W  ++EEK  Q +EI++ LEKEFY LQ LCERK
Sbjct  688   GNGVVSDGDALLSWIFAGPSSGDQLQLWMHTKEEKVHQGIEILQTLEKEFYHLQSLCERK  747

Query  2667  CEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRF  2846
             CEHL+YEEALQ VEDLCLEEGKKRE      R  Y+  L+KR+D+L  +  +    +   
Sbjct  748   CEHLSYEEALQSVEDLCLEEGKKRETD---GRSCYESVLRKRKDDLAHNADDTLFISSGI  804

Query  2847  EIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVA  3026
             E + I++VLK+ E +N NQFG++DTYGG+   LCDLESGED+DWR KDY +Q D+C++  
Sbjct  805   ESDVIANVLKEVEEMNRNQFGYQDTYGGMHPQLCDLESGEDNDWRTKDYRDQMDACIQGV  864

Query  3027  IQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDL  3206
             I  QK  +SVELSKIDARIMR V+GMQQLE+KLE VSA DYR IL+PL+KSY+RAHLEDL
Sbjct  865   IDGQKHQLSVELSKIDARIMRNVTGMQQLELKLEPVSALDYRLILLPLMKSYMRAHLEDL  924

Query  3207  AERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGS  3386
             AERDATEKSDAAREAFLAELA DSKK +  GS+N ++S EK +DK++ ++YRKTKD K +
Sbjct  925   AERDATEKSDAAREAFLAELALDSKKGARGGSDNLRNSQEKAKDKRRNREYRKTKDSKST  984

Query  3387  NGNGLHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkl  3563
              GN  H LH + A   S  V  DGG  D++ L +   + + Q+EEE RR IELE EERKL
Sbjct  985   TGNDHHLLHDEIAGLGSLPVTSDGGHLDSDILHSMNGDDMKQQEEEFRRIIELEEEERKL  1044

Query  3564  eetleYQRRIENEAKLKHLAEQHKK  3638
             EETLEYQRRIENEAKLKHLAEQ  K
Sbjct  1045  EETLEYQRRIENEAKLKHLAEQQFK  1069


 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/525 (67%), Positives = 403/525 (77%), Gaps = 42/525 (8%)
 Frame = +1

Query  3742  KELLQSNGSP--LEGHPKNS------TVSDIHKAGF-------------SNGGFLEDGAL  3858
             ++L Q NG P  LE  PK +      + S I ++ F             SNGG  EDG L
Sbjct  1097  EQLTQKNGFPNNLEVMPKANGASVPVSTSSISRSQFISGSSNAKVDQELSNGGATEDGIL  1156

Query  3859  TSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGE----VRPVDDSLEKKHAGESGP  4026
              SDRR GRR RRQK S K ++ K  P++S   N EVG     V+ V  ++     G+SG 
Sbjct  1157  PSDRRTGRRGRRQKSSIKSSDGKYQPISSEKNNAEVGSSIVHVKTVAPNM-----GDSGT  1211

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLP--LIPRSGTAQIS---EMANLG  4191
             KTLRQL  E+DDEERFQADL KAVRQSLDTF AHQ +P  L P++   + +   E  N+ 
Sbjct  1212  KTLRQLQAEEDDEERFQADLKKAVRQSLDTFQAHQIMPSSLRPQNFPLEANGCNETLNV-  1270

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHV  4368
             V+ ED      NG +V G GL+N+VGEYNCFLNVIIQSLWHLRRFR+EFLR S+SEH HV
Sbjct  1271  VTIEDA-----NGTDVVGMGLQNDVGEYNCFLNVIIQSLWHLRRFREEFLRRSTSEHAHV  1325

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALY+IF AL+ AS++ RR+AVAP SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1326  GEPCVVCALYEIFNALNAASTDMRREAVAPTSLRIALSNLYPDSNFFQEAQMNDASEVLA  1385

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             V+F+CLHQ+F    G SD ESV+S+ MGSWDC+NSAC+VHSLFGMD+FERMNCY C LES
Sbjct  1386  VLFDCLHQAFAPGLGVSDCESVESNSMGSWDCSNSACLVHSLFGMDIFERMNCYSCSLES  1445

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMKVMC +SSFDELLN VEMNHQLACDP++ GCGK N+IHH 
Sbjct  1446  RHLKYTSFFHNINASALRTMKVMCAESSFDELLNQVEMNHQLACDPESGGCGKLNYIHHI  1505

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LSTPP+VFTTV+GWQNTCES +DI ATL AL+TEIDISVLYRGLDPKS H LVSVVCYYG
Sbjct  1506  LSTPPYVFTTVIGWQNTCESADDIAATLAALNTEIDISVLYRGLDPKSMHGLVSVVCYYG  1565

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYS D  RWIMYDDKTVKVIG+WADVL+MCERGHLQPQV
Sbjct  1566  QHYHCFAYSQDQGRWIMYDDKTVKVIGSWADVLSMCERGHLQPQV  1610



>ref|XP_010550646.1| PREDICTED: uncharacterized protein LOC104821450 [Tarenaya hassleriana]
Length=1639

 Score =  1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1106 (57%), Positives = 815/1106 (74%), Gaps = 39/1106 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKK+  APR K S A    A  A   +A    +ESD S + V   +  +  Q  V +E
Sbjct  1     MGHKKKNPAPRPKQSPADAAAATTATPSSA----VESDPSDIPVGALNRRQGSQRGVRTE  56

Query  543   TNAS----SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
              + S    SSY+ IKLECE+ALTS RRG++NKA+RLMK+ C++H++S   ALI+RVQGT+
Sbjct  57    PSDSAKEVSSYSVIKLECEKALTSFRRGSYNKAIRLMKESCSRHQDS---ALIHRVQGTL  113

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVAS+ +DP  K R L+NAIDSARK+V +SPNSIEF HFYANLLYEAANDGKEYEEVV
Sbjct  114   CVKVASVYEDPATKQRFLRNAIDSARKAVELSPNSIEFGHFYANLLYEAANDGKEYEEVV  173

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QEC+RAL+IENPIDPAKESLQ E+QQK+S+ EAR+AHVQ ELR+LIQ+SN+AS+STW+KN
Sbjct  174   QECQRALSIENPIDPAKESLQDESQQKISSAEARVAHVQDELRSLIQKSNIASLSTWMKN  233

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
               +GEEKFRLIPIRR++EDPME RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ
Sbjct  234   LSNGEEKFRLIPIRRIAEDPMESRLVQTRRPNEIKKATKTPEERRKEIEVRVAAARLLQQ  293

Query  1248  KSESAQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KSES+   ++G    +  D + G+GQRG ER K GN+RKN S+ ER D VRSYW+SMS  
Sbjct  294   KSESSPLQDEGNSNNKVSDSALGSGQRGGERSKHGNSRKNGSTTERSDWVRSYWDSMSNQ  353

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             MK+ LLR+++ D+K HF   KDG ANE+++EALSF E NK W+FW CC C E+F D+ESH
Sbjct  354   MKRDLLRVKVSDVKGHFSLFKDGQANEIITEALSFYECNKTWRFWVCCRCNEKFTDAESH  413

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QHV+ EHM +  PK+Q+VLPQ+++NEW+EMLLNC+WKPLD++AA ++L  + K R +  
Sbjct  414   MQHVVQEHMGNELPKMQAVLPQSIDNEWIEMLLNCTWKPLDLSAAVQMLGNRPK-RPNSE  472

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
             L    +R +MD S +   D       WD SP K+  G  C+  T DS    +N  V ++ 
Sbjct  473   LYELNSRDNMDCSDNCFKD------AWDSSPEKENLGVACSFRTRDSSSCGENFNVGVN-  525

Query  1959  DGNEGTKICP--PSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEE  2132
              G EG ++    P + WP+++DPE AKLLE++   F+ LI+ KYL +SHL+KVI F ++E
Sbjct  526   -GTEGDQVSFSFPPDGWPLSNDPECAKLLEKVRAAFELLIRYKYLAASHLNKVIQFTLDE  584

Query  2133  LQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIS  2312
             L +L   SQ+LN  ++Q+P+CIC LGAP+L+KILKFLQ+L+HSCGL RY ++ST  DD++
Sbjct  585   LHNLASSSQVLNRGLEQSPICICLLGAPQLRKILKFLQDLAHSCGLNRY-DKSTPNDDVN  643

Query  2313  TGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTP----ITFHDGVVTDsnpnsaaissni  2480
                Q  +  E+I+   +GS LL DE     + T      +  D V T  +   A      
Sbjct  644   GSGQCCELAEEILLDGEGSYLLLDEKLIGTECTQEKDMGSASDSVATGCSRRIAN-----  698

Query  2481  QCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCE  2660
                N     +D  LSWIF G SSGEQ+ SW R++EEK +Q +EI+++LEKEF  LQ LCE
Sbjct  699   --GNSVSFGADGFLSWIFTGPSSGEQIASWMRTKEEKTRQGLEIMQVLEKEFCHLQNLCE  756

Query  2661  RKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNY  2840
             RKCEHL+YEEALQVVE LCLEEG+KRE + +FVR SYDI L+KRR+EL+ES H+    + 
Sbjct  757   RKCEHLSYEEALQVVEGLCLEEGRKREASSEFVRDSYDIVLRKRREELLESDHDLVFISN  816

Query  2841  RFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVE  3020
             RFE++A+++VLK+AESLN NQFG+E++YG +S  LCDLESGE D+WR+KD LNQAD+ +E
Sbjct  817   RFELDALTNVLKEAESLNANQFGYEESYGSVSPQLCDLESGEADEWRMKDSLNQADTFIE  876

Query  3021  VAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLE  3200
             +AIQ+QKE +S ELSKIDAR+MR V+GMQQLE+KL  VS++DY+ +L+ LVKSY+RAHLE
Sbjct  877   IAIQKQKEQLSAELSKIDARMMRNVTGMQQLELKLGPVSSNDYQTVLLSLVKSYMRAHLE  936

Query  3201  DLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlk  3380
              LAE+DATEKSDAAREAFL ELA DSKK     ++N++H  EK++DKKK KD RKTKD K
Sbjct  937   ALAEKDATEKSDAAREAFLVELALDSKKDVKSKNDNSRHVQEKSKDKKKNKDSRKTKDSK  996

Query  3381  GSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerk  3560
              + G G H  ++D+ E  S  V        AE  +G  +++ +E+EE RR+IELE E RK
Sbjct  997   TTVG-GEHLFNNDSVEHRSSPVASYNDHSKAEGVSGAVDTLKEEDEEYRRKIELEEEARK  1055

Query  3561  leetleYQRRIENEAKLKHLAEQHKK  3638
             LEETLEYQR+IENEAK KHLAEQ KK
Sbjct  1056  LEETLEYQRQIENEAKQKHLAEQQKK  1081


 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/441 (70%), Positives = 352/441 (80%), Gaps = 16/441 (4%)
 Frame = +1

Query  3916  NEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKA  4095
             N + C P T G E       RP +  L     G+ G KTLRQL  E+D+EERFQADL KA
Sbjct  1204  NGDSCKPGTGGHE-------RPSEIILRN---GDVGTKTLRQLQAEEDEEERFQADLKKA  1253

Query  4096  VRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNG----IEVYGTGLKNE  4263
             VRQSLDT+ A +K+P   R+      E+ N  V   DV  G         +V+GTGL+NE
Sbjct  1254  VRQSLDTYQALRKMPSSVRTPERTALELNN-DVLKPDVIVGEKTQDSVHSDVFGTGLQNE  1312

Query  4264  VGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETR  4440
             VGEYNCFLNVIIQSLWHLR+FR EFLR S+ +H HVGDPCVVCALY+IFTALS A+SETR
Sbjct  1313  VGEYNCFLNVIIQSLWHLRQFRAEFLRRSTLDHHHVGDPCVVCALYEIFTALSAATSETR  1372

Query  4441  RDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDS  4620
             ++ VAP SLRIALSNLYP+   FQE QMNDASEVL VIF+CLH++F   S  SDTES +S
Sbjct  1373  KEPVAPTSLRIALSNLYPESSFFQEAQMNDASEVLAVIFDCLHRAFAQVSSVSDTESSES  1432

Query  4621  SCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMC  4800
             +CMGSWDC N  CIVHSLFGMD+FE+MNC+ CGLESRHLKYTSFFHNINASALRTMKVMC
Sbjct  1433  NCMGSWDCTNRTCIVHSLFGMDIFEQMNCFSCGLESRHLKYTSFFHNINASALRTMKVMC  1492

Query  4801  QDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDI  4980
              +SSF+ELLN VEMNHQLACDP+A GCGK N+IHH LSTPPHVFTTV+GWQNTCE+ EDI
Sbjct  1493  AESSFEELLNFVEMNHQLACDPEAGGCGKPNYIHHILSTPPHVFTTVMGWQNTCETAEDI  1552

Query  4981  TATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVK  5160
              ATL AL+TEIDIS++YRGLD K+ + LVSVVCYYGQHYHCFAYSHDH+RW+MYDDKTVK
Sbjct  1553  VATLEALNTEIDISIMYRGLDSKNTYSLVSVVCYYGQHYHCFAYSHDHDRWVMYDDKTVK  1612

Query  5161  VIGNWADVLTMCERGHLQPQV  5223
             VIG W DVL+MCERGHLQPQV
Sbjct  1613  VIGKWGDVLSMCERGHLQPQV  1633



>ref|XP_010546042.1| PREDICTED: uncharacterized protein LOC104818245 isoform X3 [Tarenaya 
hassleriana]
Length=1650

 Score =  1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1103 (57%), Positives = 820/1103 (74%), Gaps = 29/1103 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQ--AVVE  536
             MGHKK+  A R K S  P E AA AV  A+  A  ESD + +    ++  R  Q  A +E
Sbjct  1     MGHKKKNPASRPKQSPTPAEAAAEAVATASSDAK-ESDPAGIPDGARNSRRGSQRGAKIE  59

Query  537   SETNA--SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
                +A  +SSY+ IKLECE+ALTS RRG++NKA+RLMK+ CA H++S   ALI+RVQGT+
Sbjct  60    PSDSAKEASSYSVIKLECEKALTSFRRGSYNKAIRLMKESCAHHQDS---ALIHRVQGTL  116

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVAS+ +DP  K R L+NAIDSARK+V +SPNSIEFAHFYANLLYEAA+DGKE EEVV
Sbjct  117   CVKVASVYEDPATKQRFLRNAIDSARKAVELSPNSIEFAHFYANLLYEAASDGKEDEEVV  176

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QEC+RAL+IEN IDPAKESLQ E+QQK+STPEARIAHVQ ELR+LIQ+SN+AS+STW+KN
Sbjct  177   QECQRALSIENAIDPAKESLQDESQQKISTPEARIAHVQEELRSLIQKSNIASLSTWMKN  236

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
               +GEEKFRLIPIRR++EDPME RLVQ R+PNEIKKA KTPEERRKEIEVRVAAARLLQQ
Sbjct  237   LSNGEEKFRLIPIRRIAEDPMESRLVQIRRPNEIKKAAKTPEERRKEIEVRVAAARLLQQ  296

Query  1248  KSESAQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KSES+ S +DG    +  DL++G GQRG ERRK GN++K  S+ ER+D VRSYWNSMS +
Sbjct  297   KSESSPSQDDGNGNNKGSDLASGAGQRGGERRKHGNSKKRGSTAERKDWVRSYWNSMSNE  356

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             MKK LLR+++ D+K+HF S KDG ANE+++EALSF E+NK W+FW C  C E+F D+ESH
Sbjct  357   MKKALLRVKVSDIKAHFSSSKDGQANEIITEALSFYESNKTWRFWVCHRCAEKFTDAESH  416

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QHV+ EHM +  P++Q+VLPQ+++N W+EMLLNCSWKPLD++AA K+L  + K R    
Sbjct  417   MQHVVQEHMGNELPRMQAVLPQSIDNGWIEMLLNCSWKPLDLSAAVKMLGDKPKHRSSEL  476

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
              E            D++ D  C    WD SP K+  G  CN  T D+   D+NS + ++ 
Sbjct  477   YEFN--------PGDNMDDSECFRDAWDSSPEKENLGSACNFGTRDNTGSDENSNIGVN-  527

Query  1959  DGNEGTKIC---PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
              G+E  ++    PP + WP+++DPERAKLLE+++  F+ LI++KYL +SHL+KVI F ++
Sbjct  528   -GSERDQVSFSFPPPDKWPLSNDPERAKLLEKVHAAFELLIRHKYLAASHLNKVIQFTLD  586

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             ELQ+L  GSQ+LN  +DQ+P+CICFLGAP+L+KILKFLQ+LS SCGL RY  +S + +++
Sbjct  587   ELQNLASGSQVLNRGLDQSPICICFLGAPQLRKILKFLQDLSQSCGLSRYSGKSLSNENV  646

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
             +   Q  +  E+I+   +GS LL DE     + T    + G  +D      +     + +
Sbjct  647   NVVGQCCELTEEILLDGEGSYLLLDEKLLDNECTKEK-NMGSASDYLAMGGSGRPANETN  705

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                   +D +LSWIF+G SS E++ SW R++EE+ +Q +EI+++LEKEF  LQ LCERKC
Sbjct  706   VSS--GADGVLSWIFVGPSSEEEIASWIRTKEERTRQGLEIMQILEKEFCHLQNLCERKC  763

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             EHL+YEEALQ VEDLCLEEG++RE + +F   SY+  L+KRR++L+ES H+    + RFE
Sbjct  764   EHLSYEEALQAVEDLCLEEGRRREASEEFNYDSYESVLRKRREDLIESDHDLVFLSNRFE  823

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+++VLK+AESLN NQFGFE++YG +SS LCDLESGE D WR+KD LNQ D+ +E+AI
Sbjct  824   LDALTNVLKEAESLNANQFGFEESYGSVSSQLCDLESGEADQWRMKDSLNQVDTLIEIAI  883

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             Q+QKE +S ELS IDAR+M  V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE L+
Sbjct  884   QKQKEQLSAELSTIDARMMHNVTGMQQLELKLGPVSSNDYQTVLLPLVKSYMRAHLEALS  943

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAAREAFL ELA DSKK     ++N++H  EK++DKKK KD RK KD K + 
Sbjct  944   EKDATEKSDAAREAFLVELALDSKKDVRGKNDNSRHVQEKSKDKKKNKDSRKAKDSKATV  1003

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
             G+  H  +HD+ E  S  V       +AE  +   +S+ ++EEE RR+IELE EERKLEE
Sbjct  1004  GSE-HRFNHDSVEHRSSPVASYDDHSEAEGVSRAVDSLQEQEEEYRRKIELEEEERKLEE  1062

Query  3570  tleYQRRIENEAKLKHLAEQHKK  3638
             TLEYQRRIENEAK KHLAEQ KK
Sbjct  1063  TLEYQRRIENEAKQKHLAEQQKK  1085


 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/407 (71%), Positives = 335/407 (82%), Gaps = 3/407 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G+ G KTLRQL  ++D+EERFQADL KAVRQSLDT+ A +K P   R+  +   E  N G
Sbjct  1238  GDVGTKTLRQLQTDEDEEERFQADLKKAVRQSLDTYQAQRKTPSGVRTPESTALESNNNG  1297

Query  4192  VSCEDVATGIVNGI--EVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHI  4362
             +  + +  G       +V+GTGL+NEVGEYNCFLNV+IQSLWHLR+FRDEFL RS+ EH 
Sbjct  1298  LQHDVIVGGTTESTHSDVFGTGLQNEVGEYNCFLNVVIQSLWHLRQFRDEFLWRSTLEHH  1357

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVC+LY+IFTA   AS+ETR+  VAP SLRIALSNLYPD   FQE QMNDASEV
Sbjct  1358  HVGDPCVVCSLYEIFTAFGAASTETRKQPVAPTSLRIALSNLYPDSSFFQEAQMNDASEV  1417

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLH++FTS S  SDTES +S+ MGSWDC N  CI HSLFGMD+FE+MNC+ CGL
Sbjct  1418  LAVIFDCLHRAFTSVSSVSDTESSESNSMGSWDCTNRTCIAHSLFGMDIFEQMNCFSCGL  1477

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESRH+KYTSFFHNINASALR+MKVMC +SSF+ELLN VEMNHQL CDP+A GCGK N+IH
Sbjct  1478  ESRHMKYTSFFHNINASALRSMKVMCGESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIH  1537

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H LS PP VFT V+GWQNTCE+ EDI ATL A+ TEIDISV+YRGLDPK+ + LVSVVCY
Sbjct  1538  HILSVPPRVFTMVMGWQNTCETAEDIAATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCY  1597

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFAYSH H+RW+MYDDKTVKVIGNW DVL+MCERGHLQPQV
Sbjct  1598  YGQHYHCFAYSHAHDRWVMYDDKTVKVIGNWGDVLSMCERGHLQPQV  1644



>ref|XP_010546039.1| PREDICTED: uncharacterized protein LOC104818245 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546040.1| PREDICTED: uncharacterized protein LOC104818245 isoform X1 [Tarenaya 
hassleriana]
Length=1656

 Score =  1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1103 (57%), Positives = 820/1103 (74%), Gaps = 29/1103 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQ--AVVE  536
             MGHKK+  A R K S  P E AA AV  A+  A  ESD + +    ++  R  Q  A +E
Sbjct  1     MGHKKKNPASRPKQSPTPAEAAAEAVATASSDAK-ESDPAGIPDGARNSRRGSQRGAKIE  59

Query  537   SETNA--SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
                +A  +SSY+ IKLECE+ALTS RRG++NKA+RLMK+ CA H++S   ALI+RVQGT+
Sbjct  60    PSDSAKEASSYSVIKLECEKALTSFRRGSYNKAIRLMKESCAHHQDS---ALIHRVQGTL  116

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVAS+ +DP  K R L+NAIDSARK+V +SPNSIEFAHFYANLLYEAA+DGKE EEVV
Sbjct  117   CVKVASVYEDPATKQRFLRNAIDSARKAVELSPNSIEFAHFYANLLYEAASDGKEDEEVV  176

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QEC+RAL+IEN IDPAKESLQ E+QQK+STPEARIAHVQ ELR+LIQ+SN+AS+STW+KN
Sbjct  177   QECQRALSIENAIDPAKESLQDESQQKISTPEARIAHVQEELRSLIQKSNIASLSTWMKN  236

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
               +GEEKFRLIPIRR++EDPME RLVQ R+PNEIKKA KTPEERRKEIEVRVAAARLLQQ
Sbjct  237   LSNGEEKFRLIPIRRIAEDPMESRLVQIRRPNEIKKAAKTPEERRKEIEVRVAAARLLQQ  296

Query  1248  KSESAQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KSES+ S +DG    +  DL++G GQRG ERRK GN++K  S+ ER+D VRSYWNSMS +
Sbjct  297   KSESSPSQDDGNGNNKGSDLASGAGQRGGERRKHGNSKKRGSTAERKDWVRSYWNSMSNE  356

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             MKK LLR+++ D+K+HF S KDG ANE+++EALSF E+NK W+FW C  C E+F D+ESH
Sbjct  357   MKKALLRVKVSDIKAHFSSSKDGQANEIITEALSFYESNKTWRFWVCHRCAEKFTDAESH  416

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QHV+ EHM +  P++Q+VLPQ+++N W+EMLLNCSWKPLD++AA K+L  + K R    
Sbjct  417   MQHVVQEHMGNELPRMQAVLPQSIDNGWIEMLLNCSWKPLDLSAAVKMLGDKPKHRSSEL  476

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
              E            D++ D  C    WD SP K+  G  CN  T D+   D+NS + ++ 
Sbjct  477   YEFN--------PGDNMDDSECFRDAWDSSPEKENLGSACNFGTRDNTGSDENSNIGVN-  527

Query  1959  DGNEGTKIC---PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
              G+E  ++    PP + WP+++DPERAKLLE+++  F+ LI++KYL +SHL+KVI F ++
Sbjct  528   -GSERDQVSFSFPPPDKWPLSNDPERAKLLEKVHAAFELLIRHKYLAASHLNKVIQFTLD  586

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             ELQ+L  GSQ+LN  +DQ+P+CICFLGAP+L+KILKFLQ+LS SCGL RY  +S + +++
Sbjct  587   ELQNLASGSQVLNRGLDQSPICICFLGAPQLRKILKFLQDLSQSCGLSRYSGKSLSNENV  646

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
             +   Q  +  E+I+   +GS LL DE     + T    + G  +D      +     + +
Sbjct  647   NVVGQCCELTEEILLDGEGSYLLLDEKLLDNECTKEK-NMGSASDYLAMGGSGRPANETN  705

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                   +D +LSWIF+G SS E++ SW R++EE+ +Q +EI+++LEKEF  LQ LCERKC
Sbjct  706   VSS--GADGVLSWIFVGPSSEEEIASWIRTKEERTRQGLEIMQILEKEFCHLQNLCERKC  763

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             EHL+YEEALQ VEDLCLEEG++RE + +F   SY+  L+KRR++L+ES H+    + RFE
Sbjct  764   EHLSYEEALQAVEDLCLEEGRRREASEEFNYDSYESVLRKRREDLIESDHDLVFLSNRFE  823

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+++VLK+AESLN NQFGFE++YG +SS LCDLESGE D WR+KD LNQ D+ +E+AI
Sbjct  824   LDALTNVLKEAESLNANQFGFEESYGSVSSQLCDLESGEADQWRMKDSLNQVDTLIEIAI  883

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             Q+QKE +S ELS IDAR+M  V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE L+
Sbjct  884   QKQKEQLSAELSTIDARMMHNVTGMQQLELKLGPVSSNDYQTVLLPLVKSYMRAHLEALS  943

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAAREAFL ELA DSKK     ++N++H  EK++DKKK KD RK KD K + 
Sbjct  944   EKDATEKSDAAREAFLVELALDSKKDVRGKNDNSRHVQEKSKDKKKNKDSRKAKDSKATV  1003

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
             G+  H  +HD+ E  S  V       +AE  +   +S+ ++EEE RR+IELE EERKLEE
Sbjct  1004  GSE-HRFNHDSVEHRSSPVASYDDHSEAEGVSRAVDSLQEQEEEYRRKIELEEEERKLEE  1062

Query  3570  tleYQRRIENEAKLKHLAEQHKK  3638
             TLEYQRRIENEAK KHLAEQ KK
Sbjct  1063  TLEYQRRIENEAKQKHLAEQQKK  1085


 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/441 (68%), Positives = 346/441 (78%), Gaps = 15/441 (3%)
 Frame = +1

Query  3922  EKCPPVTSG----AENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLM  4089
             E   P T+G    +EN+    V P D  +        G KTLRQL  ++D+EERFQADL 
Sbjct  1218  ESWKPDTAGHKRQSENLLCNGVYPGDLDV--------GTKTLRQLQTDEDEEERFQADLK  1269

Query  4090  KAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGI--EVYGTGLKNE  4263
             KAVRQSLDT+ A +K P   R+  +   E  N G+  + +  G       +V+GTGL+NE
Sbjct  1270  KAVRQSLDTYQAQRKTPSGVRTPESTALESNNNGLQHDVIVGGTTESTHSDVFGTGLQNE  1329

Query  4264  VGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETR  4440
             VGEYNCFLNV+IQSLWHLR+FRDEFL RS+ EH HVGDPCVVC+LY+IFTA   AS+ETR
Sbjct  1330  VGEYNCFLNVVIQSLWHLRQFRDEFLWRSTLEHHHVGDPCVVCSLYEIFTAFGAASTETR  1389

Query  4441  RDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDS  4620
             +  VAP SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH++FTS S  SDTES +S
Sbjct  1390  KQPVAPTSLRIALSNLYPDSSFFQEAQMNDASEVLAVIFDCLHRAFTSVSSVSDTESSES  1449

Query  4621  SCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMC  4800
             + MGSWDC N  CI HSLFGMD+FE+MNC+ CGLESRH+KYTSFFHNINASALR+MKVMC
Sbjct  1450  NSMGSWDCTNRTCIAHSLFGMDIFEQMNCFSCGLESRHMKYTSFFHNINASALRSMKVMC  1509

Query  4801  QDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDI  4980
              +SSF+ELLN VEMNHQL CDP+A GCGK N+IHH LS PP VFT V+GWQNTCE+ EDI
Sbjct  1510  GESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIHHILSVPPRVFTMVMGWQNTCETAEDI  1569

Query  4981  TATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVK  5160
              ATL A+ TEIDISV+YRGLDPK+ + LVSVVCYYGQHYHCFAYSH H+RW+MYDDKTVK
Sbjct  1570  AATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCYYGQHYHCFAYSHAHDRWVMYDDKTVK  1629

Query  5161  VIGNWADVLTMCERGHLQPQV  5223
             VIGNW DVL+MCERGHLQPQV
Sbjct  1630  VIGNWGDVLSMCERGHLQPQV  1650



>ref|XP_010256031.1| PREDICTED: uncharacterized protein LOC104596511 isoform X4 [Nelumbo 
nucifera]
Length=1443

 Score =  1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1114 (57%), Positives = 827/1114 (74%), Gaps = 38/1114 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaav------avdeaappapLESDTSAVLVQEKSLIRHDQ  524
             MGHKKR +APRS+PS     V A       +V+    P    SD S    QE+S I   +
Sbjct  1     MGHKKRNVAPRSRPSALATVVPADNLDGLGSVEYEKTPNLGHSDDSR---QEQSKI---E  54

Query  525   AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             A V+S+T   SSY+ +K+ECERAL +LRRGNH KALRLMK+ C +HE+S   AL++RVQG
Sbjct  55    AAVQSDT---SSYSAVKIECERALIALRRGNHTKALRLMKESCFRHESS---ALLHRVQG  108

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K RHL+NAI+SAR++V +SPNSIEFAHFYANLLYEAAND K YEE
Sbjct  109   TVCVKVASLIDDPNAKQRHLRNAIESARRAVALSPNSIEFAHFYANLLYEAANDSKGYEE  168

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERA  I+NP+DPA ESLQ ENQQK+STPEARI+H+Q ELR+LIQ++N+ASISTW+
Sbjct  169   VVQECERAFLIQNPVDPAIESLQDENQQKLSTPEARISHMQQELRSLIQKANIASISTWM  228

Query  1062  KNF--GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAAR  1235
             KN   G+GEE+FRLIP+RR+SEDPME+RL Q R+PNEIKKATKTPEERRKEIEVRVAAAR
Sbjct  229   KNLGGGTGEERFRLIPMRRLSEDPMEVRLAQTRRPNEIKKATKTPEERRKEIEVRVAAAR  288

Query  1236  LLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             LLQQKS S QS  D E++ + S+G+ + G ERRK  N RK  SS++R D VRSYWNSMS 
Sbjct  289   LLQQKSGSPQSPKDEEKASESSSGSHRVG-ERRKYANVRKVASSVDRMDQVRSYWNSMSL  347

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D K+ LL + + DLK+HF S KDGLA EVLSEALSFAE++K WKFW CC C E+F D  S
Sbjct  348   DKKQSLLEVSVHDLKAHFSSSKDGLATEVLSEALSFAESHKTWKFWLCCRCNEKFTDCGS  407

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             ++QH++ EHM +LSPKLQSVLPQ V+ +W EML+N SWKP+D +AA  +LE QL+C+   
Sbjct  408   YMQHIVREHMGNLSPKLQSVLPQEVDTDWAEMLVNGSWKPVDASAALSMLENQLRCQSPK  467

Query  1776  FLENTYTRSDMDESKDD-ISDPYCNVYGWDRS-------PIKKTF--GDGCNGTTVDSRE  1925
                 +  R+  D++K++ + D +C+    D S       P+ + F  GD  N   +++  
Sbjct  468   LFNESDIRNHRDKNKEEFLVDDWCSKDPSDSSPDEGKVQPLDEEFKAGDIGNENALENTS  527

Query  1926  YDKNSEVW-MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHL  2102
             +D  S+    +  GN  ++ C  ++ WP++DD ERAKLLERI  + Q L+++K L  SHL
Sbjct  528   HDYISDFQSREYSGNRLSRGCYRAQIWPLSDDSERAKLLERIRGMLQLLLRHKCLAVSHL  587

Query  2103  SKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYP  2282
             +KVI + + ELQSL  GSQLLN+ +DQTPLCICFLGA +L+KI+KFLQE+SHSCGLGRY 
Sbjct  588   NKVIQYTMNELQSLASGSQLLNHGLDQTPLCICFLGASQLRKIIKFLQEISHSCGLGRYS  647

Query  2283  ERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsa  2462
             E+ST+ +D  T   G    E+IVF+ D SCLL DE      LTP+T+      D +  ++
Sbjct  648   EKSTSTNDAHTVSPGFKIKERIVFTNDSSCLLLDERLLRGTLTPLTYDSAHADDGSATNS  707

Query  2463  aissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYE  2642
              +  +   +NG L ++D LLSW+F G SSGEQL+SW+  REEK ++ ME++++LEKEFY 
Sbjct  708   VLVDH---ENGVLPENDALLSWMFTGPSSGEQLSSWTHLREEKTRKGMEVLQMLEKEFYL  764

Query  2643  LQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHE  2822
             LQ LC+RKCEHL+YEEALQ VE LCL E K+REH  + V +SY+  L+KR++EL+E  ++
Sbjct  765   LQSLCDRKCEHLSYEEALQAVESLCLNELKRREHVTELVTQSYETVLRKRQEELVEMDND  824

Query  2823  ATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQ  3002
                 + RFE++AIS++LK+A+SLN NQFG+++   G++S LCDL+ GEDD WR++DYL+Q
Sbjct  825   VMFISSRFELDAISNILKEAKSLNANQFGYDEPMNGMTSRLCDLDYGEDDVWRMQDYLHQ  884

Query  3003  ADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSY  3182
             AD+C+EV IQ+QK+ +SVELSK DARIMR VSGMQQLE+KL  + AHDYR I++PL+KS+
Sbjct  885   ADTCIEVTIQKQKDQLSVELSKTDARIMRNVSGMQQLELKLGPLLAHDYRAIMLPLLKSF  944

Query  3183  LRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyr  3362
             +RA+LE+L ++DA EKSDAAREAFLAELA D+K S++ G ++ K   EK++D+KK KDYR
Sbjct  945   MRAYLENLVDKDAMEKSDAAREAFLAELALDAKNSASRGGDHLKQIQEKSKDRKKNKDYR  1004

Query  3363  ktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDA-ELSNGGSNSITQeeeeqrrrie  3539
             K KDLK + G     L  ++ E+   SV+ D    D+  + +   + + Q+EE+ R +IE
Sbjct  1005  KAKDLKAA-GVSEQILCQESEEQTYSSVLLDKNHLDSVAVGSISCDVLQQQEEDFRHKIE  1063

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHKKG  3641
             LEAEERKLEETLEYQRRIENEAK KHLAEQH++ 
Sbjct  1064  LEAEERKLEETLEYQRRIENEAKQKHLAEQHREA  1097


 Score =   117 bits (292),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQIS--EMAN  4185
             G+   KTLRQLHV++D EERFQADL KAVRQSLDTF AH+  P +PR    Q +  E  +
Sbjct  1330  GDITTKTLRQLHVDEDAEERFQADLQKAVRQSLDTFQAHKGSPPVPRQRVPQRTSPEAGD  1389

Query  4186  LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLN  4290
              G S + V    +NGI+V+GTGLKNEVGEYNCFLN
Sbjct  1390  YGASPDAVMVENINGIDVFGTGLKNEVGEYNCFLN  1424



>ref|XP_010546041.1| PREDICTED: uncharacterized protein LOC104818245 isoform X2 [Tarenaya 
hassleriana]
Length=1652

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1103 (57%), Positives = 820/1103 (74%), Gaps = 29/1103 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQ--AVVE  536
             MGHKK+  A R K S  P E AA AV  A+  A  ESD + +    ++  R  Q  A +E
Sbjct  1     MGHKKKNPASRPKQSPTPAEAAAEAVATASSDAK-ESDPAGIPDGARNSRRGSQRGAKIE  59

Query  537   SETNA--SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
                +A  +SSY+ IKLECE+ALTS RRG++NKA+RLMK+ CA H++S   ALI+RVQGT+
Sbjct  60    PSDSAKEASSYSVIKLECEKALTSFRRGSYNKAIRLMKESCAHHQDS---ALIHRVQGTL  116

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVAS+ +DP  K R L+NAIDSARK+V +SPNSIEFAHFYANLLYEAA+DGKE EEVV
Sbjct  117   CVKVASVYEDPATKQRFLRNAIDSARKAVELSPNSIEFAHFYANLLYEAASDGKEDEEVV  176

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             QEC+RAL+IEN IDPAKESLQ E+QQK+STPEARIAHVQ ELR+LIQ+SN+AS+STW+KN
Sbjct  177   QECQRALSIENAIDPAKESLQDESQQKISTPEARIAHVQEELRSLIQKSNIASLSTWMKN  236

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
               +GEEKFRLIPIRR++EDPME RLVQ R+PNEIKKA KTPEERRKEIEVRVAAARLLQQ
Sbjct  237   LSNGEEKFRLIPIRRIAEDPMESRLVQIRRPNEIKKAAKTPEERRKEIEVRVAAARLLQQ  296

Query  1248  KSESAQSFNDGE---RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KSES+ S +DG    +  DL++G GQRG ERRK GN++K  S+ ER+D VRSYWNSMS +
Sbjct  297   KSESSPSQDDGNGNNKGSDLASGAGQRGGERRKHGNSKKRGSTAERKDWVRSYWNSMSNE  356

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             MKK LLR+++ D+K+HF S KDG ANE+++EALSF E+NK W+FW C  C E+F D+ESH
Sbjct  357   MKKALLRVKVSDIKAHFSSSKDGQANEIITEALSFYESNKTWRFWVCHRCAEKFTDAESH  416

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QHV+ EHM +  P++Q+VLPQ+++N W+EMLLNCSWKPLD++AA K+L  + K R    
Sbjct  417   MQHVVQEHMGNELPRMQAVLPQSIDNGWIEMLLNCSWKPLDLSAAVKMLGDKPKHRSSEL  476

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
              E            D++ D  C    WD SP K+  G  CN  T D+   D+NS + ++ 
Sbjct  477   YEFN--------PGDNMDDSECFRDAWDSSPEKENLGSACNFGTRDNTGSDENSNIGVN-  527

Query  1959  DGNEGTKIC---PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
              G+E  ++    PP + WP+++DPERAKLLE+++  F+ LI++KYL +SHL+KVI F ++
Sbjct  528   -GSERDQVSFSFPPPDKWPLSNDPERAKLLEKVHAAFELLIRHKYLAASHLNKVIQFTLD  586

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             ELQ+L  GSQ+LN  +DQ+P+CICFLGAP+L+KILKFLQ+LS SCGL RY  +S + +++
Sbjct  587   ELQNLASGSQVLNRGLDQSPICICFLGAPQLRKILKFLQDLSQSCGLSRYSGKSLSNENV  646

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
             +   Q  +  E+I+   +GS LL DE     + T    + G  +D      +     + +
Sbjct  647   NVVGQCCELTEEILLDGEGSYLLLDEKLLDNECTKEK-NMGSASDYLAMGGSGRPANETN  705

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                   +D +LSWIF+G SS E++ SW R++EE+ +Q +EI+++LEKEF  LQ LCERKC
Sbjct  706   VSS--GADGVLSWIFVGPSSEEEIASWIRTKEERTRQGLEIMQILEKEFCHLQNLCERKC  763

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             EHL+YEEALQ VEDLCLEEG++RE + +F   SY+  L+KRR++L+ES H+    + RFE
Sbjct  764   EHLSYEEALQAVEDLCLEEGRRREASEEFNYDSYESVLRKRREDLIESDHDLVFLSNRFE  823

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+++VLK+AESLN NQFGFE++YG +SS LCDLESGE D WR+KD LNQ D+ +E+AI
Sbjct  824   LDALTNVLKEAESLNANQFGFEESYGSVSSQLCDLESGEADQWRMKDSLNQVDTLIEIAI  883

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             Q+QKE +S ELS IDAR+M  V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE L+
Sbjct  884   QKQKEQLSAELSTIDARMMHNVTGMQQLELKLGPVSSNDYQTVLLPLVKSYMRAHLEALS  943

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAAREAFL ELA DSKK     ++N++H  EK++DKKK KD RK KD K + 
Sbjct  944   EKDATEKSDAAREAFLVELALDSKKDVRGKNDNSRHVQEKSKDKKKNKDSRKAKDSKATV  1003

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
             G+  H  +HD+ E  S  V       +AE  +   +S+ ++EEE RR+IELE EERKLEE
Sbjct  1004  GSE-HRFNHDSVEHRSSPVASYDDHSEAEGVSRAVDSLQEQEEEYRRKIELEEEERKLEE  1062

Query  3570  tleYQRRIENEAKLKHLAEQHKK  3638
             TLEYQRRIENEAK KHLAEQ KK
Sbjct  1063  TLEYQRRIENEAKQKHLAEQQKK  1085


 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/404 (72%), Positives = 333/404 (82%), Gaps = 3/404 (1%)
 Frame = +1

Query  4021  GPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSC  4200
             G KTLRQL  ++D+EERFQADL KAVRQSLDT+ A +K P   R+  +   E  N G+  
Sbjct  1243  GTKTLRQLQTDEDEEERFQADLKKAVRQSLDTYQAQRKTPSGVRTPESTALESNNNGLQH  1302

Query  4201  EDVATGIVNGI--EVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVG  4371
             + +  G       +V+GTGL+NEVGEYNCFLNV+IQSLWHLR+FRDEFL RS+ EH HVG
Sbjct  1303  DVIVGGTTESTHSDVFGTGLQNEVGEYNCFLNVVIQSLWHLRQFRDEFLWRSTLEHHHVG  1362

Query  4372  DPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGV  4551
             DPCVVC+LY+IFTA   AS+ETR+  VAP SLRIALSNLYPD   FQE QMNDASEVL V
Sbjct  1363  DPCVVCSLYEIFTAFGAASTETRKQPVAPTSLRIALSNLYPDSSFFQEAQMNDASEVLAV  1422

Query  4552  IFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESR  4731
             IF+CLH++FTS S  SDTES +S+ MGSWDC N  CI HSLFGMD+FE+MNC+ CGLESR
Sbjct  1423  IFDCLHRAFTSVSSVSDTESSESNSMGSWDCTNRTCIAHSLFGMDIFEQMNCFSCGLESR  1482

Query  4732  HLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFL  4911
             H+KYTSFFHNINASALR+MKVMC +SSF+ELLN VEMNHQL CDP+A GCGK N+IHH L
Sbjct  1483  HMKYTSFFHNINASALRSMKVMCGESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIHHIL  1542

Query  4912  STPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQ  5091
             S PP VFT V+GWQNTCE+ EDI ATL A+ TEIDISV+YRGLDPK+ + LVSVVCYYGQ
Sbjct  1543  SVPPRVFTMVMGWQNTCETAEDIAATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCYYGQ  1602

Query  5092  HYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HYHCFAYSH H+RW+MYDDKTVKVIGNW DVL+MCERGHLQPQV
Sbjct  1603  HYHCFAYSHAHDRWVMYDDKTVKVIGNWGDVLSMCERGHLQPQV  1646



>ref|XP_010256025.1| PREDICTED: uncharacterized protein LOC104596511 isoform X3 [Nelumbo 
nucifera]
Length=1738

 Score =  1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1114 (57%), Positives = 826/1114 (74%), Gaps = 38/1114 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaav------avdeaappapLESDTSAVLVQEKSLIRHDQ  524
             MGHKKR +APRS+PS     V A       +V+    P    SD S    QE+S I   +
Sbjct  1     MGHKKRNVAPRSRPSALATVVPADNLDGLGSVEYEKTPNLGHSDDSR---QEQSKI---E  54

Query  525   AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             A V+S+T   SSY+ +K+ECERAL +LRRGNH KALRLMK+ C +HE+S   AL++RVQG
Sbjct  55    AAVQSDT---SSYSAVKIECERALIALRRGNHTKALRLMKESCFRHESS---ALLHRVQG  108

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K RHL+NAI+SAR++V +SPNSIEFAHFYANLLYEAAND K YEE
Sbjct  109   TVCVKVASLIDDPNAKQRHLRNAIESARRAVALSPNSIEFAHFYANLLYEAANDSKGYEE  168

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERA  I+NP+DPA ESLQ ENQQK+STPEARI+H+Q ELR+LIQ++N+ASISTW+
Sbjct  169   VVQECERAFLIQNPVDPAIESLQDENQQKLSTPEARISHMQQELRSLIQKANIASISTWM  228

Query  1062  KNF--GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAAR  1235
             KN   G+GEE+FRLIP+RR+SEDPME+RL Q R+PNEIKKATKTPEERRKEIEVRVAAAR
Sbjct  229   KNLGGGTGEERFRLIPMRRLSEDPMEVRLAQTRRPNEIKKATKTPEERRKEIEVRVAAAR  288

Query  1236  LLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             LLQQKS S QS  D E++ + S+G+  R  ERRK  N RK  SS++R D VRSYWNSMS 
Sbjct  289   LLQQKSGSPQSPKDEEKASESSSGS-HRVGERRKYANVRKVASSVDRMDQVRSYWNSMSL  347

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D K+ LL + + DLK+HF S KDGLA EVLSEALSFAE++K WKFW CC C E+F D  S
Sbjct  348   DKKQSLLEVSVHDLKAHFSSSKDGLATEVLSEALSFAESHKTWKFWLCCRCNEKFTDCGS  407

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             ++QH++ EHM +LSPKLQSVLPQ V+ +W EML+N SWKP+D +AA  +LE QL+C+   
Sbjct  408   YMQHIVREHMGNLSPKLQSVLPQEVDTDWAEMLVNGSWKPVDASAALSMLENQLRCQSPK  467

Query  1776  FLENTYTRSDMDESKDD-ISDPYCNVYGWDRS-------PIKKTF--GDGCNGTTVDSRE  1925
                 +  R+  D++K++ + D +C+    D S       P+ + F  GD  N   +++  
Sbjct  468   LFNESDIRNHRDKNKEEFLVDDWCSKDPSDSSPDEGKVQPLDEEFKAGDIGNENALENTS  527

Query  1926  YDKNSEVW-MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHL  2102
             +D  S+    +  GN  ++ C  ++ WP++DD ERAKLLERI  + Q L+++K L  SHL
Sbjct  528   HDYISDFQSREYSGNRLSRGCYRAQIWPLSDDSERAKLLERIRGMLQLLLRHKCLAVSHL  587

Query  2103  SKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYP  2282
             +KVI + + ELQSL  GSQLLN+ +DQTPLCICFLGA +L+KI+KFLQE+SHSCGLGRY 
Sbjct  588   NKVIQYTMNELQSLASGSQLLNHGLDQTPLCICFLGASQLRKIIKFLQEISHSCGLGRYS  647

Query  2283  ERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsa  2462
             E+ST+ +D  T   G    E+IVF+ D SCLL DE      LTP+T+      D +  ++
Sbjct  648   EKSTSTNDAHTVSPGFKIKERIVFTNDSSCLLLDERLLRGTLTPLTYDSAHADDGSATNS  707

Query  2463  aissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYE  2642
              +  +   +NG L ++D LLSW+F G SSGEQL+SW+  REEK ++ ME++++LEKEFY 
Sbjct  708   VLVDH---ENGVLPENDALLSWMFTGPSSGEQLSSWTHLREEKTRKGMEVLQMLEKEFYL  764

Query  2643  LQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHE  2822
             LQ LC+RKCEHL+YEEALQ VE LCL E K+REH  + V +SY+  L+KR++EL+E  ++
Sbjct  765   LQSLCDRKCEHLSYEEALQAVESLCLNELKRREHVTELVTQSYETVLRKRQEELVEMDND  824

Query  2823  ATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQ  3002
                 + RFE++AIS++LK+A+SLN NQFG+++   G++S LCDL+ GEDD WR++DYL+Q
Sbjct  825   VMFISSRFELDAISNILKEAKSLNANQFGYDEPMNGMTSRLCDLDYGEDDVWRMQDYLHQ  884

Query  3003  ADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSY  3182
             AD+C+EV IQ+QK+ +SVELSK DARIMR VSGMQQLE+KL  + AHDYR I++PL+KS+
Sbjct  885   ADTCIEVTIQKQKDQLSVELSKTDARIMRNVSGMQQLELKLGPLLAHDYRAIMLPLLKSF  944

Query  3183  LRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyr  3362
             +RA+LE+L ++DA EKSDAAREAFLAELA D+K S++ G ++ K   EK++D+KK KDYR
Sbjct  945   MRAYLENLVDKDAMEKSDAAREAFLAELALDAKNSASRGGDHLKQIQEKSKDRKKNKDYR  1004

Query  3363  ktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDA-ELSNGGSNSITQeeeeqrrrie  3539
             K KDLK + G     L  ++ E+   SV+ D    D+  + +   + + Q+EE+ R +IE
Sbjct  1005  KAKDLKAA-GVSEQILCQESEEQTYSSVLLDKNHLDSVAVGSISCDVLQQQEEDFRHKIE  1063

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHKKG  3641
             LEAEERKLEETLEYQRRIENEAK KHLAEQH++ 
Sbjct  1064  LEAEERKLEETLEYQRRIENEAKQKHLAEQHREA  1097


 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/402 (76%), Positives = 346/402 (86%), Gaps = 3/402 (1%)
 Frame = +1

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQIS--EMANLGVSC  4200
             KTLRQLHV++D EERFQADL KAVRQSLDTF AH+  P +PR    Q +  E  + G S 
Sbjct  1330  KTLRQLHVDEDAEERFQADLQKAVRQSLDTFQAHKGSPPVPRQRVPQRTSPEAGDYGASP  1389

Query  4201  EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDP  4377
             + V    +NGI+V+GTGLKNEVGEYNCFLNVIIQSLWHLRRFR EFL RS S H+HVGDP
Sbjct  1390  DAVMVENINGIDVFGTGLKNEVGEYNCFLNVIIQSLWHLRRFRYEFLKRSESVHVHVGDP  1449

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             CVVCALYDIFTALS+ S++TR++ VAP  LRIALSNLYPD   FQEGQMNDASEVL VIF
Sbjct  1450  CVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQEGQMNDASEVLAVIF  1509

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
             +CLHQSFTS SG  D ES +S+C+GSWDC N+ACIVH+LFGMD+FERMNCY CG+ESR L
Sbjct  1510  DCLHQSFTSGSGVHDAESEESNCLGSWDCVNNACIVHTLFGMDIFERMNCYSCGVESRQL  1569

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINASALRTMK++C DSSFDELL  VEMNHQLACDP+A GCGK N+IHH LS+
Sbjct  1570  KYTSFFHNINASALRTMKILCADSSFDELLKFVEMNHQLACDPEAGGCGKLNYIHHILSS  1629

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHY  5097
             PPHVFTTVLGWQNTCE+ +DI+ATL AL+TE+DI +LYRGLDP ++H LVSVVCYYGQHY
Sbjct  1630  PPHVFTTVLGWQNTCENADDISATLAALTTELDIGILYRGLDPGNRHSLVSVVCYYGQHY  1689

Query  5098  HCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HCFAYSH+ ERW+MYDDKTVKVIG+W DVLTMCERGHLQPQV
Sbjct  1690  HCFAYSHELERWVMYDDKTVKVIGSWHDVLTMCERGHLQPQV  1731



>ref|XP_010256018.1| PREDICTED: uncharacterized protein LOC104596511 isoform X2 [Nelumbo 
nucifera]
Length=1739

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1114 (57%), Positives = 827/1114 (74%), Gaps = 38/1114 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaav------avdeaappapLESDTSAVLVQEKSLIRHDQ  524
             MGHKKR +APRS+PS     V A       +V+    P    SD S    QE+S I   +
Sbjct  1     MGHKKRNVAPRSRPSALATVVPADNLDGLGSVEYEKTPNLGHSDDSR---QEQSKI---E  54

Query  525   AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             A V+S+T   SSY+ +K+ECERAL +LRRGNH KALRLMK+ C +HE+S   AL++RVQG
Sbjct  55    AAVQSDT---SSYSAVKIECERALIALRRGNHTKALRLMKESCFRHESS---ALLHRVQG  108

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K RHL+NAI+SAR++V +SPNSIEFAHFYANLLYEAAND K YEE
Sbjct  109   TVCVKVASLIDDPNAKQRHLRNAIESARRAVALSPNSIEFAHFYANLLYEAANDSKGYEE  168

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERA  I+NP+DPA ESLQ ENQQK+STPEARI+H+Q ELR+LIQ++N+ASISTW+
Sbjct  169   VVQECERAFLIQNPVDPAIESLQDENQQKLSTPEARISHMQQELRSLIQKANIASISTWM  228

Query  1062  KNF--GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAAR  1235
             KN   G+GEE+FRLIP+RR+SEDPME+RL Q R+PNEIKKATKTPEERRKEIEVRVAAAR
Sbjct  229   KNLGGGTGEERFRLIPMRRLSEDPMEVRLAQTRRPNEIKKATKTPEERRKEIEVRVAAAR  288

Query  1236  LLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             LLQQKS S QS  D E++ + S+G+ + G ERRK  N RK  SS++R D VRSYWNSMS 
Sbjct  289   LLQQKSGSPQSPKDEEKASESSSGSHRVG-ERRKYANVRKVASSVDRMDQVRSYWNSMSL  347

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D K+ LL + + DLK+HF S KDGLA EVLSEALSFAE++K WKFW CC C E+F D  S
Sbjct  348   DKKQSLLEVSVHDLKAHFSSSKDGLATEVLSEALSFAESHKTWKFWLCCRCNEKFTDCGS  407

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             ++QH++ EHM +LSPKLQSVLPQ V+ +W EML+N SWKP+D +AA  +LE QL+C+   
Sbjct  408   YMQHIVREHMGNLSPKLQSVLPQEVDTDWAEMLVNGSWKPVDASAALSMLENQLRCQSPK  467

Query  1776  FLENTYTRSDMDESKDD-ISDPYCNVYGWDRS-------PIKKTF--GDGCNGTTVDSRE  1925
                 +  R+  D++K++ + D +C+    D S       P+ + F  GD  N   +++  
Sbjct  468   LFNESDIRNHRDKNKEEFLVDDWCSKDPSDSSPDEGKVQPLDEEFKAGDIGNENALENTS  527

Query  1926  YDKNSEVW-MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHL  2102
             +D  S+    +  GN  ++ C  ++ WP++DD ERAKLLERI  + Q L+++K L  SHL
Sbjct  528   HDYISDFQSREYSGNRLSRGCYRAQIWPLSDDSERAKLLERIRGMLQLLLRHKCLAVSHL  587

Query  2103  SKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYP  2282
             +KVI + + ELQSL  GSQLLN+ +DQTPLCICFLGA +L+KI+KFLQE+SHSCGLGRY 
Sbjct  588   NKVIQYTMNELQSLASGSQLLNHGLDQTPLCICFLGASQLRKIIKFLQEISHSCGLGRYS  647

Query  2283  ERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsa  2462
             E+ST+ +D  T   G    E+IVF+ D SCLL DE      LTP+T+      D +  ++
Sbjct  648   EKSTSTNDAHTVSPGFKIKERIVFTNDSSCLLLDERLLRGTLTPLTYDSAHADDGSATNS  707

Query  2463  aissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYE  2642
              +  +   +NG L ++D LLSW+F G SSGEQL+SW+  REEK ++ ME++++LEKEFY 
Sbjct  708   VLVDH---ENGVLPENDALLSWMFTGPSSGEQLSSWTHLREEKTRKGMEVLQMLEKEFYL  764

Query  2643  LQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHE  2822
             LQ LC+RKCEHL+YEEALQ VE LCL E K+REH  + V +SY+  L+KR++EL+E  ++
Sbjct  765   LQSLCDRKCEHLSYEEALQAVESLCLNELKRREHVTELVTQSYETVLRKRQEELVEMDND  824

Query  2823  ATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQ  3002
                 + RFE++AIS++LK+A+SLN NQFG+++   G++S LCDL+ GEDD WR++DYL+Q
Sbjct  825   VMFISSRFELDAISNILKEAKSLNANQFGYDEPMNGMTSRLCDLDYGEDDVWRMQDYLHQ  884

Query  3003  ADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSY  3182
             AD+C+EV IQ+QK+ +SVELSK DARIMR VSGMQQLE+KL  + AHDYR I++PL+KS+
Sbjct  885   ADTCIEVTIQKQKDQLSVELSKTDARIMRNVSGMQQLELKLGPLLAHDYRAIMLPLLKSF  944

Query  3183  LRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyr  3362
             +RA+LE+L ++DA EKSDAAREAFLAELA D+K S++ G ++ K   EK++D+KK KDYR
Sbjct  945   MRAYLENLVDKDAMEKSDAAREAFLAELALDAKNSASRGGDHLKQIQEKSKDRKKNKDYR  1004

Query  3363  ktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDA-ELSNGGSNSITQeeeeqrrrie  3539
             K KDLK + G     L  ++ E+   SV+ D    D+  + +   + + Q+EE+ R +IE
Sbjct  1005  KAKDLKAA-GVSEQILCQESEEQTYSSVLLDKNHLDSVAVGSISCDVLQQQEEDFRHKIE  1063

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHKKG  3641
             LEAEERKLEETLEYQRRIENEAK KHLAEQH++ 
Sbjct  1064  LEAEERKLEETLEYQRRIENEAKQKHLAEQHREA  1097


 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/407 (74%), Positives = 344/407 (85%), Gaps = 7/407 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQIS--EMAN  4185
             G+   KTLRQLHV++D EERFQADL KAVRQSLDTF AH+  P +PR    Q +  E  +
Sbjct  1330  GDITTKTLRQLHVDEDAEERFQADLQKAVRQSLDTFQAHKGSPPVPRQRVPQRTSPEAGD  1389

Query  4186  LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHI  4362
              G S + V    +NGI+V+GTGLKNEVGEYNCFLN    SLWHLRRFR EFL RS S H+
Sbjct  1390  YGASPDAVMVENINGIDVFGTGLKNEVGEYNCFLN----SLWHLRRFRYEFLKRSESVHV  1445

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVCALYDIFTALS+ S++TR++ VAP  LRIALSNLYPD   FQEGQMNDASEV
Sbjct  1446  HVGDPCVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQEGQMNDASEV  1505

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLHQSFTS SG  D ES +S+C+GSWDC N+ACIVH+LFGMD+FERMNCY CG+
Sbjct  1506  LAVIFDCLHQSFTSGSGVHDAESEESNCLGSWDCVNNACIVHTLFGMDIFERMNCYSCGV  1565

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESR LKYTSFFHNINASALRTMK++C DSSFDELL  VEMNHQLACDP+A GCGK N+IH
Sbjct  1566  ESRQLKYTSFFHNINASALRTMKILCADSSFDELLKFVEMNHQLACDPEAGGCGKLNYIH  1625

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H LS+PPHVFTTVLGWQNTCE+ +DI+ATL AL+TE+DI +LYRGLDP ++H LVSVVCY
Sbjct  1626  HILSSPPHVFTTVLGWQNTCENADDISATLAALTTELDIGILYRGLDPGNRHSLVSVVCY  1685

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFAYSH+ ERW+MYDDKTVKVIG+W DVLTMCERGHLQPQV
Sbjct  1686  YGQHYHCFAYSHELERWVMYDDKTVKVIGSWHDVLTMCERGHLQPQV  1732



>ref|XP_010256010.1| PREDICTED: uncharacterized protein LOC104596511 isoform X1 [Nelumbo 
nucifera]
Length=1743

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1114 (57%), Positives = 827/1114 (74%), Gaps = 38/1114 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaav------avdeaappapLESDTSAVLVQEKSLIRHDQ  524
             MGHKKR +APRS+PS     V A       +V+    P    SD S    QE+S I   +
Sbjct  1     MGHKKRNVAPRSRPSALATVVPADNLDGLGSVEYEKTPNLGHSDDSR---QEQSKI---E  54

Query  525   AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             A V+S+T   SSY+ +K+ECERAL +LRRGNH KALRLMK+ C +HE+S   AL++RVQG
Sbjct  55    AAVQSDT---SSYSAVKIECERALIALRRGNHTKALRLMKESCFRHESS---ALLHRVQG  108

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKVAS+IDDPN K RHL+NAI+SAR++V +SPNSIEFAHFYANLLYEAAND K YEE
Sbjct  109   TVCVKVASLIDDPNAKQRHLRNAIESARRAVALSPNSIEFAHFYANLLYEAANDSKGYEE  168

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VVQECERA  I+NP+DPA ESLQ ENQQK+STPEARI+H+Q ELR+LIQ++N+ASISTW+
Sbjct  169   VVQECERAFLIQNPVDPAIESLQDENQQKLSTPEARISHMQQELRSLIQKANIASISTWM  228

Query  1062  KNF--GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAAR  1235
             KN   G+GEE+FRLIP+RR+SEDPME+RL Q R+PNEIKKATKTPEERRKEIEVRVAAAR
Sbjct  229   KNLGGGTGEERFRLIPMRRLSEDPMEVRLAQTRRPNEIKKATKTPEERRKEIEVRVAAAR  288

Query  1236  LLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMST  1415
             LLQQKS S QS  D E++ + S+G+ + G ERRK  N RK  SS++R D VRSYWNSMS 
Sbjct  289   LLQQKSGSPQSPKDEEKASESSSGSHRVG-ERRKYANVRKVASSVDRMDQVRSYWNSMSL  347

Query  1416  DMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSES  1595
             D K+ LL + + DLK+HF S KDGLA EVLSEALSFAE++K WKFW CC C E+F D  S
Sbjct  348   DKKQSLLEVSVHDLKAHFSSSKDGLATEVLSEALSFAESHKTWKFWLCCRCNEKFTDCGS  407

Query  1596  HIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHG  1775
             ++QH++ EHM +LSPKLQSVLPQ V+ +W EML+N SWKP+D +AA  +LE QL+C+   
Sbjct  408   YMQHIVREHMGNLSPKLQSVLPQEVDTDWAEMLVNGSWKPVDASAALSMLENQLRCQSPK  467

Query  1776  FLENTYTRSDMDESKDD-ISDPYCNVYGWDRS-------PIKKTF--GDGCNGTTVDSRE  1925
                 +  R+  D++K++ + D +C+    D S       P+ + F  GD  N   +++  
Sbjct  468   LFNESDIRNHRDKNKEEFLVDDWCSKDPSDSSPDEGKVQPLDEEFKAGDIGNENALENTS  527

Query  1926  YDKNSEVW-MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHL  2102
             +D  S+    +  GN  ++ C  ++ WP++DD ERAKLLERI  + Q L+++K L  SHL
Sbjct  528   HDYISDFQSREYSGNRLSRGCYRAQIWPLSDDSERAKLLERIRGMLQLLLRHKCLAVSHL  587

Query  2103  SKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYP  2282
             +KVI + + ELQSL  GSQLLN+ +DQTPLCICFLGA +L+KI+KFLQE+SHSCGLGRY 
Sbjct  588   NKVIQYTMNELQSLASGSQLLNHGLDQTPLCICFLGASQLRKIIKFLQEISHSCGLGRYS  647

Query  2283  ERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsa  2462
             E+ST+ +D  T   G    E+IVF+ D SCLL DE      LTP+T+      D +  ++
Sbjct  648   EKSTSTNDAHTVSPGFKIKERIVFTNDSSCLLLDERLLRGTLTPLTYDSAHADDGSATNS  707

Query  2463  aissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYE  2642
              +  +   +NG L ++D LLSW+F G SSGEQL+SW+  REEK ++ ME++++LEKEFY 
Sbjct  708   VLVDH---ENGVLPENDALLSWMFTGPSSGEQLSSWTHLREEKTRKGMEVLQMLEKEFYL  764

Query  2643  LQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHE  2822
             LQ LC+RKCEHL+YEEALQ VE LCL E K+REH  + V +SY+  L+KR++EL+E  ++
Sbjct  765   LQSLCDRKCEHLSYEEALQAVESLCLNELKRREHVTELVTQSYETVLRKRQEELVEMDND  824

Query  2823  ATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQ  3002
                 + RFE++AIS++LK+A+SLN NQFG+++   G++S LCDL+ GEDD WR++DYL+Q
Sbjct  825   VMFISSRFELDAISNILKEAKSLNANQFGYDEPMNGMTSRLCDLDYGEDDVWRMQDYLHQ  884

Query  3003  ADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSY  3182
             AD+C+EV IQ+QK+ +SVELSK DARIMR VSGMQQLE+KL  + AHDYR I++PL+KS+
Sbjct  885   ADTCIEVTIQKQKDQLSVELSKTDARIMRNVSGMQQLELKLGPLLAHDYRAIMLPLLKSF  944

Query  3183  LRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyr  3362
             +RA+LE+L ++DA EKSDAAREAFLAELA D+K S++ G ++ K   EK++D+KK KDYR
Sbjct  945   MRAYLENLVDKDAMEKSDAAREAFLAELALDAKNSASRGGDHLKQIQEKSKDRKKNKDYR  1004

Query  3363  ktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDA-ELSNGGSNSITQeeeeqrrrie  3539
             K KDLK + G     L  ++ E+   SV+ D    D+  + +   + + Q+EE+ R +IE
Sbjct  1005  KAKDLKAA-GVSEQILCQESEEQTYSSVLLDKNHLDSVAVGSISCDVLQQQEEDFRHKIE  1063

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHKKG  3641
             LEAEERKLEETLEYQRRIENEAK KHLAEQH++ 
Sbjct  1064  LEAEERKLEETLEYQRRIENEAKQKHLAEQHREA  1097


 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/407 (75%), Positives = 348/407 (86%), Gaps = 3/407 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQIS--EMAN  4185
             G+   KTLRQLHV++D EERFQADL KAVRQSLDTF AH+  P +PR    Q +  E  +
Sbjct  1330  GDITTKTLRQLHVDEDAEERFQADLQKAVRQSLDTFQAHKGSPPVPRQRVPQRTSPEAGD  1389

Query  4186  LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHI  4362
              G S + V    +NGI+V+GTGLKNEVGEYNCFLNVIIQSLWHLRRFR EFL RS S H+
Sbjct  1390  YGASPDAVMVENINGIDVFGTGLKNEVGEYNCFLNVIIQSLWHLRRFRYEFLKRSESVHV  1449

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVCALYDIFTALS+ S++TR++ VAP  LRIALSNLYPD   FQEGQMNDASEV
Sbjct  1450  HVGDPCVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQEGQMNDASEV  1509

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLHQSFTS SG  D ES +S+C+GSWDC N+ACIVH+LFGMD+FERMNCY CG+
Sbjct  1510  LAVIFDCLHQSFTSGSGVHDAESEESNCLGSWDCVNNACIVHTLFGMDIFERMNCYSCGV  1569

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESR LKYTSFFHNINASALRTMK++C DSSFDELL  VEMNHQLACDP+A GCGK N+IH
Sbjct  1570  ESRQLKYTSFFHNINASALRTMKILCADSSFDELLKFVEMNHQLACDPEAGGCGKLNYIH  1629

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H LS+PPHVFTTVLGWQNTCE+ +DI+ATL AL+TE+DI +LYRGLDP ++H LVSVVCY
Sbjct  1630  HILSSPPHVFTTVLGWQNTCENADDISATLAALTTELDIGILYRGLDPGNRHSLVSVVCY  1689

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFAYSH+ ERW+MYDDKTVKVIG+W DVLTMCERGHLQPQV
Sbjct  1690  YGQHYHCFAYSHELERWVMYDDKTVKVIGSWHDVLTMCERGHLQPQV  1736



>ref|XP_011042623.1| PREDICTED: uncharacterized protein LOC105138272 isoform X2 [Populus 
euphratica]
Length=1542

 Score =  1090 bits (2819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1099 (57%), Positives = 805/1099 (73%), Gaps = 46/1099 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG++KRP+  R+KP                      S     +  +++ +     +V +E
Sbjct  1     MGNRKRPLTSRTKPPPP------------------PSAAVPTVASDETYLYPSPNLVSTE  42

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
             ++ SS+   IK EC+RAL +LRRGNH KALR+MKD CAKH      ALI+RV  TVCVKV
Sbjct  43    SDGSSA---IKHECDRALNALRRGNHTKALRIMKDSCAKHGGD---ALIHRVHSTVCVKV  96

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K R+LKNAI++AR++  +SPNSIEFAHFYANLLYEAANDGKEYEEV++EC+
Sbjct  97    ASIIDDPNSKQRYLKNAIEAARRAAELSPNSIEFAHFYANLLYEAANDGKEYEEVMKECD  156

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RAL IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL Q+SN+ASISTW+KN G+G
Sbjct  157   RALKIENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQQKSNIASISTWMKNLGTG  216

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE  RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EE+RKEIEVRVAAARLLQ KSE 
Sbjct  217   EE-IRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEEKRKEIEVRVAAARLLQ-KSEI  274

Query  1260  AQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
                  +GE S   ++++  + +RG  R+   NARKN ++ ER+D V+SYWNSMS +MK+ 
Sbjct  275   GLGKREGEMSDKGVEVTPWSDRRGERRKNGSNARKNGTNTERKDRVQSYWNSMSLEMKRD  334

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL+I++ DLKS++ S K+GLAN+VL+EAL+ +E NK+W+FW CC C E+FADS+SH+ HV
Sbjct  335   LLKIKVSDLKSYYVSSKNGLANDVLNEALACSEENKSWRFWLCCRCNEKFADSDSHLHHV  394

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SL PK+Q VLPQ+ +NEW+EM+ +CSWKPLDI+ A K+L  + KC+    +E+ 
Sbjct  395   VQEHMRSLMPKMQEVLPQSPDNEWIEMINSCSWKPLDISTAVKMLWNRGKCQNGELVEDI  454

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGN  1967
              + +  ++      D       WD SP K+   DGC    V S +  K   +   + DGN
Sbjct  455   CSENHNEDGDGCFED------AWDSSPEKENLRDGCISCPVSSSDSGKVYSIKGKEFDGN  508

Query  1968  EGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLG  2147
             + +  C   ESWPI++D ERAKLLE+I+ VFQ LI++KYL +SHL KVI F V+ELQSL 
Sbjct  509   QLSIACT-IESWPISEDSERAKLLEKIHDVFQALIRHKYLAASHLKKVIQFTVDELQSLA  567

Query  2148  YGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQG  2327
              GSQLLN+ + QTP+CICFLGA +LKKILKFLQELSHSCGLG  PE+S+ +DD++TG +G
Sbjct  568   TGSQLLNHGVGQTPMCICFLGAFQLKKILKFLQELSHSCGLGMSPEKSSVVDDMNTGAKG  627

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
              +  E IV ++D SCL  D+   P +  P T  D  VT +              +G L  
Sbjct  628   PEIKENIVLNDDASCLYLDKCLLPLEYAPRTCPDDDVTTATSTIVGN------GDGVLPA  681

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
              D LLSWIF G SSGEQL SW R++EE+  Q MEI++ LEKEFY LQ L ERKCEHL+YE
Sbjct  682   VDTLLSWIFAGLSSGEQLQSWIRTKEERMNQGMEILQTLEKEFYHLQSLYERKCEHLSYE  741

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
             +ALQ VEDLCLEEGKKRE    F  RSYD  L++RR++L+E+ H+A   + RFE++AIS+
Sbjct  742   QALQAVEDLCLEEGKKRETDTLFELRSYDSVLRQRREKLVENEHDAMFFSSRFELDAISN  801

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VLK+A++LNVNQ+GFEDTYGGI+S  CDL+SGED +WR KD ++  ++ +E+AIQRQKE 
Sbjct  802   VLKEADTLNVNQYGFEDTYGGITSQFCDLKSGEDGNWRTKDQMHHVETFIEIAIQRQKEQ  861

Query  3048  VSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATE  3227
             +S+ELSKIDA+I+R+V+GMQQLE+KLESVSA DYR IL PLVKSY+RAHLEDLAE+DATE
Sbjct  862   LSIELSKIDAQILRIVAGMQQLELKLESVSALDYRSILPPLVKSYMRAHLEDLAEKDATE  921

Query  3228  KSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHA  3407
             KS+AA EAFLAELA DSKK +   S+ ++++ EK +D++K K+Y+KTK+LK +  +  H 
Sbjct  922   KSNAAGEAFLAELALDSKKGTQGRSDISRNTLEKGKDRRKNKEYKKTKELKVAAASEQHL  981

Query  3408  LHHDTAEEASFSVVHDGGSEDAELS-NGGSNSITQeeeeqrrrieleaeerkleetleYQ  3584
             L   T E  SF V  DG   D++   +   + + Q+EEE R +IE+E EER LEE+LEYQ
Sbjct  982   LQDVTNERGSFPVASDGDYPDSQCHLSRNDDDLRQQEEEFRWKIEIEEEERMLEESLEYQ  1041

Query  3585  RRIENEAKLKHLAE-QHKK  3638
             RRIENEAKLKHLAE Q+KK
Sbjct  1042  RRIENEAKLKHLAEKQYKK  1060


 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/496 (64%), Positives = 368/496 (74%), Gaps = 53/496 (11%)
 Frame = +1

Query  3748  LLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNE  3921
             L Q +G P  L G P  +          S GG +E G   SDR + R+SRRQK SAKY+ 
Sbjct  1089  LTQKSGFPNNLVGMPMTTASEQ------STGGNVEGGP--SDRWSDRKSRRQKSSAKYDG  1140

Query  3922  EKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVR  4101
              K  P++   ENIEVG + P        + G+S  KTLRQL VE+DDEERFQADL +AVR
Sbjct  1141  -KNQPMSCEMENIEVGSITP--------NLGDSATKTLRQLQVEEDDEERFQADLERAVR  1191

Query  4102  QSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNC  4281
             QSL                                VAT  V+G +V+GTGLKN++GEYNC
Sbjct  1192  QSL--------------------------------VATENVDGTDVFGTGLKNDIGEYNC  1219

Query  4282  FLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAP  4458
             FLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVVCALYDI TA+S+AS++TRR+AVAP
Sbjct  1220  FLNVIIQSLWHLRRFRDEFLSRSKSEHVHVGDPCVVCALYDILTAISMASTDTRREAVAP  1279

Query  4459  NSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSW  4638
              SLRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FT+    SD+ESV+ S M SW
Sbjct  1280  TSLRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTTGLHGSDSESVECSGMESW  1339

Query  4639  DCA-NSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSF  4815
             +C   +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY +FFHNINA+ALR MKVMC +S F
Sbjct  1340  ECTKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYNAFFHNINATALRAMKVMCVESCF  1399

Query  4816  DELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLV  4995
             DELLNLVEMNH L CDP+A GCGK N+I+H  +TPPHVFTTVLGW+ TCES++DI ATL 
Sbjct  1400  DELLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCESIDDIKATLA  1459

Query  4996  ALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNW  5175
             ALSTEIDISV Y GLD ++   LVSVVCYYGQHYHCFAYSHDH +WIMYDDKTVKVIG+W
Sbjct  1460  ALSTEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDDKTVKVIGSW  1519

Query  5176  ADVLTMCERGHLQPQV  5223
              DVL MCE+GHLQPQV
Sbjct  1520  TDVLIMCEKGHLQPQV  1535



>ref|XP_011042624.1| PREDICTED: uncharacterized protein LOC105138272 isoform X3 [Populus 
euphratica]
 ref|XP_011042625.1| PREDICTED: uncharacterized protein LOC105138272 isoform X4 [Populus 
euphratica]
Length=1513

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1099 (57%), Positives = 805/1099 (73%), Gaps = 46/1099 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG++KRP+  R+KP                      S     +  +++ +     +V +E
Sbjct  1     MGNRKRPLTSRTKPPPP------------------PSAAVPTVASDETYLYPSPNLVSTE  42

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
             ++ SS+   IK EC+RAL +LRRGNH KALR+MKD CAKH      ALI+RV  TVCVKV
Sbjct  43    SDGSSA---IKHECDRALNALRRGNHTKALRIMKDSCAKHGGD---ALIHRVHSTVCVKV  96

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K R+LKNAI++AR++  +SPNSIEFAHFYANLLYEAANDGKEYEEV++EC+
Sbjct  97    ASIIDDPNSKQRYLKNAIEAARRAAELSPNSIEFAHFYANLLYEAANDGKEYEEVMKECD  156

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RAL IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL Q+SN+ASISTW+KN G+G
Sbjct  157   RALKIENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQQKSNIASISTWMKNLGTG  216

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE  RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EE+RKEIEVRVAAARLLQ KSE 
Sbjct  217   EE-IRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEEKRKEIEVRVAAARLLQ-KSEI  274

Query  1260  AQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
                  +GE S   ++++  + +RG  R+   NARKN ++ ER+D V+SYWNSMS +MK+ 
Sbjct  275   GLGKREGEMSDKGVEVTPWSDRRGERRKNGSNARKNGTNTERKDRVQSYWNSMSLEMKRD  334

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL+I++ DLKS++ S K+GLAN+VL+EAL+ +E NK+W+FW CC C E+FADS+SH+ HV
Sbjct  335   LLKIKVSDLKSYYVSSKNGLANDVLNEALACSEENKSWRFWLCCRCNEKFADSDSHLHHV  394

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SL PK+Q VLPQ+ +NEW+EM+ +CSWKPLDI+ A K+L  + KC+    +E+ 
Sbjct  395   VQEHMRSLMPKMQEVLPQSPDNEWIEMINSCSWKPLDISTAVKMLWNRGKCQNGELVEDI  454

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGN  1967
              + +  ++      D       WD SP K+   DGC    V S +  K   +   + DGN
Sbjct  455   CSENHNEDGDGCFED------AWDSSPEKENLRDGCISCPVSSSDSGKVYSIKGKEFDGN  508

Query  1968  EGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLG  2147
             + +  C   ESWPI++D ERAKLLE+I+ VFQ LI++KYL +SHL KVI F V+ELQSL 
Sbjct  509   QLSIACT-IESWPISEDSERAKLLEKIHDVFQALIRHKYLAASHLKKVIQFTVDELQSLA  567

Query  2148  YGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQG  2327
              GSQLLN+ + QTP+CICFLGA +LKKILKFLQELSHSCGLG  PE+S+ +DD++TG +G
Sbjct  568   TGSQLLNHGVGQTPMCICFLGAFQLKKILKFLQELSHSCGLGMSPEKSSVVDDMNTGAKG  627

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
              +  E IV ++D SCL  D+   P +  P T  D  VT +              +G L  
Sbjct  628   PEIKENIVLNDDASCLYLDKCLLPLEYAPRTCPDDDVTTATSTIVGN------GDGVLPA  681

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
              D LLSWIF G SSGEQL SW R++EE+  Q MEI++ LEKEFY LQ L ERKCEHL+YE
Sbjct  682   VDTLLSWIFAGLSSGEQLQSWIRTKEERMNQGMEILQTLEKEFYHLQSLYERKCEHLSYE  741

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
             +ALQ VEDLCLEEGKKRE    F  RSYD  L++RR++L+E+ H+A   + RFE++AIS+
Sbjct  742   QALQAVEDLCLEEGKKRETDTLFELRSYDSVLRQRREKLVENEHDAMFFSSRFELDAISN  801

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VLK+A++LNVNQ+GFEDTYGGI+S  CDL+SGED +WR KD ++  ++ +E+AIQRQKE 
Sbjct  802   VLKEADTLNVNQYGFEDTYGGITSQFCDLKSGEDGNWRTKDQMHHVETFIEIAIQRQKEQ  861

Query  3048  VSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATE  3227
             +S+ELSKIDA+I+R+V+GMQQLE+KLESVSA DYR IL PLVKSY+RAHLEDLAE+DATE
Sbjct  862   LSIELSKIDAQILRIVAGMQQLELKLESVSALDYRSILPPLVKSYMRAHLEDLAEKDATE  921

Query  3228  KSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHA  3407
             KS+AA EAFLAELA DSKK +   S+ ++++ EK +D++K K+Y+KTK+LK +  +  H 
Sbjct  922   KSNAAGEAFLAELALDSKKGTQGRSDISRNTLEKGKDRRKNKEYKKTKELKVAAASEQHL  981

Query  3408  LHHDTAEEASFSVVHDGGSEDAELS-NGGSNSITQeeeeqrrrieleaeerkleetleYQ  3584
             L   T E  SF V  DG   D++   +   + + Q+EEE R +IE+E EER LEE+LEYQ
Sbjct  982   LQDVTNERGSFPVASDGDYPDSQCHLSRNDDDLRQQEEEFRWKIEIEEEERMLEESLEYQ  1041

Query  3585  RRIENEAKLKHLAE-QHKK  3638
             RRIENEAKLKHLAE Q+KK
Sbjct  1042  RRIENEAKLKHLAEKQYKK  1060


 Score =   595 bits (1535),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 290/434 (67%), Positives = 335/434 (77%), Gaps = 36/434 (8%)
 Frame = +1

Query  3934  PVTSGAENIEVGEVR--PVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQS  4107
             P+T+ +E    G V   P D      + G+S  KTLRQL VE+DDEERFQADL +AVRQS
Sbjct  1105  PMTTASEQSTGGNVEGGPSDRWSVTPNLGDSATKTLRQLQVEEDDEERFQADLERAVRQS  1164

Query  4108  LDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFL  4287
             L                                VAT  V+G +V+GTGLKN++GEYNCFL
Sbjct  1165  L--------------------------------VATENVDGTDVFGTGLKNDIGEYNCFL  1192

Query  4288  NVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNS  4464
             NVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVVCALYDI TA+S+AS++TRR+AVAP S
Sbjct  1193  NVIIQSLWHLRRFRDEFLSRSKSEHVHVGDPCVVCALYDILTAISMASTDTRREAVAPTS  1252

Query  4465  LRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDC  4644
             LRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FT+    SD+ESV+ S M SW+C
Sbjct  1253  LRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTTGLHGSDSESVECSGMESWEC  1312

Query  4645  A-NSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDE  4821
                +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY +FFHNINA+ALR MKVMC +S FDE
Sbjct  1313  TKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYNAFFHNINATALRAMKVMCVESCFDE  1372

Query  4822  LLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVAL  5001
             LLNLVEMNH L CDP+A GCGK N+I+H  +TPPHVFTTVLGW+ TCES++DI ATL AL
Sbjct  1373  LLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCESIDDIKATLAAL  1432

Query  5002  STEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWAD  5181
             STEIDISV Y GLD ++   LVSVVCYYGQHYHCFAYSHDH +WIMYDDKTVKVIG+W D
Sbjct  1433  STEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDDKTVKVIGSWTD  1492

Query  5182  VLTMCERGHLQPQV  5223
             VL MCE+GHLQPQV
Sbjct  1493  VLIMCEKGHLQPQV  1506



>ref|XP_010028652.1| PREDICTED: uncharacterized protein LOC104418879 [Eucalyptus grandis]
 gb|KCW83491.1| hypothetical protein EUGRSUZ_B00398 [Eucalyptus grandis]
Length=1614

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/1032 (58%), Positives = 771/1032 (75%), Gaps = 27/1032 (3%)
 Frame = +3

Query  555   SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASII  734
             S YA IKLECERAL +LRRGNH KALRLMK+ C +HE+SP+ A ++R QGTVCVKVA+II
Sbjct  70    SDYAAIKLECERALNALRRGNHTKALRLMKESCGQHESSPHSAFVHRFQGTVCVKVAAII  129

Query  735   DDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALA  914
             DDPN K RH++NAI+SAR++V +SP SIEFAHF+ANLL+EAAN+GK+YEEV+ EC+RALA
Sbjct  130   DDPNAKQRHMRNAIESARRAVELSPRSIEFAHFHANLLFEAANEGKDYEEVISECKRALA  189

Query  915   IENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IENP+DPAKESLQE +QQK+++ +ARI HVQGEL NL+Q+S+  ++ST +KN G GEEKF
Sbjct  190   IENPVDPAKESLQEESQQKITSAKARIEHVQGELHNLMQKSSFGTLSTLMKNIGGGEEKF  249

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             RLIPIRR++EDPME+RLVQ R+PNEIKKATKTPEERRKEIEVRVAAARLLQQKSE+    
Sbjct  250   RLIPIRRVTEDPMEVRLVQPRRPNEIKKATKTPEERRKEIEVRVAAARLLQQKSETPSVQ  309

Query  1272  NDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIV  1451
             N+G+R LD S G+GQRG ERRK G  +KN SS ER+D VRSYWN++S  MKK++LRIRI 
Sbjct  310   NEGDRGLDSSGGSGQRGVERRKHG--KKNGSSAERKDWVRSYWNTLSVPMKKEMLRIRIC  367

Query  1452  DLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCS  1631
             D+K++FGS  +  AN+VLS+A+ +A  NK WK W CC C E+F+DSESH+QHV+ EHM +
Sbjct  368   DIKAYFGSANNDSANKVLSDAVEYANTNKIWKLWVCCKCSEKFSDSESHMQHVVQEHMGN  427

Query  1632  LSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMD  1811
             L PK+QS+LPQNV++EW EM+LNCSWKPLD++AA K+L  + KC+     E+  + ++ D
Sbjct  428   LLPKMQSILPQNVDSEWAEMILNCSWKPLDLSAAMKMLGDRQKCQGIDSNEDFCSENNAD  487

Query  1812  ESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTT-VDSREYDKNSEVWMDRDGNEGTKICP  1988
             +  D   D       WD SP K  FG  CNG T  DS  +DK+    +D  G++  ++  
Sbjct  488   DCDDCFKD------AWDSSPAKSDFGYNCNGCTDKDSNNFDKD----IDHAGSDAKRVF-  536

Query  1989  PSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLN  2168
               +SWP  DDPE AKLLERI  +F+ LI+NK L +SHLSK++ F  +ELQ +  GSQLL+
Sbjct  537   -IDSWPTLDDPECAKLLERIRSLFEVLIRNKCLAASHLSKILQFTADELQGITSGSQLLH  595

Query  2169  YNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAIDDISTGIQGVDAMEK  2345
               +D  P  ICFLGA +LKKI+KFLQEL HS  L R+ E++ + +DD ++  Q V+  EK
Sbjct  596   QGVDHGPTRICFLGATQLKKIVKFLQELCHSASLSRHSEKTNSPVDDANSVSQEVEIKEK  655

Query  2346  IVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLS  2525
             IV S D SCL+ DE   P + T  + HD    D+   ++       C  G   ++D LLS
Sbjct  656   IVLSGDASCLILDESLLPTECTTDSSHDSAAHDAAGLTS-------CKVGA--NADALLS  706

Query  2526  WIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVV  2705
             W++ G SSGE L SW   +EEK  Q MEI+++LEKEFY LQ LCERKCE + +EEALQ +
Sbjct  707   WMYTGPSSGEPLASWDHRKEEKMHQGMEILQMLEKEFYLLQNLCERKCELIGFEEALQAL  766

Query  2706  EDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAE  2885
             EDLC+EE KKRE+  +FV RS +  L+KRR+EL    ++      R E + I SVL++AE
Sbjct  767   EDLCVEEAKKRENADEFVYRSLESVLRKRREELKGDENDLAFVGNRIESDVIGSVLREAE  826

Query  2886  SLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELS  3065
             +LN NQFG++D+Y G +SHLCDLESGED+DWR K+Y +Q D+C+EV IQ+QKE  S E+S
Sbjct  827   ALNANQFGYDDSYSGTASHLCDLESGEDEDWRTKEYQHQVDTCIEVTIQKQKEEFSTEIS  886

Query  3066  KIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaar  3245
             KIDARIMR V+GMQQLE+KLE++SA+DYR I++PLVKSY++ HLEDLAE+DATEKSDAAR
Sbjct  887   KIDARIMRNVAGMQQLELKLEALSAYDYRLIVLPLVKSYMKTHLEDLAEKDATEKSDAAR  946

Query  3246  eaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTA  3425
             EAFLAELA DSKK S  G   ++H+ ++T+D+K+ K++RKTK  K S  +       +T 
Sbjct  947   EAFLAELALDSKKVSKGGGLTSRHAQDRTKDRKRHKEFRKTKATKASGIDEQQIFSQETD  1006

Query  3426  EEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENE  3602
             E  S SV  +G   D++ L+    + + ++EEE RR+IELEAEERKLEETLEYQRRIENE
Sbjct  1007  EPDSPSVASEGDQPDSDILAYMNDDDLKEQEEEMRRKIELEAEERKLEETLEYQRRIENE  1066

Query  3603  AKLKHLAEQHKK  3638
             AK + LAEQ KK
Sbjct  1067  AKQRQLAEQQKK  1078


 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/483 (67%), Positives = 368/483 (76%), Gaps = 15/483 (3%)
 Frame = +1

Query  3787  KNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEV  3966
             K ST     + G  NGG  EDG L SDRR GRR RR + S K  E       SG E +E 
Sbjct  1136  KKSTDETKVQGGLPNGGLSEDGVLLSDRRTGRRGRRHRSSTKPMEGSNGSFPSGKEIVEA  1195

Query  3967  GEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPL-  4143
             G        +E  H      KTLRQL  E+DDEERFQADL KAV QSLDTF A Q  PL 
Sbjct  1196  GSAH-----VEGGHQ----TKTLRQLQAEEDDEERFQADLKKAVSQSLDTFQARQMSPLA  1246

Query  4144  --IPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHL  4317
               + RS     +   ++GV   +      +G +V+GTGL+NE+GEYNCFLNVIIQSLWHL
Sbjct  1247  STLLRSHKPSRT-ADDIGVIHGEAVIETKHGADVFGTGLQNEIGEYNCFLNVIIQSLWHL  1305

Query  4318  RRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYP  4494
             R+FRDEFL RS+ +H HVGDPCVVCALYDIFTALS A+++ R++A+AP +LRIALSNLYP
Sbjct  1306  RQFRDEFLKRSTLDHGHVGDPCVVCALYDIFTALSTATADARKEAIAPTALRIALSNLYP  1365

Query  4495  DRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSL  4674
             D   FQE QMNDASEVL VIF+CLH+SFT  S  SD ES +S+  GSWDC N  C+VHSL
Sbjct  1366  DSNFFQEAQMNDASEVLAVIFDCLHRSFTYCSSVSDDESEESNSRGSWDCCN-PCLVHSL  1424

Query  4675  FGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQL  4854
             FGMD+FERMNCY CGLESRHLKYTSFFHNINA+ALRT KV   +SSFD+LLN+VEMNHQL
Sbjct  1425  FGMDIFERMNCYNCGLESRHLKYTSFFHNINANALRTTKVTSSESSFDQLLNIVEMNHQL  1484

Query  4855  ACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYR  5034
              CDP++ GCGK N+ HHFLST PHVFTTV+GWQNTCES +DI ATL ALSTEIDISVLYR
Sbjct  1485  TCDPESGGCGKFNYKHHFLSTAPHVFTTVVGWQNTCESADDIAATLSALSTEIDISVLYR  1544

Query  5035  GLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQ  5214
             GLDPK  H LVSVVCYYGQHYHCFAYS +HE+WIMYDDKTVKVIG+WADVLTMCERGHLQ
Sbjct  1545  GLDPKHMHNLVSVVCYYGQHYHCFAYSCEHEKWIMYDDKTVKVIGSWADVLTMCERGHLQ  1604

Query  5215  PQV  5223
             PQV
Sbjct  1605  PQV  1607



>ref|XP_011042622.1| PREDICTED: uncharacterized protein LOC105138272 isoform X1 [Populus 
euphratica]
Length=1544

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1099 (57%), Positives = 805/1099 (73%), Gaps = 46/1099 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG++KRP+  R+KP                      S     +  +++ +     +V +E
Sbjct  1     MGNRKRPLTSRTKPPPP------------------PSAAVPTVASDETYLYPSPNLVSTE  42

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
             ++ SS+   IK EC+RAL +LRRGNH KALR+MKD CAKH      ALI+RV  TVCVKV
Sbjct  43    SDGSSA---IKHECDRALNALRRGNHTKALRIMKDSCAKHGGD---ALIHRVHSTVCVKV  96

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDDPN K R+LKNAI++AR++  +SPNSIEFAHFYANLLYEAANDGKEYEEV++EC+
Sbjct  97    ASIIDDPNSKQRYLKNAIEAARRAAELSPNSIEFAHFYANLLYEAANDGKEYEEVMKECD  156

Query  903   RALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RAL IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL Q+SN+ASISTW+KN G+G
Sbjct  157   RALKIENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQQKSNIASISTWMKNLGTG  216

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE  RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EE+RKEIEVRVAAARLLQ KSE 
Sbjct  217   EE-IRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEEKRKEIEVRVAAARLLQ-KSEI  274

Query  1260  AQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
                  +GE S   ++++  + +RG  R+   NARKN ++ ER+D V+SYWNSMS +MK+ 
Sbjct  275   GLGKREGEMSDKGVEVTPWSDRRGERRKNGSNARKNGTNTERKDRVQSYWNSMSLEMKRD  334

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL+I++ DLKS++ S K+GLAN+VL+EAL+ +E NK+W+FW CC C E+FADS+SH+ HV
Sbjct  335   LLKIKVSDLKSYYVSSKNGLANDVLNEALACSEENKSWRFWLCCRCNEKFADSDSHLHHV  394

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SL PK+Q VLPQ+ +NEW+EM+ +CSWKPLDI+ A K+L  + KC+    +E+ 
Sbjct  395   VQEHMRSLMPKMQEVLPQSPDNEWIEMINSCSWKPLDISTAVKMLWNRGKCQNGELVEDI  454

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGN  1967
              + +  ++      D       WD SP K+   DGC    V S +  K   +   + DGN
Sbjct  455   CSENHNEDGDGCFED------AWDSSPEKENLRDGCISCPVSSSDSGKVYSIKGKEFDGN  508

Query  1968  EGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLG  2147
             + +  C   ESWPI++D ERAKLLE+I+ VFQ LI++KYL +SHL KVI F V+ELQSL 
Sbjct  509   QLSIACT-IESWPISEDSERAKLLEKIHDVFQALIRHKYLAASHLKKVIQFTVDELQSLA  567

Query  2148  YGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQG  2327
              GSQLLN+ + QTP+CICFLGA +LKKILKFLQELSHSCGLG  PE+S+ +DD++TG +G
Sbjct  568   TGSQLLNHGVGQTPMCICFLGAFQLKKILKFLQELSHSCGLGMSPEKSSVVDDMNTGAKG  627

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
              +  E IV ++D SCL  D+   P +  P T  D  VT +              +G L  
Sbjct  628   PEIKENIVLNDDASCLYLDKCLLPLEYAPRTCPDDDVTTATSTIVGN------GDGVLPA  681

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
              D LLSWIF G SSGEQL SW R++EE+  Q MEI++ LEKEFY LQ L ERKCEHL+YE
Sbjct  682   VDTLLSWIFAGLSSGEQLQSWIRTKEERMNQGMEILQTLEKEFYHLQSLYERKCEHLSYE  741

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
             +ALQ VEDLCLEEGKKRE    F  RSYD  L++RR++L+E+ H+A   + RFE++AIS+
Sbjct  742   QALQAVEDLCLEEGKKRETDTLFELRSYDSVLRQRREKLVENEHDAMFFSSRFELDAISN  801

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VLK+A++LNVNQ+GFEDTYGGI+S  CDL+SGED +WR KD ++  ++ +E+AIQRQKE 
Sbjct  802   VLKEADTLNVNQYGFEDTYGGITSQFCDLKSGEDGNWRTKDQMHHVETFIEIAIQRQKEQ  861

Query  3048  VSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATE  3227
             +S+ELSKIDA+I+R+V+GMQQLE+KLESVSA DYR IL PLVKSY+RAHLEDLAE+DATE
Sbjct  862   LSIELSKIDAQILRIVAGMQQLELKLESVSALDYRSILPPLVKSYMRAHLEDLAEKDATE  921

Query  3228  KSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHA  3407
             KS+AA EAFLAELA DSKK +   S+ ++++ EK +D++K K+Y+KTK+LK +  +  H 
Sbjct  922   KSNAAGEAFLAELALDSKKGTQGRSDISRNTLEKGKDRRKNKEYKKTKELKVAAASEQHL  981

Query  3408  LHHDTAEEASFSVVHDGGSEDAELS-NGGSNSITQeeeeqrrrieleaeerkleetleYQ  3584
             L   T E  SF V  DG   D++   +   + + Q+EEE R +IE+E EER LEE+LEYQ
Sbjct  982   LQDVTNERGSFPVASDGDYPDSQCHLSRNDDDLRQQEEEFRWKIEIEEEERMLEESLEYQ  1041

Query  3585  RRIENEAKLKHLAE-QHKK  3638
             RRIENEAKLKHLAE Q+KK
Sbjct  1042  RRIENEAKLKHLAEKQYKK  1060


 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/498 (64%), Positives = 370/498 (74%), Gaps = 53/498 (11%)
 Frame = +1

Query  3742  KELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakY  3915
             ++L Q +G P  L G P  +          S GG +E G   SDR + R+SRRQK SAKY
Sbjct  1089  EQLTQKSGFPNNLVGMPMTTASEQ------STGGNVEGGP--SDRWSDRKSRRQKSSAKY  1140

Query  3916  NEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKA  4095
             +  K  P++   ENIEVG + P        + G+S  KTLRQL VE+DDEERFQADL +A
Sbjct  1141  DG-KNQPMSCEMENIEVGSITP--------NLGDSATKTLRQLQVEEDDEERFQADLERA  1191

Query  4096  VRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             VRQSL                                VAT  V+G +V+GTGLKN++GEY
Sbjct  1192  VRQSL--------------------------------VATENVDGTDVFGTGLKNDIGEY  1219

Query  4276  NCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVVCALYDI TA+S+AS++TRR+AV
Sbjct  1220  NCFLNVIIQSLWHLRRFRDEFLSRSKSEHVHVGDPCVVCALYDILTAISMASTDTRREAV  1279

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FT+    SD+ESV+ S M 
Sbjct  1280  APTSLRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTTGLHGSDSESVECSGME  1339

Query  4633  SWDCA-NSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDS  4809
             SW+C   +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY +FFHNINA+ALR MKVMC +S
Sbjct  1340  SWECTKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYNAFFHNINATALRAMKVMCVES  1399

Query  4810  SFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITAT  4989
              FDELLNLVEMNH L CDP+A GCGK N+I+H  +TPPHVFTTVLGW+ TCES++DI AT
Sbjct  1400  CFDELLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCESIDDIKAT  1459

Query  4990  LVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIG  5169
             L ALSTEIDISV Y GLD ++   LVSVVCYYGQHYHCFAYSHDH +WIMYDDKTVKVIG
Sbjct  1460  LAALSTEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDDKTVKVIG  1519

Query  5170  NWADVLTMCERGHLQPQV  5223
             +W DVL MCE+GHLQPQV
Sbjct  1520  SWTDVLIMCEKGHLQPQV  1537



>ref|XP_002317996.2| ubiquitin carboxyl-terminal hydrolase family protein [Populus 
trichocarpa]
 gb|EEE96216.2| ubiquitin carboxyl-terminal hydrolase family protein [Populus 
trichocarpa]
Length=1181

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/1103 (57%), Positives = 806/1103 (73%), Gaps = 51/1103 (5%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG++KRP+  R+K                       S  +  +  +++ +      V +E
Sbjct  1     MGNRKRPLTSRTKHPPP------------------PSAAAPSVASDETDLYPSPNSVSTE  42

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
             ++ SS+   IK EC+RAL +LRRGNH KALR+MKD CAKH      ALI+RV  TVCVKV
Sbjct  43    SDGSST---IKHECDRALNALRRGNHTKALRIMKDSCAKHGGD---ALIHRVHSTVCVKV  96

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASIIDD N K R+LKNAI++AR++  +SPNSIEFAHFYANLLYEAANDGKEYEEV++EC+
Sbjct  97    ASIIDDTNSKQRYLKNAIEAARRAAELSPNSIEFAHFYANLLYEAANDGKEYEEVMKECD  156

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RAL IENPIDPAKESLQ E+QQK++T E RIAHVQGEL+NL Q+SN+ASISTW+KN G+G
Sbjct  157   RALKIENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQQKSNIASISTWMKNLGTG  216

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE  RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EE+RKEIEVRVAAARLL QKSE 
Sbjct  217   EE-IRLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEEKRKEIEVRVAAARLL-QKSEI  274

Query  1260  AQSFNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
                  +GERS   ++++  + +RG  R+   NARKN ++ ER+D VRSYWNSMS +MK++
Sbjct  275   GLGQREGERSDKGVEVTPWSDRRGERRKNGSNARKNGTNTERKDWVRSYWNSMSLEMKRE  334

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
             LL+I++ DLKS+F S K+GLA++VL+EAL+ +E NK+W+FW CC C E+FADS+SH+ HV
Sbjct  335   LLKIKVSDLKSYFVSSKNGLASDVLNEALACSEENKSWRFWVCCRCNEKFADSDSHLHHV  394

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SL PK+Q VLPQ+ +NEW+EM+ +CSWKPLDI++A K+L  + KC+ +G L   
Sbjct  395   VQEHMRSLMPKMQEVLPQSPDNEWIEMINSCSWKPLDISSAVKMLWNRGKCQ-NGELVED  453

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGN  1967
                 + +E  D      C    WD SP K+   DGC    V S    K   +   + DGN
Sbjct  454   ICSENHNEDGDG-----CFKDAWDSSPEKENLRDGCISCPVSSSNSGKVYSIEGKEFDGN  508

Query  1968  EGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLG  2147
             + +  C   ESWPI++D ERAKLLE+I+ VFQ LI++KYL +SHL+KVI F V+ELQSL 
Sbjct  509   QLSIAC-TIESWPISEDSERAKLLEKIHDVFQALIRHKYLAASHLNKVIQFTVDELQSLA  567

Query  2148  YGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQG  2327
              GSQLLN+ + QTP+CICFLGA +LKKILKFLQELSHSCGLG  PE+S+ +DD++TG +G
Sbjct  568   TGSQLLNHGVGQTPMCICFLGAFQLKKILKFLQELSHSCGLGMSPEKSSVVDDMNTGAKG  627

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
              +  E IV ++D SCL  D+   P +  P T  D  VT +              +G L  
Sbjct  628   PEIKENIVLNDDASCLYLDKCLLPLEYAPRTCPDDDVTTATSTIVGN------GDGVLPA  681

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
              D LLSWIF G SSGEQL SW R++EE+  Q MEI++ LEKEFY LQ L ERKCEHL+YE
Sbjct  682   VDTLLSWIFAGLSSGEQLQSWIRTKEERMNQGMEILQTLEKEFYHLQSLYERKCEHLSYE  741

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
             +ALQ VEDLCLEEGKKRE    F  RSYD  L++RR++L+E+ H+A   + RFE++AIS+
Sbjct  742   QALQAVEDLCLEEGKKRETDTLFELRSYDSVLRQRREKLVENEHDALFFSSRFELDAISN  801

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VLK+A++LNVNQ+G+EDTYGGI+S  CDL+SGED +WR KD ++Q ++ +E+AIQRQKE 
Sbjct  802   VLKEADTLNVNQYGYEDTYGGITSQFCDLKSGEDGNWRTKDQMHQVETFIEIAIQRQKEQ  861

Query  3048  VSVE----LSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             +S+E    LSKIDA+IMR+V+GMQQLE+KLESVSA DYR IL PLVKSY+RAHLEDLAE+
Sbjct  862   LSIEVMVQLSKIDAQIMRIVTGMQQLELKLESVSALDYRSILPPLVKSYMRAHLEDLAEK  921

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DATEKS+AA EAFLAELA DSKK +   S+ ++++ EK +D++K K+Y+KTK+LK +  +
Sbjct  922   DATEKSNAAGEAFLAELALDSKKGTQGRSDISRNTLEKGKDRRKNKEYKKTKELKVAAAS  981

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAE--LSNGGSNSITQeeeeqrrrieleaeerklee  3569
               H L   T E  SF V  DG   D++  LS  G + + Q+EEE R +IE+E EER LEE
Sbjct  982   EQHLLQDVTNERGSFPVASDGDYPDSQCHLSRNG-DDLRQQEEEFRWKIEIEEEERMLEE  1040

Query  3570  tleYQRRIENEAKLKHLAEQHKK  3638
             +L+YQRRIENEAK KHLAEQ  K
Sbjct  1041  SLKYQRRIENEAKQKHLAEQQYK  1063



>ref|XP_010112586.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Morus notabilis]
 gb|EXC34221.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Morus notabilis]
Length=1634

 Score =  1082 bits (2799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/1046 (59%), Positives = 783/1046 (75%), Gaps = 34/1046 (3%)
 Frame = +3

Query  531   VESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTV  710
              E + + S SY+ +KLECERALT+LRRGNH KALRLMK+   ++ENSP+ AL++RVQGTV
Sbjct  66    AEPDGSGSPSYSAVKLECERALTALRRGNHTKALRLMKESSQRYENSPHSALVHRVQGTV  125

Query  711   CVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVV  890
             CVKVAS+IDD   KNRHL+NA+++AR++V +SPNSIEFAHFYANLLYE AND K+YEE V
Sbjct  126   CVKVASLIDDQTTKNRHLRNAVEAARRAVELSPNSIEFAHFYANLLYEVANDAKDYEEAV  185

Query  891   QECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKN  1067
             +ECERAL IENP+DPAKESLQ E+QQK+S+ E RI HV  ELR LIQ+SN+ASIS+W+KN
Sbjct  186   RECERALVIENPVDPAKESLQDESQQKLSSVEDRIGHVHNELRQLIQKSNIASISSWMKN  245

Query  1068  FGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
              G+G+EKFRLIPIRR++EDPME+RLVQAR+PNEIKKATKT EERRKEIEVRVAAARLLQQ
Sbjct  246   LGNGDEKFRLIPIRRVAEDPMEVRLVQARRPNEIKKATKTLEERRKEIEVRVAAARLLQQ  305

Query  1248  KSESAQSFNDG---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
             KSE  Q  N G   ++ LD S+ +GQR  +RRKS   RK  SS ERRD VRS+WNS+S D
Sbjct  306   KSEVPQLENGGDMADKGLDSSSVSGQRVGDRRKS---RKVGSSSERRDFVRSFWNSISID  362

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
              KK+LLRIR+ D+K HFGSLKD LANEVLSEALSFAE+N++WKFW CC C +RF+DSESH
Sbjct  363   AKKELLRIRVSDIKEHFGSLKDSLANEVLSEALSFAESNRSWKFWVCCSCNDRFSDSESH  422

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
               HV  EHM SL PK+QSVLPQNV+NEW+EMLL CSWKPLD++AA ++L  Q +C+   F
Sbjct  423   YHHV-QEHMGSLLPKMQSVLPQNVDNEWIEMLLKCSWKPLDVSAAVEMLRNQTRCKDSAF  481

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDK--NSEVWM  1952
             +++T    + D+   D+          D S  K+  GD    +TV+S    K  N E   
Sbjct  482   VDHT---GNFDDCSKDM---------LDSSLEKQNLGDISGDSTVESTNDVKIPNIEPRE  529

Query  1953  DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEE  2132
               + N        S++WP++DD E AKLLERI+ +F+ L +++ L +SHL++VI FA++E
Sbjct  530   CHEDNRSMAYSSLSDNWPVSDDSECAKLLERIHSLFEVLFRHRCLAASHLNRVIQFAMDE  589

Query  2133  LQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST-AIDDI  2309
             LQS+  GSQLLN+ ++QTP+CICF+G+ +LKKILKFLQ++S SCGLGRY E+S+  + D 
Sbjct  590   LQSIASGSQLLNHGVEQTPMCICFMGSSQLKKILKFLQDVSQSCGLGRYSEKSSNLLVDA  649

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
             + G Q ++  E+IV + D S L          L           D+   + +   +    
Sbjct  650   NKGSQSLEIKERIVLNGDASFL---------LLDESLLSSESAKDNAAAATSAIDSNAA-  699

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
              G + +S+ LLSWIF G +SGE+L SW  ++EEKA++ +EI+++LEKEF++LQ LCERKC
Sbjct  700   -GDITNSNALLSWIFAGPTSGEELASWVHAKEEKAREGVEILQMLEKEFHQLQSLCERKC  758

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             E L +EEALQ VEDLC+EE K+RE+  + + +S+D  LKKRR+EL+ES ++      R E
Sbjct  759   ERLGHEEALQAVEDLCVEEAKRRENDRELIYQSFDSVLKKRREELLESENDMMILGSRIE  818

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++AIS+VLK+AE+LNVNQFG+E++YG  +S L DLESGE DDWR KDYL+Q D+CVEVAI
Sbjct  819   LDAISNVLKEAETLNVNQFGYEESYGSANSQLPDLESGEYDDWRAKDYLHQVDTCVEVAI  878

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             QRQKE + VELSKIDA+IMR V+GMQQLE K+E  +AHD+R IL+PLVKSYLRAHLEDLA
Sbjct  879   QRQKEQLYVELSKIDAQIMRSVTGMQQLEAKVEPAAAHDFRSILLPLVKSYLRAHLEDLA  938

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAAREAFLAELA DSKK+   G++N +H+ EKT+DK+K KDY+K KD K   
Sbjct  939   EKDATEKSDAAREAFLAELALDSKKAVKGGNDNLRHTQEKTKDKRKNKDYKKAKDSKVIG  998

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
              +     H +  +  SF V HDG   D+E+    +    +++EE+ RRIELE EERKLEE
Sbjct  999   VSEPQRFHDEADDSVSFPVAHDGDHPDSEIVVTVNGDELKQQEEELRRIELEEEERKLEE  1058

Query  3570  tleYQRRIENEAKLKHLAEQHKKGAR  3647
             TLEYQRRIENEAK K LAEQ KK  +
Sbjct  1059  TLEYQRRIENEAKQKLLAEQQKKATQ  1084


 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/472 (69%), Positives = 384/472 (81%), Gaps = 9/472 (2%)
 Frame = +1

Query  3820  GFSNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLE  3999
             G  +GG  +DG L +DRRA R+ RRQ+GS+K  + K   ++S  E++EVG    VD  L+
Sbjct  1161  GLPDGGISDDGFLPADRRARRKGRRQRGSSKVADGKHQTLSS-RESVEVGS-SCVDGGLK  1218

Query  4000  KKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQ-IS-  4173
             ++   ++G KTLRQ+HV+ DDEERFQADL +A+RQSLDTF AHQK+P +    + Q IS 
Sbjct  1219  EE---DNGAKTLRQMHVDADDEERFQADLKRAMRQSLDTFQAHQKIPPVSTLKSPQRISG  1275

Query  4174  EMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SS  4350
             E+ N G    DV    +N ++V GTGLKNEVGEYNCFLNVIIQSLWH+RRFRDEFLR S+
Sbjct  1276  EVDNSGAVPSDVQASNMNRVDVLGTGLKNEVGEYNCFLNVIIQSLWHVRRFRDEFLRRST  1335

Query  4351  SEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMND  4530
             SEH+HVGDPCV+CAL +IF+ALS+AS++TRR+AVAP SLR ALSNLYP+   F+EGQMND
Sbjct  1336  SEHVHVGDPCVICALKEIFSALSIASTDTRREAVAPTSLRTALSNLYPNSNFFKEGQMND  1395

Query  4531  ASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCY  4710
             ASEVL  IF+CLHQSFT  S  SDT SV SS   SWDC N  CI HS+FGM++FERMNCY
Sbjct  1396  ASEVLAAIFDCLHQSFTPGSSVSDTASVASSNTSSWDCVNEDCIAHSIFGMNIFERMNCY  1455

Query  4711  ECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKH  4890
              C L+SR+LKYTSFFHNINASALRTMK+MC +SSFDELLNLVEMNHQL C+PD  GCGK 
Sbjct  1456  NCELQSRYLKYTSFFHNINASALRTMKIMCSESSFDELLNLVEMNHQLTCNPDYGGCGKL  1515

Query  4891  NHIHHFL-STPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLV  5067
             N+IHH L S+PPHVFTTVLGWQNTCE+VEDITATL AL+ EIDISVLYRGLDP+++H LV
Sbjct  1516  NYIHHILSSSPPHVFTTVLGWQNTCENVEDITATLRALNDEIDISVLYRGLDPRNRHSLV  1575

Query  5068  SVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             SVVCYYGQHYHCFAYSHDH RWIMYDD TVKV+G+W DVL  CE+GHLQPQV
Sbjct  1576  SVVCYYGQHYHCFAYSHDHGRWIMYDDNTVKVVGSWTDVLKSCEKGHLQPQV  1627



>ref|XP_011028696.1| PREDICTED: uncharacterized protein LOC105128635 isoform X2 [Populus 
euphratica]
Length=1571

 Score =  1081 bits (2796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1036 (59%), Positives = 769/1036 (74%), Gaps = 25/1036 (2%)
 Frame = +3

Query  555   SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASII  734
             S  + IK EC RAL +LRRGNH KALR+MKD CAKH      ALI+RV GTVCVKV+SII
Sbjct  37    SDGSTIKQECGRALNALRRGNHMKALRIMKDSCAKHGGD---ALIHRVHGTVCVKVSSII  93

Query  735   DDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALA  914
             DDPN K RHLKNAID+AR++  +SPNSIEFAHFYANLLYEAA+DGKEYEEV++EC+RAL 
Sbjct  94    DDPNSKQRHLKNAIDAARRAAELSPNSIEFAHFYANLLYEAASDGKEYEEVMKECDRALK  153

Query  915   IENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL  +SN+ASISTW+KN G+GEE  
Sbjct  154   IENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQHKSNIASISTWMKNLGTGEE-I  212

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSESAQS  1268
             RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EERRKEIEVRVAAARLLQQ KSE    
Sbjct  213   RLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEERRKEIEVRVAAARLLQQQKSEMGLG  272

Query  1269  FNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
              ++GERS   + ++ G+ +RG  R+   NARKN ++ ER+D VRSYWNSM+ +MK++LL+
Sbjct  273   QSEGERSDQGVAVTPGSDRRGERRKCGSNARKNGTNTERKDWVRSYWNSMTLEMKRELLK  332

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLK +F S KDG+A++VL+E L++   NK+W FW CC C E+F D++SH+ HV+ E
Sbjct  333   IKVSDLKGYFWSSKDGVASDVLNELLAYGLENKSWGFWVCCRCNEKFVDADSHLHHVVQE  392

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             HM SL PK+Q VLPQ+ +NEW+EM+LN SWKPLDI++A K+   Q KC  +G L   +  
Sbjct  393   HMGSLMPKMQEVLPQSADNEWIEMILNSSWKPLDISSAVKMPWNQGKCH-NGELGEDFCS  451

Query  1800  SDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGNEGT  1976
                +E  DD           D SP K+   DG N   V S   DK   +   + DGN+ +
Sbjct  452   EYHNEDSDDFFKD-----ARDSSPDKENLRDGYNSCPVSSSNSDKVYNIEGKEIDGNQSS  506

Query  1977  KICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGS  2156
              I    +SWPI++D ERAKLL++I+ VFQ LI +KYL +SHL+KVI   ++ELQ+L  GS
Sbjct  507   -IAYTIDSWPISEDSERAKLLKKIHDVFQALIGHKYLAASHLNKVIQLTMDELQNLASGS  565

Query  2157  QLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDA  2336
             +LLN  +DQTP CICFLGA +LKKILKFLQE+SH CGLGR PE+S  +D  ++G +G + 
Sbjct  566   RLLNRGVDQTPNCICFLGASQLKKILKFLQEISHYCGLGRSPEKSIVVDGSNSGAKGPEI  625

Query  2337  MEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDE  2516
              E+IV + D  CL  DE     +  P T  D         + A S+     NG   D+D 
Sbjct  626   KEEIVLNGDEPCLCLDERLLSLEYAPSTCPDN------DATTATSTIAAYGNGVQPDADA  679

Query  2517  LLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEAL  2696
             LLSWIF G SSGEQL SW R++EEK  Q MEI++ LEKEFY LQ LCERKCEHL YE+AL
Sbjct  680   LLSWIFAGLSSGEQLQSWIRTKEEKMHQGMEILQTLEKEFYHLQSLCERKCEHLGYEQAL  739

Query  2697  QVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLK  2876
             Q VEDLCLEEGKKRE  +    RSYD  L++RR++L+E+ H+A   + RFE++AI +VLK
Sbjct  740   QAVEDLCLEEGKKRETDMLVEHRSYDSVLRQRREQLVENEHDAPFISSRFELDAILNVLK  799

Query  2877  DAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSV  3056
             +A++LN NQFG+EDTYGGI+S  CDLESGED +WR KD+++Q ++C+E+AIQRQKEH+S+
Sbjct  800   EADTLNANQFGYEDTYGGITSQFCDLESGEDSNWRTKDHMHQVETCIEIAIQRQKEHLSI  859

Query  3057  ELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSd  3236
             ELSKIDA+IMR VSGMQQLE+KLESVSA DYR IL+PLVKSY+RAHLEDLAE+DATEKSD
Sbjct  860   ELSKIDAQIMRNVSGMQQLELKLESVSALDYRSILLPLVKSYMRAHLEDLAEKDATEKSD  919

Query  3237  aareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHH  3416
             AAREAFLAELA DSKK +   S+N++++ EK +DK+K K+Y+KTKD K    +    L  
Sbjct  920   AAREAFLAELALDSKKGTQGRSDNSRNTIEKGKDKRKNKEYKKTKDSKVIAASEQQLLQD  979

Query  3417  DTAEEASFSVVHDGGSEDAELSNGGS-NSITQeeeeqrrrieleaeerkleetleYQRRI  3593
              T    SF    DG   D++     S + + Q+EEE R +IE+E EER LE++LEYQRRI
Sbjct  980   ATNGRGSFPDASDGNYPDSQSHLSVSDDDLKQQEEEFRWKIEIEEEERMLEKSLEYQRRI  1039

Query  3594  ENEAKLKHLAE-QHKK  3638
             ENEAK KHLAE QHKK
Sbjct  1040  ENEAKQKHLAEQQHKK  1055


 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/496 (67%), Positives = 390/496 (79%), Gaps = 20/496 (4%)
 Frame = +1

Query  3748  LLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakYNE  3921
             L Q  G P  LEG      +S    +  S GG +E G  TSDRR GRRSRRQK S++ ++
Sbjct  1085  LTQKRGLPNNLEG------MSMTTASELSTGGSVERG--TSDRRPGRRSRRQKSSSRSSD  1136

Query  3922  EKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVR  4101
              K  P+ S  EN E+G            + G+S  KTLRQL VE++DEERFQADL KA+R
Sbjct  1137  GKNQPMLSETENTEIGS--------STSNLGDSATKTLRQLKVEEEDEERFQADLEKAMR  1188

Query  4102  QSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNC  4281
             QSLDTF A+QK+P++         E+ + G S  +VAT  V+G +V+GTGLKN++G+YNC
Sbjct  1189  QSLDTFQANQKIPMMSSLKQTISCELGDSGASPYEVATVNVDGTDVFGTGLKNDIGDYNC  1248

Query  4282  FLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAP  4458
             FLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVVCALYDI TA+S+ S +TRR+AVAP
Sbjct  1249  FLNVIIQSLWHLRRFRDEFLSRSRSEHVHVGDPCVVCALYDILTAMSIVSMDTRREAVAP  1308

Query  4459  NSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSW  4638
              SLRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FT     +D+E+V+ S M SW
Sbjct  1309  TSLRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTFGLHGTDSEAVEHSGMESW  1368

Query  4639  DCAN-SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSF  4815
             +C+  +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY++FFHNINASALR MKVMC +SSF
Sbjct  1369  ECSKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYSAFFHNINASALRAMKVMCAESSF  1428

Query  4816  DELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLV  4995
             DELLNLVEMNHQLACD +A GCGK N+ HH LSTPPHVFTTVLGWQ TCES++DITATL 
Sbjct  1429  DELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCESIDDITATLT  1488

Query  4996  ALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNW  5175
             AL+TEIDISV YRGLDPK+   LVSVVCYYGQHYHCFAYS DH++WIMYDDKTVKVIG+W
Sbjct  1489  ALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDHDQWIMYDDKTVKVIGSW  1548

Query  5176  ADVLTMCERGHLQPQV  5223
              DVLTMCE+GHLQPQV
Sbjct  1549  TDVLTMCEKGHLQPQV  1564



>ref|XP_011028695.1| PREDICTED: uncharacterized protein LOC105128635 isoform X1 [Populus 
euphratica]
Length=1573

 Score =  1081 bits (2796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1036 (59%), Positives = 769/1036 (74%), Gaps = 25/1036 (2%)
 Frame = +3

Query  555   SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASII  734
             S  + IK EC RAL +LRRGNH KALR+MKD CAKH      ALI+RV GTVCVKV+SII
Sbjct  37    SDGSTIKQECGRALNALRRGNHMKALRIMKDSCAKHGGD---ALIHRVHGTVCVKVSSII  93

Query  735   DDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALA  914
             DDPN K RHLKNAID+AR++  +SPNSIEFAHFYANLLYEAA+DGKEYEEV++EC+RAL 
Sbjct  94    DDPNSKQRHLKNAIDAARRAAELSPNSIEFAHFYANLLYEAASDGKEYEEVMKECDRALK  153

Query  915   IENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL  +SN+ASISTW+KN G+GEE  
Sbjct  154   IENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQHKSNIASISTWMKNLGTGEE-I  212

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSESAQS  1268
             RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EERRKEIEVRVAAARLLQQ KSE    
Sbjct  213   RLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEERRKEIEVRVAAARLLQQQKSEMGLG  272

Query  1269  FNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
              ++GERS   + ++ G+ +RG  R+   NARKN ++ ER+D VRSYWNSM+ +MK++LL+
Sbjct  273   QSEGERSDQGVAVTPGSDRRGERRKCGSNARKNGTNTERKDWVRSYWNSMTLEMKRELLK  332

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLK +F S KDG+A++VL+E L++   NK+W FW CC C E+F D++SH+ HV+ E
Sbjct  333   IKVSDLKGYFWSSKDGVASDVLNELLAYGLENKSWGFWVCCRCNEKFVDADSHLHHVVQE  392

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             HM SL PK+Q VLPQ+ +NEW+EM+LN SWKPLDI++A K+   Q KC  +G L   +  
Sbjct  393   HMGSLMPKMQEVLPQSADNEWIEMILNSSWKPLDISSAVKMPWNQGKCH-NGELGEDFCS  451

Query  1800  SDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGNEGT  1976
                +E  DD           D SP K+   DG N   V S   DK   +   + DGN+ +
Sbjct  452   EYHNEDSDDFFKD-----ARDSSPDKENLRDGYNSCPVSSSNSDKVYNIEGKEIDGNQSS  506

Query  1977  KICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGS  2156
              I    +SWPI++D ERAKLL++I+ VFQ LI +KYL +SHL+KVI   ++ELQ+L  GS
Sbjct  507   -IAYTIDSWPISEDSERAKLLKKIHDVFQALIGHKYLAASHLNKVIQLTMDELQNLASGS  565

Query  2157  QLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDA  2336
             +LLN  +DQTP CICFLGA +LKKILKFLQE+SH CGLGR PE+S  +D  ++G +G + 
Sbjct  566   RLLNRGVDQTPNCICFLGASQLKKILKFLQEISHYCGLGRSPEKSIVVDGSNSGAKGPEI  625

Query  2337  MEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDE  2516
              E+IV + D  CL  DE     +  P T  D         + A S+     NG   D+D 
Sbjct  626   KEEIVLNGDEPCLCLDERLLSLEYAPSTCPDN------DATTATSTIAAYGNGVQPDADA  679

Query  2517  LLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEAL  2696
             LLSWIF G SSGEQL SW R++EEK  Q MEI++ LEKEFY LQ LCERKCEHL YE+AL
Sbjct  680   LLSWIFAGLSSGEQLQSWIRTKEEKMHQGMEILQTLEKEFYHLQSLCERKCEHLGYEQAL  739

Query  2697  QVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLK  2876
             Q VEDLCLEEGKKRE  +    RSYD  L++RR++L+E+ H+A   + RFE++AI +VLK
Sbjct  740   QAVEDLCLEEGKKRETDMLVEHRSYDSVLRQRREQLVENEHDAPFISSRFELDAILNVLK  799

Query  2877  DAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSV  3056
             +A++LN NQFG+EDTYGGI+S  CDLESGED +WR KD+++Q ++C+E+AIQRQKEH+S+
Sbjct  800   EADTLNANQFGYEDTYGGITSQFCDLESGEDSNWRTKDHMHQVETCIEIAIQRQKEHLSI  859

Query  3057  ELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSd  3236
             ELSKIDA+IMR VSGMQQLE+KLESVSA DYR IL+PLVKSY+RAHLEDLAE+DATEKSD
Sbjct  860   ELSKIDAQIMRNVSGMQQLELKLESVSALDYRSILLPLVKSYMRAHLEDLAEKDATEKSD  919

Query  3237  aareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHH  3416
             AAREAFLAELA DSKK +   S+N++++ EK +DK+K K+Y+KTKD K    +    L  
Sbjct  920   AAREAFLAELALDSKKGTQGRSDNSRNTIEKGKDKRKNKEYKKTKDSKVIAASEQQLLQD  979

Query  3417  DTAEEASFSVVHDGGSEDAELSNGGS-NSITQeeeeqrrrieleaeerkleetleYQRRI  3593
              T    SF    DG   D++     S + + Q+EEE R +IE+E EER LE++LEYQRRI
Sbjct  980   ATNGRGSFPDASDGNYPDSQSHLSVSDDDLKQQEEEFRWKIEIEEEERMLEKSLEYQRRI  1039

Query  3594  ENEAKLKHLAE-QHKK  3638
             ENEAK KHLAE QHKK
Sbjct  1040  ENEAKQKHLAEQQHKK  1055


 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/498 (66%), Positives = 392/498 (79%), Gaps = 20/498 (4%)
 Frame = +1

Query  3742  KELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakY  3915
             ++L Q  G P  LEG      +S    +  S GG +E G  TSDRR GRRSRRQK S++ 
Sbjct  1085  EQLTQKRGLPNNLEG------MSMTTASELSTGGSVERG--TSDRRPGRRSRRQKSSSRS  1136

Query  3916  NEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKA  4095
             ++ K  P+ S  EN E+G            + G+S  KTLRQL VE++DEERFQADL KA
Sbjct  1137  SDGKNQPMLSETENTEIGS--------STSNLGDSATKTLRQLKVEEEDEERFQADLEKA  1188

Query  4096  VRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             +RQSLDTF A+QK+P++         E+ + G S  +VAT  V+G +V+GTGLKN++G+Y
Sbjct  1189  MRQSLDTFQANQKIPMMSSLKQTISCELGDSGASPYEVATVNVDGTDVFGTGLKNDIGDY  1248

Query  4276  NCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPCVVCALYDI TA+S+ S +TRR+AV
Sbjct  1249  NCFLNVIIQSLWHLRRFRDEFLSRSRSEHVHVGDPCVVCALYDILTAMSIVSMDTRREAV  1308

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FT     +D+E+V+ S M 
Sbjct  1309  APTSLRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTFGLHGTDSEAVEHSGME  1368

Query  4633  SWDCAN-SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDS  4809
             SW+C+  +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY++FFHNINASALR MKVMC +S
Sbjct  1369  SWECSKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYSAFFHNINASALRAMKVMCAES  1428

Query  4810  SFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITAT  4989
             SFDELLNLVEMNHQLACD +A GCGK N+ HH LSTPPHVFTTVLGWQ TCES++DITAT
Sbjct  1429  SFDELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCESIDDITAT  1488

Query  4990  LVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIG  5169
             L AL+TEIDISV YRGLDPK+   LVSVVCYYGQHYHCFAYS DH++WIMYDDKTVKVIG
Sbjct  1489  LTALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDHDQWIMYDDKTVKVIG  1548

Query  5170  NWADVLTMCERGHLQPQV  5223
             +W DVLTMCE+GHLQPQV
Sbjct  1549  SWTDVLTMCEKGHLQPQV  1566



>ref|XP_006374498.1| hypothetical protein POPTR_0015s07770g [Populus trichocarpa]
 gb|ERP52295.1| hypothetical protein POPTR_0015s07770g [Populus trichocarpa]
Length=1573

 Score =  1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1039 (59%), Positives = 769/1039 (74%), Gaps = 25/1039 (2%)
 Frame = +3

Query  555   SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASII  734
             S  + IK EC RAL +LRRGNH KALR+MKD CAKH      ALI+RV GTVCVKV+SII
Sbjct  37    SDGSTIKQECGRALNALRRGNHTKALRIMKDSCAKHGGD---ALIHRVHGTVCVKVSSII  93

Query  735   DDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALA  914
             DDPN K RH+KNAI++AR++  +SPNSIEFAHFYANLLYEAA+DGKEYEEV++EC+RAL 
Sbjct  94    DDPNSKQRHIKNAIEAARRAAELSPNSIEFAHFYANLLYEAASDGKEYEEVMKECDRALK  153

Query  915   IENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IENPIDPAKESLQE +QQK++T E RIAHVQGEL+NL  +SN+ASISTW+KN G+GEE  
Sbjct  154   IENPIDPAKESLQEESQQKIATAEGRIAHVQGELKNLQHKSNIASISTWMKNLGTGEE-I  212

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSESAQS  1268
             RLIPIRR +EDPME+RLVQ R+PNEIKKATKT EERRKEIEVRVAAARLLQQ KSE    
Sbjct  213   RLIPIRRATEDPMEVRLVQTRRPNEIKKATKTQEERRKEIEVRVAAARLLQQQKSEMGLG  272

Query  1269  FNDGERS---LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
              ++GERS   + ++ G+ +RG  R+   NARKN ++ ER+D VRSYWNSM+ +MK++LL+
Sbjct  273   QSEGERSDQGVAVTPGSDRRGERRKCGSNARKNGTNTERKDWVRSYWNSMTLEMKRELLK  332

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLK +F S KDGLA++VL+E L++   NK+W+FW CC C E+F D++SH+ HV+ E
Sbjct  333   IKVSDLKGYFWSSKDGLASDVLNELLAYGLENKSWRFWVCCRCNEKFVDADSHLHHVVQE  392

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             HM SL PK+Q VLPQ+ +NEW+EM+LN SWKPLDI++A K+   Q KC  +G L   +  
Sbjct  393   HMGSLMPKMQEVLPQSADNEWIEMILNSSWKPLDISSAVKMPWNQGKCH-NGELGEDFCS  451

Query  1800  SDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV-WMDRDGNEGT  1976
                +E  DD           D SP K+   DG N   V S   DK   +   + DGN+ +
Sbjct  452   EHHNEDSDDFFKD-----ARDSSPEKENLRDGYNSCPVSSSNSDKVYNIEGKEFDGNQSS  506

Query  1977  KICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGS  2156
              I    +SW I++D ERAKLLE+I+ VFQ LI +KYL +SHL+KVI   ++ELQ+L  GS
Sbjct  507   -IAYTIDSWSISEDSERAKLLEKIHDVFQALIGHKYLAASHLNKVIQLTMDELQNLASGS  565

Query  2157  QLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDA  2336
             +LLN  + QTP CICFLGA +LKKILKFLQE+SH CGLGR PE+S  +D  ++G +G + 
Sbjct  566   RLLNRGVGQTPNCICFLGASQLKKILKFLQEISHYCGLGRSPEKSIVVDGSNSGAKGPEI  625

Query  2337  MEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDE  2516
              E+IV + D  CL  DE     +  P T  D         + A S+     NG   D+D 
Sbjct  626   KEEIVLNGDEPCLCLDERLLSLEYAPSTCPDN------DATTATSTIAAYGNGVQPDADA  679

Query  2517  LLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEAL  2696
             LLSWIF G SSGEQL SW R++EEK  Q MEI++ LEKEFY LQ LCERKCEHL YE+AL
Sbjct  680   LLSWIFAGLSSGEQLQSWIRTKEEKMHQGMEILQTLEKEFYHLQSLCERKCEHLGYEQAL  739

Query  2697  QVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLK  2876
             Q VEDLCLEEGKKRE  +    RSYD  L++RR++L+E+ H+A   + RFE++AI +VLK
Sbjct  740   QAVEDLCLEEGKKRETDMLVEHRSYDSVLRQRREQLVENEHDALFISSRFELDAILNVLK  799

Query  2877  DAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSV  3056
             +A++LN NQFG+EDTYGGI+S  CDLESGED +WR KD+++Q ++C+E+AIQRQKEH+S+
Sbjct  800   EADTLNANQFGYEDTYGGITSQFCDLESGEDGNWRTKDHMHQVETCIEIAIQRQKEHLSI  859

Query  3057  ELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSd  3236
             ELSKIDA+IMR VSGMQQLE+KLESVSA DYR IL+PLVKSY+RAHLEDLAE+DATEKSD
Sbjct  860   ELSKIDAQIMRNVSGMQQLELKLESVSALDYRSILLPLVKSYMRAHLEDLAEKDATEKSD  919

Query  3237  aareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHH  3416
             AAREAFLAELA DSKK +   S+N++++ EK +DK+K K+Y+KTKD K    +    L  
Sbjct  920   AAREAFLAELALDSKKGTQGRSDNSRNTLEKGKDKRKNKEYKKTKDSKVVAASEQQLLQD  979

Query  3417  DTAEEASFSVVHDGGSEDAELSNGGS-NSITQeeeeqrrrieleaeerkleetleYQRRI  3593
              T    SF    DG   D++     S + + Q+EEE R +IE+E EER LEE+LEYQRRI
Sbjct  980   ATNGRGSFPDASDGNYPDSQSHLSVSDDDLKQQEEEFRWKIEIEEEERMLEESLEYQRRI  1039

Query  3594  ENEAKLKHLAE-QHKKGAR  3647
             ENEAK KHLAE QHKK  R
Sbjct  1040  ENEAKQKHLAEQQHKKSNR  1058


 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/498 (67%), Positives = 393/498 (79%), Gaps = 20/498 (4%)
 Frame = +1

Query  3742  KELLQSNGSP--LEGHPKNSTVSDIHKAGFSNGGFLEDGALTSDrragrrsrrqkgsakY  3915
             ++L Q  G P  LEG P  +T S++     S GG +E G   SDRR GRRSRRQK S++ 
Sbjct  1085  EQLTQKRGLPNNLEGIPM-TTASEL-----STGGSVEGGP--SDRRPGRRSRRQKSSSRS  1136

Query  3916  NEEKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKA  4095
             ++ K  P+ S  EN E+G +          + G+S  KTLRQL VE++DEERFQADL KA
Sbjct  1137  SDGKNQPMLSETENTEIGSI--------TSNLGDSATKTLRQLKVEEEDEERFQADLEKA  1188

Query  4096  VRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             +RQSLDTF A+QK+P++        SE+ N G S  +VAT  V+G +V+GTGLKN++G+Y
Sbjct  1189  MRQSLDTFQANQKIPMMSSLKQTISSELGNSGTSPYEVATVNVDGTDVFGTGLKNDIGDY  1248

Query  4276  NCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWHLRRFRDEFL RS SEH+HVGDPC VCALYDI TA+S+ S +TRR+AV
Sbjct  1249  NCFLNVIIQSLWHLRRFRDEFLSRSRSEHVHVGDPCAVCALYDILTAMSIVSMDTRREAV  1308

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQEGQMNDASEVL VIF+CLH++FTS    SD+E+V+ S M 
Sbjct  1309  APTSLRIALSNLYPNSNFFQEGQMNDASEVLAVIFDCLHRAFTSGLHGSDSEAVEHSGME  1368

Query  4633  SWDCAN-SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDS  4809
             SW+C   +ACIVHSLFGMD+ E+MNC  CG+ESRHLKY++FFHNINASALRTMKVM  +S
Sbjct  1369  SWECTKKNACIVHSLFGMDISEQMNCQSCGVESRHLKYSAFFHNINASALRTMKVMRAES  1428

Query  4810  SFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITAT  4989
             SFDELLNLVEMNHQLACD +A GCGK N+ HH LSTPPHVFTTVLGWQ TCES++DITAT
Sbjct  1429  SFDELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCESIDDITAT  1488

Query  4990  LVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIG  5169
             L AL+TEIDISV YRGLDPK+   LVSVVCYYGQHYHCFAYS D ++WIMYDDKT+KVIG
Sbjct  1489  LTALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDLDQWIMYDDKTIKVIG  1548

Query  5170  NWADVLTMCERGHLQPQV  5223
             +W DVL MCE+GHLQPQV
Sbjct  1549  SWTDVLAMCEKGHLQPQV  1566



>ref|XP_004508792.1| PREDICTED: uncharacterized protein LOC101496590 isoform X2 [Cicer 
arietinum]
Length=1648

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/1100 (55%), Positives = 806/1100 (73%), Gaps = 33/1100 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S A   VA   +  AA  + +  D  +  V +++L   ++  +   
Sbjct  1     MGHKKRNSAPRSKQSPAASPVAQSPIGGAANGS-ISPDVDSCNVFDQNLPNPNKIELIPS  59

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +  S Y+ IK+ECERALT+ RRGNH +A++LMK+LC K + S   A +YR+ G +C KV
Sbjct  60    QSEGSDYSTIKVECERALTTFRRGNHKRAMKLMKELCLKEDGSSYSAFVYRIHGFICFKV  119

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASII D + K RHLK+A++SAR++V +SPNSIE+AHF+A+++ EAA +GK+YEEVV ECE
Sbjct  120   ASIITDCSSKQRHLKHAVESARRAVELSPNSIEYAHFHASVMLEAATEGKDYEEVVHECE  179

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++QKVST E RI HVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  180   RGLAIENPNDPAKETLQDESEQKVSTLEDRITHVQNELRQLIQKSNIASLSSWMKNLSNG  239

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR +EDPME+RLVQ+R+PNEIKK TKTPEERRKEIEVRVAAARLLQQKSES
Sbjct  240   EERFRLIPIRRPTEDPMEVRLVQSRRPNEIKKVTKTPEERRKEIEVRVAAARLLQQKSES  299

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              QS N+GER   +LD S+G+GQR  +RR+  + RKN S+ ERRD V +YWNS+S D+KK 
Sbjct  300   PQSPNEGERDDRALDSSSGSGQRIGDRRR--HIRKNSSTAERRDWVLTYWNSLSMDVKKD  357

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LRI + +L SHFGS KD L  +VLSEALS+AEANK WKFW C  C E+F++ E H QHV
Sbjct  358   WLRIELCNLMSHFGSSKDTLPKDVLSEALSYAEANKTWKFWRCSICAEKFSNQEFHRQHV  417

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             +  H+ SLSPK+Q +LPQN++NEW+EM+LNCSWKPLD++AA K+LE + K +   F E+ 
Sbjct  418   MQLHLDSLSPKMQRLLPQNIDNEWIEMILNCSWKPLDVSAAVKMLEYKAKSKGSSFRED-  476

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNE  1970
             Y   D ++   D S+ Y           K++ G     +T +S +Y K  E  + R+G E
Sbjct  477   YLTQDYNDCFKDSSNSYHE---------KESLGYNIGNSTTESSKYYKIVESDV-REGLE  526

Query  1971  GTKIC--PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
               +    P  + WP++DD ERAKLLE+I+ VF+ LI++K L +SHL KVI F++ E+Q L
Sbjct  527   DQQFTANPVPDCWPVSDDKERAKLLEKIHAVFEILIRHKCLAASHLHKVIQFSMGEIQGL  586

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-IDDISTGI  2321
               GS+LL +++DQTP+CICFLGA +LKKIL+FLQE+SH+CGLGRY ++S++ ++D+    
Sbjct  587   AAGSELLKHDVDQTPMCICFLGASQLKKILQFLQEISHACGLGRYADKSSSPMNDLHDIS  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG +  +KIV + D SCLL DE   P ++TP T H+ V  D   +S+         +G  
Sbjct  647   QGPEIKDKIVLNGDASCLLLDECLLPTQVTPGTAHEAVFDDMVTSSSP--------DGIS  698

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              +S  LLSW++     G+QLTSW R+ E+K +Q  E+V+ L+KEF++L GLCE+KCE ++
Sbjct  699   HNSGALLSWLYSSRPVGDQLTSWIRTNEDKIRQGQEMVQKLDKEFFQLNGLCEKKCERIS  758

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEA+Q VEDLCLEEGKKRE+  +FV+RSY+  L++RR+EL+ES ++    + RFE++AI
Sbjct  759   YEEAIQTVEDLCLEEGKKRENVSEFVQRSYESVLRRRREELVESGNDVMYVSNRFELDAI  818

Query  2862  SSVLKDAESLNV-NQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             SSVL++AES+NV  QFG+EDTY G +S LCDLESGEDD+WR+KD L+Q D C+E++IQ+ 
Sbjct  819   SSVLQEAESMNVTTQFGYEDTYAGATSQLCDLESGEDDEWRMKDCLHQMDGCIEMSIQKL  878

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEH S+ELSKIDA I+R VS +QQLE+ L  VSA+DYR ILVPLVKSY++  LEDLAE+D
Sbjct  879   KEHSSIELSKIDAEIIRSVSEVQQLELNLGHVSANDYRAILVPLVKSYIKTLLEDLAEKD  938

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             A EKSDAA EAFLAELA DSKK    G+EN +H  EK +DKKK KD++KT+DLK ++G+ 
Sbjct  939   AREKSDAAGEAFLAELALDSKKVGKGGNENTRHV-EKPKDKKKNKDHKKTRDLKATSGSM  997

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
               +L   T +  S  V  D   +D E+++   + +   EE+ RR+IELE EE+KLEETLE
Sbjct  998   HLSLQSTTLD--SNLVAPDSDYQDHEVASMNDDDLEHHEEDFRRKIELEEEEKKLEETLE  1055

Query  3579  YQRRIENEAKLKHLAEQHKK  3638
              QRRIENEAK KHLAEQ KK
Sbjct  1056  LQRRIENEAKQKHLAEQQKK  1075


 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/409 (73%), Positives = 340/409 (83%), Gaps = 10/409 (2%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G K +++L VED++EERFQADL  AVRQSLDT+ A   LP +    + ++ + ++  V 
Sbjct  1236  NGAKVMKELQVEDEEEERFQADLEMAVRQSLDTYQARGNLPPV---SSLRMPQRSSSQVD  1292

Query  4198  C------EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSE  4356
             C      ED    +  G  + GTGL+NEVGEYNCFLNVIIQSLWH+RRFR EFL RS SE
Sbjct  1293  CSGFSPVEDSTEDVNGGATLLGTGLRNEVGEYNCFLNVIIQSLWHVRRFRVEFLGRSRSE  1352

Query  4357  HIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDAS  4536
             H+HVG+PCVVCALY+IFTAL LAS ++RR+AVAP SLRIALSNLYP    FQE QMNDAS
Sbjct  1353  HVHVGNPCVVCALYEIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDAS  1412

Query  4537  EVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYEC  4716
             EVL VIF+CLH+SFT  S  +D ESV+S+CMGSWDCA  +CI HSLFGMD+FE+MNCY C
Sbjct  1413  EVLAVIFDCLHRSFTRGSNVTDAESVESNCMGSWDCAAGSCIAHSLFGMDIFEQMNCYHC  1472

Query  4717  GLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNH  4896
             GLESRHLKYTSFFHNINA+ALRTMKVM  +SSFD+LLNLVE NHQLACD +  GCGK NH
Sbjct  1473  GLESRHLKYTSFFHNINANALRTMKVMFPESSFDKLLNLVERNHQLACDLEVDGCGKLNH  1532

Query  4897  IHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVV  5076
             IHHFLSTPPHVF TVLGWQNTCES +DITATL ALST+IDISVLYRGLDPKS H LVSVV
Sbjct  1533  IHHFLSTPPHVFMTVLGWQNTCESADDITATLAALSTKIDISVLYRGLDPKSTHNLVSVV  1592

Query  5077  CYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CYYGQHYHCFAYSH+HE+WIMYDDKTVK+IG WADVLT+CERGHLQPQV
Sbjct  1593  CYYGQHYHCFAYSHEHEQWIMYDDKTVKIIGGWADVLTVCERGHLQPQV  1641



>ref|XP_004508791.1| PREDICTED: uncharacterized protein LOC101496590 isoform X1 [Cicer 
arietinum]
Length=1649

 Score =  1048 bits (2709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/1100 (55%), Positives = 806/1100 (73%), Gaps = 33/1100 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S A   VA   +  AA  + +  D  +  V +++L   ++  +   
Sbjct  1     MGHKKRNSAPRSKQSPAASPVAQSPIGGAANGS-ISPDVDSCNVFDQNLPNPNKIELIPS  59

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +  S Y+ IK+ECERALT+ RRGNH +A++LMK+LC K + S   A +YR+ G +C KV
Sbjct  60    QSEGSDYSTIKVECERALTTFRRGNHKRAMKLMKELCLKEDGSSYSAFVYRIHGFICFKV  119

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             ASII D + K RHLK+A++SAR++V +SPNSIE+AHF+A+++ EAA +GK+YEEVV ECE
Sbjct  120   ASIITDCSSKQRHLKHAVESARRAVELSPNSIEYAHFHASVMLEAATEGKDYEEVVHECE  179

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++QKVST E RI HVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  180   RGLAIENPNDPAKETLQDESEQKVSTLEDRITHVQNELRQLIQKSNIASLSSWMKNLSNG  239

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR +EDPME+RLVQ+R+PNEIKK TKTPEERRKEIEVRVAAARLLQQKSES
Sbjct  240   EERFRLIPIRRPTEDPMEVRLVQSRRPNEIKKVTKTPEERRKEIEVRVAAARLLQQKSES  299

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              QS N+GER   +LD S+G+GQR  +RR+  + RKN S+ ERRD V +YWNS+S D+KK 
Sbjct  300   PQSPNEGERDDRALDSSSGSGQRIGDRRR--HIRKNSSTAERRDWVLTYWNSLSMDVKKD  357

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LRI + +L SHFGS KD L  +VLSEALS+AEANK WKFW C  C E+F++ E H QHV
Sbjct  358   WLRIELCNLMSHFGSSKDTLPKDVLSEALSYAEANKTWKFWRCSICAEKFSNQEFHRQHV  417

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             +  H+ SLSPK+Q +LPQN++NEW+EM+LNCSWKPLD++AA K+LE + K +   F E+ 
Sbjct  418   MQLHLDSLSPKMQRLLPQNIDNEWIEMILNCSWKPLDVSAAVKMLEYKAKSKGSSFRED-  476

Query  1791  YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNE  1970
             Y   D ++   D S+ Y           K++ G     +T +S +Y K  E  + R+G E
Sbjct  477   YLTQDYNDCFKDSSNSYHE---------KESLGYNIGNSTTESSKYYKIVESDV-REGLE  526

Query  1971  GTKIC--PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
               +    P  + WP++DD ERAKLLE+I+ VF+ LI++K L +SHL KVI F++ E+Q L
Sbjct  527   DQQFTANPVPDCWPVSDDKERAKLLEKIHAVFEILIRHKCLAASHLHKVIQFSMGEIQGL  586

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA-IDDISTGI  2321
               GS+LL +++DQTP+CICFLGA +LKKIL+FLQE+SH+CGLGRY ++S++ ++D+    
Sbjct  587   AAGSELLKHDVDQTPMCICFLGASQLKKILQFLQEISHACGLGRYADKSSSPMNDLHDIS  646

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG +  +KIV + D SCLL DE   P ++TP T H+ V  D   +S+         +G  
Sbjct  647   QGPEIKDKIVLNGDASCLLLDECLLPTQVTPGTAHEAVFDDMVTSSSP--------DGIS  698

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              +S  LLSW++     G+QLTSW R+ E+K +Q  E+V+ L+KEF++L GLCE+KCE ++
Sbjct  699   HNSGALLSWLYSSRPVGDQLTSWIRTNEDKIRQGQEMVQKLDKEFFQLNGLCEKKCERIS  758

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEA+Q VEDLCLEEGKKRE+  +FV+RSY+  L++RR+EL+ES ++    + RFE++AI
Sbjct  759   YEEAIQTVEDLCLEEGKKRENVSEFVQRSYESVLRRRREELVESGNDVMYVSNRFELDAI  818

Query  2862  SSVLKDAESLNV-NQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             SSVL++AES+NV  QFG+EDTY G +S LCDLESGEDD+WR+KD L+Q D C+E++IQ+ 
Sbjct  819   SSVLQEAESMNVTTQFGYEDTYAGATSQLCDLESGEDDEWRMKDCLHQMDGCIEMSIQKL  878

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KEH S+ELSKIDA I+R VS +QQLE+ L  VSA+DYR ILVPLVKSY++  LEDLAE+D
Sbjct  879   KEHSSIELSKIDAEIIRSVSEVQQLELNLGHVSANDYRAILVPLVKSYIKTLLEDLAEKD  938

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             A EKSDAA EAFLAELA DSKK    G+EN +H  EK +DKKK KD++KT+DLK ++G+ 
Sbjct  939   AREKSDAAGEAFLAELALDSKKVGKGGNENTRHV-EKPKDKKKNKDHKKTRDLKATSGSM  997

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
               +L   T +  S  V  D   +D E+++   + +   EE+ RR+IELE EE+KLEETLE
Sbjct  998   HLSLQSTTLD--SNLVAPDSDYQDHEVASMNDDDLEHHEEDFRRKIELEEEEKKLEETLE  1055

Query  3579  YQRRIENEAKLKHLAEQHKK  3638
              QRRIENEAK KHLAEQ KK
Sbjct  1056  LQRRIENEAKQKHLAEQQKK  1075


 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/409 (73%), Positives = 340/409 (83%), Gaps = 10/409 (2%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G K +++L VED++EERFQADL  AVRQSLDT+ A   LP +    + ++ + ++  V 
Sbjct  1237  NGAKVMKELQVEDEEEERFQADLEMAVRQSLDTYQARGNLPPV---SSLRMPQRSSSQVD  1293

Query  4198  C------EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSE  4356
             C      ED    +  G  + GTGL+NEVGEYNCFLNVIIQSLWH+RRFR EFL RS SE
Sbjct  1294  CSGFSPVEDSTEDVNGGATLLGTGLRNEVGEYNCFLNVIIQSLWHVRRFRVEFLGRSRSE  1353

Query  4357  HIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDAS  4536
             H+HVG+PCVVCALY+IFTAL LAS ++RR+AVAP SLRIALSNLYP    FQE QMNDAS
Sbjct  1354  HVHVGNPCVVCALYEIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDAS  1413

Query  4537  EVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYEC  4716
             EVL VIF+CLH+SFT  S  +D ESV+S+CMGSWDCA  +CI HSLFGMD+FE+MNCY C
Sbjct  1414  EVLAVIFDCLHRSFTRGSNVTDAESVESNCMGSWDCAAGSCIAHSLFGMDIFEQMNCYHC  1473

Query  4717  GLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNH  4896
             GLESRHLKYTSFFHNINA+ALRTMKVM  +SSFD+LLNLVE NHQLACD +  GCGK NH
Sbjct  1474  GLESRHLKYTSFFHNINANALRTMKVMFPESSFDKLLNLVERNHQLACDLEVDGCGKLNH  1533

Query  4897  IHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVV  5076
             IHHFLSTPPHVF TVLGWQNTCES +DITATL ALST+IDISVLYRGLDPKS H LVSVV
Sbjct  1534  IHHFLSTPPHVFMTVLGWQNTCESADDITATLAALSTKIDISVLYRGLDPKSTHNLVSVV  1593

Query  5077  CYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CYYGQHYHCFAYSH+HE+WIMYDDKTVK+IG WADVLT+CERGHLQPQV
Sbjct  1594  CYYGQHYHCFAYSHEHEQWIMYDDKTVKIIGGWADVLTVCERGHLQPQV  1642



>gb|EPS61315.1| hypothetical protein M569_13482 [Genlisea aurea]
Length=1566

 Score =  1041 bits (2692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/1102 (56%), Positives = 787/1102 (71%), Gaps = 40/1102 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVL---VQEKSLIRHDQAVV  533
             MGHKKR + PRSKP  A    A               ++ +V    V E   +  D    
Sbjct  1     MGHKKRTVGPRSKPPNAQPGSAVDDSVVPDGGESKIDNSFSVSPKGVGESLDLETDGR--  58

Query  534   ESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVC  713
              S T+ S+SY  +K+ECERALT+LRRGN NKALRLMKDL +KHE S +LALI RV G VC
Sbjct  59    SSGTDCSTSYGLVKVECERALTALRRGNPNKALRLMKDLSSKHEGSRHLALINRVHGAVC  118

Query  714   VKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQ  893
             VKVASII D   K RHLK A++SAR++V +SPNS+EF+HFYANLLYE A DGK+YEEVVQ
Sbjct  119   VKVASIITDQTTKQRHLKTALESARRAVSLSPNSVEFSHFYANLLYEIATDGKDYEEVVQ  178

Query  894   ECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNF  1070
             ECERAL I+NP+DPAKESLQ ENQQK+ TPEARI HVQ ++R+LIQ+SN+ASISTW+KN 
Sbjct  179   ECERALMIKNPVDPAKESLQEENQQKICTPEARIEHVQNDIRSLIQKSNIASISTWMKNL  238

Query  1071  GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             G+GEEKFRLIPIRR+ EDPMELRL+Q ++PNEIKK TKTPEERRKEIEV+VAAARL+QQK
Sbjct  239   GNGEEKFRLIPIRRVPEDPMELRLIQTKRPNEIKKVTKTPEERRKEIEVKVAAARLMQQK  298

Query  1251  SESAQSFNDGERSLDLS------AGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             SES    NDG+ +   S       G+GQ+  ERR+SGN RKN SS E +  VRSYWNS++
Sbjct  299   SESPNLSNDGDGTSSQSNGGNSFVGSGQKAGERRRSGNIRKNGSSDEMKSWVRSYWNSIN  358

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSE  1592
             +  KK  L+I + DLK+HF S KD  ++E L+EALSF + NK WKF  CC C E+F ++ 
Sbjct  359   SGEKKDFLKISVWDLKAHFSSSKDVTSSEGLAEALSFGQENKIWKFLFCCRCDEKFVEAS  418

Query  1593  SHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVH  1772
               +QHVINEH+  L P++QSVLP  V++EW EMLLN  WKPL+++ A ++  K+ K  + 
Sbjct  419   CFMQHVINEHLNRLLPEMQSVLPLKVDDEWAEMLLNYDWKPLELHTAIQVYRKRSKSGLD  478

Query  1773  GFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM  1952
              F   +  R+DM++ K          + W          D      ++S E++ N E WM
Sbjct  479   DFHAESCQRNDMNDLKQ---------HEWASPLTSGNCADEFTHIPIESNEFE-NVE-WM  527

Query  1953  DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEE  2132
             + DG++ + +   +E+WP++DDPER KLLE+I  +F +L+ +K L SSHL KV++FAVEE
Sbjct  528   ECDGDQDSNLSLLNENWPVSDDPERLKLLEKIQAIFGSLVSSKCLASSHLCKVLNFAVEE  587

Query  2133  LQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIS  2312
             LQSLG  S      ++++PL IC LGAPELKKIL FLQE+S++CG  RYP++S  ID   
Sbjct  588   LQSLGCSSL---SKLEKSPLPICLLGAPELKKILSFLQEISNACGANRYPDKSNGID--F  642

Query  2313  TGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDN  2492
               +QGVD M+KI FSEDGS L+ DE F    +   + H     D  P++    + ++ +N
Sbjct  643   HVLQGVDMMDKIRFSEDGSYLILDEDF----IHLDSLHPSGDDDVKPSALLTPAQVKHEN  698

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
             G   DSD  LSWIF G SS EQL SW+RS+EEK QQ  +I++ LEKE   LQ LC+RK +
Sbjct  699   GFAFDSDSFLSWIFRGPSSSEQLASWTRSKEEKTQQVQKILQSLEKETCHLQALCDRKYQ  758

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HLNYEEALQ VEDLCLE GKKREH  D    SYD  L+KR++EL+E+ +E      RF++
Sbjct  759   HLNYEEALQTVEDLCLEAGKKREHLADIENSSYDSILRKRQEELVENQNEDNVVANRFQL  818

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             EAI++VLKDA S++VNQFG ED Y  ++SHLCDLESGE DDWRVKD L+Q DSC+EVA+Q
Sbjct  819   EAITNVLKDAGSISVNQFGLEDGYSCMTSHLCDLESGE-DDWRVKDNLHQVDSCIEVALQ  877

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE VSVE+SKIDARI+R+V+ M+Q EVKLE  S+ D++ +L+PLVKS+LRA LEDLAE
Sbjct  878   RQKEQVSVEISKIDARILRLVAEMRQFEVKLELASSLDFQSLLIPLVKSFLRARLEDLAE  937

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DA EKSDAAREAFLAELA+DS K +++  +N+KH HEK +DKKK K+ RK KD+K  + 
Sbjct  938   KDAREKSDAAREAFLAELAQDSTKGTSIVIDNSKHVHEKVKDKKKHKESRKNKDMKAKHY  997

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleet  3572
             + L  L+   AEE    + HD   +  E+++ GS+     EEEQ+ +IELEAEERKLEET
Sbjct  998   DELSNLN---AEE----IGHDEDGQGFEIADSGSDDCLLREEEQKLKIELEAEERKLEET  1050

Query  3573  leYQRRIENEAKLKHLAEQHKK  3638
             LEYQRR+ENEAK KHLAEQHK+
Sbjct  1051  LEYQRRMENEAKQKHLAEQHKR  1072


 Score =   535 bits (1379),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 299/404 (74%), Gaps = 40/404 (10%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++G KTLRQL  E++DEERFQADL KAVRQSLD FHAH++LPL+  S   Q     ++  
Sbjct  1192  DNGGKTLRQLKAEEEDEERFQADLKKAVRQSLDAFHAHRQLPLVSSSLKLQKDLPDSVDF  1251

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSS-SEHIHVG  4371
             S        V G + YGTGL+NEVGEYNCFLNVIIQSLWH+RRFRDEFLR S S+HIHVG
Sbjct  1252  SLRH--DNEVTGNDAYGTGLRNEVGEYNCFLNVIIQSLWHVRRFRDEFLRRSLSKHIHVG  1309

Query  4372  DPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGV  4551
             DPCV CALY+IF ALS+ S + +RDAVAP SLR++LSNLYP+   FQEGQMNDASEVLGV
Sbjct  1310  DPCVTCALYEIFIALSMMSKDNKRDAVAPTSLRVSLSNLYPNSNFFQEGQMNDASEVLGV  1369

Query  4552  IFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESR  4731
             IF CLHQSF  AS AS + S   S  GSWDC++ +CI HS+FGMD               
Sbjct  1370  IFHCLHQSF--ASPASVSLSAAESVTGSWDCSDPSCIAHSIFGMD---------------  1412

Query  4732  HLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFL  4911
                                  MC + SFDELLNLVEMNHQLACDPDA GCGK N+IHH L
Sbjct  1413  --------------------AMCSEYSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHIL  1452

Query  4912  STPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQ  5091
             S+PPHVFTTVLGWQNT ESV+DI ATL ALS EIDIS LYRGLDP++KH LVSVVCYYGQ
Sbjct  1453  SSPPHVFTTVLGWQNTSESVDDIKATLSALSMEIDISALYRGLDPQTKHALVSVVCYYGQ  1512

Query  5092  HYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HYHCFA+S + E+WIMYDDKTVK IG W DV+ MCE+GHLQPQV
Sbjct  1513  HYHCFAFSRETEQWIMYDDKTVKAIGGWDDVIAMCEKGHLQPQV  1556



>ref|XP_008453169.1| PREDICTED: uncharacterized protein LOC103493964 isoform X2 [Cucumis 
melo]
Length=1521

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/1074 (57%), Positives = 779/1074 (73%), Gaps = 73/1074 (7%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIY  692
             R D+ VV+ E++   SY+ IKLECE+ALT+LRRGNH KALRLMKDL +++ENS N ALI+
Sbjct  41    RIDRVVVK-ESDEGLSYSAIKLECEKALTALRRGNHTKALRLMKDLSSRNENSVNSALIH  99

Query  693   RVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK  872
             RVQGT+ VKVASIIDDP+ K RHLKNAI+SARK+V +SP+SIEF+HFYANLLYEAAND K
Sbjct  100   RVQGTLLVKVASIIDDPSTKQRHLKNAIESARKAVQLSPDSIEFSHFYANLLYEAANDAK  159

Query  873   EYEEVVQECERALAIENPIDPAKESLQENQ-QKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             EYEEVV+ECERAL IENPIDPAKESLQ+ Q QK+ T EARI HVQ ELR LIQ+S++ SI
Sbjct  160   EYEEVVRECERALVIENPIDPAKESLQDEQNQKIPTAEARITHVQTELRQLIQKSSIYSI  219

Query  1050  STWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAA  1229
             S+W+KN G+GEEKFRLIP+RR++EDPME+ +VQAR+ NEIKKATKTPEERRK+IEVRVAA
Sbjct  220   SSWMKNLGNGEEKFRLIPLRRVTEDPMEVGMVQARRANEIKKATKTPEERRKQIEVRVAA  279

Query  1230  ARLLQQKSESAQSFNDGE-----------------------RSLDLSAGTGQRGNERRKS  1340
             ARL+QQ+SES    ++G                        R+ + S G+  R  ERRK 
Sbjct  280   ARLMQQQSESPPMQDEGGKADRTPDSSSGSVRTQETSSGSVRNQETSPGSVTRVVERRKH  339

Query  1341  GNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALS  1520
             G+ RK  SS ER++ V S WNSMS++ KK +L+I+I DL++HF SLKD  ANE +SEALS
Sbjct  340   GSVRKLGSSAERKNWVYSLWNSMSSESKKDVLKIKISDLETHFSSLKDTSANEFISEALS  399

Query  1521  FAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLN  1700
             F +ANK WKFW CC C ++F + ESH+ HV  EH+ +L PK+QS+LP NV+N+W EMLLN
Sbjct  400   FYDANKTWKFWVCCKCDKKFVNPESHMHHVAQEHLGNLLPKMQSMLPHNVDNDWSEMLLN  459

Query  1701  CSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR--SDMDESKDDISDPYCNVYGWDRSPI  1874
             CSWKPLD++A  K+   Q KC+   F+E+   +  S+ DE         C    WD SP 
Sbjct  460   CSWKPLDVSATTKMFTDQTKCKDSEFVEDMCPQRFSECDE---------CLKDAWDSSPE  510

Query  1875  KKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINV  2054
             K+   +  N    +S+ Y+K S        N G +I    +S+P++DDPERAKLLE+I  
Sbjct  511   KQDHENILN----ESKLYEKIS--------NSGYQI---PDSFPVSDDPERAKLLEKIRA  555

Query  2055  VFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKIL  2234
             VF+ LIK+KYL +S L+K+I F ++ELQ +  G  LL   +DQTP CICFLGA +L+KIL
Sbjct  556   VFELLIKHKYLAASQLNKIIQFTMDELQGIVSGPHLLKQGLDQTPQCICFLGASQLRKIL  615

Query  2235  KFLQELSHSCGLGRYPERST-AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLT  2411
             KFLQELS S G+GRY +RST   +D  +  Q V+  EKIVF+ D S LL +E     K T
Sbjct  616   KFLQELSQSSGVGRYSDRSTDQNEDSKSDKQSVEVEEKIVFNGDASLLLLNEGLLSSK-T  674

Query  2412  PITFHDGVVTDsnpnsaaissniQCDNGGLLDSDE-LLSWIFMGTSSGEQLTSWSRSREE  2588
             P   H   V+D            Q      ++SD+  LSWI+   SSGEQL SW++++EE
Sbjct  675   P---H---VSD------------QMPAASEVNSDDPFLSWIYASPSSGEQLASWAKTKEE  716

Query  2589  KAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRS  2768
             K Q   E  + LEKEFY+LQ LCERKCEHLNYEEALQ VEDLCLEEGKKRE   +F+ +S
Sbjct  717   KKQGQTENFQSLEKEFYQLQNLCERKCEHLNYEEALQSVEDLCLEEGKKREAITEFIPKS  776

Query  2769  YDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLC  2948
             Y+  L+KRR+EL+E+ ++A     RFE++A+++VLK+AE+LNVNQ G+ + +  I S L 
Sbjct  777   YESVLRKRREELIEAENDAMYIGSRFELDALTNVLKEAEALNVNQLGYGENFASIPSQLY  836

Query  2949  DLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLE  3128
             DLESGED+ WR KDYL+Q D+C+EVAI+RQKE +S+E+SKID RIMR V+GMQ+LE+KL+
Sbjct  837   DLESGEDEGWRAKDYLHQVDTCIEVAIKRQKEQLSIEISKIDGRIMRNVTGMQELELKLD  896

Query  3129  SVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSEN  3308
              VSAHDY+ IL+PLV SYLRAHLEDLAE+D T+KSDAAREAFLAEL RDSKK S  GS+N
Sbjct  897   PVSAHDYQSILLPLVNSYLRAHLEDLAEKDVTKKSDAAREAFLAELERDSKKDSKGGSDN  956

Query  3309  AKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS-N  3485
              KH+ EK+++KKK K++RK KD K  +    +  H +  +  +F V  DG + + +++ +
Sbjct  957   LKHAREKSKEKKKSKEFRKAKDSKLVSVREQNVPHDEVVDRDTFQVPSDGDAAEVDIAVS  1016

Query  3486  GGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
               S+++  EEEE RR+IELEA+ERKLEETLEYQRRIE EAK KHLAE  KK A+
Sbjct  1017  ENSDALRLEEEEIRRKIELEADERKLEETLEYQRRIEKEAKQKHLAELQKKSAQ  1070


 Score =   432 bits (1111),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 259/330 (78%), Gaps = 11/330 (3%)
 Frame = +1

Query  3952  ENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQ  4131
             +N+ V  V P        H+ ++  KTLRQ   EDD E++FQADL KAVR+SLD F   Q
Sbjct  1184  DNLPVDSVNP--------HSEDNSTKTLRQQQAEDD-EKQFQADLKKAVRESLDAFQEKQ  1234

Query  4132  KLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLW  4311
               P      T++  E+ +  +   ++  G V G ++ GTGLKNE+GEYNCFLNVIIQSLW
Sbjct  1235  NFPSSSTPSTSR-GEVDSTDLPSNELNAGNVQGADICGTGLKNEIGEYNCFLNVIIQSLW  1293

Query  4312  HLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNL  4488
             HLRRFR+EFLR S  +H+HVGDPCVVCALYDIFTALS+AS++ R++AVAP SLRIALS L
Sbjct  1294  HLRRFREEFLRRSKIKHVHVGDPCVVCALYDIFTALSMASADARKEAVAPTSLRIALSTL  1353

Query  4489  YPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVH  4668
              PD   FQEGQMNDASEVL VIF+CLHQS T +   SDTESV+S+CMGSWDCA+  C+VH
Sbjct  1354  CPDNKFFQEGQMNDASEVLAVIFDCLHQSLTPSLSISDTESVESNCMGSWDCASDTCLVH  1413

Query  4669  SLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNH  4848
             S+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +SSFDELLN+VEMNH
Sbjct  1414  SIFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKVMCTESSFDELLNVVEMNH  1473

Query  4849  QLACDPDARGCGKHNHIHHFLSTPPHVFTT  4938
             QLACD D  GCGK N+IHHFL+ PPHVFTT
Sbjct  1474  QLACDLDVGGCGKLNYIHHFLTAPPHVFTT  1503



>ref|XP_008453168.1| PREDICTED: uncharacterized protein LOC103493964 isoform X1 [Cucumis 
melo]
Length=1605

 Score =  1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/1074 (57%), Positives = 779/1074 (73%), Gaps = 73/1074 (7%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIY  692
             R D+ VV+ E++   SY+ IKLECE+ALT+LRRGNH KALRLMKDL +++ENS N ALI+
Sbjct  41    RIDRVVVK-ESDEGLSYSAIKLECEKALTALRRGNHTKALRLMKDLSSRNENSVNSALIH  99

Query  693   RVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK  872
             RVQGT+ VKVASIIDDP+ K RHLKNAI+SARK+V +SP+SIEF+HFYANLLYEAAND K
Sbjct  100   RVQGTLLVKVASIIDDPSTKQRHLKNAIESARKAVQLSPDSIEFSHFYANLLYEAANDAK  159

Query  873   EYEEVVQECERALAIENPIDPAKESLQENQ-QKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             EYEEVV+ECERAL IENPIDPAKESLQ+ Q QK+ T EARI HVQ ELR LIQ+S++ SI
Sbjct  160   EYEEVVRECERALVIENPIDPAKESLQDEQNQKIPTAEARITHVQTELRQLIQKSSIYSI  219

Query  1050  STWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAA  1229
             S+W+KN G+GEEKFRLIP+RR++EDPME+ +VQAR+ NEIKKATKTPEERRK+IEVRVAA
Sbjct  220   SSWMKNLGNGEEKFRLIPLRRVTEDPMEVGMVQARRANEIKKATKTPEERRKQIEVRVAA  279

Query  1230  ARLLQQKSESAQSFNDGE-----------------------RSLDLSAGTGQRGNERRKS  1340
             ARL+QQ+SES    ++G                        R+ + S G+  R  ERRK 
Sbjct  280   ARLMQQQSESPPMQDEGGKADRTPDSSSGSVRTQETSSGSVRNQETSPGSVTRVVERRKH  339

Query  1341  GNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALS  1520
             G+ RK  SS ER++ V S WNSMS++ KK +L+I+I DL++HF SLKD  ANE +SEALS
Sbjct  340   GSVRKLGSSAERKNWVYSLWNSMSSESKKDVLKIKISDLETHFSSLKDTSANEFISEALS  399

Query  1521  FAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLN  1700
             F +ANK WKFW CC C ++F + ESH+ HV  EH+ +L PK+QS+LP NV+N+W EMLLN
Sbjct  400   FYDANKTWKFWVCCKCDKKFVNPESHMHHVAQEHLGNLLPKMQSMLPHNVDNDWSEMLLN  459

Query  1701  CSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR--SDMDESKDDISDPYCNVYGWDRSPI  1874
             CSWKPLD++A  K+   Q KC+   F+E+   +  S+ DE   D          WD SP 
Sbjct  460   CSWKPLDVSATTKMFTDQTKCKDSEFVEDMCPQRFSECDECLKD---------AWDSSPE  510

Query  1875  KKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINV  2054
             K+   +  N    +S+ Y+K S        N G +I    +S+P++DDPERAKLLE+I  
Sbjct  511   KQDHENILN----ESKLYEKIS--------NSGYQI---PDSFPVSDDPERAKLLEKIRA  555

Query  2055  VFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKIL  2234
             VF+ LIK+KYL +S L+K+I F ++ELQ +  G  LL   +DQTP CICFLGA +L+KIL
Sbjct  556   VFELLIKHKYLAASQLNKIIQFTMDELQGIVSGPHLLKQGLDQTPQCICFLGASQLRKIL  615

Query  2235  KFLQELSHSCGLGRYPERST-AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLT  2411
             KFLQELS S G+GRY +RST   +D  +  Q V+  EKIVF+ D S LL +E     K T
Sbjct  616   KFLQELSQSSGVGRYSDRSTDQNEDSKSDKQSVEVEEKIVFNGDASLLLLNEGLLSSK-T  674

Query  2412  PITFHDGVVTDsnpnsaaissniQCDNGGLLDSDE-LLSWIFMGTSSGEQLTSWSRSREE  2588
             P   H   V+D            Q      ++SD+  LSWI+   SSGEQL SW++++EE
Sbjct  675   P---H---VSD------------QMPAASEVNSDDPFLSWIYASPSSGEQLASWAKTKEE  716

Query  2589  KAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRS  2768
             K Q   E  + LEKEFY+LQ LCERKCEHLNYEEALQ VEDLCLEEGKKRE   +F+ +S
Sbjct  717   KKQGQTENFQSLEKEFYQLQNLCERKCEHLNYEEALQSVEDLCLEEGKKREAITEFIPKS  776

Query  2769  YDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLC  2948
             Y+  L+KRR+EL+E+ ++A     RFE++A+++VLK+AE+LNVNQ G+ + +  I S L 
Sbjct  777   YESVLRKRREELIEAENDAMYIGSRFELDALTNVLKEAEALNVNQLGYGENFASIPSQLY  836

Query  2949  DLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLE  3128
             DLESGED+ WR KDYL+Q D+C+EVAI+RQKE +S+E+SKID RIMR V+GMQ+LE+KL+
Sbjct  837   DLESGEDEGWRAKDYLHQVDTCIEVAIKRQKEQLSIEISKIDGRIMRNVTGMQELELKLD  896

Query  3129  SVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSEN  3308
              VSAHDY+ IL+PLV SYLRAHLEDLAE+D T+KSDAAREAFLAEL RDSKK S  GS+N
Sbjct  897   PVSAHDYQSILLPLVNSYLRAHLEDLAEKDVTKKSDAAREAFLAELERDSKKDSKGGSDN  956

Query  3309  AKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS-N  3485
              KH+ EK+++KKK K++RK KD K  +    +  H +  +  +F V  DG + + +++ +
Sbjct  957   LKHAREKSKEKKKSKEFRKAKDSKLVSVREQNVPHDEVVDRDTFQVPSDGDAAEVDIAVS  1016

Query  3486  GGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
               S+++  EEEE RR+IELEA+ERKLEETLEYQRRIE EAK KHLAE  KK A+
Sbjct  1017  ENSDALRLEEEEIRRKIELEADERKLEETLEYQRRIEKEAKQKHLAELQKKSAQ  1070


 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/425 (71%), Positives = 345/425 (81%), Gaps = 11/425 (3%)
 Frame = +1

Query  3952  ENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQ  4131
             +N+ V  V P        H+ ++  KTLRQ   EDD E++FQADL KAVR+SLD F   Q
Sbjct  1184  DNLPVDSVNP--------HSEDNSTKTLRQQQAEDD-EKQFQADLKKAVRESLDAFQEKQ  1234

Query  4132  KLPLIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLW  4311
               P      T++  E+ +  +   ++  G V G ++ GTGLKNE+GEYNCFLNVIIQSLW
Sbjct  1235  NFPSSSTPSTSR-GEVDSTDLPSNELNAGNVQGADICGTGLKNEIGEYNCFLNVIIQSLW  1293

Query  4312  HLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNL  4488
             HLRRFR+EFLR S  +H+HVGDPCVVCALYDIFTALS+AS++ R++AVAP SLRIALS L
Sbjct  1294  HLRRFREEFLRRSKIKHVHVGDPCVVCALYDIFTALSMASADARKEAVAPTSLRIALSTL  1353

Query  4489  YPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVH  4668
              PD   FQEGQMNDASEVL VIF+CLHQS T +   SDTESV+S+CMGSWDCA+  C+VH
Sbjct  1354  CPDNKFFQEGQMNDASEVLAVIFDCLHQSLTPSLSISDTESVESNCMGSWDCASDTCLVH  1413

Query  4669  SLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNH  4848
             S+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +SSFDELLN+VEMNH
Sbjct  1414  SIFGMDIFERMNCYSCGLESRHLKYTSFFHNINASALRTMKVMCTESSFDELLNVVEMNH  1473

Query  4849  QLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVL  5028
             QLACD D  GCGK N+IHHFL+ PPHVFTTVLGWQNTCES +DITATL AL TEIDISVL
Sbjct  1474  QLACDLDVGGCGKLNYIHHFLTAPPHVFTTVLGWQNTCESADDITATLAALDTEIDISVL  1533

Query  5029  YRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGH  5208
             YRGLDPKS H LVSVVCYYGQHYHCFAYSHD + WI YDD+TVKVIG+W DVLTMCE+GH
Sbjct  1534  YRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDKKCWIKYDDRTVKVIGDWLDVLTMCEKGH  1593

Query  5209  LQPQV  5223
             LQPQV
Sbjct  1594  LQPQV  1598



>ref|XP_006579548.1| PREDICTED: uncharacterized protein LOC100799759 isoform X1 [Glycine 
max]
Length=1625

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1107 (54%), Positives = 786/1107 (71%), Gaps = 48/1107 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S+A       A          ++DT A  V + +  + + A ++SE
Sbjct  1     MGHKKRNPAPRSKQSLAAATANGGATSP-------DADT-ACNVSDHNPRKIELATLQSE  52

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S Y+ IKLECERALT+LRRGNH KA++ +K++CA+ E SP+ A + RV   +C K 
Sbjct  53    ---GSDYSTIKLECERALTTLRRGNHTKAMKQLKEICAREEGSPHAAFVNRVHSLMCFKT  109

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             A++I DP+ K RHL+NA++SAR++V + PNS+E+AHF A ++ EAA++GK+YEEVV ECE
Sbjct  110   ATVITDPSSKQRHLRNALESARRAVELMPNSVEYAHFRATVMLEAASEGKDYEEVVHECE  169

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++QK S+ E RIAHVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  170   RGLAIENPSDPAKETLQDESEQKASSLEERIAHVQNELRQLIQKSNIASLSSWMKNLSNG  229

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR  EDPME+RLVQ R+PNEIKK +KTPEERRKEIEVRVAAARL+Q+ SES
Sbjct  230   EERFRLIPIRRTPEDPMEVRLVQTRRPNEIKKVSKTPEERRKEIEVRVAAARLIQKNSES  289

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              QS N+G+R    LD SAG+GQR  +RR+ GN RK+  S ER   V SYWNS+S DMKK 
Sbjct  290   PQSANEGDRDDRQLDSSAGSGQRIGDRRRHGNVRKSGFSAERMKWVHSYWNSVSMDMKKD  349

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LR++I DLKSH+GS KD L N++LSEAL +A ANK WKFW CC+C E+ ++ +SH  HV
Sbjct  350   FLRVKIYDLKSHYGSSKDTLPNDILSEALFYAGANKTWKFWPCCNCEEKHSNPDSHRHHV  409

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SLSP++Q +LP NV++EW+EM+LNCSWKPLDI AA ++L  + K +     E+ 
Sbjct  410   VQEHMGSLSPQMQRLLPHNVDSEWIEMILNCSWKPLDILAAVRMLYNKAKFKSSSLPEDL  469

Query  1791  YTRS---DMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y      D ++   D S  Y           K++ GD     +V+   + K     ++ D
Sbjct  470   YLDHHALDYNDCFKDASSSYIE---------KESSGDSLPNCSVECNNHYK----IIEND  516

Query  1962  GNEGTK-----ICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
               EG +       P  + WP++DDPERAKLL +I+ +F+TLIK+K L +SHL+KVI F +
Sbjct  517   VREGVEDQLSMANPIIDCWPVSDDPERAKLLGKIHAIFETLIKHKCLAASHLNKVIQFTM  576

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAID  2303
              E+Q L  GSQLLN+ +DQTP+C+CFLGA +LK I +FLQE+SH+CGL R  ++  +  +
Sbjct  577   GEIQGLAAGSQLLNHGVDQTPMCMCFLGATQLKTIFQFLQEISHACGLARNADKGGSPTN  636

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +  +KIV   D SCLL DE     ++T  T    V+ D    S+       
Sbjct  637   DLLNISQGPEIKDKIVLDGDASCLLLDECLLQTQVTAGTVQGTVLDDVTTPSSP------  690

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               +G    +D LLSWIF  +  G+QLTSW R+RE+K  +  EIV+LLEKEFY LQGLCE+
Sbjct  691   --DGISCYNDALLSWIFSCSPIGDQLTSWLRTREDKLNKGKEIVQLLEKEFYHLQGLCEK  748

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             K E ++YEEALQ VEDLCLEEGKKRE   +FV+RSY+  L+KRR+EL+ES ++    + R
Sbjct  749   KGERVSYEEALQTVEDLCLEEGKKRETVGEFVQRSYESVLRKRREELIESENDMMYVSNR  808

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AIS+VL++AE+ NVNQFG+E+TY G++S LCDLESGE+D+WR+KDYL+Q D C+E 
Sbjct  809   FELDAISNVLQEAEARNVNQFGYEETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIEN  868

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQ+ KEH+S+ELSKIDARI+R V+ MQQLE KL  +SA+DYR ILVPLVKSYLRA L+D
Sbjct  869   AIQKLKEHLSIELSKIDARIIRSVTEMQQLEFKLGPISANDYRAILVPLVKSYLRALLDD  928

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DA EKSDA  EA LAE+A DSKK+   GSE+ +H  EKT+DKKK KD+RK +DLK 
Sbjct  929   LAEKDAREKSDAVSEALLAEIALDSKKAVKGGSESTRHV-EKTKDKKKNKDHRKARDLKV  987

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             ++G+   +L   T +  S  V  +    D E+     + + Q EEE RR+IELE EE+KL
Sbjct  988   ASGHAQFSLGSTTPD--SNLVAPESDFPDNEVVAMNDDDLEQLEEEFRRKIELEEEEKKL  1045

Query  3564  eetleYQRRIENEAKLKHLAEQHKKGA  3644
             EETLE+QRRIENEAK KHLAEQ KK +
Sbjct  1046  EETLEFQRRIENEAKQKHLAEQQKKSS  1072


 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/444 (69%), Positives = 345/444 (78%), Gaps = 11/444 (2%)
 Frame = +1

Query  3925  KCPPVTSGAENIE-------VGEVRPVDDSLEKKHAGES-GPKTLRQLHVEDDDEERFQA  4080
             K  PV+SG ENIE       + E   ++ + +  +  ++ G K + +L VED +EERFQA
Sbjct  1175  KFEPVSSGQENIEDTHTDYHLREQFKLNSNQDVNNVWQNNGSKVMGELQVEDAEEERFQA  1234

Query  4081  DLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDV--ATGIVNGIEVYGTGL  4254
             DL  AVRQSLDT+ A   L  +      Q +      V C  V  +T  VNG  + GTGL
Sbjct  1235  DLKMAVRQSLDTYQARGNLHSVSSLRMPQRASSQEDSVDCLPVEDSTDNVNGATLLGTGL  1294

Query  4255  KNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASS  4431
             KNEVGEYNCFLNVIIQSLWHLRRFR EFL RS SEH HVG+PCVVCALY+IFTAL  AS 
Sbjct  1295  KNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRSEHDHVGNPCVVCALYEIFTALDTASK  1354

Query  4432  ETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTES  4611
             ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL VIF+CLH+SF   S  SD ES
Sbjct  1355  DSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLSVIFDCLHRSFICGSSVSDAES  1414

Query  4612  VDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMK  4791
              +S+CMGSWDCAN +CI HSLFGM++FE+MNCY CGLESRH+KYTSFFHNINASALRTMK
Sbjct  1415  AESNCMGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLESRHMKYTSFFHNINASALRTMK  1474

Query  4792  VMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESV  4971
                 +SSFD+LLNLVEMNHQLACD +A GCGK NHIHHFLSTPPHVF TVLGWQNT ES 
Sbjct  1475  DTFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESA  1534

Query  4972  EDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDK  5151
             +DIT TL ALST+ID SVLY GLDPK  H LVSVVCYYGQHYHCFAYSHDHE+WIMYDDK
Sbjct  1535  DDITETLAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDK  1594

Query  5152  TVKVIGNWADVLTMCERGHLQPQV  5223
             TVKVIG WADVLTMCERGHLQPQV
Sbjct  1595  TVKVIGGWADVLTMCERGHLQPQV  1618



>ref|XP_006579549.1| PREDICTED: uncharacterized protein LOC100799759 isoform X2 [Glycine 
max]
Length=1624

 Score =  1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1107 (54%), Positives = 786/1107 (71%), Gaps = 48/1107 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S+A       A          ++DT A  V + +  + + A ++SE
Sbjct  1     MGHKKRNPAPRSKQSLAAATANGGATSP-------DADT-ACNVSDHNPRKIELATLQSE  52

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S Y+ IKLECERALT+LRRGNH KA++ +K++CA+ E SP+ A + RV   +C K 
Sbjct  53    ---GSDYSTIKLECERALTTLRRGNHTKAMKQLKEICAREEGSPHAAFVNRVHSLMCFKT  109

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             A++I DP+ K RHL+NA++SAR++V + PNS+E+AHF A ++ EAA++GK+YEEVV ECE
Sbjct  110   ATVITDPSSKQRHLRNALESARRAVELMPNSVEYAHFRATVMLEAASEGKDYEEVVHECE  169

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++QK S+ E RIAHVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  170   RGLAIENPSDPAKETLQDESEQKASSLEERIAHVQNELRQLIQKSNIASLSSWMKNLSNG  229

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR  EDPME+RLVQ R+PNEIKK +KTPEERRKEIEVRVAAARL+Q+ SES
Sbjct  230   EERFRLIPIRRTPEDPMEVRLVQTRRPNEIKKVSKTPEERRKEIEVRVAAARLIQKNSES  289

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              QS N+G+R    LD SAG+GQR  +RR+ GN RK+  S ER   V SYWNS+S DMKK 
Sbjct  290   PQSANEGDRDDRQLDSSAGSGQRIGDRRRHGNVRKSGFSAERMKWVHSYWNSVSMDMKKD  349

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LR++I DLKSH+GS KD L N++LSEAL +A ANK WKFW CC+C E+ ++ +SH  HV
Sbjct  350   FLRVKIYDLKSHYGSSKDTLPNDILSEALFYAGANKTWKFWPCCNCEEKHSNPDSHRHHV  409

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SLSP++Q +LP NV++EW+EM+LNCSWKPLDI AA ++L  + K +     E+ 
Sbjct  410   VQEHMGSLSPQMQRLLPHNVDSEWIEMILNCSWKPLDILAAVRMLYNKAKFKSSSLPEDL  469

Query  1791  YTRS---DMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y      D ++   D S  Y           K++ GD     +V+   + K     ++ D
Sbjct  470   YLDHHALDYNDCFKDASSSYIE---------KESSGDSLPNCSVECNNHYK----IIEND  516

Query  1962  GNEGTK-----ICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
               EG +       P  + WP++DDPERAKLL +I+ +F+TLIK+K L +SHL+KVI F +
Sbjct  517   VREGVEDQLSMANPIIDCWPVSDDPERAKLLGKIHAIFETLIKHKCLAASHLNKVIQFTM  576

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAID  2303
              E+Q L  GSQLLN+ +DQTP+C+CFLGA +LK I +FLQE+SH+CGL R  ++  +  +
Sbjct  577   GEIQGLAAGSQLLNHGVDQTPMCMCFLGATQLKTIFQFLQEISHACGLARNADKGGSPTN  636

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +  +KIV   D SCLL DE     ++T  T    V+ D    S+       
Sbjct  637   DLLNISQGPEIKDKIVLDGDASCLLLDECLLQTQVTAGTVQGTVLDDVTTPSSP------  690

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               +G    +D LLSWIF  +  G+QLTSW R+RE+K  +  EIV+LLEKEFY LQGLCE+
Sbjct  691   --DGISCYNDALLSWIFSCSPIGDQLTSWLRTREDKLNKGKEIVQLLEKEFYHLQGLCEK  748

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             K E ++YEEALQ VEDLCLEEGKKRE   +FV+RSY+  L+KRR+EL+ES ++    + R
Sbjct  749   KGERVSYEEALQTVEDLCLEEGKKRETVGEFVQRSYESVLRKRREELIESENDMMYVSNR  808

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AIS+VL++AE+ NVNQFG+E+TY G++S LCDLESGE+D+WR+KDYL+Q D C+E 
Sbjct  809   FELDAISNVLQEAEARNVNQFGYEETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIEN  868

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQ+ KEH+S+ELSKIDARI+R V+ MQQLE KL  +SA+DYR ILVPLVKSYLRA L+D
Sbjct  869   AIQKLKEHLSIELSKIDARIIRSVTEMQQLEFKLGPISANDYRAILVPLVKSYLRALLDD  928

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DA EKSDA  EA LAE+A DSKK+   GSE+ +H  EKT+DKKK KD+RK +DLK 
Sbjct  929   LAEKDAREKSDAVSEALLAEIALDSKKAVKGGSESTRHV-EKTKDKKKNKDHRKARDLKV  987

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             ++G+   +L   T +  S  V  +    D E+     + + Q EEE RR+IELE EE+KL
Sbjct  988   ASGHAQFSLGSTTPD--SNLVAPESDFPDNEVVAMNDDDLEQLEEEFRRKIELEEEEKKL  1045

Query  3564  eetleYQRRIENEAKLKHLAEQHKKGA  3644
             EETLE+QRRIENEAK KHLAEQ KK +
Sbjct  1046  EETLEFQRRIENEAKQKHLAEQQKKSS  1072


 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/444 (69%), Positives = 345/444 (78%), Gaps = 11/444 (2%)
 Frame = +1

Query  3925  KCPPVTSGAENIE-------VGEVRPVDDSLEKKHAGES-GPKTLRQLHVEDDDEERFQA  4080
             K  PV+SG ENIE       + E   ++ + +  +  ++ G K + +L VED +EERFQA
Sbjct  1174  KFEPVSSGQENIEDTHTDYHLREQFKLNSNQDVNNVWQNNGSKVMGELQVEDAEEERFQA  1233

Query  4081  DLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDV--ATGIVNGIEVYGTGL  4254
             DL  AVRQSLDT+ A   L  +      Q +      V C  V  +T  VNG  + GTGL
Sbjct  1234  DLKMAVRQSLDTYQARGNLHSVSSLRMPQRASSQEDSVDCLPVEDSTDNVNGATLLGTGL  1293

Query  4255  KNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASS  4431
             KNEVGEYNCFLNVIIQSLWHLRRFR EFL RS SEH HVG+PCVVCALY+IFTAL  AS 
Sbjct  1294  KNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRSEHDHVGNPCVVCALYEIFTALDTASK  1353

Query  4432  ETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTES  4611
             ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL VIF+CLH+SF   S  SD ES
Sbjct  1354  DSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLSVIFDCLHRSFICGSSVSDAES  1413

Query  4612  VDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMK  4791
              +S+CMGSWDCAN +CI HSLFGM++FE+MNCY CGLESRH+KYTSFFHNINASALRTMK
Sbjct  1414  AESNCMGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLESRHMKYTSFFHNINASALRTMK  1473

Query  4792  VMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESV  4971
                 +SSFD+LLNLVEMNHQLACD +A GCGK NHIHHFLSTPPHVF TVLGWQNT ES 
Sbjct  1474  DTFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESA  1533

Query  4972  EDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDK  5151
             +DIT TL ALST+ID SVLY GLDPK  H LVSVVCYYGQHYHCFAYSHDHE+WIMYDDK
Sbjct  1534  DDITETLAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDK  1593

Query  5152  TVKVIGNWADVLTMCERGHLQPQV  5223
             TVKVIG WADVLTMCERGHLQPQV
Sbjct  1594  TVKVIGGWADVLTMCERGHLQPQV  1617



>ref|XP_004138296.1| PREDICTED: uncharacterized protein LOC101212702 [Cucumis sativus]
 ref|XP_004155067.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229576 
[Cucumis sativus]
Length=1594

 Score =  1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/1061 (56%), Positives = 771/1061 (73%), Gaps = 58/1061 (5%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIY  692
             R D+ VV+ E++   SY+ IKLECE+ALT+LRRGNH KALRLMK+L ++ ENS + ALI+
Sbjct  41    RIDRVVVK-ESDEGLSYSAIKLECEKALTALRRGNHTKALRLMKELSSRDENSVHSALIH  99

Query  693   RVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK  872
             RVQGT+ VKVASIIDDP+ K RHLKNAI+SARK+V +SP+SIEF+HFYANLLYEAAND K
Sbjct  100   RVQGTLLVKVASIIDDPSTKQRHLKNAIESARKAVQLSPDSIEFSHFYANLLYEAANDAK  159

Query  873   EYEEVVQECERALAIENPIDPAKESLQENQ-QKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             EYEEVVQECERAL IENPIDPAKESLQ+ Q QK+ T E RI HVQ ELR LIQ+S++ SI
Sbjct  160   EYEEVVQECERALVIENPIDPAKESLQDEQNQKIPTAEGRITHVQTELRQLIQKSSIYSI  219

Query  1050  STWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAA  1229
             S+W+KN G+GEEKFRLIPIRR++EDPME+ +VQAR+ NEIKKATKTPEERRK+IEVRVAA
Sbjct  220   SSWMKNLGNGEEKFRLIPIRRVTEDPMEVGMVQARRANEIKKATKTPEERRKQIEVRVAA  279

Query  1230  ARLLQQKSESAQSFNDGERS----------LDLSAGTGQRGNERRK-SGNARKNVSSMER  1376
             ARL+QQ+SES    ++G ++           D   G   R  ERRK  G+ RK  SS ER
Sbjct  280   ARLMQQQSESPPMQDEGSKADRTTPDSSSGSDTPPGPVTRVVERRKHGGSVRKLGSSAER  339

Query  1377  RDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWT  1556
             ++ V S WNSMS++ KK +L+I+  DL++HF SLKD  ANE +SEALSF +ANK WKFW 
Sbjct  340   KNWVYSLWNSMSSESKKDVLKIKTNDLETHFSSLKDTSANEFISEALSFYDANKTWKFWV  399

Query  1557  CCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAA  1736
             CC C ++F +SESH+ HV  EH+ +L PK+QS+LP NV+N+W EMLLNC WKPLD++AA 
Sbjct  400   CCKCDKKFVNSESHMHHVAQEHLGNLLPKMQSMLPHNVDNDWSEMLLNCPWKPLDVSAAT  459

Query  1737  KLLEKQLKCRVHGFLENTYTR--SDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTT  1910
             K+   Q KC+   F+E+   +  S+ DE         C    WD SP K+   +  N   
Sbjct  460   KMFTDQTKCKDSEFVEDMCPQRHSECDE---------CIKDAWDFSPEKQDHENSLN---  507

Query  1911  VDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLG  2090
              +S+ Y+K +        N G    P  +S+P++DD ERAKLLE+I+ VF+ LIK+KYL 
Sbjct  508   -ESKLYEKIN--------NSGY---PIPDSFPVSDDSERAKLLEKIHAVFELLIKHKYLA  555

Query  2091  SSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGL  2270
             +S L+K+I F ++ELQ +  GS LL   +DQTP CICFLGA +L+KILKFLQELS SCG+
Sbjct  556   ASQLNKIIQFTMDELQGIVSGSHLLKQGLDQTPQCICFLGASQLRKILKFLQELSQSCGV  615

Query  2271  GRYPERST-AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDs  2447
             GRY +RST  I+D  +  Q VD  E+IVF+ D S LL +E     K++ ++      ++ 
Sbjct  616   GRYSDRSTDQIEDSKSDKQSVDVEERIVFNGDASLLLLNECLLSSKISHVSDQMPAASEV  675

Query  2448  npnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLE  2627
             +                  D D  L+WI+   SSG+QL SW++++EEK Q   E  + LE
Sbjct  676   SS-----------------DVDPFLAWIYASPSSGDQLASWAKTKEEKKQGQTENFQSLE  718

Query  2628  KEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELM  2807
             KEFY+LQ LCERKCEHLNYEEALQ VEDLCLEEGKKRE   +F+ +SY+  L+KRR+EL+
Sbjct  719   KEFYQLQNLCERKCEHLNYEEALQSVEDLCLEEGKKREVITEFIPKSYESILRKRREELI  778

Query  2808  ESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVK  2987
             ES ++A     RFE++A+++VLK+AE+LN NQ G+ + +  + S L DLESGED+ WR K
Sbjct  779   ESENDAMYIGSRFELDALTNVLKEAEALNANQLGYGENFASVPSQLYDLESGEDEGWRAK  838

Query  2988  DYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVP  3167
             DYL+Q D+C+E+AI+RQKE +S+E+SKID RIMR V+GMQ+LE+KLE VSAHDY+ IL+P
Sbjct  839   DYLHQVDTCIEIAIKRQKEQLSIEISKIDGRIMRNVTGMQELELKLEPVSAHDYQSILLP  898

Query  3168  LVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkk  3347
             LV SYLRAHLE+LAE D T+KSDAAREAFLAEL RDSKK S  GS+N KH+ EK+++KKK
Sbjct  899   LVNSYLRAHLEELAEIDVTKKSDAAREAFLAELERDSKKDSKGGSDNPKHAREKSKEKKK  958

Query  3348  ikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS-NGGSNSITQeeeeq  3524
              K++RK KD K  +    +  H +  +  +F V  DG   + +++ +  S+++  EEEE 
Sbjct  959   SKEFRKAKDSKLVSVREQNVPHDEVVDRDTFQVPSDGDVAEVDIAVSENSDALRLEEEEI  1018

Query  3525  rrrieleaeerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             RR+IELEA+ERKLEETLEYQRRIE EAK KHLAE  KK A+
Sbjct  1019  RRKIELEADERKLEETLEYQRRIEKEAKQKHLAELQKKSAQ  1059


 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/404 (74%), Positives = 336/404 (83%), Gaps = 3/404 (1%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++  KTLRQ H EDD E++FQADL KAV +SLD F   Q  P      T++  E+ +  +
Sbjct  1186  DNSAKTLRQQHAEDD-EKQFQADLKKAVLESLDAFQEKQNFPSSSTPSTSR-GEVDSTDL  1243

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVG  4371
                +   G V G ++ GTGLKNE+GEYNCFLNVIIQSLWHLRRFR EFLR S  EH+HVG
Sbjct  1244  PSNEHNAGNVQGADICGTGLKNEIGEYNCFLNVIIQSLWHLRRFRVEFLRRSKIEHVHVG  1303

Query  4372  DPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGV  4551
             DPCVVCALYDIFTALS+AS++ RR+AVAP SLRIALS L PD   FQEGQMNDASEVL V
Sbjct  1304  DPCVVCALYDIFTALSMASADARREAVAPTSLRIALSTLCPDNKFFQEGQMNDASEVLAV  1363

Query  4552  IFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESR  4731
             IF+CLHQS T++   SDTESV+S+CMGSWDCA+  C+VHS+FGMD+FERMNCY CGLESR
Sbjct  1364  IFDCLHQSLTTSLSISDTESVESNCMGSWDCASDTCLVHSIFGMDIFERMNCYSCGLESR  1423

Query  4732  HLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFL  4911
             HLKYT+FFHNINASALRTMKVMC +SSFDELLN+VEMNHQLACD D  GCGK N+IHHFL
Sbjct  1424  HLKYTTFFHNINASALRTMKVMCTESSFDELLNVVEMNHQLACDLDVGGCGKLNYIHHFL  1483

Query  4912  STPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQ  5091
             + PPHVFTTVLGWQNTCES +DITATL AL+TEIDISVLYRGLDPKS H LVSVVCYYGQ
Sbjct  1484  AAPPHVFTTVLGWQNTCESADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQ  1543

Query  5092  HYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HYHCFAYSHD + WI YDD+TVKVIG W DVLTMCE+GHLQPQV
Sbjct  1544  HYHCFAYSHDKKCWIKYDDRTVKVIGGWLDVLTMCEKGHLQPQV  1587



>gb|KGN63643.1| hypothetical protein Csa_1G008490 [Cucumis sativus]
Length=1608

 Score =  1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1075 (56%), Positives = 771/1075 (72%), Gaps = 72/1075 (7%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIY  692
             R D+ VV+ E++   SY+ IKLECE+ALT+LRRGNH KALRLMK+L ++ ENS + ALI+
Sbjct  41    RIDRVVVK-ESDEGLSYSAIKLECEKALTALRRGNHTKALRLMKELSSRDENSVHSALIH  99

Query  693   RVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK  872
             RVQGT+ VKVASIIDDP+ K RHLKNAI+SARK+V +SP+SIEF+HFYANLLYEAAND K
Sbjct  100   RVQGTLLVKVASIIDDPSTKQRHLKNAIESARKAVQLSPDSIEFSHFYANLLYEAANDAK  159

Query  873   EYEEVVQECERALAIENPIDPAKESLQENQ-QKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             EYEEVVQECERAL IENPIDPAKESLQ+ Q QK+ T E RI HVQ ELR LIQ+S++ SI
Sbjct  160   EYEEVVQECERALVIENPIDPAKESLQDEQNQKIPTAEGRITHVQTELRQLIQKSSIYSI  219

Query  1050  STWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAA  1229
             S+W+KN G+GEEKFRLIPIRR++EDPME+ +VQAR+ NEIKKATKTPEERRK+IEVRVAA
Sbjct  220   SSWMKNLGNGEEKFRLIPIRRVTEDPMEVGMVQARRANEIKKATKTPEERRKQIEVRVAA  279

Query  1230  ARLLQQKSESAQSFNDGE------------------------RSLDLSAGTGQRGNERRK  1337
             ARL+QQ+SES    ++G                         R+ D   G   R  ERRK
Sbjct  280   ARLMQQQSESPPMQDEGSKADRTTPDSSSGSVRTQDTSSGSVRTQDTPPGPVTRVVERRK  339

Query  1338  -SGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEA  1514
               G+ RK  SS ER++ V S WNSMS++ KK +L+I+  DL++HF SLKD  ANE +SEA
Sbjct  340   HGGSVRKLGSSAERKNWVYSLWNSMSSESKKDVLKIKTNDLETHFSSLKDTSANEFISEA  399

Query  1515  LSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEML  1694
             LSF +ANK WKFW CC C ++F +SESH+ HV  EH+ +L PK+QS+LP NV+N+W EML
Sbjct  400   LSFYDANKTWKFWVCCKCDKKFVNSESHMHHVAQEHLGNLLPKMQSMLPHNVDNDWSEML  459

Query  1695  LNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR--SDMDESKDDISDPYCNVYGWDRS  1868
             LNC WKPLD++AA K+   Q KC+   F+E+   +  S+ DE         C    WD S
Sbjct  460   LNCPWKPLDVSAATKMFTDQTKCKDSEFVEDMCPQRHSECDE---------CIKDAWDFS  510

Query  1869  PIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERI  2048
             P K+   +  N    +S+ Y+K +        N G    P  +S+P++DD ERAKLLE+I
Sbjct  511   PEKQDHENSLN----ESKLYEKIN--------NSGY---PIPDSFPVSDDSERAKLLEKI  555

Query  2049  NVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKK  2228
             + VF+ LIK+KYL +S L+K+I F ++ELQ +  GS LL   +DQTP CICFLGA +L+K
Sbjct  556   HAVFELLIKHKYLAASQLNKIIQFTMDELQGIVSGSHLLKQGLDQTPQCICFLGASQLRK  615

Query  2229  ILKFLQELSHSCGLGRYPERST-AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCK  2405
             ILKFLQELS SCG+GRY +RST  I+D  +  Q VD  E+IVF+ D S LL +E     K
Sbjct  616   ILKFLQELSQSCGVGRYSDRSTDQIEDSKSDKQSVDVEERIVFNGDASLLLLNECLLSSK  675

Query  2406  LTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSRE  2585
             ++ ++      ++ +                  D D  L+WI+   SSG+QL SW++++E
Sbjct  676   ISHVSDQMPAASEVSS-----------------DVDPFLAWIYASPSSGDQLASWAKTKE  718

Query  2586  EKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRR  2765
             EK Q   E  + LEKEFY+LQ LCERKCEHLNYEEALQ VEDLCLEEGKKRE   +F+ +
Sbjct  719   EKKQGQTENFQSLEKEFYQLQNLCERKCEHLNYEEALQSVEDLCLEEGKKREVITEFIPK  778

Query  2766  SYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHL  2945
             SY+  L+KRR+EL+ES ++A     RFE++A+++VLK+AE+LN NQ G+ + +  + S L
Sbjct  779   SYESILRKRREELIESENDAMYIGSRFELDALTNVLKEAEALNANQLGYGENFASVPSQL  838

Query  2946  CDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKL  3125
              DLESGED+ WR KDYL+Q D+C+E+AI+RQKE +S+E+SKID RIMR V+GMQ+LE+KL
Sbjct  839   YDLESGEDEGWRAKDYLHQVDTCIEIAIKRQKEQLSIEISKIDGRIMRNVTGMQELELKL  898

Query  3126  ESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSE  3305
             E VSAHDY+ IL+PLV SYLRAHLE+LAE D T+KSDAAREAFLAEL RDSKK S  GS+
Sbjct  899   EPVSAHDYQSILLPLVNSYLRAHLEELAEIDVTKKSDAAREAFLAELERDSKKDSKGGSD  958

Query  3306  NAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELS-  3482
             N KH+ EK+++KKK K++RK KD K  +    +  H +  +  +F V  DG   + +++ 
Sbjct  959   NPKHAREKSKEKKKSKEFRKAKDSKLVSVREQNVPHDEVVDRDTFQVPSDGDVAEVDIAV  1018

Query  3483  NGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKKGAR  3647
             +  S+++  EEEE RR+IELEA+ERKLEETLEYQRRIE EAK KHLAE  KK A+
Sbjct  1019  SENSDALRLEEEEIRRKIELEADERKLEETLEYQRRIEKEAKQKHLAELQKKSAQ  1073


 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/404 (74%), Positives = 336/404 (83%), Gaps = 3/404 (1%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++  KTLRQ H EDD E++FQADL KAV +SLD F   Q  P      T++  E+ +  +
Sbjct  1200  DNSAKTLRQQHAEDD-EKQFQADLKKAVLESLDAFQEKQNFPSSSTPSTSR-GEVDSTDL  1257

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVG  4371
                +   G V G ++ GTGLKNE+GEYNCFLNVIIQSLWHLRRFR EFLR S  EH+HVG
Sbjct  1258  PSNEHNAGNVQGADICGTGLKNEIGEYNCFLNVIIQSLWHLRRFRVEFLRRSKIEHVHVG  1317

Query  4372  DPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGV  4551
             DPCVVCALYDIFTALS+AS++ RR+AVAP SLRIALS L PD   FQEGQMNDASEVL V
Sbjct  1318  DPCVVCALYDIFTALSMASADARREAVAPTSLRIALSTLCPDNKFFQEGQMNDASEVLAV  1377

Query  4552  IFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESR  4731
             IF+CLHQS T++   SDTESV+S+CMGSWDCA+  C+VHS+FGMD+FERMNCY CGLESR
Sbjct  1378  IFDCLHQSLTTSLSISDTESVESNCMGSWDCASDTCLVHSIFGMDIFERMNCYSCGLESR  1437

Query  4732  HLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFL  4911
             HLKYT+FFHNINASALRTMKVMC +SSFDELLN+VEMNHQLACD D  GCGK N+IHHFL
Sbjct  1438  HLKYTTFFHNINASALRTMKVMCTESSFDELLNVVEMNHQLACDLDVGGCGKLNYIHHFL  1497

Query  4912  STPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQ  5091
             + PPHVFTTVLGWQNTCES +DITATL AL+TEIDISVLYRGLDPKS H LVSVVCYYGQ
Sbjct  1498  AAPPHVFTTVLGWQNTCESADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQ  1557

Query  5092  HYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HYHCFAYSHD + WI YDD+TVKVIG W DVLTMCE+GHLQPQV
Sbjct  1558  HYHCFAYSHDKKCWIKYDDRTVKVIGGWLDVLTMCEKGHLQPQV  1601



>ref|XP_006600667.1| PREDICTED: uncharacterized protein LOC100800030 isoform X4 [Glycine 
max]
Length=1592

 Score =  1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/1107 (53%), Positives = 779/1107 (70%), Gaps = 48/1107 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S         A          ++D++   V + +  + + A  +SE
Sbjct  1     MGHKKRNPAPRSKQSPPAAANGGSATSP-------DADSAFNNVSDHNPRKIELASPQSE  53

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S Y+ +KLECERALT+LRRGNH KA++ +K++CA+ E SP+ A + RV   +C K 
Sbjct  54    ---GSDYSTVKLECERALTTLRRGNHTKAMKQLKEICAREEGSPHAAFVNRVHSLMCFKT  110

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             A++I DP+ K RHL+NA++SAR++V + PNS+E+AHF A ++ EAA++GK+YEEVV ECE
Sbjct  111   ATVITDPSSKQRHLRNALESARRAVELMPNSVEYAHFRATVMLEAASEGKDYEEVVHECE  170

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++ K  + E RI HVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  171   RGLAIENPSDPAKETLQDESEHKALSLEERIGHVQNELRQLIQKSNIASLSSWMKNLSNG  230

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR  EDPME+RLVQ R+PNEIKK TKTPEERRKEIEVRVAAARL+Q+ SES
Sbjct  231   EERFRLIPIRRTPEDPMEVRLVQTRRPNEIKKVTKTPEERRKEIEVRVAAARLIQKNSES  290

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              Q  N+G+R    LD S G+GQR  +RR+  NARK+  S ER   V SYWNS+S D+KK 
Sbjct  291   PQLPNEGDRDDRPLDSSVGSGQRIGDRRRHVNARKSGFSAERMKWVHSYWNSVSMDLKKD  350

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LR++I DLKSH+GS KD L N++LSEAL +AEANK WKFW CC+C E+ ++ +SH  HV
Sbjct  351   FLRVKIYDLKSHYGSSKDTLPNDILSEALFYAEANKTWKFWRCCNCEEKHSNPDSHRHHV  410

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SLSP++Q +LPQNV++EW+EM+LNCSW PLD+ AA ++L+ + K +     E+ 
Sbjct  411   VQEHMGSLSPQMQRLLPQNVDSEWIEMILNCSWNPLDVLAAVRMLDNKAKLKSSPLPEDL  470

Query  1791  YTRS---DMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y      D ++   D S  Y           K++ GD     +V+      N+   ++ D
Sbjct  471   YLDHHALDYNDCFKDASSSYIE---------KESSGDSRRNCSVEC-----NNHCKIEND  516

Query  1962  GNEGTK-----ICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
               EG +       P  + WP++DDPERAKLL +I+ +F+TLI++K L +SHL+KVI F +
Sbjct  517   VREGVEDQLSMANPIIDCWPVSDDPERAKLLGKIHAIFETLIRHKCLAASHLNKVIQFTM  576

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAID  2303
              E+Q L  GSQLLN+ +DQTP+CICFLGA +LK I +FLQE+SH+CGL R  ++  +  +
Sbjct  577   GEIQGLAAGSQLLNHGVDQTPMCICFLGATQLKTIFQFLQEISHACGLARNADKGGSPTN  636

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +  +KIV   D SCLL DE+    ++T  T    ++ D    S+       
Sbjct  637   DLLNISQGPEIKDKIVLDGDASCLLLDEYLLQTQVTAGTVQGAILDDVTTPSSP------  690

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               +G    +D LLSWIF  +  G+QLTSW R+RE+K  +  EIV+LLEKEFY LQGLCE+
Sbjct  691   --DGISCYNDALLSWIFSCSPIGDQLTSWLRTREDKLNKGKEIVQLLEKEFYHLQGLCEK  748

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             K E + YEEALQ VEDLCLEEGKKRE   +FV+RSY+  L+KRR+EL+ES ++    + +
Sbjct  749   KGERIAYEEALQTVEDLCLEEGKKRETVGEFVQRSYESVLRKRREELIESENDMMYVSNK  808

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AIS+VL++AE+ NVNQFG+++TY G++S LCDLESGE+D+WR+KDYL+Q D C+E 
Sbjct  809   FELDAISNVLQEAEARNVNQFGYDETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIEN  868

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQ+ KEH+S+ELSKIDARI+R V+ MQQLE KL  +SA+DYR ILVPLVK YLRA LED
Sbjct  869   AIQKLKEHLSIELSKIDARIIRSVTEMQQLEFKLGPISANDYRAILVPLVKLYLRALLED  928

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DA EKSDA  EA LAELA DSKK+   GSE+A+H  EKT+DKKK KD+RK +D K 
Sbjct  929   LAEKDAREKSDAVSEALLAELALDSKKAVKGGSESARHV-EKTKDKKKNKDHRKARDFKV  987

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             ++G+   +L   T +  S  V  +    D E+ +   + + Q EEE RR+IELE EE+KL
Sbjct  988   TSGHAHFSLGSTTPD--SNLVAPESDFPDNEVVSMNDDDLEQLEEEFRRKIELEEEEKKL  1045

Query  3564  eetleYQRRIENEAKLKHLAEQHKKGA  3644
             EETLE+QRRIENEAK K LAEQ KK +
Sbjct  1046  EETLEFQRRIENEAKQKQLAEQQKKSS  1072


 Score =   510 bits (1313),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 253/355 (71%), Positives = 279/355 (79%), Gaps = 3/355 (1%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G K + +L VED +EERFQADL  AVRQSLDT+ A      +     +Q +      V 
Sbjct  1214  NGSKVMGELQVEDAEEERFQADLKMAVRQSLDTYQARGNSHSVSSLRMSQRASSQEDSVD  1273

Query  4198  CEDV--ATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHV  4368
             C  V  +T  VNG  + GTGLKNEVGEYNCFLNVIIQSLWHLRRFR+EFL RS SEH HV
Sbjct  1274  CLPVEDSTDNVNGATLLGTGLKNEVGEYNCFLNVIIQSLWHLRRFREEFLGRSRSEHDHV  1333

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALY+IFTAL  AS ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL 
Sbjct  1334  GNPCVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLA  1393

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLHQSFT  S  SD ES +S+C GSWDCAN +CI HSLFGM++FE+MNCY CGLES
Sbjct  1394  VIFDCLHQSFTRGSSVSDAESAESNCTGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLES  1453

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMK M  +SSFD+LLNLVEMNHQLACD +A GCGK NHIHH 
Sbjct  1454  RHLKYTSFFHNINASALRTMKDMFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHL  1513

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSV  5073
             LSTPPHVF TVLGWQNTCES  DIT TL ALST IDISVLY GLDPK  H LVSV
Sbjct  1514  LSTPPHVFMTVLGWQNTCESANDITETLAALSTNIDISVLYPGLDPKCIHNLVSV  1568



>gb|KHG14770.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Gossypium 
arboreum]
Length=1537

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/1045 (56%), Positives = 745/1045 (71%), Gaps = 110/1045 (11%)
 Frame = +3

Query  525   AVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
             A V  E+N SSS + +K +CERALT+LRRGNH KALRLMK+ C +HENS   AL++RVQG
Sbjct  31    AGVPDESNGSSSSSVVKADCERALTALRRGNHTKALRLMKESCTRHENSAQAALVHRVQG  90

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVC+KVASI+DDPN KNRHLK+AIDSARK+V +SPNSIEFAHFYANLLY+ AND KEYEE
Sbjct  91    TVCLKVASIMDDPNAKNRHLKSAIDSARKAVELSPNSIEFAHFYANLLYDTANDAKEYEE  150

Query  885   VVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVK  1064
             VVQECERALAIENP+DPAKESLQE                                    
Sbjct  151   VVQECERALAIENPVDPAKESLQEE-----------------------------------  175

Query  1065  NFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL-  1241
                        +P RR +E               IKKATKTPEERRKEIEVRVAAARLL 
Sbjct  176   -----------MPSRRPNE---------------IKKATKTPEERRKEIEVRVAAARLLQ  209

Query  1242  QQKSESAQSF----NDGERS-LDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNS  1406
             QQKSE+A S     + GE+  LDL++G+GQRG +RR+    RKN S+ ER+D VRSYWNS
Sbjct  210   QQKSEAASSSPQLQSKGEKDELDLTSGSGQRGADRRR----RKNGSTAERKDWVRSYWNS  265

Query  1407  MSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFAD  1586
             MS D+K+ LLRIR+ D+K+HFG +KD LA++VLSEAL FAEA K W FW CC C E+FAD
Sbjct  266   MSIDLKRDLLRIRVSDIKAHFGLVKDELASDVLSEALEFAEAYKTWNFWVCCRCSEKFAD  325

Query  1587  SESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCR  1766
             SESH+QHV+ EHM +L PK+Q+VLPQ++++EW+EMLLNCSW PLDI+AA K++       
Sbjct  326   SESHMQHVVQEHMGNLIPKMQNVLPQSIDSEWIEMLLNCSWNPLDISAAIKMI-------  378

Query  1767  VHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEV  1946
                         D +E  +D  D       WD SP K+  G   +  +V+    ++ S +
Sbjct  379   -----------GDRNEQCNDCFDD-----AWDSSPAKEILGVSYSCGSVECNVCEQVSSI  422

Query  1947  WMDR-DGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFA  2123
                  DGN+G+   P  + WP   D ERAKLLERI+  F+ LI++KYL +SHL+KVI F 
Sbjct  423   ECKGCDGNKGSVTYPLVDCWPTVADAERAKLLERIHATFELLIRHKYLAASHLNKVIQFT  482

Query  2124  VEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAID  2303
             ++ELQSL  GSQLLN+ IDQTP+CICFLG+ +L+K+LKFLQ+LSHSCG+ RY E++  +D
Sbjct  483   MDELQSLVSGSQLLNHGIDQTPMCICFLGSTQLRKVLKFLQDLSHSCGMARYSEKTAPVD  542

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    + ++  EKIV + D SCLL DEH  P         D  + DS    +  S+   
Sbjct  543   DVHGATKILEVKEKIVLNADASCLLLDEHLLP---------DAAIEDSALEKSRGSN---  590

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               N  + D+D LLSWIF G SS  QL SW   + EK QQ +EI+++LEKEFY LQ LCER
Sbjct  591   -GNEFVQDADALLSWIFSGPSSQYQLASWVHMKAEKTQQGLEILQMLEKEFYHLQSLCER  649

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             KC H++YEEALQ +EDLCLEEGKKRE   +FV +SY+  L+K R+EL+E+  +    + R
Sbjct  650   KCGHMSYEEALQALEDLCLEEGKKRETATEFVHQSYESVLRKHREELVETESDDMFLSSR  709

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AI++VL++AE+LN+NQFG+E+TY G++S LCDLESGEDDDWR KDYL+QAD+ +EV
Sbjct  710   FELDAITNVLQEAEALNINQFGYENTYAGVTSQLCDLESGEDDDWRAKDYLHQADTYIEV  769

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQRQKE +S+ELSKIDARIMR V+GMQQLE+KLESVSAHDY+ I++PLVKSYLRAHLED
Sbjct  770   AIQRQKEQLSLELSKIDARIMRNVTGMQQLELKLESVSAHDYQSIMLPLVKSYLRAHLED  829

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             +AE+DATEKSDAAREAFLAELARD+KK +  GS N++HS EK +DKKK K++RK+KD KG
Sbjct  830   MAEKDATEKSDAAREAFLAELARDAKKVARGGSGNSRHSQEKVKDKKKNKEFRKSKDSKG  889

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
               GN LH L+ +TAE+ S +   DG   D+++ +  ++ + Q+EEE RR+IELE EER L
Sbjct  890   YGGNELHMLNDETAEQVSGAA--DGDHLDSKVVSVNNDDLKQQEEEFRRKIELEEEERML  947

Query  3564  eetleYQRRIENEAKLKHLAEQHKK  3638
             EETLEYQR IEN AK KHLAEQ+ +
Sbjct  948   EETLEYQRWIENGAKPKHLAEQNTR  972


 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/407 (76%), Positives = 349/407 (86%), Gaps = 3/407 (1%)
 Frame = +1

Query  4009  AGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQIS--EMA  4182
             +GE G KTLRQL  E+DDEERFQADL KAVRQSLDT+ A Q+ PL       +    E+ 
Sbjct  1099  SGEGGTKTLRQLQAEEDDEERFQADLKKAVRQSLDTYQAQQRFPLASSLKAVERVPLEVK  1158

Query  4183  NLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEH  4359
               GVS  +V+   +   E++GTGL N+VGEYNCFLNVIIQSLWHLRRFRDEFLR S+S+H
Sbjct  1159  THGVSPNEVSGEGLKETEMFGTGLLNDVGEYNCFLNVIIQSLWHLRRFRDEFLRRSASDH  1218

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
             +HVGDPCV+CALY+IFTAL++ASS+ RR+ VAP SLRIALSNLYPD   FQEGQMNDASE
Sbjct  1219  VHVGDPCVICALYEIFTALNIASSDARREPVAPTSLRIALSNLYPDSNFFQEGQMNDASE  1278

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+SFTSAS  SD +S+DS+C GSWDCANSAC VHSLFGMD+FERMNCY CG
Sbjct  1279  VLAVIFDCLHRSFTSASSVSDADSMDSNCTGSWDCANSACTVHSLFGMDIFERMNCYSCG  1338

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             +ESRHLKYT+FFHNINASALRTMKVM ++SSFDELLNLVE NHQLACD +A GCGK N++
Sbjct  1339  VESRHLKYTTFFHNINASALRTMKVMSEESSFDELLNLVERNHQLACDQEAGGCGKLNYV  1398

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH LS PPHVFTTVLGWQNTCES +DI ATL AL+ EIDISVLYRG+DPK+KH LVSVVC
Sbjct  1399  HHILSNPPHVFTTVLGWQNTCESADDIAATLAALTNEIDISVLYRGIDPKNKHNLVSVVC  1458

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQ  5220
             YYGQHYHCFAYSHDHERW+MYDD+TVKVIG+WADVLTMCERG LQPQ
Sbjct  1459  YYGQHYHCFAYSHDHERWVMYDDQTVKVIGSWADVLTMCERGCLQPQ  1505



>ref|XP_006600664.1| PREDICTED: uncharacterized protein LOC100800030 isoform X1 [Glycine 
max]
 ref|XP_006600665.1| PREDICTED: uncharacterized protein LOC100800030 isoform X2 [Glycine 
max]
 ref|XP_006600666.1| PREDICTED: uncharacterized protein LOC100800030 isoform X3 [Glycine 
max]
Length=1625

 Score =  1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/1107 (53%), Positives = 779/1107 (70%), Gaps = 48/1107 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR  APRSK S         A          ++D++   V + +  + + A  +SE
Sbjct  1     MGHKKRNPAPRSKQSPPAAANGGSATSP-------DADSAFNNVSDHNPRKIELASPQSE  53

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S Y+ +KLECERALT+LRRGNH KA++ +K++CA+ E SP+ A + RV   +C K 
Sbjct  54    ---GSDYSTVKLECERALTTLRRGNHTKAMKQLKEICAREEGSPHAAFVNRVHSLMCFKT  110

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             A++I DP+ K RHL+NA++SAR++V + PNS+E+AHF A ++ EAA++GK+YEEVV ECE
Sbjct  111   ATVITDPSSKQRHLRNALESARRAVELMPNSVEYAHFRATVMLEAASEGKDYEEVVHECE  170

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++ K  + E RI HVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  171   RGLAIENPSDPAKETLQDESEHKALSLEERIGHVQNELRQLIQKSNIASLSSWMKNLSNG  230

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR  EDPME+RLVQ R+PNEIKK TKTPEERRKEIEVRVAAARL+Q+ SES
Sbjct  231   EERFRLIPIRRTPEDPMEVRLVQTRRPNEIKKVTKTPEERRKEIEVRVAAARLIQKNSES  290

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              Q  N+G+R    LD S G+GQR  +RR+  NARK+  S ER   V SYWNS+S D+KK 
Sbjct  291   PQLPNEGDRDDRPLDSSVGSGQRIGDRRRHVNARKSGFSAERMKWVHSYWNSVSMDLKKD  350

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LR++I DLKSH+GS KD L N++LSEAL +AEANK WKFW CC+C E+ ++ +SH  HV
Sbjct  351   FLRVKIYDLKSHYGSSKDTLPNDILSEALFYAEANKTWKFWRCCNCEEKHSNPDSHRHHV  410

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SLSP++Q +LPQNV++EW+EM+LNCSW PLD+ AA ++L+ + K +     E+ 
Sbjct  411   VQEHMGSLSPQMQRLLPQNVDSEWIEMILNCSWNPLDVLAAVRMLDNKAKLKSSPLPEDL  470

Query  1791  YTRS---DMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y      D ++   D S  Y           K++ GD     +V+      N+   ++ D
Sbjct  471   YLDHHALDYNDCFKDASSSYIE---------KESSGDSRRNCSVEC-----NNHCKIEND  516

Query  1962  GNEGTK-----ICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
               EG +       P  + WP++DDPERAKLL +I+ +F+TLI++K L +SHL+KVI F +
Sbjct  517   VREGVEDQLSMANPIIDCWPVSDDPERAKLLGKIHAIFETLIRHKCLAASHLNKVIQFTM  576

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAID  2303
              E+Q L  GSQLLN+ +DQTP+CICFLGA +LK I +FLQE+SH+CGL R  ++  +  +
Sbjct  577   GEIQGLAAGSQLLNHGVDQTPMCICFLGATQLKTIFQFLQEISHACGLARNADKGGSPTN  636

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +  +KIV   D SCLL DE+    ++T  T    ++ D    S+       
Sbjct  637   DLLNISQGPEIKDKIVLDGDASCLLLDEYLLQTQVTAGTVQGAILDDVTTPSSP------  690

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               +G    +D LLSWIF  +  G+QLTSW R+RE+K  +  EIV+LLEKEFY LQGLCE+
Sbjct  691   --DGISCYNDALLSWIFSCSPIGDQLTSWLRTREDKLNKGKEIVQLLEKEFYHLQGLCEK  748

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             K E + YEEALQ VEDLCLEEGKKRE   +FV+RSY+  L+KRR+EL+ES ++    + +
Sbjct  749   KGERIAYEEALQTVEDLCLEEGKKRETVGEFVQRSYESVLRKRREELIESENDMMYVSNK  808

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AIS+VL++AE+ NVNQFG+++TY G++S LCDLESGE+D+WR+KDYL+Q D C+E 
Sbjct  809   FELDAISNVLQEAEARNVNQFGYDETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIEN  868

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQ+ KEH+S+ELSKIDARI+R V+ MQQLE KL  +SA+DYR ILVPLVK YLRA LED
Sbjct  869   AIQKLKEHLSIELSKIDARIIRSVTEMQQLEFKLGPISANDYRAILVPLVKLYLRALLED  928

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DA EKSDA  EA LAELA DSKK+   GSE+A+H  EKT+DKKK KD+RK +D K 
Sbjct  929   LAEKDAREKSDAVSEALLAELALDSKKAVKGGSESARHV-EKTKDKKKNKDHRKARDFKV  987

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             ++G+   +L   T +  S  V  +    D E+ +   + + Q EEE RR+IELE EE+KL
Sbjct  988   TSGHAHFSLGSTTPD--SNLVAPESDFPDNEVVSMNDDDLEQLEEEFRRKIELEEEEKKL  1045

Query  3564  eetleYQRRIENEAKLKHLAEQHKKGA  3644
             EETLE+QRRIENEAK K LAEQ KK +
Sbjct  1046  EETLEFQRRIENEAKQKQLAEQQKKSS  1072


 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/405 (74%), Positives = 328/405 (81%), Gaps = 3/405 (1%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G K + +L VED +EERFQADL  AVRQSLDT+ A      +     +Q +      V 
Sbjct  1214  NGSKVMGELQVEDAEEERFQADLKMAVRQSLDTYQARGNSHSVSSLRMSQRASSQEDSVD  1273

Query  4198  CEDV--ATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHV  4368
             C  V  +T  VNG  + GTGLKNEVGEYNCFLNVIIQSLWHLRRFR+EFL RS SEH HV
Sbjct  1274  CLPVEDSTDNVNGATLLGTGLKNEVGEYNCFLNVIIQSLWHLRRFREEFLGRSRSEHDHV  1333

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALY+IFTAL  AS ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL 
Sbjct  1334  GNPCVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLA  1393

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLHQSFT  S  SD ES +S+C GSWDCAN +CI HSLFGM++FE+MNCY CGLES
Sbjct  1394  VIFDCLHQSFTRGSSVSDAESAESNCTGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLES  1453

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMK M  +SSFD+LLNLVEMNHQLACD +A GCGK NHIHH 
Sbjct  1454  RHLKYTSFFHNINASALRTMKDMFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHL  1513

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LSTPPHVF TVLGWQNTCES  DIT TL ALST IDISVLY GLDPK  H LVSVVCYYG
Sbjct  1514  LSTPPHVFMTVLGWQNTCESANDITETLAALSTNIDISVLYPGLDPKCIHNLVSVVCYYG  1573

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSH+HE+WIMYDDKTVKVIG WADVLTMCERGHLQPQV
Sbjct  1574  QHYHCFAYSHNHEQWIMYDDKTVKVIGGWADVLTMCERGHLQPQV  1618



>ref|XP_010412621.1| PREDICTED: uncharacterized protein LOC104698949 [Camelina sativa]
Length=1135

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/1031 (55%), Positives = 747/1031 (72%), Gaps = 45/1031 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   AL +RVQGT+CVKVA++ +D   
Sbjct  58    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALAHRVQGTLCVKVAAVYEDLAT  114

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             KN++L+NAI+SARK+V +SPNSIE+ HFYANLLYEAANDG+EY+EVVQEC RAL+IE PI
Sbjct  115   KNKYLRNAIESARKAVELSPNSIEYGHFYANLLYEAANDGREYDEVVQECHRALSIEYPI  174

Query  930   DPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPI  1106
             DPAK SLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIPI
Sbjct  175   DPAKGSLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIPI  234

Query  1107  RRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGER  1286
             RRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N   +
Sbjct  235   RRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSPSENVDNK  294

Query  1287  SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSH  1466
               D + G GQR  ERRK GNARKN S+++RRD VRSYW+S+S +MKK+LLR+++ DLKSH
Sbjct  295   GSDSALGAGQRNGERRKHGNARKNSSTVDRRDRVRSYWDSVSKEMKKELLRVKVSDLKSH  354

Query  1467  FGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKL  1646
             F + KDG ANE++SEALSF E NK W+FW CC C + F  SE+H+QH++  HMC++ P +
Sbjct  355   FSASKDGQANEIISEALSFREGNKTWRFWLCCQCSKMFMSSEAHMQHIVQVHMCNVMPNM  414

Query  1647  QSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKDD  1826
             Q VLPQ+V+ + +++LL+  WKPLD++AA KLL  Q K +   F  N +   D  E  DD
Sbjct  415   QMVLPQSVDPDRIDVLLSSPWKPLDLSAAVKLLPSQQKIQNSEF--NNFHSGDNMEDGDD  472

Query  1827  ISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESW  2003
                  C    W D SP K++ GD CNG      E  K S  +            PP + W
Sbjct  473   -----CFEDAWNDTSPEKESLGDACNGCDEKESEEVKLSIAF------------PPPDGW  515

Query  2004  PIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQ  2183
             P++DDPERAKLL +I   F+ LI+  YL SSHL KVI F +++LQ++   SQ +N +++Q
Sbjct  516   PLSDDPERAKLLGKIRAAFELLIRQNYLASSHLDKVIQFTLDKLQNIPAVSQFVNRSLNQ  575

Query  2184  TPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSED  2363
             +P+CICFLGA +L+ ILKFLQ+LS  CGL RY E+S  I+    G  G +  E+I+F  +
Sbjct  576   SPICICFLGASQLRNILKFLQDLSQPCGLSRYSEQSNPIN---FGDLGREVTEEILFDAE  632

Query  2364  GSCLLFDEHFKPC-----KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DELL  2522
              SCLL DE          K      H+ V+  S   +          NG  + S  D  L
Sbjct  633   DSCLLLDEKLLGTESIQEKFMGSALHNVVIASSGDIA----------NGNNVSSSMDGFL  682

Query  2523  SWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQV  2702
             SWIF G SS EQ+ SW R++EEK  Q  EI+++LEK+F  LQ LCERKCEHLNYE ALQ 
Sbjct  683   SWIFTGPSSDEQIVSWIRTKEEKTNQGQEIMQILEKDFSHLQNLCERKCEHLNYEGALQT  742

Query  2703  VEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDA  2882
             VEDLCLEEG+KRE + +F   S++  L+KRR+EL ES HE    + RFE++AI++VLKDA
Sbjct  743   VEDLCLEEGRKREISAEFTHESFETVLRKRREELNESDHELVFISSRFELDAITNVLKDA  802

Query  2883  ESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVEL  3062
             ESLN NQFG+E++YG +SS L DLESGE D+W +KD L++ADS +E AIQ+QKEH+S EL
Sbjct  803   ESLNHNQFGYEESYGCVSSQLRDLESGETDEWGMKDSLHEADSFIETAIQKQKEHLSAEL  862

Query  3063  SKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaa  3242
             S+IDA++MR+V+GMQQLE++L  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAA
Sbjct  863   SRIDAQMMRIVTGMQQLELRLGPVSSNDYQIVLLPLVKSYMRAHLEVLAEKDATEKSDAA  922

Query  3243  reaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDT  3422
             REA L ELA DSKK +   ++N+KH+ EK++DKKKIKD RK KDLK + GN  H  + D+
Sbjct  923   REALLVELALDSKKDARGRNDNSKHTLEKSKDKKKIKDTRKLKDLKATIGND-HRSNVDS  981

Query  3423  AEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENE  3602
              E +       G   +A++ +    ++ ++EEE RR+IELE EERKLE++LEYQRRIE+E
Sbjct  982   IEHSLLQGASSGDHSEADVVSEAVEALKEQEEEYRRQIELEEEERKLEKSLEYQRRIEDE  1041

Query  3603  AKLKHLAEQHK  3635
             AK KH+AEQ K
Sbjct  1042  AKEKHMAEQQK  1052



>ref|XP_002877584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53843.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1635

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1035 (56%), Positives = 746/1035 (72%), Gaps = 49/1035 (5%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +KLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D 
Sbjct  56    AVVKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDL  112

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIE  920
               K++HL+NAI+SARK+V +SPNSIEF HFYANLLYEAANDGK EYEEVVQEC RAL+IE
Sbjct  113   ATKHKHLRNAIESARKAVELSPNSIEFGHFYANLLYEAANDGKREYEEVVQECHRALSIE  172

Query  921   NPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRL  1097
              PIDPA+ESLQ E Q K+ TPEARIAH Q ELR+LIQ+SN+ S+STW++N G+GEEKFRL
Sbjct  173   YPIDPARESLQDETQLKILTPEARIAHFQDELRSLIQKSNIYSLSTWMQNLGNGEEKFRL  232

Query  1098  IPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND  1277
             IP+RRM+EDP+E  L+Q R+PNEIKKATKT EERRKE+EVRVAA RLLQQKSES+ S N 
Sbjct  233   IPLRRMAEDPIESNLIQTRRPNEIKKATKTLEERRKEVEVRVAAHRLLQQKSESSPSENV  292

Query  1278  ---GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRI  1448
                  +  D + G G R  ERRK GNARKN S+ +RRD VRSYW+S+S +MKK+ +R++ 
Sbjct  293   EAVNNKGSDPTLGAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSLSKEMKKEFVRVKF  352

Query  1449  VDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMC  1628
              DLKSHF + KDG A E+LSEALSF EANK W+FW CC C E F + E+H+ H++ EHM 
Sbjct  353   SDLKSHFSASKDGQAYEILSEALSFCEANKTWRFWACCRCSENFIEPEAHMHHIVQEHMG  412

Query  1629  SLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDM  1808
             ++ PK+Q VLPQ V+ E + ML N  WKPLD++AA KLL  Q K +   F E  ++  +M
Sbjct  413   NVLPKMQMVLPQIVDTERINMLFNSPWKPLDLSAAVKLLLSQQKIQKSEFNE-FHSGDNM  471

Query  1809  DESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEG--TK  1979
             D+  D   D       W D +P K+  GD CNG              W + +  EG  + 
Sbjct  472   DDGDDCFKD------AWNDTTPEKENLGDACNG--------------WNENESEEGKLSI  511

Query  1980  ICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQ  2159
               PP + WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F V+ELQ+L   SQ
Sbjct  512   AFPPPDGWPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVIQFTVDELQNLPSVSQ  571

Query  2160  LLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAM  2339
              LN  ++++PLCICFLGA  LKKILKFLQ+LS +CGL R  E+S   D+I+ G  G +  
Sbjct  572   FLNRGLNKSPLCICFLGASHLKKILKFLQDLSQACGLSRCSEQSNPNDEINFGDLGREVT  631

Query  2340  EKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--D  2513
             E+I+   + SCLL DE     +     +    V ++              NG  + S  D
Sbjct  632   EEILLDGEDSCLLLDEKLFGTECIQEKYMGSAVNNA--------------NGNDVSSGAD  677

Query  2514  ELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEA  2693
               LSWIF G SSGEQ+ SW  ++EEK  Q +EI++ LEKEFY LQ LCERKCEHL+YE A
Sbjct  678   GFLSWIFAGPSSGEQVVSWMCTKEEKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGA  737

Query  2694  LQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVL  2873
             LQ VEDLCLEEG+KRE + +F   SY+  L+KRRD+L ++  E    + RFE++AI++VL
Sbjct  738   LQTVEDLCLEEGRKRETSAEFTHESYESVLRKRRDDLNDNDLELVFISSRFELDAITNVL  797

Query  2874  KDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVS  3053
             KDAE+LN NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +E+AIQ+QKE +S
Sbjct  798   KDAETLNHNQFGYEESYGCTSSQLRDLESGEADEWGMKDSLHEADSFIEIAIQKQKEQLS  857

Query  3054  VELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKS  3233
              ELSKIDA++MR V+GMQQLE+KL  VS +DY+ +L+PLVKSY+RAHLE LAERDATEKS
Sbjct  858   AELSKIDAQMMRTVTGMQQLELKLGPVSFNDYQIVLLPLVKSYMRAHLEALAERDATEKS  917

Query  3234  daareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALH  3413
             DAAREA L ELA DSKK +   ++N+K+  EK++DKKKIKD RK KDLK + GN  H  +
Sbjct  918   DAAREALLVELALDSKKEARGRNDNSKNMLEKSKDKKKIKDTRKLKDLKATIGND-HRFN  976

Query  3414  HDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRI  3593
              D+ E +  +V   G   +A++ +    +I ++EEE +R+ ELE EERKLE+TLEYQRRI
Sbjct  977   TDSFEHSPLTVASVGDYSEADVVSEAVEAIKEQEEEYKRQRELEEEERKLEKTLEYQRRI  1036

Query  3594  ENEAKLKHLAEQHKK  3638
             E+EAK KH+AEQ KK
Sbjct  1037  EDEAKEKHMAEQQKK  1051


 Score =   586 bits (1510),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 291/437 (67%), Positives = 340/437 (78%), Gaps = 30/437 (7%)
 Frame = +1

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKA------------------VRQSLDTFHAH  4128
             ++ G+ G KTLRQL  EDD+EERFQADL +A                  V ++LD  H  
Sbjct  1193  RNNGDVGTKTLRQLQAEDDEEERFQADLKRALLRSHLEFSAYLVCNHFGVTKALDMKHLT  1252

Query  4129  QK----LPLIPRSGTAQIS------EMANLGVSCED-VATGIVNGIEVYGTGLKNEVGEY  4275
              +     P + + G    S      E+ N G   ED + +    GI ++GTGL+NEVGEY
Sbjct  1253  PEHFFFNPDVYQGGRNMASCLRTPLEVNNDGGLSEDTIESRSSTGIAIFGTGLQNEVGEY  1312

Query  4276  NCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLW+L  FR EFL+SS+ EH HVGDPCVVC+LY+IF ALS ASSET+ + V
Sbjct  1313  NCFLNVIIQSLWNLELFRAEFLQSSTREHHHVGDPCVVCSLYEIFAALSAASSETQNEPV  1372

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP+SLRIALSNLYPD   FQE QMNDASEVL VIF+CLH+SF  +S  SD +S DS+C G
Sbjct  1373  APSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQSSSVSDVDSSDSNCTG  1432

Query  4633  SWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSS  4812
             SWDCAN  CI HSLFGMD+FE++NCY CGLESRH+KYTSFFHNINASALRTMKV C ++S
Sbjct  1433  SWDCANRTCIAHSLFGMDIFEQLNCYSCGLESRHMKYTSFFHNINASALRTMKVTCTENS  1492

Query  4813  FDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATL  4992
             FDELLNLVEMNHQLACD +  GCGK NHIHH L+TPPHVFTTVLGWQNTCE+VEDI ATL
Sbjct  1493  FDELLNLVEMNHQLACDSETGGCGKLNHIHHILTTPPHVFTTVLGWQNTCETVEDIAATL  1552

Query  4993  VALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGN  5172
              AL+TEIDIS++YRGLDPKS + LVSVVCYYGQHYHCFA+S +H++WIMYDDKTVKVIG+
Sbjct  1553  AALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKVIGS  1612

Query  5173  WADVLTMCERGHLQPQV  5223
             W+DVL+MCERGHLQPQV
Sbjct  1613  WSDVLSMCERGHLQPQV  1629



>ref|XP_006290495.1| hypothetical protein CARUB_v10016569mg [Capsella rubella]
 gb|EOA23393.1| hypothetical protein CARUB_v10016569mg [Capsella rubella]
Length=1574

 Score =  1014 bits (2621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/1048 (56%), Positives = 760/1048 (73%), Gaps = 47/1048 (4%)
 Frame = +3

Query  540   ETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVK  719
             +T A    A IKLECE+AL S  RG++NKA+RL+KD C+++++S   AL +RVQGT+CVK
Sbjct  6     KTPAPWDSAVIKLECEKALKSFGRGSYNKAIRLIKDSCSRYQDS---ALAHRVQGTICVK  62

Query  720   VASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQE  896
             VAS+ +D   K+++L+NAI+SARK+V +SPNSIEF HFYANLLYEAANDGK +Y+EVVQE
Sbjct  63    VASVYEDLATKHKYLRNAIESARKAVELSPNSIEFGHFYANLLYEAANDGKRDYDEVVQE  122

Query  897   CERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             C+RAL+IENPIDPAKESLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G
Sbjct  123   CQRALSIENPIDPAKESLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLG  182

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQ--ARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
              G+EKFRLIPIRRM+EDP+E  L+Q   R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ
Sbjct  183   KGDEKFRLIPIRRMAEDPIESNLIQNQTRRPNEIKKATKSLEEIRKEVEVRVAAARLIQQ  242

Query  1248  KSESAQSFNDG---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTD  1418
              SES+ + N G    +  D + G G R  ERRK GNARKN S+ +RRD VRSYW+SMS +
Sbjct  243   NSESSAAENVGTVDNKGSDATLGAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSMSNE  302

Query  1419  MKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESH  1598
             MKK+LLR+++ DLKSHF + KDG ANE++SEALSF EANK W  W CC C E+F DSE+H
Sbjct  303   MKKELLRVKVSDLKSHFIASKDGDANEIISEALSFCEANKTWISWVCCRCNEKFMDSEAH  362

Query  1599  IQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGF  1778
             +QH++  HM ++ PK+Q VLPQNV+ E ++MLL+  WKPLD++AA  LL  Q K +   F
Sbjct  363   MQHIVQVHMGNIIPKMQMVLPQNVDTERIDMLLSSPWKPLDLSAAVNLLISQQKIQNFEF  422

Query  1779  LENTYTRSDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMD  1955
              E  ++  D  E+ DD     C    W D SP K++ GD CNG   +  E  K+S  +  
Sbjct  423   NE-IHSGGDNMENGDD-----CFKDAWNDTSPKKESLGDACNGCDENESEEGKSSIAF--  474

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
                       PP + WPI+DDPERAKLLE+I   F+ LI++KYL  SH  KVI F ++EL
Sbjct  475   ----------PPPDGWPISDDPERAKLLEKIRAAFELLIRHKYLAVSHHDKVIQFTLDEL  524

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             ++L   SQ +N++++Q+P+CICFL A +L+KILKFLQ+LS +CGL RY E+S   D+I+ 
Sbjct  525   RNLPSVSQFVNHSLNQSPICICFLEASQLRKILKFLQDLSQACGLSRYSEQSNPNDEINF  584

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHF--KPC---KLTPITFHDGVVTDsnpnsaaissni  2480
             G  G +  E+I F  + SCLL DE      C   K     FH+ V+  S   +       
Sbjct  585   GDLGREVTEEIHFDAEDSCLLLDEKLLGTECFQEKFMGSPFHNVVIASSGDIA-------  637

Query  2481  QCDNGGLLDS--DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGL  2654
                NG  + +  D  LSWIF G SSGEQ+ SW  ++EEK  Q MEI+++LEKEF  LQ L
Sbjct  638   ---NGDNVSAGADGFLSWIFTGPSSGEQIVSWMHTKEEKTNQGMEIMQILEKEFSHLQNL  694

Query  2655  CERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATST  2834
             CERKCEHL+YE ALQ VEDLCLEEG+KRE + +F   SY+  L+KRR+EL ES HE    
Sbjct  695   CERKCEHLSYEGALQTVEDLCLEEGRKRETSAEFTHESYETVLRKRREELNESDHELVFI  754

Query  2835  NYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSC  3014
             + RFE++AI++VLKDAE+LN NQFG+E+TYG  SS L DLESGE   W ++D L++ADS 
Sbjct  755   SSRFELDAITNVLKDAETLNHNQFGYEETYGCTSSQLRDLESGEAAVWGMRDSLHEADSF  814

Query  3015  VEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAH  3194
             +E+AIQ+QKE +S ELS+IDA++MR V+GMQQLE+KL  VS  DY+ +L+PLVKSY+RAH
Sbjct  815   IEIAIQKQKEQLSAELSRIDAQMMRNVTGMQQLELKLGPVSFIDYQIVLLPLVKSYMRAH  874

Query  3195  LEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkd  3374
             LE LAE+DATEKSDAAREA L ELA DSKK +   ++N+KH  EK++DKKKIKD RK KD
Sbjct  875   LEALAEKDATEKSDAAREALLFELALDSKKEARGRNDNSKHMLEKSKDKKKIKDTRKLKD  934

Query  3375  lkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaee  3554
             LK + GN  H  + D+ E +  SV   G   +A++ +    ++ ++EEE RRRIELE EE
Sbjct  935   LKATIGND-HRFNGDSTEHSQPSVASFGDHSEADVVSEAVEALNEQEEEYRRRIELEEEE  993

Query  3555  rkleetleYQRRIENEAKLKHLAEQHKK  3638
             RKLE+TLEYQRRIENEAK KH+AEQ KK
Sbjct  994   RKLEKTLEYQRRIENEAKEKHIAEQKKK  1021


 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/406 (71%), Positives = 337/406 (83%), Gaps = 6/406 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++G KTLRQL  EDD+EERFQADL +AV QSLD +   + +    R+      E+ N G
Sbjct  1166  GDAGTKTLRQLQAEDDEEERFQADLKRAVLQSLDVYQGGRNMTSYLRTPL----EVNNDG  1221

Query  4192  V-SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             V S   + +     + ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFL+SS+ EH H
Sbjct  1222  VLSVVTMKSQNTTEVALFGTGLQNEVGEYNCFLNVIIQSLWNLGLFRTEFLQSSTLEHHH  1281

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VG+PCVVC+LY+IFTALS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  1282  VGEPCVVCSLYEIFTALSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  1341

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF   S  SDTES +S+  GSWDCAN  CI HSLFGMD++E++NCY CGLE
Sbjct  1342  AVIFDCLHRSFAQNSSLSDTESAESNSTGSWDCANRTCIAHSLFGMDIYEQLNCYSCGLE  1401

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINASALRTMKV   + SFDELLNLVEMNHQ+ACDP+A GCGK NHIHH
Sbjct  1402  SRHLKYTSFFHNINASALRTMKVTFAEKSFDELLNLVEMNHQIACDPEAGGCGKPNHIHH  1461

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVS+VCYY
Sbjct  1462  ILTTPPHVFTTVLGWQNTCETVEDIAATLEALNTEIDISIVYRGLDPKSTYSLVSMVCYY  1521

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCF++SH+H RWIMYDD+TVKVIG+W+DVL+MCERGHLQPQV
Sbjct  1522  GQHYHCFSFSHEHNRWIMYDDQTVKVIGSWSDVLSMCERGHLQPQV  1567



>gb|KFK34093.1| hypothetical protein AALP_AA5G101100 [Arabis alpina]
Length=1619

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/1101 (55%), Positives = 776/1101 (70%), Gaps = 46/1101 (4%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+  A RSK S   V     A ++        S+ SA  V E      D A V+ E
Sbjct  1     MGQKKKTPASRSKQSPPSVTPVTTAPEDE------PSEISACTVHEGECSGAD-ANVDVE  53

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                S   A IKLECE+AL S RRG++NKA+RLMK+ C +H++S   ALIYRVQGTV VKV
Sbjct  54    PLDS---AVIKLECEKALASFRRGSYNKAIRLMKESCLRHQDS---ALIYRVQGTVFVKV  107

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK---EYEEVVQ  893
             AS+ +D   KNR+L NAI+SARK+V +SP+SIEF HFYANLLY+AA DG+   EY+EVVQ
Sbjct  108   ASVFEDLATKNRYLHNAIESARKAVELSPHSIEFGHFYANLLYDAAIDGRDGIEYDEVVQ  167

Query  894   ECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNF  1070
             EC R+L+IENPIDPAKESLQ E QQK+ TPEARI HVQ ELR+LIQ+SNL+S+STW+KN 
Sbjct  168   ECHRSLSIENPIDPAKESLQDETQQKILTPEARIVHVQDELRSLIQKSNLSSLSTWMKNL  227

Query  1071  GSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             G+GEEKFRLIPIRR  EDP+E  L+QA++PNEIKKA KT EE+RKEIEV+VAA RLLQQ 
Sbjct  228   GNGEEKFRLIPIRRTVEDPIESNLIQAKRPNEIKKANKTLEEKRKEIEVKVAALRLLQQN  287

Query  1251  SESAQS---FNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             SES+ S    N  ++  D + GTGQR  ERR+ GNARKN S+ ERRD VRSYW+S+  +M
Sbjct  288   SESSVSDSIGNGNDKGSDTTLGTGQRSGERRRHGNARKNDSTAERRDRVRSYWDSVGKEM  347

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLR+++ DLKSHF + KD  ANE++SEAL+F E NK W+FW CC C E+F DSE+H+
Sbjct  348   KKELLRVKVSDLKSHFSASKDDNANEIISEALTFREVNKTWRFWACCRCSEKFLDSEAHM  407

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
             QH++ EHM ++ PK+Q VLPQ++ NE +EMLL+  WKPLDI+AA KLL  Q K +   F 
Sbjct  408   QHIVQEHMGNVIPKMQMVLPQSLNNERIEMLLSSPWKPLDISAAVKLLCSQQKIQNTEF-  466

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTT-VDSREYDKNSEVWMD  1955
              N +   D+ E  DD     C    W D SP K+  GD CNG   ++S E          
Sbjct  467   -NGFHSGDIMEDGDD-----CFKDAWNDTSPEKENLGDTCNGCDEIESEE----------  510

Query  1956  RDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEEL  2135
               G        P E WPI+DDPERAKLLE++   F+ LI++KYL +SH  KVI F ++EL
Sbjct  511   --GKMPITFHLPDE-WPISDDPERAKLLEKLRAAFELLIRHKYLAASHHDKVIQFTLDEL  567

Query  2136  QSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIST  2315
             Q+L   SQ LN  + Q+P+CI FLGA +L+KILKFLQ+LS +CGL RY E+S   D+I+ 
Sbjct  568   QNLASVSQFLNRGLGQSPICIFFLGATQLRKILKFLQDLSQACGLSRYSEQSNPNDEINF  627

Query  2316  GIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNG  2495
             G  G++  E+I+F  + SCLL DE     +     +    + +    S+   +N    + 
Sbjct  628   GDLGLEVTEEILFDGEDSCLLLDEKLLGTECIQEKYMGSALKNGTIASSGDIANGNNVSS  687

Query  2496  GLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEH  2675
             G   +D  LSWIF G S GEQ  SW R++EEK  Q +EI+++LEKEF  LQ L ERKCEH
Sbjct  688   G---ADGFLSWIFTGPSGGEQTVSWMRTKEEKTNQGLEIMQILEKEFCNLQNLSERKCEH  744

Query  2676  LNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIE  2855
             L+YE ALQ VEDLCLEEG+KRE + DF   SYD  L+KRR+EL ES  E    + RFE++
Sbjct  745   LSYEGALQTVEDLCLEEGRKRETSADFTHESYDSVLRKRREELNESDQELVFISSRFELD  804

Query  2856  AISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQR  3035
             AI++VLKDAESLN NQFG+E++Y   SS L D+ESGE D+W +KD  N+ADS +E+AIQ+
Sbjct  805   AITNVLKDAESLNHNQFGYEESYACTSSPLRDVESGEVDEWGIKDSFNEADSFIEIAIQK  864

Query  3036  QKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAER  3215
             QKEH+S ELS+IDAR+MR V+GMQ LE+KL  VS++DY+ +L+PLVKSY+R+HLE LAE+
Sbjct  865   QKEHLSSELSRIDARMMRNVTGMQHLELKLGPVSSNDYQIVLLPLVKSYMRSHLEALAEK  924

Query  3216  DATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGN  3395
             DATEKSDAAREAFL ELA DSKK +   + N+KH+ EK++DKKKIKD +K KDLK + GN
Sbjct  925   DATEKSDAAREAFLVELALDSKKEALRRNANSKHTQEKSKDKKKIKDTKKLKDLKATIGN  984

Query  3396  GLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetl  3575
               H  +  + E +  S+   G    A++ +    ++ ++EEE RRRIELE EERKLE+TL
Sbjct  985   D-HRFNVASTEHSLPSLASYGDHSQADVVSEAVEALKEQEEEYRRRIELEDEERKLEKTL  1043

Query  3576  eYQRRIENEAKLKHLAEQHKK  3638
             EYQRRIENEAK KH+AEQ KK
Sbjct  1044  EYQRRIENEAKEKHIAEQQKK  1064


 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/407 (73%), Positives = 340/407 (84%), Gaps = 8/407 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++  KTLRQL  E+D+EERFQADL KAVRQSLD +   + +P   R+      E+ N G
Sbjct  1212  GDAETKTLRQLQAEEDEEERFQADLKKAVRQSLDVYQGKRNMPTYLRTPL----EVNNDG  1267

Query  4192  VSCEDVATGIVN--GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHI  4362
             V   DV    ++  G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH 
Sbjct  1268  V-LSDVTEETLSSTGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRRSTLEHH  1326

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVC+LYDIFTALS AS ETR++ VAP+SLRIALSNLYPD   FQE QMNDASEV
Sbjct  1327  HVGDPCVVCSLYDIFTALSAASGETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEV  1386

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLH+SF  +S  SD +S +S+C GSWDCAN  CI HSLFGMD+FE++NCY CGL
Sbjct  1387  LAVIFDCLHRSFAQSSSVSDADSSESNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGL  1446

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESRH+KYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+A GCGK NHIH
Sbjct  1447  ESRHMKYTSFFHNINASALRTMKVTCVENSFDELLNLVEMNHQLACDPEAGGCGKPNHIH  1506

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVVCY
Sbjct  1507  HILTTPPHVFTIVLGWQNTCETVEDIVATLAALNTEIDISIMYRGLDPKSIYSLVSVVCY  1566

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFAYSHDH+RWIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  1567  YGQHYHCFAYSHDHDRWIMYDDKTVKVIGSWNDVLSMCERGHLQPQV  1613



>ref|XP_006404317.1| hypothetical protein EUTSA_v10010059mg [Eutrema salsugineum]
 gb|ESQ45770.1| hypothetical protein EUTSA_v10010059mg [Eutrema salsugineum]
Length=1601

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1038 (56%), Positives = 755/1038 (73%), Gaps = 46/1038 (4%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +KLECE+AL S +RG++NKA+RLMK+ C++H++S   ALI+RVQGT+ VKVAS+ +D 
Sbjct  52    AVVKLECEKALLSFQRGSYNKAIRLMKESCSRHQDS---ALIHRVQGTLYVKVASVFEDL  108

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
               K +HL+NAI+SARK+V +SPNS+EF HFYANLLYEAANDG+EYEEVVQEC RAL+IEN
Sbjct  109   ATKQKHLRNAIESARKAVELSPNSVEFGHFYANLLYEAANDGREYEEVVQECHRALSIEN  168

Query  924   PIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLI  1100
             PIDPAKESLQ ENQQK+ TPEARIAHVQ ELR+LIQ+SNL+S+STW+KN G+GEEKFRLI
Sbjct  169   PIDPAKESLQDENQQKILTPEARIAHVQDELRSLIQKSNLSSLSTWMKNLGNGEEKFRLI  228

Query  1101  PIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ-KSESAQSFND  1277
             PIRRM EDP+E  L+Q R+PNEIKKATKT EE+RKEIEVRVAAA+L+QQ KSES  S N 
Sbjct  229   PIRRMVEDPIESTLIQTRRPNEIKKATKTLEEKRKEIEVRVAAAKLVQQQKSESLPSDNV  288

Query  1278  G---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRI  1448
             G       D + G GQR    RK GNARKN S+ ERRD VRSYW+SMS  MKK LLR+++
Sbjct  289   GTVNNNGSDPALGAGQR----RKHGNARKNGSTAERRDRVRSYWDSMSRVMKKDLLRVKV  344

Query  1449  VDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMC  1628
              DLKSHF   KDG ANE++SEA+SF EANK W+FW CC C E+FADSESH+QH++ EHM 
Sbjct  345   SDLKSHFSLTKDGNANEIISEAMSFFEANKTWRFWVCCRCSEKFADSESHMQHIVQEHMG  404

Query  1629  SLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSD-  1805
             ++ PK+Q VLP+++++E +E+LL+  WKPLD++AA KLL  Q K  +   + N +   D 
Sbjct  405   NVLPKMQMVLPESLDSERIEILLSSPWKPLDLSAAVKLLCSQQK--IQNSVSNEFHSGDN  462

Query  1806  MDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC  1985
             MD+  D   D + ++   D SP K+   D CN                   D NE  K+ 
Sbjct  463   MDDGDDCFKDAWNDI---DTSPEKENLEDTCNVC-----------------DENEEGKLS  502

Query  1986  PP---SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGS  2156
              P    + WPI+DD ERAKLL++I   F+ LI++KYL  SH  KVI F ++EL+++   S
Sbjct  503   IPFHLPDGWPISDDIERAKLLKKIRGAFELLIRHKYLAVSHHDKVIQFTLDELRNVPSVS  562

Query  2157  QLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDA  2336
             Q LN  + Q+P+CI FLGA +L KILKFLQ+LS +CGL RY E+S   D+++ G +G++ 
Sbjct  563   QFLNRGLGQSPICIFFLGATQLSKILKFLQDLSQACGLSRYSEQSNPNDEVNVGDRGLEV  622

Query  2337  MEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--  2510
              ++I+   + SCLL DE+    +     +    V +    S    +     NG  + S  
Sbjct  623   TDEILLDGENSCLLLDENLLGTECIQEKYMSSAVNNGAIASTGYIA-----NGNEVSSGA  677

Query  2511  DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEE  2690
             D  LSWIF G SS EQ+ SW R++EEK  + +EI+++LEK+F  L  LCERKCEHL+YE 
Sbjct  678   DGFLSWIFTGPSSEEQIVSWMRTKEEKTNEGLEIMQILEKDFCHLHNLCERKCEHLSYEG  737

Query  2691  ALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSV  2870
             ALQ VEDLCL+E +KRE + +F   SY+  L++RR+EL ES HE    + RFE++AI++V
Sbjct  738   ALQTVEDLCLDESRKRETSAEFTHESYESVLRRRREELNESDHELVFMSSRFELDAITNV  797

Query  2871  LKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHV  3050
             LKDAESLN NQFG+E++Y G SS+L DLESGE D W +KD  N+ADS +E+AIQ+QKE +
Sbjct  798   LKDAESLNQNQFGYEESYAGTSSYLRDLESGEADGWGMKDSFNEADSFIEIAIQKQKEQL  857

Query  3051  SVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEK  3230
             S ELS+IDA++MR VSGMQQLE+KL  VS++DY  +L+PLVKSY+RAHLE LAE+DATEK
Sbjct  858   SSELSRIDAQMMRNVSGMQQLELKLGPVSSNDYLIVLLPLVKSYMRAHLEALAEKDATEK  917

Query  3231  SdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHAL  3410
             SDAA EAFLAELA DSKK +   ++N+KH+ E+++DKKK KD +K KD+K + G+  H  
Sbjct  918   SDAASEAFLAELALDSKKGARGRNDNSKHTQERSKDKKKCKDTKKLKDMKATIGDN-HRF  976

Query  3411  HHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRR  3590
             + D+ E +  SV   G   +A++ +    +I ++EEE RRRIELE EERKLE+TLEYQRR
Sbjct  977   NVDSTEHSLPSVASYGDHSEADIVSEAVEAIKEQEEENRRRIELEEEERKLEKTLEYQRR  1036

Query  3591  IENEAKLKHLAEQHKKGA  3644
             IENEAK KH+AEQ KK +
Sbjct  1037  IENEAKEKHIAEQQKKNS  1054


 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/407 (72%), Positives = 333/407 (82%), Gaps = 8/407 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++G KTLRQL  E+D+EERFQADL KAVRQSLD +   + +     SG     E+ N G
Sbjct  1194  GDAGTKTLRQLQAEEDEEERFQADLQKAVRQSLDAYQGGRNMT----SGLRTPVEVNNDG  1249

Query  4192  VSCEDVAT--GIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHI  4362
             V   DV T      G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH 
Sbjct  1250  V-LSDVTTESQSSTGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLEMFRAEFLRSSTLEHH  1308

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVC+LY+IFTAL+ ASSET+++ VAP+SLRIALS LYPD   FQE QMNDASEV
Sbjct  1309  HVGDPCVVCSLYEIFTALNAASSETQKEPVAPSSLRIALSKLYPDSSFFQEAQMNDASEV  1368

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLH SF  +S  SD ES++S+  GSWDCAN  CI HSLFGMD+ E++NC  CGL
Sbjct  1369  LAVIFDCLHCSFAQSSSVSDAESLESNFTGSWDCANRTCIAHSLFGMDISEQLNCNSCGL  1428

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESRH+KYTSFFHNINASALRTMKV   ++SFDELLNLVEMNHQLACDPDA GCGK NHIH
Sbjct  1429  ESRHMKYTSFFHNINASALRTMKVTFAENSFDELLNLVEMNHQLACDPDAGGCGKPNHIH  1488

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS +YRGLDP S + L SVVCY
Sbjct  1489  HILTTPPHVFTTVLGWQNTCENVEDIAATLAALNTEIDISNMYRGLDPMSTYTLASVVCY  1548

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFA+SH+H+RWIMYDDKTVKVIG+W DVL MCERGHLQPQV
Sbjct  1549  YGQHYHCFAFSHEHDRWIMYDDKTVKVIGSWNDVLLMCERGHLQPQV  1595



>ref|XP_007155356.1| hypothetical protein PHAVU_003G194200g [Phaseolus vulgaris]
 gb|ESW27350.1| hypothetical protein PHAVU_003G194200g [Phaseolus vulgaris]
Length=1629

 Score =  1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/1107 (52%), Positives = 766/1107 (69%), Gaps = 38/1107 (3%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MGHKKR   PR+KPS A        V  AA  +    D  A  V +       +  +   
Sbjct  1     MGHKKRNSVPRTKPSAAASPAVQSGVGGAANGST-SPDADASNVSDHKPHNPSKIELTPP  59

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +  S Y+ IKLECERALT+LRRGNHNKA++L++++C++ E SP+ A ++RV   +C K 
Sbjct  60    QSEGSDYSTIKLECERALTTLRRGNHNKAMKLLREICSREEGSPHSAFVHRVHSLMCFKT  119

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             A++I DP+ K RHLKNA++SAR +V + PNS+E+AHF A ++ EAA++GK+YE+VV ECE
Sbjct  120   ATVITDPSSKQRHLKNALESARHAVELMPNSVEYAHFRATVMLEAASEGKDYEDVVHECE  179

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             R LAIENP DPAKE+LQ E++QK S+ E RIAHVQ ELR LIQ+SN+AS+S+W+KN  +G
Sbjct  180   RGLAIENPSDPAKETLQDESEQKASSTEERIAHVQNELRQLIQKSNIASLSSWMKNLSNG  239

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             EE+FRLIPIRR  EDPME+RLVQ R+PNEIKK TKTPEERRKEIEVRVAAARLLQQKSE+
Sbjct  240   EERFRLIPIRRTPEDPMEVRLVQTRRPNEIKKVTKTPEERRKEIEVRVAAARLLQQKSEA  299

Query  1260  AQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
              QS N+G+R    LD SAG+GQR  +RR+ GN RK+  + ER   V SYW S+S D KK 
Sbjct  300   PQSPNEGDRDDRPLDSSAGSGQRIGDRRRHGNVRKSGFTTERMKWVHSYWKSVSVDRKKN  359

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LR++  DLK H+GS KD L N++LSEALS+AEANK WKFW CC+C E+  + +SH  HV
Sbjct  360   FLRVKTCDLKLHYGSSKDTLPNDILSEALSYAEANKTWKFWPCCNCEEKHYNPDSHRHHV  419

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SLSP++Q +LPQNV++EW+EM+LNCSWKPLD+ AA ++L+ + + +     E+ 
Sbjct  420   VQEHMGSLSPQMQRLLPQNVDSEWIEMILNCSWKPLDVLAAVRMLDNKARFKSPSLSEDL  479

Query  1791  YTRS---DMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             Y  +   D +    + S  Y           K++ GD       +   + K  E  + R+
Sbjct  480   YLDNHTLDYNVCFKEASSSYIE---------KESSGDTLRNCLEECNNHCKIIENNV-RE  529

Query  1962  GNE-----GTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
             G E       +I    + WP++DDPERAKLL +I+ +F+TLI++K L +SHL+KVI F +
Sbjct  530   GVEDQLSVADRII---DCWPVSDDPERAKLLGKIHGMFETLIRHKCLAASHLNKVIQFTM  586

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPER-STAID  2303
              E+Q L  GSQLL++ +DQTP+CICFLG  +LK I +FLQE+SH+CGL R  ++ S+  +
Sbjct  587   GEIQGLAAGSQLLSHGVDQTPMCICFLGPSQLKTIFQFLQEISHACGLARNADKGSSPTN  646

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +  +KIV   D S LL DE     ++T  T    V+ D            +
Sbjct  647   DLLNISQGPEIKDKIVLDGDASRLLLDECLLQTQVTAGTNQGSVLDDVTTP--------R  698

Query  2484  CDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCER  2663
               +G    +D  LSWIF  +  G+Q+TSW R RE+K  +  EIV++LEKEFY LQGLCE+
Sbjct  699   SPDGTSCYNDAFLSWIFSSSPIGDQVTSWLRIREDKINKGKEIVQMLEKEFYHLQGLCEK  758

Query  2664  KCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYR  2843
             K E L+YEEALQ VEDLCLEEGKKRE   +FV+RSY+  L+KRR+EL+ES ++    + R
Sbjct  759   KGERLSYEEALQTVEDLCLEEGKKRETVGEFVQRSYESVLRKRREELIESENDMMYVSNR  818

Query  2844  FEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEV  3023
             FE++AIS+VL++AE+ NVNQFG+E+TY G++S LCDLESGE+D+WR+KDYL+Q D C+E 
Sbjct  819   FELDAISNVLQEAEARNVNQFGYEETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIEN  878

Query  3024  AIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLED  3203
             AIQ+ KEH+S+ELSKIDARI+R V+ MQQLE KL  +SA+DYR ILVPLVKSYLRA LED
Sbjct  879   AIQKLKEHLSIELSKIDARIIRSVTEMQQLEFKLGPISANDYRAILVPLVKSYLRALLED  938

Query  3204  LAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkG  3383
             LAE+DA EKSDAA EAFLAELA DSKK+   GSE+ KH  +    KK     +       
Sbjct  939   LAEKDAREKSDAASEAFLAELALDSKKAVKGGSESTKHVEKTKDRKKNKDHRKARDIK--  996

Query  3384  SNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkl  3563
             + G+ +      T  +++  V  +    D E+ +   + + Q EEE RR+IELE EE+KL
Sbjct  997   ATGDHVQFSVGSTVPDSNL-VAPESDFLDHEVGSMNDDDLEQLEEEFRRKIELEEEEKKL  1055

Query  3564  eetleYQRRIENEAKLKHLAEQHKKGA  3644
             EETLE+QRRIENEAK +HLAEQ KK +
Sbjct  1056  EETLEFQRRIENEAKQRHLAEQQKKSS  1082


 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/405 (73%), Positives = 327/405 (81%), Gaps = 3/405 (1%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G   +R+L VED +EERFQADL  AVRQSLDTF A   LP       +Q +     GV 
Sbjct  1218  NGSNVMRELPVEDAEEERFQADLKIAVRQSLDTFQARGSLPSASSLRMSQRASSVLDGVD  1277

Query  4198  CEDV--ATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHV  4368
             C  V   T  VNG  + GTGLKNEVGEYNCFLNVIIQSLWHLRRFR EFL RS +EH HV
Sbjct  1278  CSPVEDPTDNVNGATLLGTGLKNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRTEHDHV  1337

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALY+IFTAL +AS ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL 
Sbjct  1338  GNPCVVCALYEIFTALDIASKDSRREAVAPTSLRIALSNLYPHSSFFQEAQMNDASEVLA  1397

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SFT  S  SD ES +++CMGSWDCANS+CI HSLFGM++FE+MNCY CGLES
Sbjct  1398  VIFDCLHRSFTRGSSVSDAESAETNCMGSWDCANSSCIAHSLFGMNIFEQMNCYHCGLES  1457

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RH+KYTSFFHNINASALR MK     S FD LLNLVEMNHQLACDP+A GCGK NHIHHF
Sbjct  1458  RHMKYTSFFHNINASALRDMKEKSPASFFDNLLNLVEMNHQLACDPEADGCGKLNHIHHF  1517

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LSTPPHVF TVLGWQNTCES +DI ATL ALST I+ISVLY GL+ +  H LVSVVCYYG
Sbjct  1518  LSTPPHVFMTVLGWQNTCESADDIAATLAALSTTINISVLYGGLNLECTHNLVSVVCYYG  1577

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSHDHE+WIMYDDKTVKVIG W DVLTMCERGHLQPQV
Sbjct  1578  QHYHCFAYSHDHEQWIMYDDKTVKVIGGWGDVLTMCERGHLQPQV  1622



>ref|XP_010503406.1| PREDICTED: uncharacterized protein LOC104780600 isoform X2 [Camelina 
sativa]
Length=1601

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1035 (55%), Positives = 749/1035 (72%), Gaps = 50/1035 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   AL +RVQGT+CVKVA++ +D   
Sbjct  58    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALAHRVQGTLCVKVAAVYEDLAT  114

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K ++L+NAI+SARK+V +SP+SIE+ HFYANLLYEAANDG+EY+EVVQEC RAL+IE PI
Sbjct  115   KKKYLRNAIESARKAVELSPSSIEYGHFYANLLYEAANDGREYDEVVQECHRALSIEYPI  174

Query  930   DPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPI  1106
             DPAK SLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G+GE+KFRLIPI
Sbjct  175   DPAKGSLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGNGEDKFRLIPI  234

Query  1107  RRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFN----  1274
             RRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N    
Sbjct  235   RRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSLSENVENV  294

Query  1275  DGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
             D + S D + G GQR  ERRK GNARKN S+++RRD VRSYW+SMS +MKK+LLR+++ D
Sbjct  295   DNKGS-DSTLGAGQRHGERRKHGNARKNSSTVDRRDRVRSYWDSMSKEMKKELLRVKVSD  353

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF + KDG ANE++SEALSF   NK W+FW CC C E F  SE+H+QH++  HMC++
Sbjct  354   LKSHFSASKDGQANEIISEALSFCGGNKTWRFWPCCQCSEMFMSSEAHMQHIVQVHMCNV  413

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ+V+ + +++LL+  WKPLD++AA KLL  Q K +   F  N +   D  E
Sbjct  414   RPKMQMVLPQSVDTDRIDVLLSSPWKPLDLSAAMKLLRSQQKIQNSEF--NNFHSGDNIE  471

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPP  1991
               DD     C    W D SP K++ GD CNG      E  K S  +            PP
Sbjct  472   DGDD-----CFEDAWNDTSPEKESLGDACNGCDEKESEEVKLSIAF------------PP  514

Query  1992  SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNY  2171
              + WP++DDPERAKLL +I   F+ LI+  YL SSHL KVI F +++LQ++   SQ +N 
Sbjct  515   PDGWPLSDDPERAKLLGKIRAAFEQLIRQNYLASSHLDKVIQFTLDKLQNIPAVSQFVNR  574

Query  2172  NIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIV  2351
             +++Q+P+CICFLGA +L+ ILKFLQ+LS  CGL RY E+S  I+    G  G +  E+I+
Sbjct  575   SLNQSPICICFLGASQLRNILKFLQDLSQPCGLSRYSEQSNPIN---FGDLGREVTEEIL  631

Query  2352  FSEDGSCLLFDEHFKPC-----KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--  2510
             F  + SCLL DE          K      H+ V+  S   +          NG  + S  
Sbjct  632   FDAEDSCLLLDEKLLGTESIQEKFMGSALHNVVIASSVDIA----------NGNNVSSSV  681

Query  2511  DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEE  2690
             D  LSWIF G SS EQ+ SW R++E+K  Q  EI+++LEK+F  L+ LCERKCEHLNYE 
Sbjct  682   DGFLSWIFTGPSSEEQIVSWIRTKEDKTNQGQEIMQILEKDFSHLENLCERKCEHLNYEG  741

Query  2691  ALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSV  2870
             ALQ VEDLCLEEG+KRE + +F   S++  L+KRR+EL ES HE    + RFE++AI++V
Sbjct  742   ALQTVEDLCLEEGRKREISAEFTHESFETVLRKRREELNESDHELVFISSRFELDAITNV  801

Query  2871  LKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHV  3050
             LKDAESLN NQFG+E++YG +SS L DLESGE D+W +KD L++ADS +E AIQ+QKEH+
Sbjct  802   LKDAESLNHNQFGYEESYGCVSSQLRDLESGETDEWGMKDSLHEADSFIETAIQKQKEHL  861

Query  3051  SVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEK  3230
             S ELS+IDA++MR+V+GMQQLE++L  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEK
Sbjct  862   SAELSRIDAQMMRIVTGMQQLELRLGPVSSNDYQIVLLPLVKSYMRAHLEVLAEKDATEK  921

Query  3231  SdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHAL  3410
             SDAAREA L ELA DSKK +   ++N+KH+ EK++DKKKIKD RK KDLK + GN  H  
Sbjct  922   SDAAREALLVELALDSKKDARGRNDNSKHTLEKSKDKKKIKDTRKLKDLKATIGND-HRS  980

Query  3411  HHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRR  3590
             + D+ E +       G   +A++ +    ++ +++EE RR+IELE EERKLE++LEYQRR
Sbjct  981   NVDSIEHSLLQGASSGDHSEADVVSEAVEALKEQDEEYRRQIELEEEERKLEKSLEYQRR  1040

Query  3591  IENEAKLKHLAEQHK  3635
             IE+EAK KH+AEQ K
Sbjct  1041  IEDEAKEKHMAEQQK  1055


 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/405 (70%), Positives = 333/405 (82%), Gaps = 8/405 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G+ G KTLRQL  EDD+EERFQADL KAVRQSLD +   + +  +       +    + G
Sbjct  1198  GDLGTKTLRQLQAEDDEEERFQADLQKAVRQSLDAYQGGRNMSTL-------LEVNNDGG  1250

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             +S     +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH HV
Sbjct  1251  LSYVTTESWSPTGVPIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRRSTLEHHHV  1310

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY++FTALS+ASSE+R++ V P+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1311  GDPCVVCSLYEVFTALSVASSESRKEPVTPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1370

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE++NCY CGLES
Sbjct  1371  VIFDCLHRSFAQSSSLSDTESAESNSTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLES  1430

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RH+KYTSFFHNINASALRTMKV   ++SFDELLNLVE+NHQLACDP+  GCGK NHIHH 
Sbjct  1431  RHMKYTSFFHNINASALRTMKVTYPENSFDELLNLVEVNHQLACDPETGGCGKPNHIHHI  1490

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             L+TPP+VFTTVLGWQNTCE+VEDI  TL AL+TEIDIS++YRGLDPKS + LVSVVCYYG
Sbjct  1491  LTTPPNVFTTVLGWQNTCETVEDIADTLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYG  1550

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSH+H++WIMYDDK VKVIG+W+DVLTM ERGHLQPQV
Sbjct  1551  QHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVLTMSERGHLQPQV  1595



>ref|XP_010503405.1| PREDICTED: uncharacterized protein LOC104780600 isoform X1 [Camelina 
sativa]
Length=1602

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1035 (55%), Positives = 749/1035 (72%), Gaps = 50/1035 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   AL +RVQGT+CVKVA++ +D   
Sbjct  58    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALAHRVQGTLCVKVAAVYEDLAT  114

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K ++L+NAI+SARK+V +SP+SIE+ HFYANLLYEAANDG+EY+EVVQEC RAL+IE PI
Sbjct  115   KKKYLRNAIESARKAVELSPSSIEYGHFYANLLYEAANDGREYDEVVQECHRALSIEYPI  174

Query  930   DPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPI  1106
             DPAK SLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G+GE+KFRLIPI
Sbjct  175   DPAKGSLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGNGEDKFRLIPI  234

Query  1107  RRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFN----  1274
             RRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N    
Sbjct  235   RRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSLSENVENV  294

Query  1275  DGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
             D + S D + G GQR  ERRK GNARKN S+++RRD VRSYW+SMS +MKK+LLR+++ D
Sbjct  295   DNKGS-DSTLGAGQRHGERRKHGNARKNSSTVDRRDRVRSYWDSMSKEMKKELLRVKVSD  353

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF + KDG ANE++SEALSF   NK W+FW CC C E F  SE+H+QH++  HMC++
Sbjct  354   LKSHFSASKDGQANEIISEALSFCGGNKTWRFWPCCQCSEMFMSSEAHMQHIVQVHMCNV  413

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ+V+ + +++LL+  WKPLD++AA KLL  Q K +   F  N +   D  E
Sbjct  414   RPKMQMVLPQSVDTDRIDVLLSSPWKPLDLSAAMKLLRSQQKIQNSEF--NNFHSGDNIE  471

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPP  1991
               DD     C    W D SP K++ GD CNG      E  K S  +            PP
Sbjct  472   DGDD-----CFEDAWNDTSPEKESLGDACNGCDEKESEEVKLSIAF------------PP  514

Query  1992  SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNY  2171
              + WP++DDPERAKLL +I   F+ LI+  YL SSHL KVI F +++LQ++   SQ +N 
Sbjct  515   PDGWPLSDDPERAKLLGKIRAAFEQLIRQNYLASSHLDKVIQFTLDKLQNIPAVSQFVNR  574

Query  2172  NIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIV  2351
             +++Q+P+CICFLGA +L+ ILKFLQ+LS  CGL RY E+S  I+    G  G +  E+I+
Sbjct  575   SLNQSPICICFLGASQLRNILKFLQDLSQPCGLSRYSEQSNPIN---FGDLGREVTEEIL  631

Query  2352  FSEDGSCLLFDEHFKPC-----KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--  2510
             F  + SCLL DE          K      H+ V+  S   +          NG  + S  
Sbjct  632   FDAEDSCLLLDEKLLGTESIQEKFMGSALHNVVIASSVDIA----------NGNNVSSSV  681

Query  2511  DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEE  2690
             D  LSWIF G SS EQ+ SW R++E+K  Q  EI+++LEK+F  L+ LCERKCEHLNYE 
Sbjct  682   DGFLSWIFTGPSSEEQIVSWIRTKEDKTNQGQEIMQILEKDFSHLENLCERKCEHLNYEG  741

Query  2691  ALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSV  2870
             ALQ VEDLCLEEG+KRE + +F   S++  L+KRR+EL ES HE    + RFE++AI++V
Sbjct  742   ALQTVEDLCLEEGRKREISAEFTHESFETVLRKRREELNESDHELVFISSRFELDAITNV  801

Query  2871  LKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHV  3050
             LKDAESLN NQFG+E++YG +SS L DLESGE D+W +KD L++ADS +E AIQ+QKEH+
Sbjct  802   LKDAESLNHNQFGYEESYGCVSSQLRDLESGETDEWGMKDSLHEADSFIETAIQKQKEHL  861

Query  3051  SVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEK  3230
             S ELS+IDA++MR+V+GMQQLE++L  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEK
Sbjct  862   SAELSRIDAQMMRIVTGMQQLELRLGPVSSNDYQIVLLPLVKSYMRAHLEVLAEKDATEK  921

Query  3231  SdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHAL  3410
             SDAAREA L ELA DSKK +   ++N+KH+ EK++DKKKIKD RK KDLK + GN  H  
Sbjct  922   SDAAREALLVELALDSKKDARGRNDNSKHTLEKSKDKKKIKDTRKLKDLKATIGND-HRS  980

Query  3411  HHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRR  3590
             + D+ E +       G   +A++ +    ++ +++EE RR+IELE EERKLE++LEYQRR
Sbjct  981   NVDSIEHSLLQGASSGDHSEADVVSEAVEALKEQDEEYRRQIELEEEERKLEKSLEYQRR  1040

Query  3591  IENEAKLKHLAEQHK  3635
             IE+EAK KH+AEQ K
Sbjct  1041  IEDEAKEKHMAEQQK  1055


 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/405 (70%), Positives = 333/405 (82%), Gaps = 8/405 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G+ G KTLRQL  EDD+EERFQADL KAVRQSLD +   + +  +       +    + G
Sbjct  1199  GDLGTKTLRQLQAEDDEEERFQADLQKAVRQSLDAYQGGRNMSTL-------LEVNNDGG  1251

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             +S     +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH HV
Sbjct  1252  LSYVTTESWSPTGVPIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRRSTLEHHHV  1311

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY++FTALS+ASSE+R++ V P+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1312  GDPCVVCSLYEVFTALSVASSESRKEPVTPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1371

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE++NCY CGLES
Sbjct  1372  VIFDCLHRSFAQSSSLSDTESAESNSTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLES  1431

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RH+KYTSFFHNINASALRTMKV   ++SFDELLNLVE+NHQLACDP+  GCGK NHIHH 
Sbjct  1432  RHMKYTSFFHNINASALRTMKVTYPENSFDELLNLVEVNHQLACDPETGGCGKPNHIHHI  1491

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             L+TPP+VFTTVLGWQNTCE+VEDI  TL AL+TEIDIS++YRGLDPKS + LVSVVCYYG
Sbjct  1492  LTTPPNVFTTVLGWQNTCETVEDIADTLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYG  1551

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSH+H++WIMYDDK VKVIG+W+DVLTM ERGHLQPQV
Sbjct  1552  QHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVLTMSERGHLQPQV  1596



>ref|XP_010426256.1| PREDICTED: uncharacterized protein LOC104711264 [Camelina sativa]
Length=1599

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/1026 (55%), Positives = 744/1026 (73%), Gaps = 35/1026 (3%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   AL +RVQGT+CVKVA++ +D   
Sbjct  58    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALAHRVQGTLCVKVAAVYEDLAT  114

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             KN+ L+NAI+SARK+V +SPNSIE+ HFYANLLYEAANDG+EY+EVVQEC RAL+IE PI
Sbjct  115   KNKFLRNAIESARKAVELSPNSIEYGHFYANLLYEAANDGREYDEVVQECHRALSIEYPI  174

Query  930   DPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPI  1106
             DPAK SLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIPI
Sbjct  175   DPAKGSLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIPI  234

Query  1107  RRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGER  1286
             RRM+EDP+E  LVQ R PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N   +
Sbjct  235   RRMAEDPIESNLVQTRWPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSLSENVDNK  294

Query  1287  SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSH  1466
               D + G G R  ERRK GNARKN S+++RRD VRSYW+SMS +MKK+LLR+++ DLKSH
Sbjct  295   GSDSTLGAGHRNGERRKHGNARKNSSTVDRRDRVRSYWDSMSKEMKKELLRVKVSDLKSH  354

Query  1467  FGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKL  1646
             F + KDG ANE++SEALSF   +K W+FW CC C E F  SE+H+QH++  HMC++ PK+
Sbjct  355   FSASKDGQANEIISEALSFCGGSKTWRFWRCCQCSEMFMSSEAHMQHIVQVHMCNVMPKM  414

Query  1647  QSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKDD  1826
             Q VLPQ+V+ + +++LL+  WKPLD++AA KLL  Q K +   F  N +   D  E  DD
Sbjct  415   QMVLPQSVDTDRIDVLLSSPWKPLDLSAAMKLLRSQQKIQNSEF--NNFHSGDNMEDGDD  472

Query  1827  ISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESW  2003
                  C    W D SP K++ GD CNG      E  K S  +            PP + W
Sbjct  473   -----CFEDAWNDTSPEKESLGDACNGCDEKESEEVKLSIAF------------PPLDGW  515

Query  2004  PIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQ  2183
             P++DDPERAKLL +I   F+ LI+  YL SSHL KVI F +++LQ++   SQ +N +++Q
Sbjct  516   PLSDDPERAKLLGKIRAAFELLIRQNYLASSHLDKVIQFTLDKLQNIPAVSQFVNRSLNQ  575

Query  2184  TPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSED  2363
             +P+CICFLGA +L+ ILKFLQ+LS  CGL RY E+S  I+    G  G +  E+I+F  +
Sbjct  576   SPICICFLGASQLRNILKFLQDLSQPCGLSRYSEQSNPIN---FGDLGREVTEEILFDAE  632

Query  2364  GSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DELLSWIFM  2537
              SCLL DE     +     F    + + +  S+   +     NG  + S  D  LSWIF 
Sbjct  633   DSCLLLDEKLLGTESIQEKFMGSALHNVDIASSGDIA-----NGNNVSSSVDGFLSWIFT  687

Query  2538  GTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLC  2717
             G SS EQ+ SW R++EEK  Q  EI+++LEK+F  L+ LCERKCEHLNYE ALQ VEDLC
Sbjct  688   GPSSEEQIVSWIRTKEEKTNQGQEIMQILEKDFSHLENLCERKCEHLNYEGALQTVEDLC  747

Query  2718  LEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNV  2897
             LEEG+KRE + +F   S++  L+KRR+EL ES HE    + RFE++AI++VLKDAESLN 
Sbjct  748   LEEGRKREISAEFTHESFETVLRKRREELNESDHELVFISSRFELDAITNVLKDAESLNH  807

Query  2898  NQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDA  3077
             NQFG+E++YG +SS L DLESGE D+W +KD L++ADS +E AIQ+QKEH+S ELS+IDA
Sbjct  808   NQFGYEESYGCVSSQLRDLESGETDEWGLKDSLHEADSFIETAIQKQKEHLSAELSRIDA  867

Query  3078  RIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareafl  3257
             ++MR+V+GMQQLE++L  VS++DY+ +L+PLVKSY+R HLE LAE+DATEKSDAAREA L
Sbjct  868   QMMRIVTGMQQLELRLGPVSSNDYQIVLLPLVKSYMRTHLEVLAEKDATEKSDAAREALL  927

Query  3258  aelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEAS  3437
              ELA DSKK +   ++N+KH+ EK++DKKKIKD RK KDLK + GN  H  + D+ E + 
Sbjct  928   VELALDSKKDARGRNDNSKHTLEKSKDKKKIKDTRKLKDLKATIGND-HRSNVDSTEHSL  986

Query  3438  FSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKH  3617
                   G   +A++ +    ++ ++EEE RR+IELE EERKLE++LEYQRRIE+EAK KH
Sbjct  987   LQGASSGDYSEADVVSEAVEALKEQEEEYRRQIELEEEERKLEKSLEYQRRIEDEAKEKH  1046

Query  3618  LAEQHK  3635
             +AEQ K
Sbjct  1047  MAEQQK  1052


 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/405 (70%), Positives = 334/405 (82%), Gaps = 8/405 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G+ G KTLRQL  EDD+EERFQADL KAVRQSLD +   + +  +       +    + G
Sbjct  1196  GDVGTKTLRQLQAEDDEEERFQADLQKAVRQSLDAYQGGRNMSTL-------LEVNNDGG  1248

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             +S     +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH HV
Sbjct  1249  LSYVTTESWSPTGVPIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRRSTLEHHHV  1308

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY++FTALS+ASSE+R++ VAP+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1309  GDPCVVCSLYEVFTALSVASSESRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1368

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE++NCY CGLES
Sbjct  1369  VIFDCLHRSFAQSSSLSDTESAESNSTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLES  1428

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RH+KYTSFFHNINASALRTMKV    +SFDELLNLVE+NHQLACDP+  GCGK NHIHH 
Sbjct  1429  RHMKYTSFFHNINASALRTMKVTHPGNSFDELLNLVEVNHQLACDPETGGCGKLNHIHHI  1488

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             L+TPP+VFTTVLGWQNTCE+VEDI  TL AL+TEID+S++YRGLDPKS + LVSVVCYYG
Sbjct  1489  LTTPPNVFTTVLGWQNTCETVEDIAGTLAALNTEIDVSIMYRGLDPKSAYSLVSVVCYYG  1548

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSH+H++WIMYDDK VKVIG+W+DVLTMCERGHLQPQV
Sbjct  1549  QHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVLTMCERGHLQPQV  1593



>ref|XP_002877583.1| hypothetical protein ARALYDRAFT_485153 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53842.1| hypothetical protein ARALYDRAFT_485153 [Arabidopsis lyrata subsp. 
lyrata]
Length=1571

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/1030 (56%), Positives = 754/1030 (73%), Gaps = 30/1030 (3%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A IKLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D 
Sbjct  14    AVIKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDL  70

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIE  920
               K+++L+NAI+SARK+V +SPNSIEF HFYANLLYEAANDGK EY+EVVQEC+RAL+IE
Sbjct  71    ATKHKYLRNAIESARKAVELSPNSIEFGHFYANLLYEAANDGKREYDEVVQECQRALSIE  130

Query  921   NPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRL  1097
             NPIDPAKESL  E Q K+ TPEARI HVQ ELR+LIQ+SN+ S+STW+ N G GEEKFRL
Sbjct  131   NPIDPAKESLHDETQLKILTPEARIVHVQDELRSLIQKSNIGSLSTWMNNLGKGEEKFRL  190

Query  1098  IPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND  1277
             IPIRRM+EDP+E  L+Q R+PNEIKKA KT EE RKE+EVRVAAARLLQQKSES+   N 
Sbjct  191   IPIRRMAEDPIESNLIQTRRPNEIKKANKTIEEIRKEVEVRVAAARLLQQKSESSPLENV  250

Query  1278  G---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRI  1448
             G    +  D + G+G+R  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++
Sbjct  251   GAVDNKGPDPTLGSGKRSGERRKHGNARKNGSTADRRDRVRSYWDSMSKEMKKQLLRVKV  310

Query  1449  VDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMC  1628
              DLKSHF + KDG ANE++SEALSF EANK W+FW CC C E+F  SE+H+ H++ EHM 
Sbjct  311   SDLKSHFSASKDGNANEIISEALSFCEANKTWRFWVCCQCSEKFIKSEAHMHHIVQEHMG  370

Query  1629  SLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDM  1808
             ++ PK+Q VLPQ+V+ E ++MLL   WKPLD++AA KLL  Q K +   F E  ++  +M
Sbjct  371   NVLPKMQMVLPQSVDTERIDMLLTSPWKPLDLSAAIKLLRGQQKIQNSKFDE-FHSGDNM  429

Query  1809  DESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICP  1988
             D+  D  +D        D SP K++ G  CNG   + +E  K S  +            P
Sbjct  430   DDGDDCFTDARN-----DTSPEKESLGYTCNGCNENEQEEVKLSIAF------------P  472

Query  1989  PSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLN  2168
             P + WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ L+
Sbjct  473   PPDGWPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVIQFTLDELQNLASVSQFLS  532

Query  2169  YNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKI  2348
              +++Q+P+CICFLGA +L+KIL FLQ+L+ +CGL RY E+S + D+I++G    +  E+I
Sbjct  533   RSLNQSPICICFLGASQLRKILIFLQDLTQACGLNRYSEQSNSNDEINSGDLSREVTEEI  592

Query  2349  VFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSW  2528
             +   + SCLL DE     +     +      +    S+   +N    + G   +D  LSW
Sbjct  593   LLDGEDSCLLLDEKVLGTECIQEKYMGSAFDNVAIVSSGDIANGNNVSSG---ADGFLSW  649

Query  2529  IFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVE  2708
             IF G SSGEQ+ SW  ++EEK  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ VE
Sbjct  650   IFAGPSSGEQVVSWMCTKEEKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQTVE  709

Query  2709  DLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAES  2888
             DLCLEE +KRE + +F   SY+  L+KRR  L E+  E    + RFE++AI++VLKDAE+
Sbjct  710   DLCLEEARKRETSAEFTHESYESLLRKRRQGLNENDLELVFISSRFELDAITNVLKDAET  769

Query  2889  LNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSK  3068
             LN NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +EVAIQ+QKE +S ELS+
Sbjct  770   LNHNQFGYEESYGCTSSQLRDLESGEADEWGMKDSLHEADSFIEVAIQKQKEQLSAELSR  829

Query  3069  IDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaare  3248
             IDA++MR V+GMQQLE+KL  VS +DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAARE
Sbjct  830   IDAQMMRNVTGMQQLELKLGPVSFNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAARE  889

Query  3249  aflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAE  3428
             A L ELA DSKK +   ++N+K++ EK++DKKKIKD RK KDLK + GN  H  + D+ E
Sbjct  890   ALLVELALDSKKEARGRNDNSKNTLEKSKDKKKIKDTRKLKDLKATIGND-HRFNVDSIE  948

Query  3429  EASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAK  3608
              +  SV       +A++ +    ++  EEEE RRRIELE EERKLE+TLEYQRRIENEAK
Sbjct  949   HSLPSVASFVDHSEADVVSEAVEALKDEEEEYRRRIELEEEERKLEKTLEYQRRIENEAK  1008

Query  3609  LKHLAEQHKK  3638
              KH+AEQ+KK
Sbjct  1009  EKHIAEQNKK  1018


 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/405 (71%), Positives = 338/405 (83%), Gaps = 4/405 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++G KTLRQL  EDD+EERFQADL +AV QSLD +   + +    R+     ++     
Sbjct  1163  GDAGIKTLRQLQAEDDEEERFQADLKRAVLQSLDVYRGGRNMTSCLRTSLEDNNDWVLSD  1222

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             V+ E  ++    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH HV
Sbjct  1223  VTKESQSSP---GVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGLFRAEFLRSSTLEHHHV  1279

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY+I TALS A+SE R++ VAP+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1280  GDPCVVCSLYEILTALSAATSEARKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1339

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN +CI HSLFGMD+FE++NCY CGLES
Sbjct  1340  VIFDCLHRSFAQSSSVSDTESTESNSTGSWDCANRSCIAHSLFGMDIFEQLNCYSCGLES  1399

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+A GCGK NHIHH 
Sbjct  1400  RHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPEAGGCGKPNHIHHI  1459

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLD KS + LVSVVCYYG
Sbjct  1460  LTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDLKSTYSLVSVVCYYG  1519

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFA+SH+H+RWIMYDD+TVKVIG+W+DVL+MCERGHLQPQV
Sbjct  1520  QHYHCFAHSHEHDRWIMYDDQTVKVIGSWSDVLSMCERGHLQPQV  1564



>emb|CAB41150.1| putative protein [Arabidopsis thaliana]
Length=1528

 Score =  1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1029 (56%), Positives = 746/1029 (72%), Gaps = 31/1029 (3%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A IKLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D 
Sbjct  14    ALIKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDL  70

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIE  920
               K ++L+NAI+SARK+V +SP+SIEF HFYANLLYEAANDGK EY+EVVQEC RAL+IE
Sbjct  71    ATKQKYLRNAIESARKAVELSPDSIEFGHFYANLLYEAANDGKREYDEVVQECHRALSIE  130

Query  921   NPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRL  1097
             NPIDPAKESLQ E Q K+ TPEARI HVQ ELR+LIQ+SN++S+STW+ N G GEEKFRL
Sbjct  131   NPIDPAKESLQDETQLKILTPEARIVHVQDELRSLIQKSNISSLSTWMNNLGKGEEKFRL  190

Query  1098  IPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND  1277
             IPIRRM+EDP+E  LVQ R+PNEIKKA K+ EE RKE+EVRVAAARLLQQKSE       
Sbjct  191   IPIRRMAEDPIESNLVQTRRPNEIKKANKSIEEIRKEVEVRVAAARLLQQKSECENVGAV  250

Query  1278  GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDL  1457
               +  D + G+G+R  ERRK GNAR+N S+ +RRD V+SYW+SMS +MKK+LLR+++ DL
Sbjct  251   DNKGSDATLGSGKRSGERRKHGNARRNGSTADRRDRVKSYWDSMSKEMKKQLLRVKLSDL  310

Query  1458  KSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLS  1637
             KSHF + KDG  NE++SEALSF EANK W+FW CC C E+F  SE+++ H++  HM ++ 
Sbjct  311   KSHFSASKDGNENEIISEALSFCEANKTWRFWVCCQCSEKFIKSEAYMHHIVQVHMGNVL  370

Query  1638  PKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDES  1817
             PK+Q VLPQ+ + E ++MLL   WKPLD++AA K L  + K +   F E  +   +MD+ 
Sbjct  371   PKMQMVLPQSFDTERIDMLLTSPWKPLDLSAAVKWLRSRQKIQNSEFSE-FHAGDNMDDG  429

Query  1818  KDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSE  1997
              D   D        D SP K++ GD C G   +  E  K S  +            PP +
Sbjct  430   DDCFKDARN-----DTSPEKESLGDSCKGCDENDPEEGKLSITF------------PPPD  472

Query  1998  SWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNI  2177
              WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ LN ++
Sbjct  473   GWPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVIQFTLDELQNLASVSQFLNRSL  532

Query  2178  DQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFS  2357
             +Q+P+CICFLGA +L+KILKFLQ+LS +CGL RY E+S   D+ + G    +  E+I+  
Sbjct  533   NQSPICICFLGASQLRKILKFLQDLSQACGLSRYSEQSNPNDEFNFGALCREVTEEILLD  592

Query  2358  EDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DELLSWI  2531
              + SCLL DE     KL        +   S  ++ A++S+    NG  + S  D  LSWI
Sbjct  593   GEDSCLLLDE-----KLLGTECIQEIYMGSALHNVAVASSGDIANGNDVSSGADGFLSWI  647

Query  2532  FMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVED  2711
             F G SS EQ+ SW R++EEK  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ VED
Sbjct  648   FTGPSSEEQVVSWMRTKEEKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQTVED  707

Query  2712  LCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESL  2891
             LCLEE +KRE + +F   SY+  L+KRR+EL E+  E    + RFE++A+++VLKDAE+L
Sbjct  708   LCLEESRKRETSAEFTHESYESVLRKRREELNENDLELVFISSRFELDALTNVLKDAETL  767

Query  2892  NVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKI  3071
             N NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +EVAIQ+QKE +S ELS+I
Sbjct  768   NHNQFGYEESYGCTSSQLRDLESGEADEWGMKDSLHEADSFIEVAIQKQKEQLSAELSRI  827

Query  3072  DARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaarea  3251
             DA++MR V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAAREA
Sbjct  828   DAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAAREA  887

Query  3252  flaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEE  3431
              L ELA DSKK     ++N+KH+ EK++DKKKIKD RK K+LK + GN  H  + D+ E 
Sbjct  888   LLFELALDSKKEGRGRNDNSKHTLEKSKDKKKIKDTRKLKNLKATIGND-HRFNGDSIEH  946

Query  3432  ASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKL  3611
             +  SV   G   +A++ +    +++ EEEE RR  ELE EERKL +TLEYQRRIENEAK 
Sbjct  947   SLLSVASFGDHSEADVVSEAIEALSDEEEEYRRCNELEEEERKLAKTLEYQRRIENEAKE  1006

Query  3612  KHLAEQHKK  3638
             KH+AEQ KK
Sbjct  1007  KHIAEQKKK  1015


 Score =   499 bits (1286),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 240/358 (67%), Positives = 283/358 (79%), Gaps = 12/358 (3%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++GPKTLRQL  EDD+EERFQADL +A  QSLD +   + +    ++     ++     
Sbjct  1160  GDAGPKTLRQLQAEDDEEERFQADLKRAKLQSLDVYRGRRNMTSCLKTSLEDNNDWVLSD  1219

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             V+ E  ++    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH H 
Sbjct  1220  VTKESQSSP---GVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRSSTLEHHHF  1276

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY IFTALS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1277  GDPCVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1336

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN +CI HSLFGMDV E++NCY CGLES
Sbjct  1337  VIFDCLHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFGMDVSEQLNCYSCGLES  1396

Query  4729  RHLKYTSFFHNINASALRTMK--------VMCQDSSFDELLNLVEMNHQLACDPDARGCG  4884
             RHLKYTSFFHNINASALRTMK        V C ++SFDELLNLVEMNHQLACD +A GCG
Sbjct  1397  RHLKYTSFFHNINASALRTMKVSYECSLDVTCAENSFDELLNLVEMNHQLACDREAGGCG  1456

Query  4885  KHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKH  5058
             K NHIHH L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRG+DPK+ +
Sbjct  1457  KRNHIHHILTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGVDPKNTY  1514



>ref|XP_006292726.1| hypothetical protein CARUB_v10018972mg [Capsella rubella]
 gb|EOA25624.1| hypothetical protein CARUB_v10018972mg [Capsella rubella]
Length=1603

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/1035 (55%), Positives = 751/1035 (73%), Gaps = 45/1035 (4%)
 Frame = +3

Query  567   NIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPN  746
             +IKLEC++AL S  RG++NKA+RL+K+ C++H++S   AL++RVQGT+CVKVA++ +D  
Sbjct  54    DIKLECDKALKSFGRGSYNKAIRLIKESCSRHQHS---ALVHRVQGTLCVKVAAVYEDQA  110

Query  747   VKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENP  926
              K ++L+ AI+SARK+V + P SIEF HFYANLLYEAANDG+EY+EVVQEC RAL+IENP
Sbjct  111   TKQKYLRTAIESARKAVELCPTSIEFGHFYANLLYEAANDGREYDEVVQECHRALSIENP  170

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPAK SLQ E Q K+ TPEARIAHVQ ELR+L+Q+SN+ S+STW+ N G G+EKFRLIP
Sbjct  171   IDPAKGSLQDETQLKILTPEARIAHVQDELRSLVQKSNIGSLSTWMSNLGKGDEKFRLIP  230

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDG-  1280
             IRRM+EDP+E  L+Q R+PNEIKKATK+ EE RKE+EVRVAAARL+QQKSES  + N G 
Sbjct  231   IRRMAEDPIESNLIQTRRPNEIKKATKSLEEIRKEVEVRVAAARLIQQKSESLAAENVGT  290

Query  1281  --ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
                +  D + G G R  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++ D
Sbjct  291   VDNKGSDATLGAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSMSKEMKKELLRVKVSD  350

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF + KD  ANE++SEALSF E +K W+FW CC C E F DSE+H+QH++  HM ++
Sbjct  351   LKSHFSASKDEDANEIISEALSFCEGSKTWRFWLCCQCSEMFMDSEAHMQHIVQVHMGNV  410

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ+V+ E ++ML +  WKP+D++AA KLL  Q K  +  F  N +   D  E
Sbjct  411   VPKMQMVLPQSVDTERIDMLFSSPWKPMDLSAAVKLLRSQQK--IQNFEFNEFHSGDNIE  468

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPP  1991
               DD     C    W D SP +++  D CNG   +  E  K S  +            PP
Sbjct  469   DGDD-----CFKDAWNDTSPEQESLEDACNGCGENDSEEGKLSIAF------------PP  511

Query  1992  SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNY  2171
              + WP++DDPERAKLLE+I   F+ LIK+KYL +SH  KVI F V+ELQ+L   SQ +N 
Sbjct  512   PDGWPLSDDPERAKLLEKIRAAFELLIKHKYLAASHHDKVIQFTVDELQNLPAVSQFVNR  571

Query  2172  NIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIV  2351
             + +Q+P+CICFLGA +L+KILKFLQ+LS +CGL RY E+S   D+I+ G  G +  E+I+
Sbjct  572   SSNQSPICICFLGASQLRKILKFLQDLSQACGLSRYSEQSNPNDEINLGDLGREVTEEIL  631

Query  2352  FSEDGSCLLFDE-----HFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--  2510
             F  + SCLL DE      F   K      H+ V+           S+    NG  + S  
Sbjct  632   FDAEDSCLLLDEKLLLTEFIQEKFMGSLLHNVVIA----------SSGDITNGNNVSSGA  681

Query  2511  DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEE  2690
             D  LSWIF G SS EQ+ SW R++EEK+ Q MEI+++LEKEF  LQ LCERKCEHL+YE 
Sbjct  682   DGFLSWIFRGPSSEEQIVSWMRTKEEKSNQGMEIMQILEKEFSHLQNLCERKCEHLSYEG  741

Query  2691  ALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSV  2870
             ALQ VE+LCLEE +KRE + +F   SY+  L+KRR+EL ES HE    + RFE++AI+++
Sbjct  742   ALQTVEELCLEECRKREISAEFTHESYETVLRKRREELNESDHELMFISSRFELDAITNI  801

Query  2871  LKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHV  3050
             LKDAE+LN NQFG+E++YG  SS L D+ESGE D+W +KD L++ADS +E+AIQ+QKE +
Sbjct  802   LKDAETLNQNQFGYEESYGCTSSQLRDMESGEADEWGMKDSLHEADSFIEIAIQKQKEQL  861

Query  3051  SVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEK  3230
             S ELS+IDA++MR+V+GMQQLE++L  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEK
Sbjct  862   SAELSRIDAQMMRIVTGMQQLELRLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEK  921

Query  3231  SdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHAL  3410
             SDAAR+A L ELA DSKK S   ++N+KH+ EK++DKKK+KD RK KD+KG+ GN  H  
Sbjct  922   SDAARDALLVELALDSKKESRGRNDNSKHTLEKSKDKKKVKDTRKLKDMKGTIGND-HRS  980

Query  3411  HHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRR  3590
             + D+ E +   V   G   +AE+ +    ++ ++EEE RR+IELE EERKLE TLEYQR+
Sbjct  981   NVDSIERSLLQVASFGDHSEAEVVSEAVEALKEQEEEHRRQIELEEEERKLEITLEYQRK  1040

Query  3591  IENEAKLKHLAEQHK  3635
             IE+EAK KH+AEQ K
Sbjct  1041  IEDEAKEKHIAEQQK  1055


 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/408 (71%), Positives = 336/408 (82%), Gaps = 14/408 (3%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKL--PL-IPRSGTAQISEMA  4182
             G+ G KTLRQL  EDD+EERFQADL KAV QSLD +   + L  PL +  +G      M 
Sbjct  1200  GDVGTKTLRQLQAEDDEEERFQADLKKAVLQSLDAYQGGRNLSTPLEVNNNGGLSSVTME  1259

Query  4183  NLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EH  4359
             +LG      +TG V    ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH
Sbjct  1260  SLG------STGDV----IFGTGLQNEVGEYNCFLNVIIQSLWNLELFRTEFLRSSTLEH  1309

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
              HVG+PC VC+LY+IFTALS ASSE R++ VAP+SLRIALSNLYPD   FQE QMNDASE
Sbjct  1310  HHVGNPCAVCSLYEIFTALSAASSELRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASE  1369

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+SF  +S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE++NCY CG
Sbjct  1370  VLAVIFDCLHRSFAQSSSMSDTESAESNSTGSWDCANRTCIAHSLFGMDIFEQLNCYSCG  1429

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             LESRH+KYTSFFHNINASALRTMKV   ++SFDELLN VE+NHQLACDP+A GCGK NHI
Sbjct  1430  LESRHMKYTSFFHNINASALRTMKVTYPENSFDELLNHVEVNHQLACDPEAGGCGKPNHI  1489

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH L+TPP+VFTTVLGWQNTCE+VEDI  TL AL+TEIDIS++YRGLDPKS + LVSVVC
Sbjct  1490  HHILTTPPNVFTTVLGWQNTCETVEDIADTLAALNTEIDISIMYRGLDPKSTYSLVSVVC  1549

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YYGQHYHCFAYSH+H++WIMYDDK VKVIG+W+DVL+MC+RGHLQPQV
Sbjct  1550  YYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVLSMCKRGHLQPQV  1597



>ref|NP_190372.3| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78343.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1568

 Score =  1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1029 (56%), Positives = 746/1029 (72%), Gaps = 31/1029 (3%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A IKLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D 
Sbjct  14    ALIKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDL  70

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIE  920
               K ++L+NAI+SARK+V +SP+SIEF HFYANLLYEAANDGK EY+EVVQEC RAL+IE
Sbjct  71    ATKQKYLRNAIESARKAVELSPDSIEFGHFYANLLYEAANDGKREYDEVVQECHRALSIE  130

Query  921   NPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRL  1097
             NPIDPAKESLQ E Q K+ TPEARI HVQ ELR+LIQ+SN++S+STW+ N G GEEKFRL
Sbjct  131   NPIDPAKESLQDETQLKILTPEARIVHVQDELRSLIQKSNISSLSTWMNNLGKGEEKFRL  190

Query  1098  IPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND  1277
             IPIRRM+EDP+E  LVQ R+PNEIKKA K+ EE RKE+EVRVAAARLLQQKSE       
Sbjct  191   IPIRRMAEDPIESNLVQTRRPNEIKKANKSIEEIRKEVEVRVAAARLLQQKSECENVGAV  250

Query  1278  GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDL  1457
               +  D + G+G+R  ERRK GNAR+N S+ +RRD V+SYW+SMS +MKK+LLR+++ DL
Sbjct  251   DNKGSDATLGSGKRSGERRKHGNARRNGSTADRRDRVKSYWDSMSKEMKKQLLRVKLSDL  310

Query  1458  KSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLS  1637
             KSHF + KDG  NE++SEALSF EANK W+FW CC C E+F  SE+++ H++  HM ++ 
Sbjct  311   KSHFSASKDGNENEIISEALSFCEANKTWRFWVCCQCSEKFIKSEAYMHHIVQVHMGNVL  370

Query  1638  PKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDES  1817
             PK+Q VLPQ+ + E ++MLL   WKPLD++AA K L  + K +   F E  +   +MD+ 
Sbjct  371   PKMQMVLPQSFDTERIDMLLTSPWKPLDLSAAVKWLRSRQKIQNSEFSE-FHAGDNMDDG  429

Query  1818  KDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSE  1997
              D   D        D SP K++ GD C G   +  E  K S  +            PP +
Sbjct  430   DDCFKDARN-----DTSPEKESLGDSCKGCDENDPEEGKLSITF------------PPPD  472

Query  1998  SWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNI  2177
              WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ LN ++
Sbjct  473   GWPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVIQFTLDELQNLASVSQFLNRSL  532

Query  2178  DQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFS  2357
             +Q+P+CICFLGA +L+KILKFLQ+LS +CGL RY E+S   D+ + G    +  E+I+  
Sbjct  533   NQSPICICFLGASQLRKILKFLQDLSQACGLSRYSEQSNPNDEFNFGALCREVTEEILLD  592

Query  2358  EDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DELLSWI  2531
              + SCLL DE     KL        +   S  ++ A++S+    NG  + S  D  LSWI
Sbjct  593   GEDSCLLLDE-----KLLGTECIQEIYMGSALHNVAVASSGDIANGNDVSSGADGFLSWI  647

Query  2532  FMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVED  2711
             F G SS EQ+ SW R++EEK  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ VED
Sbjct  648   FTGPSSEEQVVSWMRTKEEKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQTVED  707

Query  2712  LCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESL  2891
             LCLEE +KRE + +F   SY+  L+KRR+EL E+  E    + RFE++A+++VLKDAE+L
Sbjct  708   LCLEESRKRETSAEFTHESYESVLRKRREELNENDLELVFISSRFELDALTNVLKDAETL  767

Query  2892  NVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKI  3071
             N NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +EVAIQ+QKE +S ELS+I
Sbjct  768   NHNQFGYEESYGCTSSQLRDLESGEADEWGMKDSLHEADSFIEVAIQKQKEQLSAELSRI  827

Query  3072  DARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaarea  3251
             DA++MR V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAAREA
Sbjct  828   DAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAAREA  887

Query  3252  flaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEE  3431
              L ELA DSKK     ++N+KH+ EK++DKKKIKD RK K+LK + GN  H  + D+ E 
Sbjct  888   LLFELALDSKKEGRGRNDNSKHTLEKSKDKKKIKDTRKLKNLKATIGND-HRFNGDSIEH  946

Query  3432  ASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKL  3611
             +  SV   G   +A++ +    +++ EEEE RR  ELE EERKL +TLEYQRRIENEAK 
Sbjct  947   SLLSVASFGDHSEADVVSEAIEALSDEEEEYRRCNELEEEERKLAKTLEYQRRIENEAKE  1006

Query  3612  KHLAEQHKK  3638
             KH+AEQ KK
Sbjct  1007  KHIAEQKKK  1015


 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/405 (71%), Positives = 336/405 (83%), Gaps = 4/405 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++GPKTLRQL  EDD+EERFQADL +A  QSLD +   + +    R+     ++     
Sbjct  1160  GDAGPKTLRQLQAEDDEEERFQADLKRAKLQSLDVYRGRRNMTSCLRTSLEDNNDWVLSD  1219

Query  4192  VSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHV  4368
             V+ E  ++    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH H 
Sbjct  1220  VTKESQSSP---GVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRSSTLEHHHF  1276

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             GDPCVVC+LY IFTALS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1277  GDPCVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLA  1336

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF  +S  SDTES +S+  GSWDCAN +CI HSLFGMDV E++NCY CGLES
Sbjct  1337  VIFDCLHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFGMDVSEQLNCYSCGLES  1396

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACD +A GCGK NHIHH 
Sbjct  1397  RHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDREAGGCGKRNHIHHI  1456

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRG+DPK+ + LVSVVCYYG
Sbjct  1457  LTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGVDPKNTYSLVSVVCYYG  1516

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSH+H++WIMYDD+ VKVIG+W+DVL+MC+RGHLQPQV
Sbjct  1517  QHYHCFAYSHEHDQWIMYDDQNVKVIGSWSDVLSMCKRGHLQPQV  1561



>ref|XP_010426263.1| PREDICTED: uncharacterized protein LOC104711270 isoform X2 [Camelina 
sativa]
Length=1550

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1033 (55%), Positives = 744/1033 (72%), Gaps = 43/1033 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IKLECE+AL S  RG++NKA+RL+KD C++H   P+ AL +RVQGT+ VKVAS+ +D   
Sbjct  16    IKLECEKALKSFGRGSYNKAIRLIKDSCSRH---PDSALAHRVQGTIYVKVASVYEDLTT  72

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K+++L+NAI+SA K+V +SP+SIEF HFYANLLY+AANDGK EY+EVVQEC+RAL+IENP
Sbjct  73    KHKYLRNAIESASKAVELSPDSIEFGHFYANLLYDAANDGKREYDEVVQECQRALSIENP  132

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPAKESLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIP
Sbjct  133   IDPAKESLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIP  192

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGE  1283
             IRRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N  +
Sbjct  193   IRRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSPSENVDK  252

Query  1284  RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKS  1463
             +  D + G GQR  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++ DLKS
Sbjct  253   KGSDQTLGAGQRSGERRKHGNARKNGSTADRRDRVRSYWDSMSKEMKKELLRVKVSDLKS  312

Query  1464  HFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPK  1643
             HF + KDG ANE++SEALSF EA+K W F  CC C ++F DSE+H+QH++  HM ++ PK
Sbjct  313   HFSASKDGQANEIISEALSFCEASKTWSFLVCCRCSKKFMDSEAHMQHIVQVHMGNVVPK  372

Query  1644  LQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKD  1823
             +Q VLPQ ++ + +++LL+  WKPLD++AA +LL  Q + +   F  N +   D  E  D
Sbjct  373   MQMVLPQILDTDRIDILLSSPWKPLDLSAAVELLRSQQRIQKSEF--NDFHPGDNMEDGD  430

Query  1824  DISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSES  2000
             D     C    W D SP K++ GD CNG   +  E  K S  +            PP + 
Sbjct  431   D-----CFEDAWNDTSPEKESLGDACNGCDENESEERKLSIAF------------PPPDG  473

Query  2001  WPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNID  2180
             WPI+DDPERAKLL +I   F+ LI++KYL +SH  KVI F V+EL +L   SQ +N +++
Sbjct  474   WPISDDPERAKLLMKIRAAFELLIRHKYLAASHHDKVIQFTVDELLNLPSVSQFVNRSLN  533

Query  2181  QTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSE  2360
             Q+P+CICFL A +L KIL+FL +LS +CGL RY E S   D+I+ G  G +  EKIVF  
Sbjct  534   QSPMCICFLEASQLGKILRFLHDLSQACGLSRYSEPSNPNDEINFGDLGREVTEKIVFDA  593

Query  2361  DGSCLLFDEHF--KPC---KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DEL  2519
             +GSCLL DE      C   K+   T H+ V+  S   +          NG  + S  D  
Sbjct  594   EGSCLLLDEKLLGTECIQEKIMGATLHNVVIASSRDIA----------NGDNVSSGADGF  643

Query  2520  LSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQ  2699
             LSWIF G SSGEQ+ SW  + EEK  Q +EI+ +LEKE   LQ LCERKCEH++YE ALQ
Sbjct  644   LSWIFTGPSSGEQIVSWMHTMEEKTNQGLEIMEILEKELSRLQNLCERKCEHISYEGALQ  703

Query  2700  VVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKD  2879
              V D+CLEE +KRE + DF   SY+  L++RR+EL E+ HE    + RFE++AI++VLKD
Sbjct  704   TVVDICLEESRKRETSADFTHESYETVLRRRREELNENDHELVFMSSRFELDAITNVLKD  763

Query  2880  AESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVE  3059
             AESLN NQFG+E++YG +SS L DLESGE  +  +KD L++ADSC+E+AIQ+QKE +S E
Sbjct  764   AESLNYNQFGYEESYGSMSSQLRDLESGEAYERGMKDSLHEADSCIEIAIQKQKEQLSAE  823

Query  3060  LSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSda  3239
             LSKIDA++MR+V+GMQQ E++L  VS+ DY+ +L+PLVKSY+RAHLE LAE+DATEKSDA
Sbjct  824   LSKIDAQMMRIVTGMQQTELRLGPVSSSDYQIVLLPLVKSYMRAHLEALAEKDATEKSDA  883

Query  3240  areaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHD  3419
             AREA L ELA DS K +   ++N+KH  EK++DKKKIKD RK KDLK S  N     + D
Sbjct  884   AREALLVELALDSTKETRGRNDNSKHMLEKSKDKKKIKDTRKLKDLKASTEND-QRFNDD  942

Query  3420  TAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIEN  3599
             + E +  SV   G   +A++ +    ++ ++EEE RRR+ELE EERKLE+TLEYQRRIEN
Sbjct  943   SIEHSHPSVASYGDPSEADVFSEAVEALNEQEEEYRRRMELEEEERKLEKTLEYQRRIEN  1002

Query  3600  EAKLKHLAEQHKK  3638
             EAK KH+AEQ KK
Sbjct  1003  EAKEKHIAEQKKK  1015


 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/435 (66%), Positives = 338/435 (78%), Gaps = 30/435 (7%)
 Frame = +1

Query  3922  EKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVR  4101
             E C    SG E+    E+         +  G++G KTLRQL  EDD+EERFQADL +AVR
Sbjct  1138  ENCKSQRSGTESEGQSEIL--------RSNGDAGTKTLRQLQAEDDEEERFQADLKRAVR  1189

Query  4102  QSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCE-DVATGIVNGIEVYGTGLKNEVGEYN  4278
             QSLD +   + +P  P        E+ N G+  +  + +   +G+ ++GTGL+NEVGEYN
Sbjct  1190  QSLDVYQGGRSMP-TPL-------EVINDGILSDVTMESQSTSGVAIFGTGLQNEVGEYN  1241

Query  4279  CFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAP  4458
             CFLNVIIQS             S+ EH HVGDPCVVCALY+IFTALS ASSETR++ VAP
Sbjct  1242  CFLNVIIQS-------------STLEHHHVGDPCVVCALYEIFTALSAASSETRKEPVAP  1288

Query  4459  NSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSW  4638
             +SLRIALS LYPD   FQE QMNDASEVL VIF+CLH+SF   S  SDT+S +S+  G W
Sbjct  1289  SSLRIALSKLYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQTSSVSDTDSAESNSTGLW  1348

Query  4639  DCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFD  4818
             DCAN  CI HSLFGMD+FE++NCY CGLESRH+KYTSFFHNINASALRTMKV C ++SF+
Sbjct  1349  DCANRTCIAHSLFGMDIFEQLNCYSCGLESRHMKYTSFFHNINASALRTMKVTCVENSFE  1408

Query  4819  ELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVA  4998
             ELLNLVEMNHQ+ACDP+A GCGK NHIHH L+TPPHVFTTVLGWQNTCE+VEDI ATL A
Sbjct  1409  ELLNLVEMNHQVACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIAATLAA  1468

Query  4999  LSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWA  5178
             L+TEIDIS++YRGLDPKS + LVSVVCYYGQHYHCF YSH+H+RWIMYDDKTVKVIG+W+
Sbjct  1469  LNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHDRWIMYDDKTVKVIGSWS  1528

Query  5179  DVLTMCERGHLQPQV  5223
             DVL+MCERGHLQPQV
Sbjct  1529  DVLSMCERGHLQPQV  1543



>ref|XP_010426262.1| PREDICTED: uncharacterized protein LOC104711270 isoform X1 [Camelina 
sativa]
Length=1564

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1033 (55%), Positives = 744/1033 (72%), Gaps = 43/1033 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IKLECE+AL S  RG++NKA+RL+KD C++H   P+ AL +RVQGT+ VKVAS+ +D   
Sbjct  16    IKLECEKALKSFGRGSYNKAIRLIKDSCSRH---PDSALAHRVQGTIYVKVASVYEDLTT  72

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K+++L+NAI+SA K+V +SP+SIEF HFYANLLY+AANDGK EY+EVVQEC+RAL+IENP
Sbjct  73    KHKYLRNAIESASKAVELSPDSIEFGHFYANLLYDAANDGKREYDEVVQECQRALSIENP  132

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPAKESLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIP
Sbjct  133   IDPAKESLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIP  192

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGE  1283
             IRRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N  +
Sbjct  193   IRRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSPSENVDK  252

Query  1284  RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKS  1463
             +  D + G GQR  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++ DLKS
Sbjct  253   KGSDQTLGAGQRSGERRKHGNARKNGSTADRRDRVRSYWDSMSKEMKKELLRVKVSDLKS  312

Query  1464  HFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPK  1643
             HF + KDG ANE++SEALSF EA+K W F  CC C ++F DSE+H+QH++  HM ++ PK
Sbjct  313   HFSASKDGQANEIISEALSFCEASKTWSFLVCCRCSKKFMDSEAHMQHIVQVHMGNVVPK  372

Query  1644  LQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKD  1823
             +Q VLPQ ++ + +++LL+  WKPLD++AA +LL  Q + +   F  N +   D  E  D
Sbjct  373   MQMVLPQILDTDRIDILLSSPWKPLDLSAAVELLRSQQRIQKSEF--NDFHPGDNMEDGD  430

Query  1824  DISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSES  2000
             D     C    W D SP K++ GD CNG   +  E  K S  +            PP + 
Sbjct  431   D-----CFEDAWNDTSPEKESLGDACNGCDENESEERKLSIAF------------PPPDG  473

Query  2001  WPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNID  2180
             WPI+DDPERAKLL +I   F+ LI++KYL +SH  KVI F V+EL +L   SQ +N +++
Sbjct  474   WPISDDPERAKLLMKIRAAFELLIRHKYLAASHHDKVIQFTVDELLNLPSVSQFVNRSLN  533

Query  2181  QTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSE  2360
             Q+P+CICFL A +L KIL+FL +LS +CGL RY E S   D+I+ G  G +  EKIVF  
Sbjct  534   QSPMCICFLEASQLGKILRFLHDLSQACGLSRYSEPSNPNDEINFGDLGREVTEKIVFDA  593

Query  2361  DGSCLLFDEHF--KPC---KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DEL  2519
             +GSCLL DE      C   K+   T H+ V+  S   +          NG  + S  D  
Sbjct  594   EGSCLLLDEKLLGTECIQEKIMGATLHNVVIASSRDIA----------NGDNVSSGADGF  643

Query  2520  LSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQ  2699
             LSWIF G SSGEQ+ SW  + EEK  Q +EI+ +LEKE   LQ LCERKCEH++YE ALQ
Sbjct  644   LSWIFTGPSSGEQIVSWMHTMEEKTNQGLEIMEILEKELSRLQNLCERKCEHISYEGALQ  703

Query  2700  VVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKD  2879
              V D+CLEE +KRE + DF   SY+  L++RR+EL E+ HE    + RFE++AI++VLKD
Sbjct  704   TVVDICLEESRKRETSADFTHESYETVLRRRREELNENDHELVFMSSRFELDAITNVLKD  763

Query  2880  AESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVE  3059
             AESLN NQFG+E++YG +SS L DLESGE  +  +KD L++ADSC+E+AIQ+QKE +S E
Sbjct  764   AESLNYNQFGYEESYGSMSSQLRDLESGEAYERGMKDSLHEADSCIEIAIQKQKEQLSAE  823

Query  3060  LSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSda  3239
             LSKIDA++MR+V+GMQQ E++L  VS+ DY+ +L+PLVKSY+RAHLE LAE+DATEKSDA
Sbjct  824   LSKIDAQMMRIVTGMQQTELRLGPVSSSDYQIVLLPLVKSYMRAHLEALAEKDATEKSDA  883

Query  3240  areaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHD  3419
             AREA L ELA DS K +   ++N+KH  EK++DKKKIKD RK KDLK S  N     + D
Sbjct  884   AREALLVELALDSTKETRGRNDNSKHMLEKSKDKKKIKDTRKLKDLKASTEND-QRFNDD  942

Query  3420  TAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIEN  3599
             + E +  SV   G   +A++ +    ++ ++EEE RRR+ELE EERKLE+TLEYQRRIEN
Sbjct  943   SIEHSHPSVASYGDPSEADVFSEAVEALNEQEEEYRRRMELEEEERKLEKTLEYQRRIEN  1002

Query  3600  EAKLKHLAEQHKK  3638
             EAK KH+AEQ KK
Sbjct  1003  EAKEKHIAEQKKK  1015


 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/436 (68%), Positives = 349/436 (80%), Gaps = 18/436 (4%)
 Frame = +1

Query  3922  EKCPPVTSGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVR  4101
             E C    SG E+    E+         +  G++G KTLRQL  EDD+EERFQADL +AVR
Sbjct  1138  ENCKSQRSGTESEGQSEIL--------RSNGDAGTKTLRQLQAEDDEEERFQADLKRAVR  1189

Query  4102  QSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCE-DVATGIVNGIEVYGTGLKNEVGEYN  4278
             QSLD +   + +P  P        E+ N G+  +  + +   +G+ ++GTGL+NEVGEYN
Sbjct  1190  QSLDVYQGGRSMP-TPL-------EVINDGILSDVTMESQSTSGVAIFGTGLQNEVGEYN  1241

Query  4279  CFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVA  4455
             CFLNVIIQSLW+L  FR EFL+SS+ EH HVGDPCVVCALY+IFTALS ASSETR++ VA
Sbjct  1242  CFLNVIIQSLWNLGMFRAEFLQSSTLEHHHVGDPCVVCALYEIFTALSAASSETRKEPVA  1301

Query  4456  PNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGS  4635
             P+SLRIALS LYPD   FQE QMNDASEVL VIF+CLH+SF   S  SDT+S +S+  G 
Sbjct  1302  PSSLRIALSKLYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQTSSVSDTDSAESNSTGL  1361

Query  4636  WDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSF  4815
             WDCAN  CI HSLFGMD+FE++NCY CGLESRH+KYTSFFHNINASALRTMKV C ++SF
Sbjct  1362  WDCANRTCIAHSLFGMDIFEQLNCYSCGLESRHMKYTSFFHNINASALRTMKVTCVENSF  1421

Query  4816  DELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLV  4995
             +ELLNLVEMNHQ+ACDP+A GCGK NHIHH L+TPPHVFTTVLGWQNTCE+VEDI ATL 
Sbjct  1422  EELLNLVEMNHQVACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIAATLA  1481

Query  4996  ALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNW  5175
             AL+TEIDIS++YRGLDPKS + LVSVVCYYGQHYHCF YSH+H+RWIMYDDKTVKVIG+W
Sbjct  1482  ALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHDRWIMYDDKTVKVIGSW  1541

Query  5176  ADVLTMCERGHLQPQV  5223
             +DVL+MCERGHLQPQV
Sbjct  1542  SDVLSMCERGHLQPQV  1557



>ref|XP_010515104.1| PREDICTED: uncharacterized protein LOC104791003 [Camelina sativa]
Length=1565

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1028 (56%), Positives = 740/1028 (72%), Gaps = 35/1028 (3%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IKLECE+AL S  RG++NKA+RL+KD C++H   P+ AL +RVQGT+ VKVAS+ DD   
Sbjct  16    IKLECEKALKSFGRGSYNKAVRLIKDTCSRH---PDSALAHRVQGTIYVKVASVYDDLAT  72

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K++HL+NAI+SARK+V +SP+SIEF HFYANLLY+AANDGK EY+EVVQEC+RAL+IENP
Sbjct  73    KHKHLRNAIESARKAVELSPDSIEFGHFYANLLYDAANDGKREYDEVVQECQRALSIENP  132

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPAKESLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIP
Sbjct  133   IDPAKESLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIP  192

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGE  1283
             IRRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N  +
Sbjct  193   IRRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSPSENVDK  252

Query  1284  RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKS  1463
             +  D + GTGQR  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++ DLKS
Sbjct  253   KGSDQTLGTGQRSGERRKHGNARKNGSTADRRDRVRSYWDSMSEEMKKELLRVKVSDLKS  312

Query  1464  HFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPK  1643
             HF + KDG ANE++SEALSF EANK W F  CC C E+F DSE+H+QH++  HM ++ PK
Sbjct  313   HFSASKDGQANEIISEALSFCEANKTWSFLVCCRCSEKFMDSEAHMQHIVQVHMGNVVPK  372

Query  1644  LQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKD  1823
             +Q VLPQ ++ + +++LL+  WKPLD++AA +LL  Q + +   F  N +   D  E  D
Sbjct  373   MQMVLPQILDTDRIDILLSSPWKPLDLSAAVELLRSQQRIQKSEF--NDFHPGDNMEEGD  430

Query  1824  DISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSES  2000
             D     C    W D S  K++ GD CNG   +  E  K S  +            PP + 
Sbjct  431   D-----CFKDAWNDTSLDKESLGDACNGCDENESEECKLSIAF------------PPPDG  473

Query  2001  WPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNID  2180
             WPI+DDPERAKLL +I   F+ LI++KYL +SH  KVI F V+ELQ+L   SQ +N +++
Sbjct  474   WPISDDPERAKLLIKIRAAFELLIRHKYLAASHHDKVIQFTVDELQNLPSVSQFVNRSLN  533

Query  2181  QTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSE  2360
             Q+P+CICFL A +L KIL+FL +LS +CGL RY E+S   D+I+ G  G +  EKI+F  
Sbjct  534   QSPICICFLEASQLGKILRFLHDLSQACGLSRYSEQSNPNDEINFGDLGREVTEKIIFDA  593

Query  2361  DGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DELLSWIF  2534
             +GSCLL DE     +     F    + +   +           NG  + S  D  LSWIF
Sbjct  594   EGSCLLLDEKLLGTECIQEKFMGSALHNVASSRDIA-------NGDNVSSGADGFLSWIF  646

Query  2535  MGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDL  2714
              G SSGEQ+ SW  + E K  + MEI+ +LEKE   LQ LCERKCEHL+YE ALQ V D+
Sbjct  647   TGPSSGEQIVSWMHTMEAKTNKGMEIMEILEKELSRLQNLCERKCEHLSYEGALQTVVDI  706

Query  2715  CLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLN  2894
             CLEE +KRE + DF   SY+  L+KRR+EL ES HE    + RFE++AI++VLKDAESLN
Sbjct  707   CLEESRKRETSADFTHESYETVLRKRREELNESDHELVFMSSRFELDAITNVLKDAESLN  766

Query  2895  VNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKID  3074
              N FG+E++YG +SS L DLESGE  +  +KD L++ DS +E+AIQ+QKE +S ELSKID
Sbjct  767   HNHFGYEESYGSMSSQLRDLESGEAYECGMKDSLHEPDSFIEIAIQKQKEQLSAELSKID  826

Query  3075  ARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaf  3254
             A++MR+V+GMQQ E++L  VS++DY+ +L+PLVKSY+RAH+E L+E+DATEKSDAAREA 
Sbjct  827   AQMMRIVTGMQQSELRLGPVSSNDYQILLLPLVKSYMRAHVEALSEKDATEKSDAAREAL  886

Query  3255  laelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEA  3434
             L ELA DS K +   ++N+KH  EK++DKKKIKD RK KDLK + GN     + D+ E +
Sbjct  887   LVELALDSTKETRGRNDNSKHMLEKSKDKKKIKDTRKLKDLKATTGND-QRFNDDSIEHS  945

Query  3435  SFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLK  3614
               SV   G   +A++ +    ++ ++EEE RRRIELE EERKLE+TLEYQRRIENEAK K
Sbjct  946   HPSVASFGDHSEADVFSEAVEALNEQEEEYRRRIELEEEERKLEKTLEYQRRIENEAKEK  1005

Query  3615  HLAEQHKK  3638
             H+AEQ KK
Sbjct  1006  HIAEQKKK  1013


 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/469 (66%), Positives = 364/469 (78%), Gaps = 8/469 (2%)
 Frame = +1

Query  3829  NGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGE--VRPVDDSLEK  4002
             NG  +  G L SD+R G+R RRQK S K  + K     SG+EN +           S   
Sbjct  1094  NGVAIPAGVLQSDQRTGQRGRRQKASNKLVDGKYQVTPSGSENCKSQRSGTESEGQSETL  1153

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMA  4182
             +  G++G KTLRQL  EDD+EERFQADL +AVRQSLD +   + +    R+      E+ 
Sbjct  1154  RSNGDAGTKTLRQLQAEDDEEERFQADLKRAVRQSLDVYQGGRNMTSYMRTPL----EVN  1209

Query  4183  NLGVSCE-DVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-E  4356
             N GV  +  + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFL+SS+ E
Sbjct  1210  NDGVLSDVTMKSQSSTGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLQSSTLE  1269

Query  4357  HIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDAS  4536
             H HVGDPCVVC+LY+IFTALS AS ETR++ VAP+SLRIALSNLYPD   FQE QMNDAS
Sbjct  1270  HHHVGDPCVVCSLYEIFTALSAASIETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDAS  1329

Query  4537  EVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYEC  4716
             EVL VIF+CLH+SF   S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE +NCY C
Sbjct  1330  EVLAVIFDCLHRSFAQTSSVSDTESTESNSTGSWDCANRTCIAHSLFGMDIFEELNCYSC  1389

Query  4717  GLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNH  4896
             GLESRH+KYTSFFHNINASALRTMK    ++SF+ELLNLVEMNHQLACDP+A GCGK NH
Sbjct  1390  GLESRHMKYTSFFHNINASALRTMKATWAENSFEELLNLVEMNHQLACDPEAGGCGKPNH  1449

Query  4897  IHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVV  5076
             IHH L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVV
Sbjct  1450  IHHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVV  1509

Query  5077  CYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CYYGQHYHCF YSH+H RWIMYDD+TVKVIG+W+DVL+MCE+GHLQPQV
Sbjct  1510  CYYGQHYHCFTYSHEHNRWIMYDDQTVKVIGSWSDVLSMCEKGHLQPQV  1558



>emb|CAB41148.1| putative protein [Arabidopsis thaliana]
Length=1291

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/1032 (55%), Positives = 742/1032 (72%), Gaps = 41/1032 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D   
Sbjct  56    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDLAT  112

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K ++L+NAI+SARK+V +SPNSIEF HFYANLLYEAAN+GK EYEEVVQEC RAL+IE P
Sbjct  113   KQKYLRNAIESARKAVELSPNSIEFGHFYANLLYEAANEGKREYEEVVQECHRALSIEYP  172

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPA+ESLQ E Q K+ TPEARIAH Q ELR+LIQ+SN+ S+STW++  G+GEEKFRLIP
Sbjct  173   IDPARESLQDETQLKILTPEARIAHFQDELRSLIQKSNIYSLSTWMQTLGNGEEKFRLIP  232

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND--  1277
             +RRM+EDP+E  L+Q+R+PNEIKK+TKT EERRKEIEVRVAA RLLQQKSES+ S N   
Sbjct  233   LRRMAEDPIESNLIQSRRPNEIKKSTKTNEERRKEIEVRVAAHRLLQQKSESSPSENVEA  292

Query  1278  -GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
                +  D +   G R  ERRK GNARKN S+ +RRD VRSYW+S+S +MKK+ LR++  D
Sbjct  293   VNNKGSDSALAAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSLSKEMKKEFLRVKFSD  352

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF   KDG A E++SEALSF EANK W+FW CC C + F +SE+H+ H++  HM ++
Sbjct  353   LKSHFSGSKDGQAYEIVSEALSFCEANKTWRFWACCRCSQNFIESEAHMHHIVQAHMGNV  412

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ V+ E ++ML    WKPLD++A  KLL  Q K +   F E  ++  +MD 
Sbjct  413   LPKMQMVLPQIVDTERIDMLFKSPWKPLDLSATLKLLRSQQKIQNSEFDE-FHSGDNMDG  471

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC--  1985
               D   D       W D +P     GD CNG              W + +  E  K+   
Sbjct  472   GDDCFKD------AWNDTTPD----GDTCNG--------------WNENESEEEVKLSIA  507

Query  1986  -PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQL  2162
              PP + WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ 
Sbjct  508   FPPPDGWPISDDPERAKLLEKIRAAFEQLIRHKYLAASHHDKVIQFTLDELQNLPSVSQF  567

Query  2163  LNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAME  2342
             LN  ++++PLCICFLGA  L KILKFLQ+LS +CGL RY E+S   D+I+ G  G +  E
Sbjct  568   LNRGLNKSPLCICFLGASHLSKILKFLQDLSQACGLSRYSEQSNPHDEINFGDLGREVTE  627

Query  2343  KIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELL  2522
             +I+   + SCLL DE     +     +      +    S+   +N    + G   +D  L
Sbjct  628   EILLDSEDSCLLMDEKLLGTECIQEKYMGSAFNNVTIASSGDIANGNDVSSG---ADGFL  684

Query  2523  SWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQV  2702
             SWIF G SS EQ+ SW R++E+K  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ 
Sbjct  685   SWIFTGPSSEEQVVSWMRTKEDKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQT  744

Query  2703  VEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDA  2882
             VEDLCLEEG+KRE + +F   SY+  L+KRR+EL ES HE    + RFE++AI++VLKDA
Sbjct  745   VEDLCLEEGRKRETSAEFTHESYETVLRKRREELNESDHELLFISSRFELDAITNVLKDA  804

Query  2883  ESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVEL  3062
             E+LN NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +E+AIQ+QKE +S EL
Sbjct  805   ETLNHNQFGYEESYGCTSSQLRDLESGEADEWGIKDSLHEADSFIEIAIQKQKEQLSAEL  864

Query  3063  SKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaa  3242
             S+IDA++MR V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAA
Sbjct  865   SRIDAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAA  924

Query  3243  reaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDT  3422
             REA L ELA DSKK +   ++N+K++ EK++DKKKIKD RK KD+K + G+  H  + D+
Sbjct  925   REALLVELALDSKKEARGRNDNSKNTLEKSKDKKKIKDTRKVKDMKATIGSD-HRSNADS  983

Query  3423  AEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENE  3602
              E +   V   G   +A++ +    ++ +EEEE +R+IELE EERKLE+TLEYQRRIE+E
Sbjct  984   VEHSPLPVAPVGDHSEADIVSEAVEALKEEEEEYKRQIELEEEERKLEKTLEYQRRIEDE  1043

Query  3603  AKLKHLAEQHKK  3638
             AK KH+AEQ KK
Sbjct  1044  AKEKHMAEQQKK  1055


 Score = 55.1 bits (131),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTF  4119
             ++ G+ G KTLRQL  EDDDEERFQAD+ +AV QSL +F
Sbjct  1197  RNNGDVGTKTLRQLQAEDDDEERFQADMQRAVLQSLGSF  1235



>gb|KEH31899.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=1638

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/1107 (53%), Positives = 776/1107 (70%), Gaps = 40/1107 (4%)
 Frame = +3

Query  363   MGHKKR-PIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVES  539
             MGHKKR  + PRSK S A   V    +  AA        TS        L   +   +E 
Sbjct  1     MGHKKRNSVPPRSKLSPAASPVNQSPIGGAATATTTNGSTSPDADNSIILFDPNPNKIEF  60

Query  540   ETNAS-----SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
               N S     S ++ IK+ECERALT+ RRGNHN+A++LMK+LC K E S     ++R+ G
Sbjct  61    ANNGSPQSEASHFSAIKVECERALTTFRRGNHNRAMKLMKELCLKEEGSFYSPFVHRIYG  120

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
              +C KVAS+I D N K RHLK+A+D AR++V +SPNS+E+AHF+A+++ EAA + K+YE+
Sbjct  121   FICFKVASVITDCNAKQRHLKHAVDLARRAVELSPNSVEYAHFHASVMLEAATEAKDYED  180

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VV ECER LAIE P DPAKE+LQ E++QKVST E RI HVQGELR LIQ+SN+AS+S+W+
Sbjct  181   VVHECERGLAIEYPTDPAKETLQDESEQKVSTMEDRILHVQGELRQLIQKSNIASLSSWM  240

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             KN  +GEE+FRLIPIRR +EDPME+RLVQ R+PNEIKK TKTPEERRKEIEVRVAAARLL
Sbjct  241   KNLSNGEERFRLIPIRRATEDPMEVRLVQTRRPNEIKKVTKTPEERRKEIEVRVAAARLL  300

Query  1242  QQKSESAQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             QQKSES QS N+G+R   +LDL++G+ QR  ERR+  + RKN S+ ERR  V SYW+S+ 
Sbjct  301   QQKSESPQSPNEGDREDRALDLNSGSSQRTGERRR--HLRKNGSTAERRKWVLSYWDSVG  358

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSE  1592
              D+KK LL+I+I D+ SHF S KD L  +VLSEALS+AEANK W+FW+CC C ERF++ E
Sbjct  359   MDVKKDLLKIKISDIVSHFNSTKDTLLKDVLSEALSYAEANKTWRFWSCCICSERFSNQE  418

Query  1593  SHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVH  1772
              H QHV+  H+ +L PK+Q +LPQ+V+NEW+EM+LNCSWKPLD++AA K+L+ + K R  
Sbjct  419   FHRQHVMQVHLQTLPPKMQRILPQHVDNEWIEMILNCSWKPLDVSAAVKMLDYKAKFRGS  478

Query  1773  GFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM  1952
                E+ Y   D D+   D +  Y           +++ G      T +S +Y K  E  +
Sbjct  479   SRPED-YLTQDYDDCFKDSNSSYHE---------QESLGYSAVNCTSESSKYYKIDESDV  528

Query  1953  DRDGNEGTKIC--PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
              R+G E  +    P S+ WP++DD ERA+LLE+I+  F+ LI+ K L + HL KVI F++
Sbjct  529   -REGIEDQQFMANPVSDCWPVSDDEERAQLLEKIHGAFEILIRYKCLAAGHLHKVIQFSI  587

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAI-D  2303
              E+Q L  GS+LL ++IDQTP+CICFLGA +LKKIL+FLQELSH+CGLGRY ++S++  +
Sbjct  588   SEIQGLAAGSELLKHDIDQTPMCICFLGASQLKKILQFLQELSHACGLGRYADKSSSPKN  647

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +A EKIV S D SCLL DE     ++TP    + V  D    S+       
Sbjct  648   DLHDISQGAEAKEKIVLSGDASCLLLDECLLRTQVTPGITQEAVFEDLVTPSSP------  701

Query  2484  CDNGGLLDSD-ELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCE  2660
                 G+ DS   LLSW++     G+   SWSR++E+K  Q  E+VR L+KEFY+L  LC+
Sbjct  702   ---DGISDSSGALLSWLYASRPIGDHFASWSRTKEDKMCQGQEMVRALDKEFYQLHSLCQ  758

Query  2661  RKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNY  2840
             +KCE L+ EEALQ +EDLCLEEGKKRE+  +FV+RSY+  LK+RRDEL E  +E      
Sbjct  759   KKCERLSIEEALQTIEDLCLEEGKKRENVSEFVQRSYESVLKRRRDELAERENEMMYPGN  818

Query  2841  RFEIEAISSVLKDAESLNVN-QFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
             R E + I++VL++AE+ ++N Q+ +++ Y G++S LCDLESGEDD+WR+KD L+Q D C+
Sbjct  819   RVEFDCITNVLQEAETTSLNNQYCYDEAYTGVASQLCDLESGEDDEWRMKDCLHQMDGCI  878

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             E+AIQ+ KEH S+E+SK+DA I++ VS +Q LE+KL  VS +DYR ILVPLVK YL+  L
Sbjct  879   EIAIQKLKEHSSIEISKVDAEIIKCVSEVQLLELKLGHVSTYDYRAILVPLVKLYLKTLL  938

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             EDLAE+DA EKSDAA EAFLAELA DSKK    G+EN +H  EKT+DKKK KD+RKT+DL
Sbjct  939   EDLAEKDAREKSDAAGEAFLAELALDSKKIGKGGNENTRHV-EKTKDKKKNKDHRKTRDL  997

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeer  3557
             K ++G+ +H L   T  ++   V  D   +D E+ +   + +   EEE RR+IELE EE+
Sbjct  998   KATSGS-MHPLFQSTNLDSDL-VSPDSEFQDHEVVSMNDDDLEHHEEEFRRKIELEEEEK  1055

Query  3558  kleetleYQRRIENEAKLKHLAEQHKK  3638
             KLEETLE QRRIENEAK KHLAEQ KK
Sbjct  1056  KLEETLELQRRIENEAKQKHLAEQQKK  1082


 Score =   593 bits (1530),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 297/410 (72%), Positives = 336/410 (82%), Gaps = 13/410 (3%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLI-----PRSGTAQI--SE  4176
             +G K +++L VED++EERFQADL  AVRQSLDT+ A   LPL+     P+  ++Q+  S 
Sbjct  1227  NGTKVMKELQVEDEEEERFQADLKMAVRQSLDTYQARGSLPLVSSLRMPQRPSSQVDCSG  1286

Query  4177  MANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSS  4353
             +A +  S +DV     NG  + GTGL+NEVGEYNCFLNVIIQSLWHLRRFR EFL RS S
Sbjct  1287  LAPVEDSAQDV-----NGANLLGTGLRNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRS  1341

Query  4354  EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDA  4533
             EH HVG+PCVVCALYDIFTAL LAS ++RR+AVAP SLRIALSNLYP    FQE QMNDA
Sbjct  1342  EHDHVGNPCVVCALYDIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDA  1401

Query  4534  SEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYE  4713
             SEVL VIF+CLH+SFT  S  SD+ESV+S CMGSWDCA S+CI HSLFGM++FE+MNCY 
Sbjct  1402  SEVLAVIFDCLHRSFTRGSSVSDSESVESKCMGSWDCAASSCIAHSLFGMNIFEQMNCYH  1461

Query  4714  CGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHN  4893
             C LESRHLKYTSFF NINA+ALRTMK M  +SS D+LLNLVE NH+L CD +  GCGK N
Sbjct  1462  CNLESRHLKYTSFFQNINANALRTMKAMFPESSLDKLLNLVERNHRLTCDQEVGGCGKLN  1521

Query  4894  HIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSV  5073
             HIHHFLSTPPHVF TVLGWQNTCES  DI ATL ALST+IDISVLYRGL+PKS H LVSV
Sbjct  1522  HIHHFLSTPPHVFMTVLGWQNTCESANDIAATLAALSTKIDISVLYRGLNPKSTHNLVSV  1581

Query  5074  VCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             VCYYGQHYHCFAYSHDH +WIMYDDKTVK+IG W DVLT+CERGHLQPQV
Sbjct  1582  VCYYGQHYHCFAYSHDHGQWIMYDDKTVKIIGGWGDVLTVCERGHLQPQV  1631



>gb|KEH31898.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=1637

 Score =   990 bits (2560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/1107 (53%), Positives = 776/1107 (70%), Gaps = 40/1107 (4%)
 Frame = +3

Query  363   MGHKKR-PIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVES  539
             MGHKKR  + PRSK S A   V    +  AA        TS        L   +   +E 
Sbjct  1     MGHKKRNSVPPRSKLSPAASPVNQSPIGGAATATTTNGSTSPDADNSIILFDPNPNKIEF  60

Query  540   ETNAS-----SSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
               N S     S ++ IK+ECERALT+ RRGNHN+A++LMK+LC K E S     ++R+ G
Sbjct  61    ANNGSPQSEASHFSAIKVECERALTTFRRGNHNRAMKLMKELCLKEEGSFYSPFVHRIYG  120

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
              +C KVAS+I D N K RHLK+A+D AR++V +SPNS+E+AHF+A+++ EAA + K+YE+
Sbjct  121   FICFKVASVITDCNAKQRHLKHAVDLARRAVELSPNSVEYAHFHASVMLEAATEAKDYED  180

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VV ECER LAIE P DPAKE+LQ E++QKVST E RI HVQGELR LIQ+SN+AS+S+W+
Sbjct  181   VVHECERGLAIEYPTDPAKETLQDESEQKVSTMEDRILHVQGELRQLIQKSNIASLSSWM  240

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             KN  +GEE+FRLIPIRR +EDPME+RLVQ R+PNEIKK TKTPEERRKEIEVRVAAARLL
Sbjct  241   KNLSNGEERFRLIPIRRATEDPMEVRLVQTRRPNEIKKVTKTPEERRKEIEVRVAAARLL  300

Query  1242  QQKSESAQSFNDGER---SLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMS  1412
             QQKSES QS N+G+R   +LDL++G+ QR  ERR+  + RKN S+ ERR  V SYW+S+ 
Sbjct  301   QQKSESPQSPNEGDREDRALDLNSGSSQRTGERRR--HLRKNGSTAERRKWVLSYWDSVG  358

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSE  1592
              D+KK LL+I+I D+ SHF S KD L  +VLSEALS+AEANK W+FW+CC C ERF++ E
Sbjct  359   MDVKKDLLKIKISDIVSHFNSTKDTLLKDVLSEALSYAEANKTWRFWSCCICSERFSNQE  418

Query  1593  SHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVH  1772
              H QHV+  H+ +L PK+Q +LPQ+V+NEW+EM+LNCSWKPLD++AA K+L+ + K R  
Sbjct  419   FHRQHVMQVHLQTLPPKMQRILPQHVDNEWIEMILNCSWKPLDVSAAVKMLDYKAKFRGS  478

Query  1773  GFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWM  1952
                E+ Y   D D+   D +  Y           +++ G      T +S +Y K  E  +
Sbjct  479   SRPED-YLTQDYDDCFKDSNSSYHE---------QESLGYSAVNCTSESSKYYKIDESDV  528

Query  1953  DRDGNEGTKIC--PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAV  2126
              R+G E  +    P S+ WP++DD ERA+LLE+I+  F+ LI+ K L + HL KVI F++
Sbjct  529   -REGIEDQQFMANPVSDCWPVSDDEERAQLLEKIHGAFEILIRYKCLAAGHLHKVIQFSI  587

Query  2127  EELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAI-D  2303
              E+Q L  GS+LL ++IDQTP+CICFLGA +LKKIL+FLQELSH+CGLGRY ++S++  +
Sbjct  588   SEIQGLAAGSELLKHDIDQTPMCICFLGASQLKKILQFLQELSHACGLGRYADKSSSPKN  647

Query  2304  DISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQ  2483
             D+    QG +A EKIV S D SCLL DE     ++TP    + V  D    S+       
Sbjct  648   DLHDISQGAEAKEKIVLSGDASCLLLDECLLRTQVTPGITQEAVFEDLVTPSSP------  701

Query  2484  CDNGGLLDSD-ELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCE  2660
                 G+ DS   LLSW++     G+   SWSR++E+K  Q  E+VR L+KEFY+L  LC+
Sbjct  702   ---DGISDSSGALLSWLYASRPIGDHFASWSRTKEDKMCQGQEMVRALDKEFYQLHSLCQ  758

Query  2661  RKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNY  2840
             +KCE L+ EEALQ +EDLCLEEGKKRE+  +FV+RSY+  LK+RRDEL E  +E      
Sbjct  759   KKCERLSIEEALQTIEDLCLEEGKKRENVSEFVQRSYESVLKRRRDELAERENEMMYPGN  818

Query  2841  RFEIEAISSVLKDAESLNVN-QFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
             R E + I++VL++AE+ ++N Q+ +++ Y G++S LCDLESGEDD+WR+KD L+Q D C+
Sbjct  819   RVEFDCITNVLQEAETTSLNNQYCYDEAYTGVASQLCDLESGEDDEWRMKDCLHQMDGCI  878

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
             E+AIQ+ KEH S+E+SK+DA I++ VS +Q LE+KL  VS +DYR ILVPLVK YL+  L
Sbjct  879   EIAIQKLKEHSSIEISKVDAEIIKCVSEVQLLELKLGHVSTYDYRAILVPLVKLYLKTLL  938

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
             EDLAE+DA EKSDAA EAFLAELA DSKK    G+EN +H  EKT+DKKK KD+RKT+DL
Sbjct  939   EDLAEKDAREKSDAAGEAFLAELALDSKKIGKGGNENTRHV-EKTKDKKKNKDHRKTRDL  997

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeer  3557
             K ++G+ +H L   T  ++   V  D   +D E+ +   + +   EEE RR+IELE EE+
Sbjct  998   KATSGS-MHPLFQSTNLDSDL-VSPDSEFQDHEVVSMNDDDLEHHEEEFRRKIELEEEEK  1055

Query  3558  kleetleYQRRIENEAKLKHLAEQHKK  3638
             KLEETLE QRRIENEAK KHLAEQ KK
Sbjct  1056  KLEETLELQRRIENEAKQKHLAEQQKK  1082


 Score =   592 bits (1525),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 296/410 (72%), Positives = 335/410 (82%), Gaps = 13/410 (3%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLI-----PRSGTAQI--SE  4176
             +G K +++L VED++EERFQADL  AVRQSLDT+ A   LPL+     P+  ++Q+  S 
Sbjct  1227  NGTKVMKELQVEDEEEERFQADLKMAVRQSLDTYQARGSLPLVSSLRMPQRPSSQVDCSG  1286

Query  4177  MANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSS  4353
             +A +  S +DV     NG  + GTGL+NEVGEYNCFLNVIIQSLWHLRRFR EFL RS S
Sbjct  1287  LAPVEDSAQDV-----NGANLLGTGLRNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRS  1341

Query  4354  EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDA  4533
             EH HVG+PCVVCALYDIFTAL LAS ++RR+AVAP SLRIALSNLYP    FQE QMNDA
Sbjct  1342  EHDHVGNPCVVCALYDIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDA  1401

Query  4534  SEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYE  4713
             SEVL VIF+CLH+SFT  S  SD+ESV+S CMGSWDCA S+CI HSLFGM++FE+MNCY 
Sbjct  1402  SEVLAVIFDCLHRSFTRGSSVSDSESVESKCMGSWDCAASSCIAHSLFGMNIFEQMNCYH  1461

Query  4714  CGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHN  4893
             C LESRHLKYTSFF NINA+ALRTMK M  +SS D+LLNLVE NH+L CD +  GCGK N
Sbjct  1462  CNLESRHLKYTSFFQNINANALRTMKAMFPESSLDKLLNLVERNHRLTCDQEVGGCGKLN  1521

Query  4894  HIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSV  5073
             HIHHFLSTPPHVF TVLGWQNTCES  DI ATL ALST+IDISVLYRGL+PKS H LVSV
Sbjct  1522  HIHHFLSTPPHVFMTVLGWQNTCESANDIAATLAALSTKIDISVLYRGLNPKSTHNLVSV  1581

Query  5074  VCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             VCYYGQHYHCFAYSHDH +WIMYDDKTVK+IG W DVLT+CERGHLQPQ 
Sbjct  1582  VCYYGQHYHCFAYSHDHGQWIMYDDKTVKIIGGWGDVLTVCERGHLQPQA  1631



>ref|NP_001118788.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78345.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1607

 Score =   989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/1032 (55%), Positives = 742/1032 (72%), Gaps = 41/1032 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D   
Sbjct  56    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDLAT  112

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K ++L+NAI+SARK+V +SPNSIEF HFYANLLYEAAN+GK EYEEVVQEC RAL+IE P
Sbjct  113   KQKYLRNAIESARKAVELSPNSIEFGHFYANLLYEAANEGKREYEEVVQECHRALSIEYP  172

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPA+ESLQ E Q K+ TPEARIAH Q ELR+LIQ+SN+ S+STW++  G+GEEKFRLIP
Sbjct  173   IDPARESLQDETQLKILTPEARIAHFQDELRSLIQKSNIYSLSTWMQTLGNGEEKFRLIP  232

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND--  1277
             +RRM+EDP+E  L+Q+R+PNEIKK+TKT EERRKEIEVRVAA RLLQQKSES+ S N   
Sbjct  233   LRRMAEDPIESNLIQSRRPNEIKKSTKTNEERRKEIEVRVAAHRLLQQKSESSPSENVEA  292

Query  1278  -GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
                +  D +   G R  ERRK GNARKN S+ +RRD VRSYW+S+S +MKK+ LR++  D
Sbjct  293   VNNKGSDSALAAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSLSKEMKKEFLRVKFSD  352

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF   KDG A E++SEALSF EANK W+FW CC C + F +SE+H+ H++  HM ++
Sbjct  353   LKSHFSGSKDGQAYEIVSEALSFCEANKTWRFWACCRCSQNFIESEAHMHHIVQAHMGNV  412

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ V+ E ++ML    WKPLD++A  KLL  Q K +   F E  ++  +MD 
Sbjct  413   LPKMQMVLPQIVDTERIDMLFKSPWKPLDLSATLKLLRSQQKIQNSEFDE-FHSGDNMDG  471

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC--  1985
               D   D       W D +P     GD CNG              W + +  E  K+   
Sbjct  472   GDDCFKD------AWNDTTPD----GDTCNG--------------WNENESEEEVKLSIA  507

Query  1986  -PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQL  2162
              PP + WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ 
Sbjct  508   FPPPDGWPISDDPERAKLLEKIRAAFEQLIRHKYLAASHHDKVIQFTLDELQNLPSVSQF  567

Query  2163  LNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAME  2342
             LN  ++++PLCICFLGA  L KILKFLQ+LS +CGL RY E+S   D+I+ G  G +  E
Sbjct  568   LNRGLNKSPLCICFLGASHLSKILKFLQDLSQACGLSRYSEQSNPHDEINFGDLGREVTE  627

Query  2343  KIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELL  2522
             +I+   + SCLL DE     +     +      +    S+   +N    + G   +D  L
Sbjct  628   EILLDSEDSCLLMDEKLLGTECIQEKYMGSAFNNVTIASSGDIANGNDVSSG---ADGFL  684

Query  2523  SWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQV  2702
             SWIF G SS EQ+ SW R++E+K  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ 
Sbjct  685   SWIFTGPSSEEQVVSWMRTKEDKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQT  744

Query  2703  VEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDA  2882
             VEDLCLEEG+KRE + +F   SY+  L+KRR+EL ES HE    + RFE++AI++VLKDA
Sbjct  745   VEDLCLEEGRKRETSAEFTHESYETVLRKRREELNESDHELLFISSRFELDAITNVLKDA  804

Query  2883  ESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVEL  3062
             E+LN NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +E+AIQ+QKE +S EL
Sbjct  805   ETLNHNQFGYEESYGCTSSQLRDLESGEADEWGIKDSLHEADSFIEIAIQKQKEQLSAEL  864

Query  3063  SKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaa  3242
             S+IDA++MR V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAA
Sbjct  865   SRIDAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAA  924

Query  3243  reaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDT  3422
             REA L ELA DSKK +   ++N+K++ EK++DKKKIKD RK KD+K + G+  H  + D+
Sbjct  925   REALLVELALDSKKEARGRNDNSKNTLEKSKDKKKIKDTRKVKDMKATIGSD-HRSNADS  983

Query  3423  AEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENE  3602
              E +   V   G   +A++ +    ++ +EEEE +R+IELE EERKLE+TLEYQRRIE+E
Sbjct  984   VEHSPLPVAPVGDHSEADIVSEAVEALKEEEEEYKRQIELEEEERKLEKTLEYQRRIEDE  1043

Query  3603  AKLKHLAEQHKK  3638
             AK KH+AEQ KK
Sbjct  1044  AKEKHMAEQQKK  1055


 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/408 (71%), Positives = 338/408 (83%), Gaps = 4/408 (1%)
 Frame = +1

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMA  4182
             ++ G+ G KTLRQL  EDDDEERFQAD+ +AV QSLD +   + +    R+    +    
Sbjct  1197  RNNGDVGTKTLRQLQAEDDDEERFQADMQRAVLQSLDVYQGGRNMASCLRT---PLEVNN  1253

Query  4183  NLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EH  4359
             + G+S + + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH
Sbjct  1254  DGGLSDDTMESRSSTGVTIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRSSTREH  1313

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
              HVGDPCVVC+LY+IFTALS ASSE + + VAP+SLRIALSNLYPD   FQE QMNDASE
Sbjct  1314  HHVGDPCVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDASE  1373

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+SF  +S  SD +S DS+C GSWDCAN  CI HSLFGMD+FE++NCY CG
Sbjct  1374  VLAVIFDCLHRSFAQSSSVSDVDSSDSNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCG  1433

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             LESRHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+  GCGK NHI
Sbjct  1434  LESRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPETGGCGKLNHI  1493

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVVC
Sbjct  1494  HHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVVC  1553

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YYGQHYHCFA+S +H++WIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  1554  YYGQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVLSMCERGHLQPQV  1601



>ref|XP_009149862.1| PREDICTED: uncharacterized protein LOC103873189 [Brassica rapa]
Length=1579

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/1097 (53%), Positives = 761/1097 (69%), Gaps = 63/1097 (6%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+P APRSK S++                     +SA   +  S +    A   SE
Sbjct  1     MGQKKKPPAPRSKQSLS---------------------SSAAEAEPSSEV---SACTSSE  36

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S+ A IK ECE+ALTS RRG++NKA+RLMK+ C++H++S   ALI+RVQGTVCVKV
Sbjct  37    --EPSNLAEIKAECEKALTSFRRGSYNKAIRLMKESCSRHQHS---ALIHRVQGTVCVKV  91

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             +S+ +D   K +++++AI+SARK+V +SPNSIEF+HFYANLLYE+A+DG+EYEEVVQEC 
Sbjct  92    SSVYEDAVTKQKYIRSAIESARKAVELSPNSIEFSHFYANLLYESASDGREYEEVVQECH  151

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAK+SLQ E+Q K+STPEARIA+VQ ELR+LIQ+SNL S+STW+K+ G+G
Sbjct  152   RALAIENPIDPAKDSLQDESQHKISTPEARIANVQDELRSLIQKSNLGSLSTWMKHLGNG  211

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             E +FRL  +R+M+EDP+E  LVQ R+PNEIKKATKT EE+RKEIEVRVAA RLLQQKSES
Sbjct  212   EGEFRLFDMRKMAEDPIESNLVQTRRPNEIKKATKTLEEKRKEIEVRVAAGRLLQQKSES  271

Query  1260  AQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +   +   +  D + G+GQR  ERRK GNARKN S++ERRD VRSYW S S +MKK+LLR
Sbjct  272   SSVDSVNSKGSDPALGSGQRSGERRKHGNARKNGSTVERRDRVRSYWESTSKEMKKELLR  331

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLKSHF + KDG AN++++EALSF EANK W+FW CC C E+F DSES++QH++ E
Sbjct  332   IKVSDLKSHFSASKDGDANDIIAEALSFCEANKTWRFWVCCKCSEKFKDSESYMQHIVGE  391

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             HM ++ PK+Q VLPQ++++E +EMLL   WKPLD  A  KLL  Q K +   F E  Y  
Sbjct  392   HMGNVFPKMQMVLPQSLDSERIEMLLTSPWKPLDFPAVVKLLCSQQKIQNSEFSE-FYAG  450

Query  1800  SDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGT  1976
               MD+  D   D       W D SP K+  GD CNG       Y+KN         +E  
Sbjct  451   GYMDDGDDCFQD------AWNDTSPEKENIGDACNG-------YEKNE--------SEKD  489

Query  1977  KICPP---SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLG  2147
             ++  P   ++ WPI+DDPER KLL+ I   F+ LIK+ YL +SH  KVI F ++EL++L 
Sbjct  490   RLPNPFYLTDEWPISDDPERTKLLKSIRAAFELLIKHSYLATSHYDKVIQFTLDELRNLP  549

Query  2148  YGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQG  2327
               SQ LN  + Q+P+CI FLGA +LKKIL+FLQ+LSH+CG+ RY E+S   D++  G+Q 
Sbjct  550   SVSQFLNRGLGQSPICIRFLGATQLKKILQFLQDLSHACGVSRYSEQSNPNDEVDLGLQ-  608

Query  2328  VDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLD  2507
                 E+I    +GSCLL DE     +          + + +  S+   +N    + G   
Sbjct  609   --ITEEIFLDGEGSCLLLDEKLLGSECIQEKHMGSALNNGDIASSEDIANGNNVSAG---  663

Query  2508  SDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYE  2687
             +D  LSWIF G SSGEQ   W R+ EEK  Q  + + +LEKE  +L+ L ERKCEHL YE
Sbjct  664   ADGFLSWIFSGPSSGEQTAIWMRTVEEKTNQGQKTMEILEKEVRDLKNLFERKCEHLGYE  723

Query  2688  EALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISS  2867
              ALQ VEDLCLEEG+KRE + DF   SY+  L+KRR+EL ES HE    +  FE+EAI +
Sbjct  724   GALQTVEDLCLEEGRKRETSPDFTHESYESVLRKRREELNESAHEMDCLSSSFELEAIKN  783

Query  2868  VLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEH  3047
             VL+DA+++N NQFG+E+TY   SS L DLESGE D+W +KD  ++ADS +E AIQ+QKE 
Sbjct  784   VLRDADTVNRNQFGYEETYTCTSSQLRDLESGEADEWGMKDSFSEADSFIETAIQKQKEQ  843

Query  3048  VSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATE  3227
             +S EL++IDAR+MR V+ +QQLE+KL   S++DY+ +L+PLV+SY+RAHLE LAE+DATE
Sbjct  844   LSTELNRIDARMMRGVTVVQQLELKLGPASSNDYQIVLLPLVRSYMRAHLEALAEKDATE  903

Query  3228  KSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHA  3407
             KSDAA +AFL ELA DSKK +   ++ +KH+ EK++DKKK K  +K KD K S GN  H 
Sbjct  904   KSDAASKAFLVELALDSKKEARGRNDQSKHTQEKSKDKKKNKHSKKLKDSKASVGND-HR  962

Query  3408  LHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQR  3587
              + D+ E +  SV   G   +A++      S+ ++EEE RRR ELE +E KLEETLEYQR
Sbjct  963   FNVDSVEHSLPSVASFGDPSEADVVPEAVESLKEQEEECRRRTELELDEIKLEETLEYQR  1022

Query  3588  RIENEAKLKHLAEQHKK  3638
             RIENEAK KH+AEQ KK
Sbjct  1023  RIENEAKEKHIAEQQKK  1039


 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 367/482 (76%), Gaps = 19/482 (4%)
 Frame = +1

Query  3784  PKNSTVSDIHKAGF-SNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENI  3960
             P  +TV D+      +NG   +DG L SD+R GRR RRQK S   N+   P  ++G E  
Sbjct  1108  PDAATVQDVKSQKVVANGVATQDGVLQSDQRIGRRGRRQKTS---NKVVGPSESTGKER-  1163

Query  3961  EVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLP  4140
                      +S   +  G+ G KTLRQL  E+D+EE+FQADL KAVRQSLDT+   + + 
Sbjct  1164  ---------ESETLRSNGDVGTKTLRQLQAEEDEEEKFQADLKKAVRQSLDTYQGGRNMT  1214

Query  4141  LIPRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLR  4320
                R+      E+ +  +S     +     + ++GTGL+NEVGEYNCFLNVIIQSLW+L 
Sbjct  1215  SCLRTSV----EVNSHEISDSTKESPTSTEVGIFGTGLQNEVGEYNCFLNVIIQSLWNLG  1270

Query  4321  RFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPD  4497
              FR EFLRSS+ +H HVGDPCVVC+LY++ TALS AS E R++ V P++LRIALSNLYPD
Sbjct  1271  VFRAEFLRSSTLDHHHVGDPCVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPD  1330

Query  4498  RLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLF  4677
                FQE QMNDASEVL VIF+CLH+SF  ++  SDT+S +S+  GSWDCAN  CI HSLF
Sbjct  1331  SSFFQEAQMNDASEVLAVIFDCLHRSFAQSASVSDTDSSESNYTGSWDCANRTCIAHSLF  1390

Query  4678  GMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLA  4857
             GM++FE++NCY CGLESRH+KYTSFFHNINASALR MKV C +++FDELLNLVEMNHQLA
Sbjct  1391  GMNIFEQLNCYSCGLESRHMKYTSFFHNINASALRNMKVTCPETAFDELLNLVEMNHQLA  1450

Query  4858  CDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRG  5037
             CDP+  GCGK NHI HFL+TPPHVFT VLGWQNTCESVEDI ATL AL+TEIDIS++YRG
Sbjct  1451  CDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAATLAALNTEIDISIMYRG  1510

Query  5038  LDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQP  5217
             LDPKS + L SVVCYYGQHYHCFAYSH+H+RWIMYDDKTVKVIG+W+D+L+MC++GHLQP
Sbjct  1511  LDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSWSDILSMCKKGHLQP  1570

Query  5218  QV  5223
             Q+
Sbjct  1571  QL  1572



>gb|KFK34092.1| hypothetical protein AALP_AA5G101000 [Arabis alpina]
Length=1610

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1108 (52%), Positives = 763/1108 (69%), Gaps = 68/1108 (6%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+P A RSK S                     S T+AV V E             E
Sbjct  1     MGQKKKPPASRSKQS--------------------PSSTTAVTVVEVEPSSEISDCSVPE  40

Query  543   TNASSSYANI--------KLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRV  698
                S   AN+        + ECE+AL S +RG++NKA+RLMK+ C++H++S   ALI+RV
Sbjct  41    VGFSGPEANVEPLDSAVVRQECEKALASFQRGSYNKAIRLMKESCSRHQDS---ALIFRV  97

Query  699   QGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK--  872
             QGT+ VKVAS+ ++   K R+L NAI+SARK+V +SPNSIEF HFYANLLY+AA+DG+  
Sbjct  98    QGTLYVKVASVFENLVTKQRYLLNAIESARKAVELSPNSIEFGHFYANLLYDAASDGRDG  157

Query  873   -EYEEVVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLAS  1046
              EY+EVVQEC R+L+IENPIDPA++SLQ E QQK+ TPEARI HVQ ELR+LIQ+SN +S
Sbjct  158   IEYDEVVQECHRSLSIENPIDPARDSLQDETQQKILTPEARIVHVQDELRSLIQKSNFSS  217

Query  1047  ISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVA  1226
             +S+W+KN G+GEEK+R+IPIRR  EDP+E  L+Q R+PNEI+KA KT EE RKEIEV+VA
Sbjct  218   LSSWMKNLGTGEEKYRIIPIRRPVEDPIESNLIQTRRPNEIQKANKTREELRKEIEVKVA  277

Query  1227  AARLLQQKSESAQSFNDG---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSY  1397
             AARLLQQKSES  S N G    +  D + GTGQRG  +++ GNAR N S+ ERRD VRSY
Sbjct  278   AARLLQQKSESPPSDNAGTVNNKGSDTTLGTGQRGGGKKRHGNARNNSSTAERRDRVRSY  337

Query  1398  WNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             W+SMS +MKK LLR++  DLKSHF + KD  ANE++SEA+SF +ANK W+FW CC C E+
Sbjct  338   WDSMSKEMKKGLLRVKFSDLKSHFSASKDDNANEIISEAMSFHKANKTWRFWACCRCSEK  397

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F D+E+H+QH++ EHM ++ P++Q VLP+++ +E +EMLL   WKPLD++A  KLL  Q 
Sbjct  398   FLDTEAHMQHIVQEHMGNVLPRMQMVLPESLNSERIEMLLCTPWKPLDLSATMKLLRSQQ  457

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDK  1934
             K +   F  N +   D+ E  DD     C    W D SP K+  GD CNG   +  E   
Sbjct  458   KIQNTEF--NGFHSGDIMEEDDD-----CFKDAWNDTSPEKENLGDTCNGVNENEPE---  507

Query  1935  NSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVI  2114
                     +G        P E WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI
Sbjct  508   --------EGKMPITFHLPDE-WPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVI  558

Query  2115  HFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST  2294
              F ++ELQ+L   SQ LN  + Q+P+CICFLGA +L+KILKFLQ+LS +CGL RY E+S 
Sbjct  559   QFTLDELQNLASVSQFLNRGLGQSPICICFLGATQLRKILKFLQDLSQACGLSRYSEQSN  618

Query  2295  AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaiss  2474
               D+I+ G  G++  E+I+F  + SCLL DE     +     +    + +    S+   +
Sbjct  619   PNDEINFGDLGLEVTEEILFDGEDSCLLLDEKLLGTECIQEKYMGSALKNVTIASSGDIA  678

Query  2475  niQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGL  2654
             N    + G   +D  LSWIF G SS EQ  SW R+ EEK  Q +EI+++LEKEF  LQ L
Sbjct  679   NGNNVSSG---ADGFLSWIFTGPSSEEQTVSWMRTMEEKTNQGVEIMQILEKEFCVLQNL  735

Query  2655  CERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATST  2834
             CERKCEHL+YE ALQ VEDLCLEEG+KRE + DF   SY+  L+KRR+EL ES HE    
Sbjct  736   CERKCEHLSYEGALQTVEDLCLEEGRKRETSADFTHESYESVLRKRREELNESDHEFMFI  795

Query  2835  NYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSC  3014
             + RFE++AI++VLKDA+SLN NQFG+E++Y   +S L DLE GE D+W +KD  N+ADS 
Sbjct  796   SSRFELDAITNVLKDADSLNHNQFGYEESY-AYTSQLRDLECGEVDEWGIKDSFNEADSF  854

Query  3015  VEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAH  3194
             +E+AIQ+QKEH+S ELS+IDAR+MR V+GMQQLE+KL  VS +DY+ +L+PLVKSY+R+H
Sbjct  855   IEIAIQKQKEHLSSELSRIDARMMRNVTGMQQLELKLGLVSTNDYKIVLLPLVKSYMRSH  914

Query  3195  LEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkd  3374
             LE LA++DATEKSDAAR+A L ELA DSKK +   ++N+KH+ EK++DK+KIKD +K KD
Sbjct  915   LEALAQKDATEKSDAARDALLVELALDSKKEARGRNDNSKHTQEKSKDKRKIKDTKKLKD  974

Query  3375  lkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaee  3554
                 NG   H  + ++ E++   V   G   + ++    S ++ ++EEE RRR+ELE EE
Sbjct  975   ATIGNG---HHFNVESMEQSHLPVASIGDPSEVDIV---SEALKEQEEESRRRVELEEEE  1028

Query  3555  rkleetleYQRRIENEAKLKHLAEQHKK  3638
             +KLE+TLEYQR+IENEAK KH AEQ KK
Sbjct  1029  KKLEKTLEYQRKIENEAKEKHNAEQQKK  1056


 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/406 (73%), Positives = 340/406 (84%), Gaps = 6/406 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++  KTLRQL  E+D+EERFQADL KAVRQSLD +   + +P  PR+      E+ N G
Sbjct  1202  GDAETKTLRQLQAEEDEEERFQADLKKAVRQSLDVYQGSRNMPTYPRTPL----EVNNDG  1257

Query  4192  VSCEDVATGIVN-GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             V  +     + + G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH H
Sbjct  1258  VLSDVTEESLSSTGVVIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRRSTLEHHH  1317

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVC+LYDIFT+LS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  1318  VGDPCVVCSLYDIFTSLSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  1377

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF  +S  SD ES +S+C GSWDCAN  CI HSLFGMD+FE++NCY CGLE
Sbjct  1378  AVIFDCLHRSFAQSSSVSDAESSESNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLE  1437

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINASALRTMKV C + SFDELLNLVEMNHQLACDP+A GCGK NHIHH
Sbjct  1438  SRHLKYTSFFHNINASALRTMKVTCVEDSFDELLNLVEMNHQLACDPEAGGCGKLNHIHH  1497

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + L SVVCYY
Sbjct  1498  ILTTPPHVFTIVLGWQNTCETVEDIAATLSALNTEIDISIIYRGLDPKSIYSLASVVCYY  1557

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFAYSH+H+RWIMYDDKTVKVIG+W+DVL+MCERGHLQPQV
Sbjct  1558  GQHYHCFAYSHEHDRWIMYDDKTVKVIGSWSDVLSMCERGHLQPQV  1603



>gb|KFK34091.1| hypothetical protein AALP_AA5G101000 [Arabis alpina]
Length=1607

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1108 (52%), Positives = 763/1108 (69%), Gaps = 68/1108 (6%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+P A RSK S                     S T+AV V E             E
Sbjct  1     MGQKKKPPASRSKQS--------------------PSSTTAVTVVEVEPSSEISDCSVPE  40

Query  543   TNASSSYANI--------KLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRV  698
                S   AN+        + ECE+AL S +RG++NKA+RLMK+ C++H++S   ALI+RV
Sbjct  41    VGFSGPEANVEPLDSAVVRQECEKALASFQRGSYNKAIRLMKESCSRHQDS---ALIFRV  97

Query  699   QGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK--  872
             QGT+ VKVAS+ ++   K R+L NAI+SARK+V +SPNSIEF HFYANLLY+AA+DG+  
Sbjct  98    QGTLYVKVASVFENLVTKQRYLLNAIESARKAVELSPNSIEFGHFYANLLYDAASDGRDG  157

Query  873   -EYEEVVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLAS  1046
              EY+EVVQEC R+L+IENPIDPA++SLQ E QQK+ TPEARI HVQ ELR+LIQ+SN +S
Sbjct  158   IEYDEVVQECHRSLSIENPIDPARDSLQDETQQKILTPEARIVHVQDELRSLIQKSNFSS  217

Query  1047  ISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVA  1226
             +S+W+KN G+GEEK+R+IPIRR  EDP+E  L+Q R+PNEI+KA KT EE RKEIEV+VA
Sbjct  218   LSSWMKNLGTGEEKYRIIPIRRPVEDPIESNLIQTRRPNEIQKANKTREELRKEIEVKVA  277

Query  1227  AARLLQQKSESAQSFNDG---ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSY  1397
             AARLLQQKSES  S N G    +  D + GTGQRG  +++ GNAR N S+ ERRD VRSY
Sbjct  278   AARLLQQKSESPPSDNAGTVNNKGSDTTLGTGQRGGGKKRHGNARNNSSTAERRDRVRSY  337

Query  1398  WNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             W+SMS +MKK LLR++  DLKSHF + KD  ANE++SEA+SF +ANK W+FW CC C E+
Sbjct  338   WDSMSKEMKKGLLRVKFSDLKSHFSASKDDNANEIISEAMSFHKANKTWRFWACCRCSEK  397

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F D+E+H+QH++ EHM ++ P++Q VLP+++ +E +EMLL   WKPLD++A  KLL  Q 
Sbjct  398   FLDTEAHMQHIVQEHMGNVLPRMQMVLPESLNSERIEMLLCTPWKPLDLSATMKLLRSQQ  457

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDK  1934
             K +   F  N +   D+ E  DD     C    W D SP K+  GD CNG   +  E   
Sbjct  458   KIQNTEF--NGFHSGDIMEEDDD-----CFKDAWNDTSPEKENLGDTCNGVNENEPE---  507

Query  1935  NSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVI  2114
                     +G        P E WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI
Sbjct  508   --------EGKMPITFHLPDE-WPISDDPERAKLLEKIRAAFELLIRHKYLAASHHDKVI  558

Query  2115  HFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST  2294
              F ++ELQ+L   SQ LN  + Q+P+CICFLGA +L+KILKFLQ+LS +CGL RY E+S 
Sbjct  559   QFTLDELQNLASVSQFLNRGLGQSPICICFLGATQLRKILKFLQDLSQACGLSRYSEQSN  618

Query  2295  AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaiss  2474
               D+I+ G  G++  E+I+F  + SCLL DE     +     +    + +    S+   +
Sbjct  619   PNDEINFGDLGLEVTEEILFDGEDSCLLLDEKLLGTECIQEKYMGSALKNVTIASSGDIA  678

Query  2475  niQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGL  2654
             N    + G   +D  LSWIF G SS EQ  SW R+ EEK  Q +EI+++LEKEF  LQ L
Sbjct  679   NGNNVSSG---ADGFLSWIFTGPSSEEQTVSWMRTMEEKTNQGVEIMQILEKEFCVLQNL  735

Query  2655  CERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATST  2834
             CERKCEHL+YE ALQ VEDLCLEEG+KRE + DF   SY+  L+KRR+EL ES HE    
Sbjct  736   CERKCEHLSYEGALQTVEDLCLEEGRKRETSADFTHESYESVLRKRREELNESDHEFMFI  795

Query  2835  NYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSC  3014
             + RFE++AI++VLKDA+SLN NQFG+E++Y   +S L DLE GE D+W +KD  N+ADS 
Sbjct  796   SSRFELDAITNVLKDADSLNHNQFGYEESY-AYTSQLRDLECGEVDEWGIKDSFNEADSF  854

Query  3015  VEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAH  3194
             +E+AIQ+QKEH+S ELS+IDAR+MR V+GMQQLE+KL  VS +DY+ +L+PLVKSY+R+H
Sbjct  855   IEIAIQKQKEHLSSELSRIDARMMRNVTGMQQLELKLGLVSTNDYKIVLLPLVKSYMRSH  914

Query  3195  LEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkd  3374
             LE LA++DATEKSDAAR+A L ELA DSKK +   ++N+KH+ EK++DK+KIKD +K KD
Sbjct  915   LEALAQKDATEKSDAARDALLVELALDSKKEARGRNDNSKHTQEKSKDKRKIKDTKKLKD  974

Query  3375  lkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaee  3554
                 NG   H  + ++ E++   V   G   + ++    S ++ ++EEE RRR+ELE EE
Sbjct  975   ATIGNG---HHFNVESMEQSHLPVASIGDPSEVDIV---SEALKEQEEESRRRVELEEEE  1028

Query  3555  rkleetleYQRRIENEAKLKHLAEQHKK  3638
             +KLE+TLEYQR+IENEAK KH AEQ KK
Sbjct  1029  KKLEKTLEYQRKIENEAKEKHNAEQQKK  1056


 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/406 (73%), Positives = 340/406 (84%), Gaps = 6/406 (1%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++  KTLRQL  E+D+EERFQADL KAVRQSLD +   + +P  PR+      E+ N G
Sbjct  1199  GDAETKTLRQLQAEEDEEERFQADLKKAVRQSLDVYQGSRNMPTYPRTPL----EVNNDG  1254

Query  4192  VSCEDVATGIVN-GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             V  +     + + G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH H
Sbjct  1255  VLSDVTEESLSSTGVVIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRRSTLEHHH  1314

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVC+LYDIFT+LS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  1315  VGDPCVVCSLYDIFTSLSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  1374

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF  +S  SD ES +S+C GSWDCAN  CI HSLFGMD+FE++NCY CGLE
Sbjct  1375  AVIFDCLHRSFAQSSSVSDAESSESNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLE  1434

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINASALRTMKV C + SFDELLNLVEMNHQLACDP+A GCGK NHIHH
Sbjct  1435  SRHLKYTSFFHNINASALRTMKVTCVEDSFDELLNLVEMNHQLACDPEAGGCGKLNHIHH  1494

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + L SVVCYY
Sbjct  1495  ILTTPPHVFTIVLGWQNTCETVEDIAATLSALNTEIDISIIYRGLDPKSIYSLASVVCYY  1554

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFAYSH+H+RWIMYDDKTVKVIG+W+DVL+MCERGHLQPQV
Sbjct  1555  GQHYHCFAYSHEHDRWIMYDDKTVKVIGSWSDVLSMCERGHLQPQV  1600



>ref|NP_190374.4| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78344.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1606

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/1032 (55%), Positives = 742/1032 (72%), Gaps = 41/1032 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             +KLECE+AL S  RG++NKA+RL+KD C++H++S   ALI+RVQGT+CVKVA++ +D   
Sbjct  56    VKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDS---ALIHRVQGTICVKVAAVYEDLAT  112

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K ++L+NAI+SARK+V +SPNSIEF HFYANLLYEAAN+GK EYEEVVQEC RAL+IE P
Sbjct  113   KQKYLRNAIESARKAVELSPNSIEFGHFYANLLYEAANEGKREYEEVVQECHRALSIEYP  172

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPA+ESLQ E Q K+ TPEARIAH Q ELR+LIQ+SN+ S+STW++  G+GEEKFRLIP
Sbjct  173   IDPARESLQDETQLKILTPEARIAHFQDELRSLIQKSNIYSLSTWMQTLGNGEEKFRLIP  232

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND--  1277
             +RRM+EDP+E  L+Q+R+PNEIKK+TKT EERRKEIEVRVAA RLLQQKSES+ S N   
Sbjct  233   LRRMAEDPIESNLIQSRRPNEIKKSTKTNEERRKEIEVRVAAHRLLQQKSESSPSENVEA  292

Query  1278  -GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVD  1454
                +  D +   G R  ERRK GNARKN S+ +RRD VRSYW+S+S +MKK+ LR++  D
Sbjct  293   VNNKGSDSALAAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSLSKEMKKEFLRVKFSD  352

Query  1455  LKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSL  1634
             LKSHF   KDG A E++SEALSF EANK W+FW CC C + F +SE+H+ H++  HM ++
Sbjct  353   LKSHFSGSKDGQAYEIVSEALSFCEANKTWRFWACCRCSQNFIESEAHMHHIVQAHMGNV  412

Query  1635  SPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDE  1814
              PK+Q VLPQ V+ E ++ML    WKPLD++A  KLL  Q K +   F E  ++  +MD 
Sbjct  413   LPKMQMVLPQIVDTERIDMLFKSPWKPLDLSATLKLLRSQQKIQNSEFDE-FHSGDNMDG  471

Query  1815  SKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC--  1985
               D   D       W D +P     GD CNG              W + +  E  K+   
Sbjct  472   GDDCFKD------AWNDTTPD----GDTCNG--------------WNENESEEEVKLSIA  507

Query  1986  -PPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQL  2162
              PP + WPI+DDPERAKLLE+I   F+ LI++KYL +SH  KVI F ++ELQ+L   SQ 
Sbjct  508   FPPPDGWPISDDPERAKLLEKIRAAFEQLIRHKYLAASHHDKVIQFTLDELQNLPSVSQF  567

Query  2163  LNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAME  2342
             LN  ++++PLCICFLGA  L KILKFLQ+LS +CGL RY E+S   D+I+ G  G +  E
Sbjct  568   LNRGLNKSPLCICFLGASHLSKILKFLQDLSQACGLSRYSEQSNPHDEINFGDLGREVTE  627

Query  2343  KIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELL  2522
             +I+   + SCLL DE     +     +      +    S+   +N    + G   +D  L
Sbjct  628   EILLDSEDSCLLMDEKLLGTECIQEKYMGSAFNNVTIASSGDIANGNDVSSG---ADGFL  684

Query  2523  SWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQV  2702
             SWIF G SS EQ+ SW R++E+K  Q +EI++ LEKEFY LQ LCERKCEHL+YE ALQ 
Sbjct  685   SWIFTGPSSEEQVVSWMRTKEDKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQT  744

Query  2703  VEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDA  2882
             VEDLCLEEG+KRE + +F   SY+  L+KRR+EL ES HE    + RFE++AI++VLKDA
Sbjct  745   VEDLCLEEGRKRETSAEFTHESYETVLRKRREELNESDHELLFISSRFELDAITNVLKDA  804

Query  2883  ESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVEL  3062
             E+LN NQFG+E++YG  SS L DLESGE D+W +KD L++ADS +E+AIQ+QKE +S EL
Sbjct  805   ETLNHNQFGYEESYGCTSSQLRDLESGEADEWGIKDSLHEADSFIEIAIQKQKEQLSAEL  864

Query  3063  SKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaa  3242
             S+IDA++MR V+GMQQLE+KL  VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAA
Sbjct  865   SRIDAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAA  924

Query  3243  reaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDT  3422
             REA L ELA DSKK +   ++N+K++ EK++DKKKIKD RK KD+K + G+  H  + D+
Sbjct  925   REALLVELALDSKKEARGRNDNSKNTLEKSKDKKKIKDTRKVKDMKATIGSD-HRSNADS  983

Query  3423  AEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENE  3602
              E +   V   G   +A++ +    ++ +EEEE +R+IELE EERKLE+TLEYQRRIE+E
Sbjct  984   VEHSPLPVAPVGDHSEADIVSEAVEALKEEEEEYKRQIELEEEERKLEKTLEYQRRIEDE  1043

Query  3603  AKLKHLAEQHKK  3638
             AK KH+AEQ KK
Sbjct  1044  AKEKHMAEQQKK  1055


 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/408 (71%), Positives = 338/408 (83%), Gaps = 4/408 (1%)
 Frame = +1

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMA  4182
             ++ G+ G KTLRQL  EDDDEERFQAD+ +AV QSLD +   + +    R+    +    
Sbjct  1196  RNNGDVGTKTLRQLQAEDDDEERFQADMQRAVLQSLDVYQGGRNMASCLRT---PLEVNN  1252

Query  4183  NLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EH  4359
             + G+S + + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH
Sbjct  1253  DGGLSDDTMESRSSTGVTIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRSSTREH  1312

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
              HVGDPCVVC+LY+IFTALS ASSE + + VAP+SLRIALSNLYPD   FQE QMNDASE
Sbjct  1313  HHVGDPCVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDASE  1372

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+SF  +S  SD +S DS+C GSWDCAN  CI HSLFGMD+FE++NCY CG
Sbjct  1373  VLAVIFDCLHRSFAQSSSVSDVDSSDSNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCG  1432

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             LESRHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+  GCGK NHI
Sbjct  1433  LESRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPETGGCGKLNHI  1492

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVVC
Sbjct  1493  HHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVVC  1552

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YYGQHYHCFA+S +H++WIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  1553  YYGQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVLSMCERGHLQPQV  1600



>ref|XP_010503407.1| PREDICTED: uncharacterized protein LOC104780601 isoform X1 [Camelina 
sativa]
 ref|XP_010503408.1| PREDICTED: uncharacterized protein LOC104780601 isoform X2 [Camelina 
sativa]
Length=1565

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1033 (55%), Positives = 742/1033 (72%), Gaps = 45/1033 (4%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IKLECE+AL S  RG++NKA+RL+KD C++H   P+ AL +RVQGT+ VKVAS+ +D   
Sbjct  16    IKLECEKALKSFGRGSYNKAIRLIKDSCSRH---PDSALAHRVQGTIYVKVASVYEDLAT  72

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGK-EYEEVVQECERALAIENP  926
             K++HL+NAI+SARK+V +SP+SIEF HFYANLLY+AANDGK EY+EVVQEC+RAL+IENP
Sbjct  73    KHKHLRNAIESARKAVELSPDSIEFGHFYANLLYDAANDGKREYDEVVQECQRALSIENP  132

Query  927   IDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIP  1103
             IDPAKESLQ E Q K+ TPEARIAHVQ ELR+LIQ+SN+ S+STW+ N G GE+KFRLIP
Sbjct  133   IDPAKESLQDETQLKILTPEARIAHVQDELRSLIQKSNIGSLSTWMSNLGKGEDKFRLIP  192

Query  1104  IRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGE  1283
             IRRM+EDP+E  LVQ R+PNEIKKATK+ EE RKE+EVRVAAARL+QQ SES+ S N  +
Sbjct  193   IRRMAEDPIESNLVQTRRPNEIKKATKSREELRKEVEVRVAAARLIQQNSESSPSENVDK  252

Query  1284  RSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKS  1463
             +  D +   GQR  ERRK GNARKN S+ +RRD VRSYW+SMS +MKK+LLR+++ DLKS
Sbjct  253   KGSDQT--LGQRSGERRKHGNARKNGSTADRRDRVRSYWDSMSEEMKKELLRVKVSDLKS  310

Query  1464  HFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPK  1643
             HF + KDG ANE++SEALSF EANK W F  CC C E+F DSE+H+QH++  HM ++ PK
Sbjct  311   HFSASKDGQANEIISEALSFCEANKTWSFLVCCRCSEKFMDSEAHMQHIVQVHMGNVVPK  370

Query  1644  LQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKD  1823
             +Q VLPQ +  + +++LL+  WKPLD++AA +LL  Q + +   F  N +   D  E  D
Sbjct  371   MQMVLPQILATDRIDILLSFPWKPLDLSAAVELLRSQQRIQKSEF--NDFHPGDNMEDGD  428

Query  1824  DISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSES  2000
             D     C    W D SP K++ GD CNG   +  E  K S  +            PP + 
Sbjct  429   D-----CFEDAWNDTSPEKESLGDACNGCNENESEECKLSIAF------------PPPDG  471

Query  2001  WPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNID  2180
             WPI+DDPERAKLL +I   F+ LI++KYL +SH  KVI F V+ELQ++   SQ +N +++
Sbjct  472   WPISDDPERAKLLMKIRAAFELLIRHKYLAASHHDKVIQFTVDELQNIPSASQFVNRSLN  531

Query  2181  QTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSE  2360
             Q+P+CICFL A +L KIL+FL +LS +CGL RY E+S   D I+ G  G +  EKI+F  
Sbjct  532   QSPICICFLEASQLGKILRFLHDLSQACGLSRYSEQSNPNDKINFGDLGREVTEKILFDA  591

Query  2361  DGSCLLFDEHF--KPC---KLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDS--DEL  2519
             +GSCLL DE      C   K      H+ VV  S   +          NG  + S  D  
Sbjct  592   EGSCLLLDEKLLGTECIQEKFMGSALHNVVVASSRDIA----------NGDNVSSGADGF  641

Query  2520  LSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQ  2699
             LSWIF G SSGEQ+ SW  + EEK  + +EI+ +LEKE   LQ LCERKCEH++YE ALQ
Sbjct  642   LSWIFTGPSSGEQIVSWMHTMEEKTNKGLEIMEILEKELSRLQNLCERKCEHVSYEGALQ  701

Query  2700  VVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKD  2879
              V D+CLEE +KRE + DF   SY+  L+KRR+EL +S H     + RFE++AI++VLKD
Sbjct  702   TVVDICLEESRKRETSADFTHESYETVLRKRREELNKSDHGLVFMSSRFELDAITNVLKD  761

Query  2880  AESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVE  3059
             AESLN NQFG+E++YG +SS L DLESGE  +W +KD L++ADS +E+AIQ+QKE +S E
Sbjct  762   AESLNYNQFGYEESYGSMSSQLRDLESGEAYEWGMKDSLHEADSFIEIAIQKQKEQLSAE  821

Query  3060  LSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSda  3239
             LSKIDA++MR+V+ MQQ E++L  VS++DY+ +L+PL+KSY+RAHLE LAE+DATEKSDA
Sbjct  822   LSKIDAQMMRIVTEMQQSELRLGPVSSNDYQIVLLPLMKSYMRAHLEALAEKDATEKSDA  881

Query  3240  areaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHD  3419
             AREA L ELA DS K +   ++N+KH  EK++DKKKIKD RK KDLK + GN     + D
Sbjct  882   AREALLVELALDSTKETRGRNDNSKHMLEKSKDKKKIKDTRKLKDLKATTGND-QRFNDD  940

Query  3420  TAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIEN  3599
             + + +  SV   G   +A++ +    ++ +EEEE RRRIELE EERKLE+TLEYQRRIEN
Sbjct  941   SIKHSHPSVASFGDHSEADVFSEAVEALNEEEEEYRRRIELEEEERKLEKTLEYQRRIEN  1000

Query  3600  EAKLKHLAEQHKK  3638
             EAK KH+AEQ KK
Sbjct  1001  EAKEKHIAEQKKK  1013


 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/469 (67%), Positives = 366/469 (78%), Gaps = 8/469 (2%)
 Frame = +1

Query  3829  NGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENIEVGE--VRPVDDSLEK  4002
             NG  +  G L SD+R G+R RRQK S K  + K     SG+EN +           S   
Sbjct  1094  NGVAIPAGVLQSDQRTGQRGRRQKASNKLVDGKYQVTPSGSENCKSQRSGTESEGQSETL  1153

Query  4003  KHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMA  4182
             +  G++G KTLRQL  EDD+EERFQADL +AVRQSLD +   +      R+      E+ 
Sbjct  1154  RSNGDAGTKTLRQLQAEDDEEERFQADLKRAVRQSLDVYQGGRNTTSYLRTPM----EVN  1209

Query  4183  NLGVSCE-DVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-E  4356
             N GV  +  + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFL+SS+ E
Sbjct  1210  NDGVLSDVTMKSPSSTGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLQSSTLE  1269

Query  4357  HIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDAS  4536
             H HVGDPCVVC+LY+IFTALS ASS+TR++ VAP+SLRIALSNLYPD   FQE QMNDAS
Sbjct  1270  HHHVGDPCVVCSLYEIFTALSAASSQTRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDAS  1329

Query  4537  EVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYEC  4716
             EVL VIF+CLH+SF   S  SDTES +S+  GSWDC N  CI HSLFGMD+FE++NCY C
Sbjct  1330  EVLAVIFDCLHRSFAQTSSVSDTESAESNSTGSWDCVNRTCIAHSLFGMDIFEQLNCYSC  1389

Query  4717  GLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNH  4896
             GLESRH+KYTSFFHNINASALRTMKV C + SF+ELLNLVEMNHQLACDP+A GCGK NH
Sbjct  1390  GLESRHMKYTSFFHNINASALRTMKVTCAEKSFEELLNLVEMNHQLACDPEAGGCGKPNH  1449

Query  4897  IHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVV  5076
             IHH L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVV
Sbjct  1450  IHHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVV  1509

Query  5077  CYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             CYYGQHYHCF YSH+H+RWIMYDD+TVKVIG+W+DVL+MCERGHLQPQV
Sbjct  1510  CYYGQHYHCFTYSHEHDRWIMYDDQTVKVIGSWSDVLSMCERGHLQPQV  1558



>ref|XP_010678607.1| PREDICTED: uncharacterized protein LOC104894129 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=1307

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/1053 (53%), Positives = 733/1053 (70%), Gaps = 50/1053 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IK ECE+AL +LR+GN+NKA+RLMKD   K+E S   AL  RV GT+ VK+A IIDDPN 
Sbjct  42    IKQECEKALNALRKGNYNKAVRLMKDSSQKYEKS---ALFQRVFGTIYVKIAGIIDDPNA  98

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K RH +NAI+SARK+V MSPNS+EFAHFYANLL+E ANDGK+YEEVV ECERALAIENP 
Sbjct  99    KQRHYRNAIESARKAVSMSPNSVEFAHFYANLLFETANDGKDYEEVVSECERALAIENPN  158

Query  930   DPAKESLQENQQK------VSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEE  1085
             DP KE++   QQ+      ++T E RI  VQGELR LIQ+SN+ASISTW+KN G  +GEE
Sbjct  159   DPLKENVSNQQQQEENSPALATAEGRITQVQGELRGLIQKSNIASISTWMKNLGGPTGEE  218

Query  1086  KFRLIPIRRMSEDPMELRLV-----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             KFRLIP++++SED  E +         R+PNEIKKATKT EERRKEIE RV AARL+QQ+
Sbjct  219   KFRLIPLKKLSEDTSESKYFSTTNSNVRRPNEIKKATKTLEERRKEIETRVTAARLMQQQ  278

Query  1251  SESAQSFNDGERSLDLSAGTGQ--------RGNERRKSGNARKNVSSMERRDCVRSYWNS  1406
             SE A++  +G+ ++   + +          +  ERRK GN ++N S  ER+D VR++W+S
Sbjct  279   SEQARNAEEGKTNVGAQSQSSSLVSGSGGSKVGERRKHGNYKRNSSFCERKDQVRTFWDS  338

Query  1407  MSTDMKKKLLRIRIVDLKSHF--GSLKDGL-ANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             MS++M++ LL + + DL+ HF   S KDG  A E+LSEA+ F + NK WKFW CC C ++
Sbjct  339   MSSEMRRGLLSVSVSDLREHFKGSSNKDGRQACELLSEAIQFGKVNKTWKFWVCCRCEQK  398

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F  +++H+QHV+ +HM +L PK+QS LPQN++NEW EMLL+CSWKPLD+ A+ ++LE Q 
Sbjct  399   FPQADAHVQHVVQKHMGNLLPKVQSALPQNIDNEWAEMLLSCSWKPLDLTASVRMLEDQS  458

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSRE--YD  1931
             K     F   +   +D +++KD  SD +C+   W+  P K+T  DGCNG   +S+    D
Sbjct  459   KSEESEF---SGRENDKEQTKDCWSDSFCSEEVWEPFPEKRTSADGCNGDIWESKGDCRD  515

Query  1932  KNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKV  2111
              N+E  +  D  EG+K+     SWP++DD ER KLLE+I+ +FQ L+++K   ++HL KV
Sbjct  516   LNTEC-ITCDRKEGSKVYSSPNSWPLSDDIERVKLLEKISSLFQILVRHKCFATTHLQKV  574

Query  2112  IHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS  2291
             IH+ +EELQ +  GSQ+L+  +D TPLCICFLGA +LKKI+KFLQE+SH+CG+ RYPE+ 
Sbjct  575   IHYTMEELQGMFPGSQILSSGVDATPLCICFLGATQLKKIIKFLQEISHACGVSRYPEKV  634

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
             T  D+ S   Q  D  E+I+ +ED S               +   DG+  D+    +   
Sbjct  635   TP-DESSNCPQVCDHEERIMLNEDAS--------SLLLDESLLNSDGLRIDTGSGYSIDV  685

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
                   +G    S   LSWI+ G+S  EQ+++W R +EE++QQ +E++++LEKEF  LQ 
Sbjct  686   CEKGAQSGSGSGSGSFLSWIYAGSSCAEQISTWGRLKEERSQQGVELLQMLEKEFGHLQS  745

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LC+RK EHL YEEALQ +E+LCLEE KKREH  +F  RSYD  ++K RD+L+E  ++A  
Sbjct  746   LCDRKYEHLGYEEALQGLEELCLEESKKREHITEFSHRSYDTIIRKHRDQLVEGENDAPF  805

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
              + R E+EAI++VLK+AESL VNQFG+EDTYGG++SHLCDLE+GE DDWR  DYL+Q D+
Sbjct  806   VSNRVELEAITNVLKEAESLGVNQFGYEDTYGGVNSHLCDLEAGE-DDWRSNDYLHQVDT  864

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
             C+E+AIQRQKEH+S EL KIDARIMR V+ MQQLE+KLE VSA DYR IL+PLVKS++RA
Sbjct  865   CIEIAIQRQKEHMSTELCKIDARIMRNVASMQQLELKLEPVSALDYRSILLPLVKSFMRA  924

Query  3192  HLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKH-SHEktrdkkkikdyrkt  3368
             HLEDLAE+DAT+KSDAAREAFLAELA DSKK +  G  N K    +    KK     R  
Sbjct  925   HLEDLAEKDATQKSDAAREAFLAELALDSKKDTGKGYYNLKQIQDKTKDKKKNKDSRRNK  984

Query  3369  kdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSN-SITQeeeeqrrriele  3545
                 GS    L     + +E+ S +V   G   D +L    S+  I + EE  RR+IELE
Sbjct  985   DTKVGSFTEQL-----EPSEQFSLAVTSGGDHVDTDLLASESDEKIKELEEVSRRKIELE  1039

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             AEERKLEETLEYQRR+ENEAK K LAEQ ++ A
Sbjct  1040  AEERKLEETLEYQRRLENEAKQKLLAEQRRRNA  1072


 Score = 89.0 bits (219),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +1

Query  3943  SGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFH  4122
             S AE ++  +VR  DD L     G+ G KTLRQL  E+D+EER+QAD  KA+RQSLDT+ 
Sbjct  1195  SAAEMMQKDQVRSQDDGL-SCSVGDVGSKTLRQLQAEEDEEERYQADFNKALRQSLDTYQ  1253

Query  4123  AHQKLPLIPRSGTAQISEMAN---LGVSCEDVATGIVNGIEVYGTGLKNEVG  4269
             A QKLPL+P +   Q S + N   +G    +V +  VN +  +G GL+NE+ 
Sbjct  1254  ACQKLPLVPNTRMVQQS-LQNADIMGTETGEVISINVNEMASFGAGLRNEIA  1304



>ref|XP_010678606.1| PREDICTED: uncharacterized protein LOC104894129 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1489

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/1053 (53%), Positives = 734/1053 (70%), Gaps = 50/1053 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IK ECE+AL +LR+GN+NKA+RLMKD   K+E S   AL  RV GT+ VK+A IIDDPN 
Sbjct  42    IKQECEKALNALRKGNYNKAVRLMKDSSQKYEKS---ALFQRVFGTIYVKIAGIIDDPNA  98

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K RH +NAI+SARK+V MSPNS+EFAHFYANLL+E ANDGK+YEEVV ECERALAIENP 
Sbjct  99    KQRHYRNAIESARKAVSMSPNSVEFAHFYANLLFETANDGKDYEEVVSECERALAIENPN  158

Query  930   DPAKESLQENQQK------VSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEE  1085
             DP KE++   QQ+      ++T E RI  VQGELR LIQ+SN+ASISTW+KN G  +GEE
Sbjct  159   DPLKENVSNQQQQEENSPALATAEGRITQVQGELRGLIQKSNIASISTWMKNLGGPTGEE  218

Query  1086  KFRLIPIRRMSEDPMELRLV-----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             KFRLIP++++SED  E +         R+PNEIKKATKT EERRKEIE RV AARL+QQ+
Sbjct  219   KFRLIPLKKLSEDTSESKYFSTTNSNVRRPNEIKKATKTLEERRKEIETRVTAARLMQQQ  278

Query  1251  SESAQSFNDGERSLD--------LSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNS  1406
             SE A++  +G+ ++         +S   G +  ERRK GN ++N S  ER+D VR++W+S
Sbjct  279   SEQARNAEEGKTNVGAQSQSSSLVSGSGGSKVGERRKHGNYKRNSSFCERKDQVRTFWDS  338

Query  1407  MSTDMKKKLLRIRIVDLKSHF--GSLKDG-LANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             MS++M++ LL + + DL+ HF   S KDG  A E+LSEA+ F + NK WKFW CC C ++
Sbjct  339   MSSEMRRGLLSVSVSDLREHFKGSSNKDGRQACELLSEAIQFGKVNKTWKFWVCCRCEQK  398

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F  +++H+QHV+ +HM +L PK+QS LPQN++NEW EMLL+CSWKPLD+ A+ ++LE Q 
Sbjct  399   FPQADAHVQHVVQKHMGNLLPKVQSALPQNIDNEWAEMLLSCSWKPLDLTASVRMLEDQS  458

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSRE--YD  1931
             K     F   +   +D +++KD  SD +C+   W+  P K+T  DGCNG   +S+    D
Sbjct  459   KSEESEF---SGRENDKEQTKDCWSDSFCSEEVWEPFPEKRTSADGCNGDIWESKGDCRD  515

Query  1932  KNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKV  2111
              N+E  +  D  EG+K+     SWP++DD ER KLLE+I+ +FQ L+++K   ++HL KV
Sbjct  516   LNTEC-ITCDRKEGSKVYSSPNSWPLSDDIERVKLLEKISSLFQILVRHKCFATTHLQKV  574

Query  2112  IHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS  2291
             IH+ +EELQ +  GSQ+L+  +D TPLCICFLGA +LKKI+KFLQE+SH+CG+ RYPE+ 
Sbjct  575   IHYTMEELQGMFPGSQILSSGVDATPLCICFLGATQLKKIIKFLQEISHACGVSRYPEKV  634

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
             T  D+ S   Q  D  E+I+ +ED S               +   DG+  D+    +   
Sbjct  635   TP-DESSNCPQVCDHEERIMLNEDAS--------SLLLDESLLNSDGLRIDTGSGYSIDV  685

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
                   +G    S   LSWI+ G+S  EQ+++W R +EE++QQ +E++++LEKEF  LQ 
Sbjct  686   CEKGAQSGSGSGSGSFLSWIYAGSSCAEQISTWGRLKEERSQQGVELLQMLEKEFGHLQS  745

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LC+RK EHL YEEALQ +E+LCLEE KKREH  +F  RSYD  ++K RD+L+E  ++A  
Sbjct  746   LCDRKYEHLGYEEALQGLEELCLEESKKREHITEFSHRSYDTIIRKHRDQLVEGENDAPF  805

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
              + R E+EAI++VLK+AESL VNQFG+EDTYGG++SHLCDLE+GE DDWR  DYL+Q D+
Sbjct  806   VSNRVELEAITNVLKEAESLGVNQFGYEDTYGGVNSHLCDLEAGE-DDWRSNDYLHQVDT  864

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
             C+E+AIQRQKEH+S EL KIDARIMR V+ MQQLE+KLE VSA DYR IL+PLVKS++RA
Sbjct  865   CIEIAIQRQKEHMSTELCKIDARIMRNVASMQQLELKLEPVSALDYRSILLPLVKSFMRA  924

Query  3192  HLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKH-SHEktrdkkkikdyrkt  3368
             HLEDLAE+DAT+KSDAAREAFLAELA DSKK +  G  N K    +    KK     R  
Sbjct  925   HLEDLAEKDATQKSDAAREAFLAELALDSKKDTGKGYYNLKQIQDKTKDKKKNKDSRRNK  984

Query  3369  kdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSN-SITQeeeeqrrriele  3545
                 GS    L     + +E+ S +V   G   D +L    S+  I + EE  RR+IELE
Sbjct  985   DTKVGSFTEQL-----EPSEQFSLAVTSGGDHVDTDLLASESDEKIKELEEVSRRKIELE  1039

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             AEERKLEETLEYQRR+ENEAK K LAEQ ++ A
Sbjct  1040  AEERKLEETLEYQRRLENEAKQKLLAEQRRRNA  1072


 Score =   361 bits (927),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 187/288 (65%), Positives = 226/288 (78%), Gaps = 6/288 (2%)
 Frame = +1

Query  3943  SGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFH  4122
             S AE ++  +VR  DD L     G+ G KTLRQL  E+D+EER+QAD  KA+RQSLDT+ 
Sbjct  1195  SAAEMMQKDQVRSQDDGL-SCSVGDVGSKTLRQLQAEEDEEERYQADFNKALRQSLDTYQ  1253

Query  4123  AHQKLPLIPRSGTAQISEMAN---LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNV  4293
             A QKLPL+P +   Q S + N   +G    +V +  VN +  +G GL+NE+GEYNCFLNV
Sbjct  1254  ACQKLPLVPNTRMVQQS-LQNADIMGTETGEVISINVNEMASFGAGLRNEIGEYNCFLNV  1312

Query  4294  IIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLR  4470
             IIQSLWHLRRFR+EFLR SSSEH+HVGDPCVVCAL+DI TAL++A  + +   VAP +LR
Sbjct  1313  IIQSLWHLRRFREEFLRRSSSEHVHVGDPCVVCALFDILTALNMACGDAKSKPVAPTALR  1372

Query  4471  IALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCAN  4650
             IALSNLYP+   FQEGQMNDASEVLGVIFECLH+SF S S  SD+ES++S+C+GSWDC++
Sbjct  1373  IALSNLYPESNFFQEGQMNDASEVLGVIFECLHRSFPSGSIGSDSESIESNCLGSWDCSS  1432

Query  4651  SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKV  4794
              +CI H+LFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMK 
Sbjct  1433  PSCIAHTLFGMDIFERMNCYNCHLESRHLKYTSFFHNINASALRTMKA  1480



>ref|XP_009149858.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103873186 
[Brassica rapa]
Length=1579

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/1105 (52%), Positives = 761/1105 (69%), Gaps = 79/1105 (7%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG K++P APRSK S+                    S ++A            +A   SE
Sbjct  1     MGQKEKPPAPRSKQSL--------------------SSSAA------------EAQPSSE  28

Query  543   TNASSSY------ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQG  704
              +AS+SY      A IK ECE+ALTS RRG++NKA+RLMK+ C++H++S   ALI+RVQG
Sbjct  29    VSASTSYEEPSNLAEIKAECEKALTSFRRGSYNKAIRLMKESCSRHQHS---ALIHRVQG  85

Query  705   TVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEE  884
             TVCVKV+S+ +D   K +++++AI+SARK+V +SPNSIEF+HFYANLLYE+A+DG+EYEE
Sbjct  86    TVCVKVSSVYEDAVTKQKYIRSAIESARKAVELSPNSIEFSHFYANLLYESASDGREYEE  145

Query  885   VVQECERALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWV  1061
             VV+EC RALAIENPIDPAK+SLQ E+Q K+ TPEARIA+VQ ELR+LIQ+SNL S+STW+
Sbjct  146   VVRECHRALAIENPIDPAKDSLQDESQHKILTPEARIANVQDELRSLIQKSNLGSLSTWM  205

Query  1062  KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLL  1241
             K+  +GE +FRL  +R+M+EDP+E  LVQ R+PNEIKKATKT EE+RKEIEVRVAA RLL
Sbjct  206   KHLRNGEGEFRLFDMRKMAEDPIESNLVQTRRPNEIKKATKTLEEKRKEIEVRVAAGRLL  265

Query  1242  QQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
             QQKSES+   +   +  D + G+GQR  ERRK GNARKN S++ERRD VRSYW S S +M
Sbjct  266   QQKSESSSVDSVNSKGSDPALGSGQRSGERRKHGNARKNGSTVERRDRVRSYWESTSKEM  325

Query  1422  KKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
             KK+LLRI++ DLKSHF + KDG AN++++EALSF EANK W+FW CC C E+F DSES++
Sbjct  326   KKELLRIKVSDLKSHFSASKDGDANDIIAEALSFCEANKTWRFWVCCKCSEKFKDSESYM  385

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
             QH++ EHM ++ PK+Q VLPQ++++E +EMLL   WKPLD  A  KLL  Q K +   F 
Sbjct  386   QHIVGEHMGNVFPKMQMVLPQSLDSERIEMLLTSPWKPLDFPAVVKLLCSQQKIQNSEFS  445

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDR  1958
             E  Y    MD+  D   D       W D SP K+  GD CNG       Y+KN       
Sbjct  446   E-FYAGGYMDDGDDCFQD------AWNDTSPEKENIGDACNG-------YEKNE------  485

Query  1959  DGNEGTKICPP---SESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
               +E  ++  P   ++ WPI+DDPER KLL+ I   F+ LIK+ YL +SH  KVI F ++
Sbjct  486   --SEKDRLPNPFYLTDEWPISDDPERTKLLKSIRAAFELLIKHSYLATSHYDKVIQFTLD  543

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             EL++L   SQ LN  + Q+P+CI FLGA +LKKIL+FLQ+LSH+CG+ RY E+S   D++
Sbjct  544   ELRNLPSVSQFLNRGLGQSPICIRFLGATQLKKILQFLQDLSHACGVSRYSEQSNPNDEV  603

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
               G+Q     E+I    +GSCLL DE     +          + + +  S+   +N    
Sbjct  604   DLGLQ---ITEEIFLDGEGSCLLLDEKLLGSECIQEKHMGSALNNGDIASSEDIANGNNV  660

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
             + G   +D  LSWIF G SSGEQ   W R+ EEK  Q  + + +LEKE ++LQ L ERKC
Sbjct  661   SAG---ADGFLSWIFSGPSSGEQTAIWMRTVEEKTNQGQKTMEILEKEVHDLQNLFERKC  717

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             EHL YE ALQ VEDLCLEEG+KRE + DF   SY+  L+KRR+EL  S HE    +  FE
Sbjct  718   EHLGYEGALQTVEDLCLEEGRKRETSPDFTHESYESVLRKRREEL--SAHELEFFSSSFE  775

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             +EAI +VL+DA++L  NQFG+E++Y   SS L DLESGE D+W +KD  ++ADS +E AI
Sbjct  776   LEAIKNVLRDADTLKRNQFGYEESYTCTSSQLRDLESGEADEWGMKDSFSEADSFIETAI  835

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             Q+QKE +S EL++IDAR+MR V+ +QQLE++L   S++DY+ +++PLV+SY+RAHLE LA
Sbjct  836   QKQKEQLSTELNRIDARMMRGVTVVQQLELRLGPASSNDYQIVMLPLVRSYMRAHLEALA  895

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             E+DATEKSDAA +AFL ELA DSKK +   ++++KH+ EK++DKKK K  +K KD K S 
Sbjct  896   EKDATEKSDAASKAFLVELALDSKKEARGRNDHSKHTQEKSKDKKKNKHSKKLKDSKASV  955

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqr--rrieleaeerkl  3563
             GN  H  + D+ E +  SV   G   +A++      S+ ++EEE +  RR ELE +E KL
Sbjct  956   GND-HRFNVDSVEHSLPSVASFGDPSEADVVPEAVESLKEQEEECKCRRRTELELDEIKL  1014

Query  3564  eetleYQRRIENEAKLKHLAEQHKK  3638
             EETLEYQRRIENEAK KH+AEQ KK
Sbjct  1015  EETLEYQRRIENEAKEKHIAEQQKK  1039


 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 366/486 (75%), Gaps = 27/486 (6%)
 Frame = +1

Query  3784  PKNSTVSDIHKAGF-SNGGFLEDGALTSDrragrrsrrqkgsakYNEEKCPPVTSGAENI  3960
             P  +TV D+      +NG   +DG L SD+R GRR RRQK S   N+   P  ++G E  
Sbjct  1108  PDAATVQDVKSQKVVANGVATQDGVLQSDQRIGRRGRRQKTS---NKVVGPSESTGKER-  1163

Query  3961  EVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLP  4140
                      +S   +  G+ G KTLRQL  E+D+EE+FQADL KAVRQSLDT+   + + 
Sbjct  1164  ---------ESETLRSNGDVGTKTLRQLQAEEDEEEKFQADLKKAVRQSLDTYQGGRNMT  1214

Query  4141  LIPRS----GTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSL  4308
                R+     + +IS+      S  +V         ++GTGL+NEVGEYNCFLNVIIQSL
Sbjct  1215  SCLRTPLEVNSHEISDSTKESPSSTEVG--------IFGTGLQNEVGEYNCFLNVIIQSL  1266

Query  4309  WHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSN  4485
             W+L  FR EFLRSS+ +H HVGDPCVVC+LY++ TALS AS E R++ V P++LRIALSN
Sbjct  1267  WNLGVFRAEFLRSSTLDHHHVGDPCVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSN  1326

Query  4486  LYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIV  4665
             LYPD   FQE QMNDASEVL VIF+CLH+SF  ++  SDT+S +S+  GSWDCAN  CI 
Sbjct  1327  LYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQSASVSDTDSSESNYTGSWDCANRTCIA  1386

Query  4666  HSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMN  4845
             HSLFGM++FE++NCY CGLESRH+KYTSFFHNINASALR MKV C +++FDELLNLVEMN
Sbjct  1387  HSLFGMNIFEQLNCYSCGLESRHMKYTSFFHNINASALRNMKVTCPETAFDELLNLVEMN  1446

Query  4846  HQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISV  5025
             HQ+ACDP+  GCGK NHI HFL+TPPHVFT VLGWQNTCESVEDI ATL AL+TEIDIS+
Sbjct  1447  HQIACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAATLAALNTEIDISI  1506

Query  5026  LYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERG  5205
             +YRGLDPKS + L SVVCYYGQHYHCFAYSH+H+RWIMYDDKTVKVIG+W DVL+ C++G
Sbjct  1507  MYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSWTDVLSTCKKG  1566

Query  5206  HLQPQV  5223
             HLQPQ+
Sbjct  1567  HLQPQL  1572



>ref|XP_010678605.1| PREDICTED: uncharacterized protein LOC104894129 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1631

 Score =   967 bits (2501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/1053 (53%), Positives = 734/1053 (70%), Gaps = 50/1053 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IK ECE+AL +LR+GN+NKA+RLMKD   K+E S   AL  RV GT+ VK+A IIDDPN 
Sbjct  42    IKQECEKALNALRKGNYNKAVRLMKDSSQKYEKS---ALFQRVFGTIYVKIAGIIDDPNA  98

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K RH +NAI+SARK+V MSPNS+EFAHFYANLL+E ANDGK+YEEVV ECERALAIENP 
Sbjct  99    KQRHYRNAIESARKAVSMSPNSVEFAHFYANLLFETANDGKDYEEVVSECERALAIENPN  158

Query  930   DPAKESLQENQQK------VSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEE  1085
             DP KE++   QQ+      ++T E RI  VQGELR LIQ+SN+ASISTW+KN G  +GEE
Sbjct  159   DPLKENVSNQQQQEENSPALATAEGRITQVQGELRGLIQKSNIASISTWMKNLGGPTGEE  218

Query  1086  KFRLIPIRRMSEDPMELRLV-----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             KFRLIP++++SED  E +         R+PNEIKKATKT EERRKEIE RV AARL+QQ+
Sbjct  219   KFRLIPLKKLSEDTSESKYFSTTNSNVRRPNEIKKATKTLEERRKEIETRVTAARLMQQQ  278

Query  1251  SESAQSFNDGERSLD--------LSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNS  1406
             SE A++  +G+ ++         +S   G +  ERRK GN ++N S  ER+D VR++W+S
Sbjct  279   SEQARNAEEGKTNVGAQSQSSSLVSGSGGSKVGERRKHGNYKRNSSFCERKDQVRTFWDS  338

Query  1407  MSTDMKKKLLRIRIVDLKSHF--GSLKDG-LANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             MS++M++ LL + + DL+ HF   S KDG  A E+LSEA+ F + NK WKFW CC C ++
Sbjct  339   MSSEMRRGLLSVSVSDLREHFKGSSNKDGRQACELLSEAIQFGKVNKTWKFWVCCRCEQK  398

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F  +++H+QHV+ +HM +L PK+QS LPQN++NEW EMLL+CSWKPLD+ A+ ++LE Q 
Sbjct  399   FPQADAHVQHVVQKHMGNLLPKVQSALPQNIDNEWAEMLLSCSWKPLDLTASVRMLEDQS  458

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSRE--YD  1931
             K     F   +   +D +++KD  SD +C+   W+  P K+T  DGCNG   +S+    D
Sbjct  459   KSEESEF---SGRENDKEQTKDCWSDSFCSEEVWEPFPEKRTSADGCNGDIWESKGDCRD  515

Query  1932  KNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKV  2111
              N+E  +  D  EG+K+     SWP++DD ER KLLE+I+ +FQ L+++K   ++HL KV
Sbjct  516   LNTEC-ITCDRKEGSKVYSSPNSWPLSDDIERVKLLEKISSLFQILVRHKCFATTHLQKV  574

Query  2112  IHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS  2291
             IH+ +EELQ +  GSQ+L+  +D TPLCICFLGA +LKKI+KFLQE+SH+CG+ RYPE+ 
Sbjct  575   IHYTMEELQGMFPGSQILSSGVDATPLCICFLGATQLKKIIKFLQEISHACGVSRYPEKV  634

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
             T  D+ S   Q  D  E+I+ +ED S               +   DG+  D+    +   
Sbjct  635   TP-DESSNCPQVCDHEERIMLNEDAS--------SLLLDESLLNSDGLRIDTGSGYSIDV  685

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
                   +G    S   LSWI+ G+S  EQ+++W R +EE++QQ +E++++LEKEF  LQ 
Sbjct  686   CEKGAQSGSGSGSGSFLSWIYAGSSCAEQISTWGRLKEERSQQGVELLQMLEKEFGHLQS  745

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LC+RK EHL YEEALQ +E+LCLEE KKREH  +F  RSYD  ++K RD+L+E  ++A  
Sbjct  746   LCDRKYEHLGYEEALQGLEELCLEESKKREHITEFSHRSYDTIIRKHRDQLVEGENDAPF  805

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
              + R E+EAI++VLK+AESL VNQFG+EDTYGG++SHLCDLE+GE DDWR  DYL+Q D+
Sbjct  806   VSNRVELEAITNVLKEAESLGVNQFGYEDTYGGVNSHLCDLEAGE-DDWRSNDYLHQVDT  864

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
             C+E+AIQRQKEH+S EL KIDARIMR V+ MQQLE+KLE VSA DYR IL+PLVKS++RA
Sbjct  865   CIEIAIQRQKEHMSTELCKIDARIMRNVASMQQLELKLEPVSALDYRSILLPLVKSFMRA  924

Query  3192  HLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKH-SHEktrdkkkikdyrkt  3368
             HLEDLAE+DAT+KSDAAREAFLAELA DSKK +  G  N K    +    KK     R  
Sbjct  925   HLEDLAEKDATQKSDAAREAFLAELALDSKKDTGKGYYNLKQIQDKTKDKKKNKDSRRNK  984

Query  3369  kdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSN-SITQeeeeqrrriele  3545
                 GS    L     + +E+ S +V   G   D +L    S+  I + EE  RR+IELE
Sbjct  985   DTKVGSFTEQL-----EPSEQFSLAVTSGGDHVDTDLLASESDEKIKELEEVSRRKIELE  1039

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             AEERKLEETLEYQRR+ENEAK K LAEQ ++ A
Sbjct  1040  AEERKLEETLEYQRRLENEAKQKLLAEQRRRNA  1072


 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/431 (71%), Positives = 358/431 (83%), Gaps = 6/431 (1%)
 Frame = +1

Query  3943  SGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFH  4122
             S AE ++  +VR  DD L     G+ G KTLRQL  E+D+EER+QAD  KA+RQSLDT+ 
Sbjct  1195  SAAEMMQKDQVRSQDDGL-SCSVGDVGSKTLRQLQAEEDEEERYQADFNKALRQSLDTYQ  1253

Query  4123  AHQKLPLIPRSGTAQISEMAN---LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNV  4293
             A QKLPL+P +   Q S + N   +G    +V +  VN +  +G GL+NE+GEYNCFLNV
Sbjct  1254  ACQKLPLVPNTRMVQQS-LQNADIMGTETGEVISINVNEMASFGAGLRNEIGEYNCFLNV  1312

Query  4294  IIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLR  4470
             IIQSLWHLRRFR+EFLR SSSEH+HVGDPCVVCAL+DI TAL++A  + +   VAP +LR
Sbjct  1313  IIQSLWHLRRFREEFLRRSSSEHVHVGDPCVVCALFDILTALNMACGDAKSKPVAPTALR  1372

Query  4471  IALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCAN  4650
             IALSNLYP+   FQEGQMNDASEVLGVIFECLH+SF S S  SD+ES++S+C+GSWDC++
Sbjct  1373  IALSNLYPESNFFQEGQMNDASEVLGVIFECLHRSFPSGSIGSDSESIESNCLGSWDCSS  1432

Query  4651  SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLN  4830
              +CI H+LFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMKVMC+D+SFDELLN
Sbjct  1433  PSCIAHTLFGMDIFERMNCYNCHLESRHLKYTSFFHNINASALRTMKVMCEDTSFDELLN  1492

Query  4831  LVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTE  5010
              VEMNHQLACD +A GCGK NHIHH LS PPH+FTTVLGWQ TCESV+DITATL AL+TE
Sbjct  1493  YVEMNHQLACDLEAGGCGKSNHIHHILSNPPHIFTTVLGWQKTCESVDDITATLAALATE  1552

Query  5011  IDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLT  5190
             IDISVLYRGLDPK+ H LVSVVCYYGQHY+CFA+SHDHERWIMYDD+TVKVIG W DVL+
Sbjct  1553  IDISVLYRGLDPKNVHRLVSVVCYYGQHYYCFAFSHDHERWIMYDDRTVKVIGAWEDVLS  1612

Query  5191  MCERGHLQPQV  5223
             MCERGHLQPQV
Sbjct  1613  MCERGHLQPQV  1623



>ref|XP_010678604.1| PREDICTED: uncharacterized protein LOC104894129 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1642

 Score =   967 bits (2501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/1053 (53%), Positives = 734/1053 (70%), Gaps = 50/1053 (5%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IK ECE+AL +LR+GN+NKA+RLMKD   K+E S   AL  RV GT+ VK+A IIDDPN 
Sbjct  42    IKQECEKALNALRKGNYNKAVRLMKDSSQKYEKS---ALFQRVFGTIYVKIAGIIDDPNA  98

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K RH +NAI+SARK+V MSPNS+EFAHFYANLL+E ANDGK+YEEVV ECERALAIENP 
Sbjct  99    KQRHYRNAIESARKAVSMSPNSVEFAHFYANLLFETANDGKDYEEVVSECERALAIENPN  158

Query  930   DPAKESLQENQQK------VSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEE  1085
             DP KE++   QQ+      ++T E RI  VQGELR LIQ+SN+ASISTW+KN G  +GEE
Sbjct  159   DPLKENVSNQQQQEENSPALATAEGRITQVQGELRGLIQKSNIASISTWMKNLGGPTGEE  218

Query  1086  KFRLIPIRRMSEDPMELRLV-----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQK  1250
             KFRLIP++++SED  E +         R+PNEIKKATKT EERRKEIE RV AARL+QQ+
Sbjct  219   KFRLIPLKKLSEDTSESKYFSTTNSNVRRPNEIKKATKTLEERRKEIETRVTAARLMQQQ  278

Query  1251  SESAQSFNDGERSLD--------LSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNS  1406
             SE A++  +G+ ++         +S   G +  ERRK GN ++N S  ER+D VR++W+S
Sbjct  279   SEQARNAEEGKTNVGAQSQSSSLVSGSGGSKVGERRKHGNYKRNSSFCERKDQVRTFWDS  338

Query  1407  MSTDMKKKLLRIRIVDLKSHF--GSLKDG-LANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             MS++M++ LL + + DL+ HF   S KDG  A E+LSEA+ F + NK WKFW CC C ++
Sbjct  339   MSSEMRRGLLSVSVSDLREHFKGSSNKDGRQACELLSEAIQFGKVNKTWKFWVCCRCEQK  398

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             F  +++H+QHV+ +HM +L PK+QS LPQN++NEW EMLL+CSWKPLD+ A+ ++LE Q 
Sbjct  399   FPQADAHVQHVVQKHMGNLLPKVQSALPQNIDNEWAEMLLSCSWKPLDLTASVRMLEDQS  458

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSRE--YD  1931
             K     F   +   +D +++KD  SD +C+   W+  P K+T  DGCNG   +S+    D
Sbjct  459   KSEESEF---SGRENDKEQTKDCWSDSFCSEEVWEPFPEKRTSADGCNGDIWESKGDCRD  515

Query  1932  KNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKV  2111
              N+E  +  D  EG+K+     SWP++DD ER KLLE+I+ +FQ L+++K   ++HL KV
Sbjct  516   LNTEC-ITCDRKEGSKVYSSPNSWPLSDDIERVKLLEKISSLFQILVRHKCFATTHLQKV  574

Query  2112  IHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS  2291
             IH+ +EELQ +  GSQ+L+  +D TPLCICFLGA +LKKI+KFLQE+SH+CG+ RYPE+ 
Sbjct  575   IHYTMEELQGMFPGSQILSSGVDATPLCICFLGATQLKKIIKFLQEISHACGVSRYPEKV  634

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
             T  D+ S   Q  D  E+I+ +ED S               +   DG+  D+    +   
Sbjct  635   TP-DESSNCPQVCDHEERIMLNEDAS--------SLLLDESLLNSDGLRIDTGSGYSIDV  685

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
                   +G    S   LSWI+ G+S  EQ+++W R +EE++QQ +E++++LEKEF  LQ 
Sbjct  686   CEKGAQSGSGSGSGSFLSWIYAGSSCAEQISTWGRLKEERSQQGVELLQMLEKEFGHLQS  745

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LC+RK EHL YEEALQ +E+LCLEE KKREH  +F  RSYD  ++K RD+L+E  ++A  
Sbjct  746   LCDRKYEHLGYEEALQGLEELCLEESKKREHITEFSHRSYDTIIRKHRDQLVEGENDAPF  805

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
              + R E+EAI++VLK+AESL VNQFG+EDTYGG++SHLCDLE+GE DDWR  DYL+Q D+
Sbjct  806   VSNRVELEAITNVLKEAESLGVNQFGYEDTYGGVNSHLCDLEAGE-DDWRSNDYLHQVDT  864

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
             C+E+AIQRQKEH+S EL KIDARIMR V+ MQQLE+KLE VSA DYR IL+PLVKS++RA
Sbjct  865   CIEIAIQRQKEHMSTELCKIDARIMRNVASMQQLELKLEPVSALDYRSILLPLVKSFMRA  924

Query  3192  HLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKH-SHEktrdkkkikdyrkt  3368
             HLEDLAE+DAT+KSDAAREAFLAELA DSKK +  G  N K    +    KK     R  
Sbjct  925   HLEDLAEKDATQKSDAAREAFLAELALDSKKDTGKGYYNLKQIQDKTKDKKKNKDSRRNK  984

Query  3369  kdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSN-SITQeeeeqrrriele  3545
                 GS    L     + +E+ S +V   G   D +L    S+  I + EE  RR+IELE
Sbjct  985   DTKVGSFTEQL-----EPSEQFSLAVTSGGDHVDTDLLASESDEKIKELEEVSRRKIELE  1039

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             AEERKLEETLEYQRR+ENEAK K LAEQ ++ A
Sbjct  1040  AEERKLEETLEYQRRLENEAKQKLLAEQRRRNA  1072


 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/442 (70%), Positives = 358/442 (81%), Gaps = 17/442 (4%)
 Frame = +1

Query  3943  SGAENIEVGEVRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFH  4122
             S AE ++  +VR  DD L     G+ G KTLRQL  E+D+EER+QAD  KA+RQSLDT+ 
Sbjct  1195  SAAEMMQKDQVRSQDDGL-SCSVGDVGSKTLRQLQAEEDEEERYQADFNKALRQSLDTYQ  1253

Query  4123  AHQKLPLIPRSGTAQISEMAN---LGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNV  4293
             A QKLPL+P +   Q S + N   +G    +V +  VN +  +G GL+NE+GEYNCFLNV
Sbjct  1254  ACQKLPLVPNTRMVQQS-LQNADIMGTETGEVISINVNEMASFGAGLRNEIGEYNCFLNV  1312

Query  4294  IIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLR  4470
             IIQSLWHLRRFR+EFLR SSSEH+HVGDPCVVCAL+DI TAL++A  + +   VAP +LR
Sbjct  1313  IIQSLWHLRRFREEFLRRSSSEHVHVGDPCVVCALFDILTALNMACGDAKSKPVAPTALR  1372

Query  4471  IALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCAN  4650
             IALSNLYP+   FQEGQMNDASEVLGVIFECLH+SF S S  SD+ES++S+C+GSWDC++
Sbjct  1373  IALSNLYPESNFFQEGQMNDASEVLGVIFECLHRSFPSGSIGSDSESIESNCLGSWDCSS  1432

Query  4651  SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMK-----------VM  4797
              +CI H+LFGMD+FERMNCY C LESRHLKYTSFFHNINASALRTMK           VM
Sbjct  1433  PSCIAHTLFGMDIFERMNCYNCHLESRHLKYTSFFHNINASALRTMKACLLERRCILPVM  1492

Query  4798  CQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVED  4977
             C+D+SFDELLN VEMNHQLACD +A GCGK NHIHH LS PPH+FTTVLGWQ TCESV+D
Sbjct  1493  CEDTSFDELLNYVEMNHQLACDLEAGGCGKSNHIHHILSNPPHIFTTVLGWQKTCESVDD  1552

Query  4978  ITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTV  5157
             ITATL AL+TEIDISVLYRGLDPK+ H LVSVVCYYGQHY+CFA+SHDHERWIMYDD+TV
Sbjct  1553  ITATLAALATEIDISVLYRGLDPKNVHRLVSVVCYYGQHYYCFAFSHDHERWIMYDDRTV  1612

Query  5158  KVIGNWADVLTMCERGHLQPQV  5223
             KVIG W DVL+MCERGHLQPQV
Sbjct  1613  KVIGAWEDVLSMCERGHLQPQV  1634



>ref|XP_008809576.1| PREDICTED: uncharacterized protein LOC103721233 isoform X1 [Phoenix 
dactylifera]
Length=1599

 Score =   961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1042 (55%), Positives = 738/1042 (71%), Gaps = 67/1042 (6%)
 Frame = +3

Query  573   KLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNVK  752
             K ECERALT+ RRGNH KALRLM+D C +HE+SP   L++RV GTV VKVA+++DD N K
Sbjct  69    KAECERALTAFRRGNHKKALRLMRDACVQHESSP---LLHRVHGTVQVKVAALLDDSNAK  125

Query  753   NRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPID  932
              RHL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ YEEVVQECERAL I +PID
Sbjct  126   LRHLRAAIDSARRAVSLSPSSIEFAHFYANLLYEAATDGRGYEEVVQECERALNILDPID  185

Query  933   PAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEEKFRLIP  1103
             PA+ESLQ E   K+S+PE+RI  V+ ELR LIQ+SN+ASISTW+KN G  +GEEKFRLIP
Sbjct  186   PARESLQDEAAHKLSSPESRIEQVRQELRALIQKSNIASISTWMKNLGGAAGEEKFRLIP  245

Query  1104  IRRMSEDPMELRLV-QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND-  1277
             +RR+S+DPME+R+V  AR+PNEIKKATKTPEERRKEIEVRVAAARLLQQ S      +D 
Sbjct  246   MRRLSDDPMEVRVVPAARRPNEIKKATKTPEERRKEIEVRVAAARLLQQHSPRPGGEDDA  305

Query  1278  --GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIV  1451
               G+  +  S+G G R  ERRK+ N+RK  SS +R D +R+YWNSMS + +   L + I 
Sbjct  306   RAGDSPVSSSSG-GHRLAERRKA-NSRKPASSTDRMDQIRAYWNSMSIEKRLGFLAVSIP  363

Query  1452  DLKSHF--GSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHM  1625
              L++H    S KD  A+++LSEALSF+EAN  W+FW CC C E+F D +SH+QH + EHM
Sbjct  364   ALRAHHTSSSAKDSFASDILSEALSFSEANGTWRFWLCCRCDEKFTDCDSHMQHAVREHM  423

Query  1626  CSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLENTYTRS  1802
               LSPKLQSVLPQ V+ EW+EML+N +WKP+D + A K LE+ QLKC             
Sbjct  424   GILSPKLQSVLPQEVDGEWIEMLVNGTWKPIDTSVALKFLEEEQLKC--------CTLVK  475

Query  1803  DMDESKDDISDPYCNVYGW------DRSPIKKTFG----DGCNGTTVDSREYDKNSEVWM  1952
             D+D       D +C    W      D SP  +  G    D CNG T++ R  D       
Sbjct  476   DVDPDAGS-KDKHCTSEYWSAREKSDSSPSSQHGGLKDQDACNGFTMEGRNGD-------  527

Query  1953  DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEE  2132
                    +     S+ WP++DD ER+KLLERI  +FQ L+K+K L  SH++KVI FA+EE
Sbjct  528   ------ASNFDDVSQRWPLSDDTERSKLLERIQGMFQLLVKHKSLSVSHVNKVIQFAMEE  581

Query  2133  LQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIS  2312
             +Q    GS LLN+++DQ+P+CICFLGA +L+KILKFLQELS SCGLGRY E+ +   D  
Sbjct  582   IQGFQSGSLLLNHSLDQSPICICFLGALQLRKILKFLQELSQSCGLGRYSEKDSNAGDAD  641

Query  2313  TGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDN  2492
             T  QG + ++ I  S D S LL D      K+      D   +D    SA          
Sbjct  642   TAGQGSEVLDAITLSCDSSNLLLDGRSFSRKIGSGN-ADNYGSDEGTESAP---------  691

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
                 D++ L SW++ G SSG QL++W+R REEK+ Q MEI+R+LEKEFY LQ +CERKCE
Sbjct  692   ----DTNALFSWLYAGPSSGGQLSAWTRMREEKSHQGMEILRMLEKEFYLLQSMCERKCE  747

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HL+YEEALQ VE+LC EE K+REH    V +SY+  L+KR++EL+E  ++    + RFE+
Sbjct  748   HLSYEEALQTVENLCFEELKRREHGGKLVSQSYEAVLRKRQEELVERQNDEMFISSRFEL  807

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             +AIS+VLK+A++LNV+QFG++DT   ++S LCDL+SGEDDDWR+ DYL+Q D+C+  AIQ
Sbjct  808   DAISNVLKEAQALNVSQFGYDDTLSCMTSRLCDLDSGEDDDWRMHDYLHQTDTCIGGAIQ  867

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE +SVEL+KIDA+IMR V+GMQQLE+KL   S  DYR +++PLVKS+LR HLEDL +
Sbjct  868   RQKEQLSVELNKIDAKIMRSVTGMQQLELKLGPASTFDYRTVVLPLVKSFLRLHLEDLVD  927

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DA EKSDAAREAFLAELA D+KK+ N G  ++K ++EK++DKKK KDY+K KD+K  + 
Sbjct  928   KDAAEKSDAAREAFLAELALDAKKNVNKGG-DSKQTNEKSKDKKKNKDYKKAKDIKAVSS  986

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerklee  3569
             N     + +TAE + F  + DG   + E + NG  + + ++EEE R R+ELEAEERKLEE
Sbjct  987   NDQLPFYQETAERSEF--LADGDLFEPEHMING--DHLKKKEEEFRCRVELEAEERKLEE  1042

Query  3570  tleYQRRIENEAKLKHLAEQHK  3635
             TLEYQRRIE+EAK KHLAEQ K
Sbjct  1043  TLEYQRRIEDEAKKKHLAEQFK  1064


 Score =   601 bits (1550),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 282/408 (69%), Positives = 333/408 (82%), Gaps = 25/408 (6%)
 Frame = +1

Query  4000  KKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEM  4179
             K+  G++G +TLR LH E DDEERFQ DL KAVRQSL+  +A            A I+E 
Sbjct  1210  KRKQGDNGTETLRPLHAELDDEERFQEDLKKAVRQSLENDYA------------ASITET  1257

Query  4180  ANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEH  4359
             A+           I    +++GTGLKN VGEYNCFLNVIIQSLWHLRRFRDEFL++SS H
Sbjct  1258  AS-----------IPGRKDIFGTGLKNAVGEYNCFLNVIIQSLWHLRRFRDEFLKTSSMH  1306

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
             +HVG+PCVVCAL+DIF+AL+ AS E +R+AVAP SLRIALSNLYPD   FQE QMNDASE
Sbjct  1307  VHVGNPCVVCALHDIFSALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQMNDASE  1366

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+S+TS+SG  D ES++S+ +G+WDCAN++CIVHSLFGMD++E+MNCY CG
Sbjct  1367  VLAVIFDCLHKSYTSSSGEYDAESLESNSVGAWDCANNSCIVHSLFGMDIYEQMNCYSCG  1426

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             +ESRHLKYTSFFHNINA++LRT K+MC D  FDELL +VEMNHQLACD DA GCGK NHI
Sbjct  1427  MESRHLKYTSFFHNINANSLRTTKIMCPDVCFDELLKIVEMNHQLACDLDAGGCGKSNHI  1486

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH LS+PPHVFTTVLGWQNT ES +DI+ATL A++TE+DI VLYRGLD  SKH LVSVVC
Sbjct  1487  HHILSSPPHVFTTVLGWQNTNESADDISATLAAITTEVDIGVLYRGLDQGSKHSLVSVVC  1546

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YYGQHYHCFAY  +HE+W+MYDD+TVKVIG W DV++MCERGHLQPQV
Sbjct  1547  YYGQHYHCFAY--EHEQWVMYDDQTVKVIGGWDDVISMCERGHLQPQV  1592



>ref|XP_008809577.1| PREDICTED: uncharacterized protein LOC103721233 isoform X2 [Phoenix 
dactylifera]
Length=1584

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1042 (55%), Positives = 738/1042 (71%), Gaps = 67/1042 (6%)
 Frame = +3

Query  573   KLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNVK  752
             K ECERALT+ RRGNH KALRLM+D C +HE+SP   L++RV GTV VKVA+++DD N K
Sbjct  69    KAECERALTAFRRGNHKKALRLMRDACVQHESSP---LLHRVHGTVQVKVAALLDDSNAK  125

Query  753   NRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPID  932
              RHL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ YEEVVQECERAL I +PID
Sbjct  126   LRHLRAAIDSARRAVSLSPSSIEFAHFYANLLYEAATDGRGYEEVVQECERALNILDPID  185

Query  933   PAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEEKFRLIP  1103
             PA+ESLQ E   K+S+PE+RI  V+ ELR LIQ+SN+ASISTW+KN G  +GEEKFRLIP
Sbjct  186   PARESLQDEAAHKLSSPESRIEQVRQELRALIQKSNIASISTWMKNLGGAAGEEKFRLIP  245

Query  1104  IRRMSEDPMELRLV-QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFND-  1277
             +RR+S+DPME+R+V  AR+PNEIKKATKTPEERRKEIEVRVAAARLLQQ S      +D 
Sbjct  246   MRRLSDDPMEVRVVPAARRPNEIKKATKTPEERRKEIEVRVAAARLLQQHSPRPGGEDDA  305

Query  1278  --GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIV  1451
               G+  +  S+G G R  ERRK+ N+RK  SS +R D +R+YWNSMS + +   L + I 
Sbjct  306   RAGDSPVSSSSG-GHRLAERRKA-NSRKPASSTDRMDQIRAYWNSMSIEKRLGFLAVSIP  363

Query  1452  DLKSHF--GSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHM  1625
              L++H    S KD  A+++LSEALSF+EAN  W+FW CC C E+F D +SH+QH + EHM
Sbjct  364   ALRAHHTSSSAKDSFASDILSEALSFSEANGTWRFWLCCRCDEKFTDCDSHMQHAVREHM  423

Query  1626  CSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLENTYTRS  1802
               LSPKLQSVLPQ V+ EW+EML+N +WKP+D + A K LE+ QLKC             
Sbjct  424   GILSPKLQSVLPQEVDGEWIEMLVNGTWKPIDTSVALKFLEEEQLKC--------CTLVK  475

Query  1803  DMDESKDDISDPYCNVYGW------DRSPIKKTFG----DGCNGTTVDSREYDKNSEVWM  1952
             D+D       D +C    W      D SP  +  G    D CNG T++ R  D       
Sbjct  476   DVDPDAGS-KDKHCTSEYWSAREKSDSSPSSQHGGLKDQDACNGFTMEGRNGD-------  527

Query  1953  DRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEE  2132
                    +     S+ WP++DD ER+KLLERI  +FQ L+K+K L  SH++KVI FA+EE
Sbjct  528   ------ASNFDDVSQRWPLSDDTERSKLLERIQGMFQLLVKHKSLSVSHVNKVIQFAMEE  581

Query  2133  LQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDIS  2312
             +Q    GS LLN+++DQ+P+CICFLGA +L+KILKFLQELS SCGLGRY E+ +   D  
Sbjct  582   IQGFQSGSLLLNHSLDQSPICICFLGALQLRKILKFLQELSQSCGLGRYSEKDSNAGDAD  641

Query  2313  TGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDN  2492
             T  QG + ++ I  S D S LL D      K+      D   +D    SA          
Sbjct  642   TAGQGSEVLDAITLSCDSSNLLLDGRSFSRKIGSGN-ADNYGSDEGTESAP---------  691

Query  2493  GGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCE  2672
                 D++ L SW++ G SSG QL++W+R REEK+ Q MEI+R+LEKEFY LQ +CERKCE
Sbjct  692   ----DTNALFSWLYAGPSSGGQLSAWTRMREEKSHQGMEILRMLEKEFYLLQSMCERKCE  747

Query  2673  HLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEI  2852
             HL+YEEALQ VE+LC EE K+REH    V +SY+  L+KR++EL+E  ++    + RFE+
Sbjct  748   HLSYEEALQTVENLCFEELKRREHGGKLVSQSYEAVLRKRQEELVERQNDEMFISSRFEL  807

Query  2853  EAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQ  3032
             +AIS+VLK+A++LNV+QFG++DT   ++S LCDL+SGEDDDWR+ DYL+Q D+C+  AIQ
Sbjct  808   DAISNVLKEAQALNVSQFGYDDTLSCMTSRLCDLDSGEDDDWRMHDYLHQTDTCIGGAIQ  867

Query  3033  RQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAE  3212
             RQKE +SVEL+KIDA+IMR V+GMQQLE+KL   S  DYR +++PLVKS+LR HLEDL +
Sbjct  868   RQKEQLSVELNKIDAKIMRSVTGMQQLELKLGPASTFDYRTVVLPLVKSFLRLHLEDLVD  927

Query  3213  RDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNG  3392
             +DA EKSDAAREAFLAELA D+KK+ N G  ++K ++EK++DKKK KDY+K KD+K  + 
Sbjct  928   KDAAEKSDAAREAFLAELALDAKKNVNKGG-DSKQTNEKSKDKKKNKDYKKAKDIKAVSS  986

Query  3393  NGLHALHHDTAEEASFSVVHDGGSEDAE-LSNGGSNSITQeeeeqrrrieleaeerklee  3569
             N     + +TAE + F  + DG   + E + NG  + + ++EEE R R+ELEAEERKLEE
Sbjct  987   NDQLPFYQETAERSEF--LADGDLFEPEHMING--DHLKKKEEEFRCRVELEAEERKLEE  1042

Query  3570  tleYQRRIENEAKLKHLAEQHK  3635
             TLEYQRRIE+EAK KHLAEQ K
Sbjct  1043  TLEYQRRIEDEAKKKHLAEQFK  1064


 Score =   590 bits (1520),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 276/408 (68%), Positives = 323/408 (79%), Gaps = 40/408 (10%)
 Frame = +1

Query  4000  KKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEM  4179
             K+  G++G +TLR LH E DDEERFQ DL KAVRQSL                       
Sbjct  1210  KRKQGDNGTETLRPLHAELDDEERFQEDLKKAVRQSL-----------------------  1246

Query  4180  ANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEH  4359
                               +++GTGLKN VGEYNCFLNVIIQSLWHLRRFRDEFL++SS H
Sbjct  1247  ---------------GRKDIFGTGLKNAVGEYNCFLNVIIQSLWHLRRFRDEFLKTSSMH  1291

Query  4360  IHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASE  4539
             +HVG+PCVVCAL+DIF+AL+ AS E +R+AVAP SLRIALSNLYPD   FQE QMNDASE
Sbjct  1292  VHVGNPCVVCALHDIFSALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQMNDASE  1351

Query  4540  VLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECG  4719
             VL VIF+CLH+S+TS+SG  D ES++S+ +G+WDCAN++CIVHSLFGMD++E+MNCY CG
Sbjct  1352  VLAVIFDCLHKSYTSSSGEYDAESLESNSVGAWDCANNSCIVHSLFGMDIYEQMNCYSCG  1411

Query  4720  LESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHI  4899
             +ESRHLKYTSFFHNINA++LRT K+MC D  FDELL +VEMNHQLACD DA GCGK NHI
Sbjct  1412  MESRHLKYTSFFHNINANSLRTTKIMCPDVCFDELLKIVEMNHQLACDLDAGGCGKSNHI  1471

Query  4900  HHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVC  5079
             HH LS+PPHVFTTVLGWQNT ES +DI+ATL A++TE+DI VLYRGLD  SKH LVSVVC
Sbjct  1472  HHILSSPPHVFTTVLGWQNTNESADDISATLAAITTEVDIGVLYRGLDQGSKHSLVSVVC  1531

Query  5080  YYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YYGQHYHCFAY  +HE+W+MYDD+TVKVIG W DV++MCERGHLQPQV
Sbjct  1532  YYGQHYHCFAY--EHEQWVMYDDQTVKVIGGWDDVISMCERGHLQPQV  1577



>ref|XP_010907346.1| PREDICTED: uncharacterized protein LOC105034021 isoform X3 [Elaeis 
guineensis]
Length=1516

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/1042 (55%), Positives = 740/1042 (71%), Gaps = 60/1042 (6%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +K ECERALT+LRRGNH KALRLM+D C +HE+SP   L++RV GTV VKVA+++DD 
Sbjct  73    AAVKAECERALTALRRGNHKKALRLMRDACLQHESSP---LLHRVHGTVQVKVAALLDDS  129

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
             N K RHL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ YEEVVQECERAL+I +
Sbjct  130   NAKLRHLRAAIDSARRAVALSPSSIEFAHFYANLLYEAATDGRGYEEVVQECERALSILD  189

Query  924   PIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEEKFR  1094
             PIDPA+ESL  E   K+S+PEARI  V+ ELR LIQ+SN+ASISTW+KN G  +GEEKFR
Sbjct  190   PIDPARESLHDEAAHKLSSPEARIDQVRQELRALIQKSNIASISTWMKNLGGAAGEEKFR  249

Query  1095  LIPIRRMSEDPMELRLVQA-RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             LIP+RR+S+DPME+R+V A R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ+S  +   
Sbjct  250   LIPMRRLSDDPMEVRVVPAARRPNEIKKATKTPEERRKEIEVRVAAARLLQQRSPQSGGE  309

Query  1272  NDGERSLDLSAG----TGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +D  R++D  A      G R  ERRK+ N+RK  SS +R D VR+YW SMS + +   L 
Sbjct  310   DDA-RAVDSPASSSSSIGHRLAERRKA-NSRKPASSTDRVDQVRAYWKSMSIEKRLGFLV  367

Query  1440  IRIVDLKSHFGSL--KDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVI  1613
             + I +L++H+ SL  KD  A+ +LSEALSFAEAN AW+FW CC C E+F D +SH+QHV+
Sbjct  368   VSIPELRAHYASLSPKDSFASGILSEALSFAEANGAWRFWLCCCCDEKFTDCDSHMQHVV  427

Query  1614  NEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLENT  1790
              EHM SL PKLQSVLPQ V+ EW+EML+N SWKP+D + AA++LE+ QLKCR      + 
Sbjct  428   REHMGSLLPKLQSVLPQEVDGEWIEMLVNGSWKPIDASVAAQMLEEEQLKCR------SV  481

Query  1791  YTRSDMDESKDD---ISDPYCNVYGWDRSPIK----KTFGDGCNGTTVDSREYDKNSEVW  1949
                 D+D    D   IS+ +      D SP          D CNG T++ R  D      
Sbjct  482   VKDVDLDTGSKDKHCISEYWSAREKLDSSPSSLRGWSNGQDACNGFTMEGRNGD------  535

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
                     +     S+ WP+ DD ER KLLERI  +FQ L+K+K L  SH++KVI FA+E
Sbjct  536   -------ASNFDDVSQRWPLCDDMERGKLLERIQGMFQLLVKHKSLSVSHVNKVIQFAME  588

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             E+Q    GS LL++++DQ+PLCICFLGA +L+KILKFLQELS SCGLGRY E+ +   D 
Sbjct  589   EIQGFQSGSLLLSHSLDQSPLCICFLGASQLQKILKFLQELSQSCGLGRYSEKDSNAGDA  648

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
                 QG + ++ I  + D S LL D      K+      D   +D    SA         
Sbjct  649   DIAGQGSEVLDAITLNCDSSNLLLDGRSFSGKIGSGN-ADNCGSDEGTESAP--------  699

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                  D++ L SW+F G SSGEQL++W+R R+EK+ Q MEI+R+LEKEF+ LQ +CERKC
Sbjct  700   -----DTNALFSWLFAGPSSGEQLSAWTRMRKEKSHQGMEILRMLEKEFHLLQSMCERKC  754

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             +HL+YEEALQ VE+LC EE K+REH    V +SY+  L+KRR+EL+E  ++    + RFE
Sbjct  755   DHLSYEEALQTVENLCFEELKRREHAGKLVSQSYEAVLRKRREELVERENDEMFISSRFE  814

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+S+VLK+A++LNV QFG++DT   ++S LCDL+SGEDDDWR  DYL+Q D+C+ VAI
Sbjct  815   LDAVSNVLKEAQALNVPQFGYDDTLSCMTSRLCDLDSGEDDDWRTHDYLHQTDTCIGVAI  874

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             QRQKE +SVEL+KIDARIMR V+GMQQLE+KL   S  DYR +++PLVKS+LR HLEDL 
Sbjct  875   QRQKEQLSVELNKIDARIMRSVTGMQQLELKLGPASMFDYRMVVLPLVKSFLRLHLEDLV  934

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             ++DA E+SDAAREAFLAELA D+KK+ N G  + K ++EK++DKKK KDY+K KD K  +
Sbjct  935   DKDAAERSDAAREAFLAELALDAKKNVNKGG-DPKQTNEKSKDKKKNKDYKKAKDTKAVS  993

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
              N     +  TAE++ F  + DG   + E    G + + Q EEE R R+ELEAEE+KLEE
Sbjct  994   SNDQRPFYQKTAEKSEF--LADGDLLEPEHMVTG-DHLKQNEEEFRCRVELEAEEKKLEE  1050

Query  3570  tleYQRRIENEAKLKHLAEQHK  3635
             TLEYQRRIE+EAK KHLAEQ K
Sbjct  1051  TLEYQRRIEDEAKKKHLAEQFK  1072


 Score =   256 bits (654),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 9/189 (5%)
 Frame = +1

Query  4657  CIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLV  4836
             C   S     +  R + +  GL++   +Y  F + I       +++MC DS FDELL +V
Sbjct  1330  CGASSTETASIPSRKDIFGTGLKNAVGEYNCFLNVI-------IQIMCPDSCFDELLKIV  1382

Query  4837  EMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEID  5016
             EMNHQLACDPDARGCGK N+IHH LS+PPHVFTTVLGWQNT ESV+DI+ATL A++ E+D
Sbjct  1383  EMNHQLACDPDARGCGKPNYIHHILSSPPHVFTTVLGWQNTNESVDDISATLAAITIEVD  1442

Query  5017  ISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMC  5196
             I VLYRGLD  SKH LVSVVCYYGQHYHCFA+  +HE+W+MYDD+ VKVIG W DV++MC
Sbjct  1443  IGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAF--EHEQWVMYDDQMVKVIGGWNDVISMC  1500

Query  5197  ERGHLQPQV  5223
             E+GHLQPQV
Sbjct  1501  EKGHLQPQV  1509


 Score = 81.6 bits (200),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 23/96 (24%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++G +TLR LH E DDEERFQADL KAVRQSL+                       + G 
Sbjct  1295  DNGTETLRPLHTELDDEERFQADLKKAVRQSLEN----------------------DCGA  1332

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQ  4302
             S  + A+ I +  +++GTGLKN VGEYNCFLNVIIQ
Sbjct  1333  SSTETAS-IPSRKDIFGTGLKNAVGEYNCFLNVIIQ  1367



>ref|XP_010907345.1| PREDICTED: uncharacterized protein LOC105034021 isoform X2 [Elaeis 
guineensis]
Length=1652

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/1042 (55%), Positives = 740/1042 (71%), Gaps = 60/1042 (6%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +K ECERALT+LRRGNH KALRLM+D C +HE+SP   L++RV GTV VKVA+++DD 
Sbjct  73    AAVKAECERALTALRRGNHKKALRLMRDACLQHESSP---LLHRVHGTVQVKVAALLDDS  129

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
             N K RHL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ YEEVVQECERAL+I +
Sbjct  130   NAKLRHLRAAIDSARRAVALSPSSIEFAHFYANLLYEAATDGRGYEEVVQECERALSILD  189

Query  924   PIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEEKFR  1094
             PIDPA+ESL  E   K+S+PEARI  V+ ELR LIQ+SN+ASISTW+KN G  +GEEKFR
Sbjct  190   PIDPARESLHDEAAHKLSSPEARIDQVRQELRALIQKSNIASISTWMKNLGGAAGEEKFR  249

Query  1095  LIPIRRMSEDPMELRLVQA-RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             LIP+RR+S+DPME+R+V A R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ+S  +   
Sbjct  250   LIPMRRLSDDPMEVRVVPAARRPNEIKKATKTPEERRKEIEVRVAAARLLQQRSPQSGGE  309

Query  1272  NDGERSLDLSAG----TGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +D  R++D  A      G R  ERRK+ N+RK  SS +R D VR+YW SMS + +   L 
Sbjct  310   DDA-RAVDSPASSSSSIGHRLAERRKA-NSRKPASSTDRVDQVRAYWKSMSIEKRLGFLV  367

Query  1440  IRIVDLKSHFGSL--KDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVI  1613
             + I +L++H+ SL  KD  A+ +LSEALSFAEAN AW+FW CC C E+F D +SH+QHV+
Sbjct  368   VSIPELRAHYASLSPKDSFASGILSEALSFAEANGAWRFWLCCCCDEKFTDCDSHMQHVV  427

Query  1614  NEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLENT  1790
              EHM SL PKLQSVLPQ V+ EW+EML+N SWKP+D + AA++LE+ QLKCR      + 
Sbjct  428   REHMGSLLPKLQSVLPQEVDGEWIEMLVNGSWKPIDASVAAQMLEEEQLKCR------SV  481

Query  1791  YTRSDMDESKDD---ISDPYCNVYGWDRSPIK----KTFGDGCNGTTVDSREYDKNSEVW  1949
                 D+D    D   IS+ +      D SP          D CNG T++ R  D      
Sbjct  482   VKDVDLDTGSKDKHCISEYWSAREKLDSSPSSLRGWSNGQDACNGFTMEGRNGD------  535

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
                     +     S+ WP+ DD ER KLLERI  +FQ L+K+K L  SH++KVI FA+E
Sbjct  536   -------ASNFDDVSQRWPLCDDMERGKLLERIQGMFQLLVKHKSLSVSHVNKVIQFAME  588

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             E+Q    GS LL++++DQ+PLCICFLGA +L+KILKFLQELS SCGLGRY E+ +   D 
Sbjct  589   EIQGFQSGSLLLSHSLDQSPLCICFLGASQLQKILKFLQELSQSCGLGRYSEKDSNAGDA  648

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
                 QG + ++ I  + D S LL D      K+      D   +D    SA         
Sbjct  649   DIAGQGSEVLDAITLNCDSSNLLLDGRSFSGKIGSGN-ADNCGSDEGTESAP--------  699

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                  D++ L SW+F G SSGEQL++W+R R+EK+ Q MEI+R+LEKEF+ LQ +CERKC
Sbjct  700   -----DTNALFSWLFAGPSSGEQLSAWTRMRKEKSHQGMEILRMLEKEFHLLQSMCERKC  754

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             +HL+YEEALQ VE+LC EE K+REH    V +SY+  L+KRR+EL+E  ++    + RFE
Sbjct  755   DHLSYEEALQTVENLCFEELKRREHAGKLVSQSYEAVLRKRREELVERENDEMFISSRFE  814

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+S+VLK+A++LNV QFG++DT   ++S LCDL+SGEDDDWR  DYL+Q D+C+ VAI
Sbjct  815   LDAVSNVLKEAQALNVPQFGYDDTLSCMTSRLCDLDSGEDDDWRTHDYLHQTDTCIGVAI  874

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             QRQKE +SVEL+KIDARIMR V+GMQQLE+KL   S  DYR +++PLVKS+LR HLEDL 
Sbjct  875   QRQKEQLSVELNKIDARIMRSVTGMQQLELKLGPASMFDYRMVVLPLVKSFLRLHLEDLV  934

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             ++DA E+SDAAREAFLAELA D+KK+ N G +  K ++EK++DKKK KDY+K KD K  +
Sbjct  935   DKDAAERSDAAREAFLAELALDAKKNVNKGGD-PKQTNEKSKDKKKNKDYKKAKDTKAVS  993

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
              N     +  TAE++ F  + DG   + E    G + + Q EEE R R+ELEAEE+KLEE
Sbjct  994   SNDQRPFYQKTAEKSEF--LADGDLLEPEHMVTG-DHLKQNEEEFRCRVELEAEEKKLEE  1050

Query  3570  tleYQRRIENEAKLKHLAEQHK  3635
             TLEYQRRIE+EAK KHLAEQ K
Sbjct  1051  TLEYQRRIEDEAKKKHLAEQFK  1072


 Score =   554 bits (1428),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 264/382 (69%), Positives = 311/382 (81%), Gaps = 26/382 (7%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++G +TLR LH E DDEERFQADL KAVRQSL+                       + G 
Sbjct  1295  DNGTETLRPLHTELDDEERFQADLKKAVRQSLEN----------------------DCGA  1332

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGD  4374
             S  + A+ I +  +++GTGLKN VGEYNCFLNVIIQSLWHLRRFRDEFL++SS H+HVG+
Sbjct  1333  SSTETAS-IPSRKDIFGTGLKNAVGEYNCFLNVIIQSLWHLRRFRDEFLKTSSMHVHVGN  1391

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PCVVCAL DIFTAL+ AS E +R+AVAP SLRIALSNLYPD   FQE QMNDASEVL VI
Sbjct  1392  PCVVCALDDIFTALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQMNDASEVLAVI  1451

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             F+CLH+S+TS SG  D ES++S+ +GSWDCAN++CIVHSLFGMD++E+MNCY CG+ESRH
Sbjct  1452  FDCLHKSYTS-SGECDAESLESNSVGSWDCANNSCIVHSLFGMDIYEQMNCYSCGMESRH  1510

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINA++LRT K+MC DS FDELL +VEMNHQLACDPDARGCGK N+IHH LS
Sbjct  1511  LKYTSFFHNINANSLRTTKIMCPDSCFDELLKIVEMNHQLACDPDARGCGKPNYIHHILS  1570

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
             +PPHVFTTVLGWQNT ESV+DI+ATL A++ E+DI VLYRGLD  SKH LVSVVCYYGQH
Sbjct  1571  SPPHVFTTVLGWQNTNESVDDISATLAAITIEVDIGVLYRGLDQGSKHSLVSVVCYYGQH  1630

Query  5095  YHCFAYSHDHERWIMYDDKTVK  5160
             YHCFA+  +HE+W+MYDD+ VK
Sbjct  1631  YHCFAF--EHEQWVMYDDQMVK  1650



>ref|XP_010907344.1| PREDICTED: uncharacterized protein LOC105034021 isoform X1 [Elaeis 
guineensis]
Length=1678

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/1042 (55%), Positives = 740/1042 (71%), Gaps = 60/1042 (6%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +K ECERALT+LRRGNH KALRLM+D C +HE+SP   L++RV GTV VKVA+++DD 
Sbjct  73    AAVKAECERALTALRRGNHKKALRLMRDACLQHESSP---LLHRVHGTVQVKVAALLDDS  129

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
             N K RHL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ YEEVVQECERAL+I +
Sbjct  130   NAKLRHLRAAIDSARRAVALSPSSIEFAHFYANLLYEAATDGRGYEEVVQECERALSILD  189

Query  924   PIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG--SGEEKFR  1094
             PIDPA+ESL  E   K+S+PEARI  V+ ELR LIQ+SN+ASISTW+KN G  +GEEKFR
Sbjct  190   PIDPARESLHDEAAHKLSSPEARIDQVRQELRALIQKSNIASISTWMKNLGGAAGEEKFR  249

Query  1095  LIPIRRMSEDPMELRLVQA-RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             LIP+RR+S+DPME+R+V A R+PNEIKKATKTPEERRKEIEVRVAAARLLQQ+S  +   
Sbjct  250   LIPMRRLSDDPMEVRVVPAARRPNEIKKATKTPEERRKEIEVRVAAARLLQQRSPQSGGE  309

Query  1272  NDGERSLDLSAG----TGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +D  R++D  A      G R  ERRK+ N+RK  SS +R D VR+YW SMS + +   L 
Sbjct  310   DDA-RAVDSPASSSSSIGHRLAERRKA-NSRKPASSTDRVDQVRAYWKSMSIEKRLGFLV  367

Query  1440  IRIVDLKSHFGSL--KDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVI  1613
             + I +L++H+ SL  KD  A+ +LSEALSFAEAN AW+FW CC C E+F D +SH+QHV+
Sbjct  368   VSIPELRAHYASLSPKDSFASGILSEALSFAEANGAWRFWLCCCCDEKFTDCDSHMQHVV  427

Query  1614  NEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEK-QLKCRVHGFLENT  1790
              EHM SL PKLQSVLPQ V+ EW+EML+N SWKP+D + AA++LE+ QLKCR      + 
Sbjct  428   REHMGSLLPKLQSVLPQEVDGEWIEMLVNGSWKPIDASVAAQMLEEEQLKCR------SV  481

Query  1791  YTRSDMDESKDD---ISDPYCNVYGWDRSPIK----KTFGDGCNGTTVDSREYDKNSEVW  1949
                 D+D    D   IS+ +      D SP          D CNG T++ R  D      
Sbjct  482   VKDVDLDTGSKDKHCISEYWSAREKLDSSPSSLRGWSNGQDACNGFTMEGRNGD------  535

Query  1950  MDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVE  2129
                     +     S+ WP+ DD ER KLLERI  +FQ L+K+K L  SH++KVI FA+E
Sbjct  536   -------ASNFDDVSQRWPLCDDMERGKLLERIQGMFQLLVKHKSLSVSHVNKVIQFAME  588

Query  2130  ELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDI  2309
             E+Q    GS LL++++DQ+PLCICFLGA +L+KILKFLQELS SCGLGRY E+ +   D 
Sbjct  589   EIQGFQSGSLLLSHSLDQSPLCICFLGASQLQKILKFLQELSQSCGLGRYSEKDSNAGDA  648

Query  2310  STGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCD  2489
                 QG + ++ I  + D S LL D      K+      D   +D    SA         
Sbjct  649   DIAGQGSEVLDAITLNCDSSNLLLDGRSFSGKIGSGN-ADNCGSDEGTESAP--------  699

Query  2490  NGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKC  2669
                  D++ L SW+F G SSGEQL++W+R R+EK+ Q MEI+R+LEKEF+ LQ +CERKC
Sbjct  700   -----DTNALFSWLFAGPSSGEQLSAWTRMRKEKSHQGMEILRMLEKEFHLLQSMCERKC  754

Query  2670  EHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFE  2849
             +HL+YEEALQ VE+LC EE K+REH    V +SY+  L+KRR+EL+E  ++    + RFE
Sbjct  755   DHLSYEEALQTVENLCFEELKRREHAGKLVSQSYEAVLRKRREELVERENDEMFISSRFE  814

Query  2850  IEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAI  3029
             ++A+S+VLK+A++LNV QFG++DT   ++S LCDL+SGEDDDWR  DYL+Q D+C+ VAI
Sbjct  815   LDAVSNVLKEAQALNVPQFGYDDTLSCMTSRLCDLDSGEDDDWRTHDYLHQTDTCIGVAI  874

Query  3030  QRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLA  3209
             QRQKE +SVEL+KIDARIMR V+GMQQLE+KL   S  DYR +++PLVKS+LR HLEDL 
Sbjct  875   QRQKEQLSVELNKIDARIMRSVTGMQQLELKLGPASMFDYRMVVLPLVKSFLRLHLEDLV  934

Query  3210  ERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSN  3389
             ++DA E+SDAAREAFLAELA D+KK+ N G +  K ++EK++DKKK KDY+K KD K  +
Sbjct  935   DKDAAERSDAAREAFLAELALDAKKNVNKGGD-PKQTNEKSKDKKKNKDYKKAKDTKAVS  993

Query  3390  GNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerklee  3569
              N     +  TAE++ F  + DG   + E    G + + Q EEE R R+ELEAEE+KLEE
Sbjct  994   SNDQRPFYQKTAEKSEF--LADGDLLEPEHMVTG-DHLKQNEEEFRCRVELEAEEKKLEE  1050

Query  3570  tleYQRRIENEAKLKHLAEQHK  3635
             TLEYQRRIE+EAK KHLAEQ K
Sbjct  1051  TLEYQRRIEDEAKKKHLAEQFK  1072


 Score =   593 bits (1528),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 330/403 (82%), Gaps = 26/403 (6%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++G +TLR LH E DDEERFQADL KAVRQSL+                       + G 
Sbjct  1295  DNGTETLRPLHTELDDEERFQADLKKAVRQSLEN----------------------DCGA  1332

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGD  4374
             S  + A+ I +  +++GTGLKN VGEYNCFLNVIIQSLWHLRRFRDEFL++SS H+HVG+
Sbjct  1333  SSTETAS-IPSRKDIFGTGLKNAVGEYNCFLNVIIQSLWHLRRFRDEFLKTSSMHVHVGN  1391

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PCVVCAL DIFTAL+ AS E +R+AVAP SLRIALSNLYPD   FQE QMNDASEVL VI
Sbjct  1392  PCVVCALDDIFTALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQMNDASEVLAVI  1451

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             F+CLH+S+TS SG  D ES++S+ +GSWDCAN++CIVHSLFGMD++E+MNCY CG+ESRH
Sbjct  1452  FDCLHKSYTS-SGECDAESLESNSVGSWDCANNSCIVHSLFGMDIYEQMNCYSCGMESRH  1510

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINA++LRT K+MC DS FDELL +VEMNHQLACDPDARGCGK N+IHH LS
Sbjct  1511  LKYTSFFHNINANSLRTTKIMCPDSCFDELLKIVEMNHQLACDPDARGCGKPNYIHHILS  1570

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
             +PPHVFTTVLGWQNT ESV+DI+ATL A++ E+DI VLYRGLD  SKH LVSVVCYYGQH
Sbjct  1571  SPPHVFTTVLGWQNTNESVDDISATLAAITIEVDIGVLYRGLDQGSKHSLVSVVCYYGQH  1630

Query  5095  YHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YHCFA+  +HE+W+MYDD+ VKVIG W DV++MCE+GHLQPQV
Sbjct  1631  YHCFAF--EHEQWVMYDDQMVKVIGGWNDVISMCEKGHLQPQV  1671



>ref|XP_006404318.1| hypothetical protein EUTSA_v10010060mg [Eutrema salsugineum]
 gb|ESQ45771.1| hypothetical protein EUTSA_v10010060mg [Eutrema salsugineum]
Length=1587

 Score =   954 bits (2465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/1040 (55%), Positives = 749/1040 (72%), Gaps = 57/1040 (5%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +KLECE+AL S +RG++NKA+RLMK+ C++H +S   ALI+RVQGT+ VKVAS+ +DP
Sbjct  52    AEVKLECEKALLSFQRGSYNKAIRLMKEACSRHRDS---ALIHRVQGTLYVKVASVFEDP  108

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKE---YEEVVQECERALA  914
               K +HL+NAI+SARK+V +SPNSIEF HFYANLL+EAANDG+E   ++EV+QEC+RAL+
Sbjct  109   ATKQKHLRNAIESARKAVELSPNSIEFGHFYANLLFEAANDGRESIEFDEVLQECQRALS  168

Query  915   IENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKF  1091
             IENPIDPAKESLQ ENQQK+ TPE RIA+VQ EL +LIQ+SNL SISTW+KN G+GEEKF
Sbjct  169   IENPIDPAKESLQDENQQKILTPEGRIANVQDELTSLIQKSNLGSISTWMKNLGNGEEKF  228

Query  1092  RLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
             RLIPIRRM EDP+E  L+Q R+PNEIKKATKT EE+RKEIEVRVAAA+L+QQ+   + S 
Sbjct  229   RLIPIRRMVEDPIESTLIQTRRPNEIKKATKTLEEKRKEIEVRVAAAKLVQQQKSESSSS  288

Query  1272  ND----GERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +       +  D + G GQR  ERRK GNARKN S+ ERRD VRSYW+SMS +MKK+LLR
Sbjct  289   DIVGTVNNKGADPALGAGQRSGERRKHGNARKNGSTAERRDRVRSYWDSMSIEMKKELLR  348

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             +++ DLKSHF + KDG ANEV+SEA+SF EANK W+FW CC C E+F DSESH+QH++ E
Sbjct  349   VKVSDLKSHFSASKDGNANEVISEAMSFCEANKTWRFWVCCRCSEKFMDSESHMQHIVQE  408

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT---  1790
             HM ++ PK+Q VLP+++++E +E+LL+  WKPLD++AA KLL     C  H  ++N+   
Sbjct  409   HMGNVLPKMQMVLPESLDSERIEILLSSPWKPLDLSAAVKLL-----CS-HQKIQNSESS  462

Query  1791  --YTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDG  1964
               ++  +MD+  D   D + ++   D SP K+   D CNG         K S  +   DG
Sbjct  463   EFHSGDNMDDGDDCFKDAWNDI---DTSPEKENLEDTCNG---------KLSVSFHLPDG  510

Query  1965  NEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSL  2144
                         WPI+DD ERAKLL++I   F+ LI++KYL  SH  KVI F ++EL+++
Sbjct  511   ------------WPISDDIERAKLLKKIRAAFELLIRHKYLAVSHHDKVIQFTLDELRNV  558

Query  2145  GYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQ  2324
                SQ LN  + Q+P+CI FLGA +L KILKFLQ+LS +CGL RY E+S   D+++ G +
Sbjct  559   PLVSQFLNRGLGQSPICIFFLGANQLSKILKFLQDLSQACGLSRYSEQSNPNDEVNVGDR  618

Query  2325  GVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLL  2504
             G++  ++I+   + SCLL DE+    +     +    V +    S    +     NG  +
Sbjct  619   GLEVTDEILLDGENSCLLLDENLLGTECIQEKYMSSAVNNGAIASTGNIA-----NGNKV  673

Query  2505  DS--DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHL  2678
              S  D  LSWIF G SS EQ+ SW R++E+K  + +EI+++LEKEF  LQ LCERK EHL
Sbjct  674   SSGADGFLSWIFTGPSSEEQIVSWMRTKEDKTNEGLEIMQILEKEFCHLQNLCERKSEHL  733

Query  2679  NYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEA  2858
             +YE ALQ VEDLCL+E +KRE + +F   SY+  L++RR+EL E+  E    + RFE++A
Sbjct  734   SYEGALQTVEDLCLDESRKRETSAEFTHESYESVLRRRREELNENDLELVFISSRFELDA  793

Query  2859  ISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQ  3038
             I++VLKDAESLN NQFG+E    G SS+L DLESGE D+W +KD LN+ADS +E+AIQ+Q
Sbjct  794   ITNVLKDAESLNHNQFGYE--CAGTSSYLRDLESGEADEWGMKDSLNEADSFIEIAIQKQ  851

Query  3039  KEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERD  3218
             KE +S ELS+IDA+IMR V+GMQQLE+KL +VS++DY  +L+PLVKSY+ AHLE LAE+D
Sbjct  852   KEQLSAELSRIDAQIMRNVTGMQQLELKLGAVSSNDYLLVLLPLVKSYMWAHLEALAEKD  911

Query  3219  ATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNG  3398
             ATEKSDAAREAFL ELA DSK +    ++N+KHS EK++DKKKIKD +K KDLK S GN 
Sbjct  912   ATEKSDAAREAFLVELALDSKDAGR-RNDNSKHSKEKSKDKKKIKDTKKLKDLKASIGND  970

Query  3399  LHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetle  3578
              H  + D+ E +   V   G   +A++      ++ ++EEE RRR+ELE EERKLE TLE
Sbjct  971   -HRCNVDSIEHSLPPVSSCGDHSEADVVPESVEALKKQEEECRRRMELEEEERKLETTLE  1029

Query  3579  YQRRIENEAKLKHLAEQHKK  3638
             YQRRIENEAK KH AEQ KK
Sbjct  1030  YQRRIENEAKEKHSAEQQKK  1049


 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/407 (71%), Positives = 336/407 (83%), Gaps = 8/407 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLG  4191
             G++G KTLRQL  E+D+EERFQADL KAVRQSLD +   + +     SG     E+ N G
Sbjct  1180  GDAGTKTLRQLQAEEDEEERFQADLKKAVRQSLDAYQGGRYMT----SGLRTSVEVNNDG  1235

Query  4192  VSCEDVA--TGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHI  4362
             +   DV   +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH 
Sbjct  1236  L-LSDVTKESQSSTGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLEMFRAEFLRSSTLEHH  1294

Query  4363  HVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEV  4542
             HVGDPCVVC+LY+IFTAL+ ASSET+++ VAP+SLRIALS LYPD   FQE QMNDASEV
Sbjct  1295  HVGDPCVVCSLYEIFTALNGASSETQKEPVAPSSLRIALSKLYPDSSFFQEAQMNDASEV  1354

Query  4543  LGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGL  4722
             L VIF+CLH++F  +S  SD ES++S+C GSWDCAN  CI HSLFGMD+FE++NC  CGL
Sbjct  1355  LAVIFDCLHRAFAQSSSVSDAESLESNCTGSWDCANRTCIAHSLFGMDIFEQLNCNSCGL  1414

Query  4723  ESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIH  4902
             ESRH+KYTSFFHNINASALRTMKV   ++SFDELLNLVEMNHQLACDPDA GCGK NHIH
Sbjct  1415  ESRHMKYTSFFHNINASALRTMKVTFAENSFDELLNLVEMNHQLACDPDAGGCGKPNHIH  1474

Query  4903  HFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCY  5082
             H L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+T IDIS +YRGLDPKS + L SVVCY
Sbjct  1475  HILTTPPHVFTTVLGWQNTCENVEDIAATLAALNTVIDISNIYRGLDPKSTYTLASVVCY  1534

Query  5083  YGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YGQHYHCFAYSH+ +RWIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  1535  YGQHYHCFAYSHEQDRWIMYDDKTVKVIGSWNDVLSMCERGHLQPQV  1581



>ref|XP_009386394.1| PREDICTED: uncharacterized protein LOC103973523 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1643

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/1038 (53%), Positives = 730/1038 (70%), Gaps = 44/1038 (4%)
 Frame = +3

Query  552   SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASI  731
             S+  A++K+ECERALT+LRRGNH KALRLMK+   +HE+S   AL++RV GTV VKVA++
Sbjct  54    SAEAASVKVECERALTALRRGNHTKALRLMKEAAVRHESS---ALLHRVHGTVAVKVAAL  110

Query  732   IDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERAL  911
             +DDP  K RHL+ AIDSAR++V +SP+SIEFAHFYA+LLY+AA DG+ YEEVVQECERAL
Sbjct  111   LDDPGAKLRHLRAAIDSARRAVTLSPSSIEFAHFYASLLYDAATDGRGYEEVVQECERAL  170

Query  912   AIENPIDPAKESL-QENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG---SG  1079
             AI +P+DPAKESL +E+QQK+ST +ARI HVQ ELR LIQ+SN+ASIS+W+KN G   +G
Sbjct  171   AIPDPVDPAKESLHEESQQKLSTSDARITHVQQELRALIQKSNIASISSWMKNLGNGAAG  230

Query  1080  EEKFRLIPIRRMSEDPMELRLVQA-RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  1256
             EE+FRLIP+RR+SEDPME+RLVQA R+PNEIKK TKTPEERRKEIEVRVAAAR++QQK  
Sbjct  231   EERFRLIPMRRISEDPMEVRLVQAARRPNEIKKVTKTPEERRKEIEVRVAAARIIQQKPG  290

Query  1257  SAQSF---NDGERSLDL-SAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             S+      +DG    D   + +  R  ERRK  +++K  SS +R D VR+YWNSMS   +
Sbjct  291   SSPRSPHEDDGRPGSDTPGSSSAHRLAERRKL-SSKKVGSSTDRMDQVRAYWNSMSIKKR  349

Query  1425  KKLLRIRIVDLKSHFGSL-KDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
                L + I +L++H+ S  KD  A ++L EAL+F E N  WKFW CC C E+F + ++HI
Sbjct  350   LGFLIVSIPELRTHYASTAKDNFALDILGEALAFVETNGTWKFWACCRCDEKFTECDAHI  409

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
             QH + EH+ SLS KLQSV+PQ V+ EW+EMLLN SWKP+D  AAA +L+++   R     
Sbjct  410   QHTVREHLSSLSTKLQSVMPQEVDGEWIEMLLNGSWKPIDAAAAAMMLKEEHSKRQPVIR  469

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             +     SD      D S  Y     W       +     +G   D    D ++E  ++ +
Sbjct  470   D---AESDSGSKDKDCSSEY-----WSARENSDSSSSPQHGDLADR---DISNEFPVEGN  518

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
              +E + I   S  WP++DD ER  LLER+  +FQTL+K+K L  SHL+KVI +A+EE+Q+
Sbjct  519   YSEMSDIDDVSRRWPLSDDVERINLLERVQAMFQTLVKHKSLSVSHLNKVIQYAIEEIQA  578

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
                GS  LN+ +DQ+P+CICFL A  L+K+LKFLQELS SCGLGRY E+ TA  D  +  
Sbjct  579   FPSGSLPLNHALDQSPICICFLDASHLRKVLKFLQELSQSCGLGRYSEKDTAAGDADSSG  638

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG +  + +  + D S LL   H +     P + H+    D              D   +
Sbjct  639   QGSEDSDDVCLTFDSSSLLL--HGRSFTQKPGSHHENSGNDD-------------DKDSM  683

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D+D  LSW+F G S+G+QL++W+R REEK+ Q +EI+++LEKEFY LQ LCERKCEHL+
Sbjct  684   PDADAFLSWLFAGPSNGDQLSAWTRMREEKSHQGIEILQMLEKEFYLLQSLCERKCEHLS  743

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ +E+LC EE KKRE    F  +SY+  L+KR++EL+E  ++      R E++ I
Sbjct  744   YEEALQSIENLCFEELKKREQAGKFASQSYEATLRKRQEELVERENDEIFNACRLELDVI  803

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLK+A++LNV+QFG ++   G+SS LC+L+  E DDWRV DYL Q D+CV +AIQRQK
Sbjct  804   SNVLKEAQALNVSQFGCDEALSGVSSRLCELDCDEGDDWRVHDYLQQTDTCVGIAIQRQK  863

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +SVEL+KIDARIMR ++GMQQLE KL    A DYR +L+PLVKS+LR  LE L ++DA
Sbjct  864   EQLSVELNKIDARIMRNMTGMQQLEAKLGPALAFDYRTVLLPLVKSFLRLCLESLVDKDA  923

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             TEKSDAAREAFLAELA D+KK+ N G+ ++KH+HEK+RDKKK +DYRK KD K    +  
Sbjct  924   TEKSDAAREAFLAELALDAKKNINRGN-DSKHAHEKSRDKKKNRDYRKIKDQKALGYSDQ  982

Query  3402  HALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleY  3581
             ++ H DTAE++ F  + DG   + +    G + + Q+EEE + R+ELEAEERKLEETLEY
Sbjct  983   YSDHQDTAEQSEF--LDDGDILEHDYVASG-DYLKQQEEELKLRVELEAEERKLEETLEY  1039

Query  3582  QRRIENEAKLKHLAEQHK  3635
             QRRIE+EAK KHLAEQ K
Sbjct  1040  QRRIEDEAKQKHLAEQLK  1057


 Score =   542 bits (1396),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 310/405 (77%), Gaps = 24/405 (6%)
 Frame = +1

Query  4009  AGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANL  4188
             AG++  KTLRQLH E+DDE+RFQ DL KAVR+SL                     E  + 
Sbjct  1256  AGDNEVKTLRQLHTEEDDEQRFQEDLKKAVRESL---------------------EGDDY  1294

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHV  4368
              VS  +  + + +  ++ GTGL+N VGEYNCFLNVIIQSLWHLRRFR++FL+ SS H+HV
Sbjct  1295  CVSATESGS-VSSRKDIVGTGLRNAVGEYNCFLNVIIQSLWHLRRFREQFLKMSSAHVHV  1353

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALYDIF  L  A  +   DAVAP SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1354  GNPCVVCALYDIFLDLRKAFDDGPNDAVAPTSLRIALSNLYPDSKFFQEAQMNDASEVLA  1413

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF   SG  D ES +S+ +GSWDCANS+CI HSLFGMD+ E+MNCY C  ++
Sbjct  1414  VIFDCLHKSFNIFSGDCDVESYESNSVGSWDCANSSCIAHSLFGMDIDEQMNCYSCHCQT  1473

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINA++LRT K+MC +SSFDELL  VEMNHQL+CD +A GCGK N+++H 
Sbjct  1474  RHLKYTSFFHNINANSLRTAKIMCPESSFDELLKTVEMNHQLSCDVEAGGCGKPNYMNHI  1533

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LS PPHVFT VLGWQ+T ES +DI+ATL A++T++DI +LY G+D   KH LVSVVCYYG
Sbjct  1534  LSHPPHVFTAVLGWQSTNESADDISATLAAITTDVDIGILYCGIDKGCKHSLVSVVCYYG  1593

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAY  D  +W+MYDD+TVKVIG W DVLTMCERGHLQPQV
Sbjct  1594  QHYHCFAYECD--QWVMYDDQTVKVIGGWNDVLTMCERGHLQPQV  1636



>ref|XP_009386389.1| PREDICTED: uncharacterized protein LOC103973523 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1646

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/1038 (53%), Positives = 730/1038 (70%), Gaps = 44/1038 (4%)
 Frame = +3

Query  552   SSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASI  731
             S+  A++K+ECERALT+LRRGNH KALRLMK+   +HE+S   AL++RV GTV VKVA++
Sbjct  54    SAEAASVKVECERALTALRRGNHTKALRLMKEAAVRHESS---ALLHRVHGTVAVKVAAL  110

Query  732   IDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERAL  911
             +DDP  K RHL+ AIDSAR++V +SP+SIEFAHFYA+LLY+AA DG+ YEEVVQECERAL
Sbjct  111   LDDPGAKLRHLRAAIDSARRAVTLSPSSIEFAHFYASLLYDAATDGRGYEEVVQECERAL  170

Query  912   AIENPIDPAKESL-QENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG---SG  1079
             AI +P+DPAKESL +E+QQK+ST +ARI HVQ ELR LIQ+SN+ASIS+W+KN G   +G
Sbjct  171   AIPDPVDPAKESLHEESQQKLSTSDARITHVQQELRALIQKSNIASISSWMKNLGNGAAG  230

Query  1080  EEKFRLIPIRRMSEDPMELRLVQA-RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE  1256
             EE+FRLIP+RR+SEDPME+RLVQA R+PNEIKK TKTPEERRKEIEVRVAAAR++QQK  
Sbjct  231   EERFRLIPMRRISEDPMEVRLVQAARRPNEIKKVTKTPEERRKEIEVRVAAARIIQQKPG  290

Query  1257  SAQSF---NDGERSLDL-SAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMK  1424
             S+      +DG    D   + +  R  ERRK  +++K  SS +R D VR+YWNSMS   +
Sbjct  291   SSPRSPHEDDGRPGSDTPGSSSAHRLAERRKL-SSKKVGSSTDRMDQVRAYWNSMSIKKR  349

Query  1425  KKLLRIRIVDLKSHFGSL-KDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHI  1601
                L + I +L++H+ S  KD  A ++L EAL+F E N  WKFW CC C E+F + ++HI
Sbjct  350   LGFLIVSIPELRTHYASTAKDNFALDILGEALAFVETNGTWKFWACCRCDEKFTECDAHI  409

Query  1602  QHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFL  1781
             QH + EH+ SLS KLQSV+PQ V+ EW+EMLLN SWKP+D  AAA +L+++   R     
Sbjct  410   QHTVREHLSSLSTKLQSVMPQEVDGEWIEMLLNGSWKPIDAAAAAMMLKEEHSKRQPVIR  469

Query  1782  ENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRD  1961
             +     SD      D S  Y     W       +     +G   D    D ++E  ++ +
Sbjct  470   D---AESDSGSKDKDCSSEY-----WSARENSDSSSSPQHGDLADR---DISNEFPVEGN  518

Query  1962  GNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS  2141
              +E + I   S  WP++DD ER  LLER+  +FQTL+K+K L  SHL+KVI +A+EE+Q+
Sbjct  519   YSEMSDIDDVSRRWPLSDDVERINLLERVQAMFQTLVKHKSLSVSHLNKVIQYAIEEIQA  578

Query  2142  LGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGI  2321
                GS  LN+ +DQ+P+CICFL A  L+K+LKFLQELS SCGLGRY E+ TA  D  +  
Sbjct  579   FPSGSLPLNHALDQSPICICFLDASHLRKVLKFLQELSQSCGLGRYSEKDTAAGDADSSG  638

Query  2322  QGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGL  2501
             QG +  + +  + D S LL   H +     P + H+    D              D   +
Sbjct  639   QGSEDSDDVCLTFDSSSLLL--HGRSFTQKPGSHHENSGNDD-------------DKDSM  683

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D+D  LSW+F G S+G+QL++W+R REEK+ Q +EI+++LEKEFY LQ LCERKCEHL+
Sbjct  684   PDADAFLSWLFAGPSNGDQLSAWTRMREEKSHQGIEILQMLEKEFYLLQSLCERKCEHLS  743

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEALQ +E+LC EE KKRE    F  +SY+  L+KR++EL+E  ++      R E++ I
Sbjct  744   YEEALQSIENLCFEELKKREQAGKFASQSYEATLRKRQEELVERENDEIFNACRLELDVI  803

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLK+A++LNV+QFG ++   G+SS LC+L+  E DDWRV DYL Q D+CV +AIQRQK
Sbjct  804   SNVLKEAQALNVSQFGCDEALSGVSSRLCELDCDEGDDWRVHDYLQQTDTCVGIAIQRQK  863

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +SVEL+KIDARIMR ++GMQQLE KL    A DYR +L+PLVKS+LR  LE L ++DA
Sbjct  864   EQLSVELNKIDARIMRNMTGMQQLEAKLGPALAFDYRTVLLPLVKSFLRLCLESLVDKDA  923

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
             TEKSDAAREAFLAELA D+KK+ N G+ ++KH+HEK+RDKKK +DYRK KD K    +  
Sbjct  924   TEKSDAAREAFLAELALDAKKNINRGN-DSKHAHEKSRDKKKNRDYRKIKDQKALGYSDQ  982

Query  3402  HALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleY  3581
             ++ H DTAE++ F  + DG   + +    G + + Q+EEE + R+ELEAEERKLEETLEY
Sbjct  983   YSDHQDTAEQSEF--LDDGDILEHDYVASG-DYLKQQEEELKLRVELEAEERKLEETLEY  1039

Query  3582  QRRIENEAKLKHLAEQHK  3635
             QRRIE+EAK KHLAEQ K
Sbjct  1040  QRRIEDEAKQKHLAEQLK  1057


 Score =   545 bits (1404),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 259/405 (64%), Positives = 309/405 (76%), Gaps = 21/405 (5%)
 Frame = +1

Query  4009  AGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANL  4188
             AG++  KTLRQLH E+DDE+RFQ DL KAVR+SL++            SG+         
Sbjct  1256  AGDNEVKTLRQLHTEEDDEQRFQEDLKKAVRESLESTEGDDYCVSATESGS---------  1306

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHV  4368
                       + +  ++ GTGL+N VGEYNCFLNVIIQSLWHLRRFR++FL+ SS H+HV
Sbjct  1307  ----------VSSRKDIVGTGLRNAVGEYNCFLNVIIQSLWHLRRFREQFLKMSSAHVHV  1356

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALYDIF  L  A  +   DAVAP SLRIALSNLYPD   FQE QMNDASEVL 
Sbjct  1357  GNPCVVCALYDIFLDLRKAFDDGPNDAVAPTSLRIALSNLYPDSKFFQEAQMNDASEVLA  1416

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLH+SF   SG  D ES +S+ +GSWDCANS+CI HSLFGMD+ E+MNCY C  ++
Sbjct  1417  VIFDCLHKSFNIFSGDCDVESYESNSVGSWDCANSSCIAHSLFGMDIDEQMNCYSCHCQT  1476

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINA++LRT K+MC +SSFDELL  VEMNHQL+CD +A GCGK N+++H 
Sbjct  1477  RHLKYTSFFHNINANSLRTAKIMCPESSFDELLKTVEMNHQLSCDVEAGGCGKPNYMNHI  1536

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LS PPHVFT VLGWQ+T ES +DI+ATL A++T++DI +LY G+D   KH LVSVVCYYG
Sbjct  1537  LSHPPHVFTAVLGWQSTNESADDISATLAAITTDVDIGILYCGIDKGCKHSLVSVVCYYG  1596

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAY  D  +W+MYDD+TVKVIG W DVLTMCERGHLQPQV
Sbjct  1597  QHYHCFAYECD--QWVMYDDQTVKVIGGWNDVLTMCERGHLQPQV  1639



>ref|XP_008374916.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103438156 
[Malus domestica]
Length=1784

 Score =   569 bits (1466),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 307/477 (64%), Positives = 357/477 (75%), Gaps = 38/477 (8%)
 Frame = +1

Query  3745  ELLQSNGSP--LEGHPKN-----------STVSDIHKA----GFSNGGFLE-DGALTSDr  3870
             +L Q  G P  LEG P N           ST S  H+A    G +NGG +E DG L SDR
Sbjct  1317  QLTQKTGFPNNLEGLPVNMANGSAVPANSSTASGAHQAKVNQGXANGGIVEEDGCLPSDR  1376

Query  3871  ragrrsrrqkgsakYNEEKCPPVTSGAENIEVGEVRPVDDSLEKKH-----AGESGPKTL  4035
             R GR++RRQ+ S K  + K   +++G EN+EVG       S+E  H        +G + L
Sbjct  1377  RTGRKNRRQRSSTKVPDGKSQGLSTGNENVEVGR-----SSVEGSHDNLLMNNHNGIQEL  1431

Query  4036  RQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLI-----PRSGTAQISEMANLGVSC  4200
             RQ   E+DDEERFQADL KAVRQSLDTF   QK P++     PR    +IS   + GV  
Sbjct  1432  RQKRAEEDDEERFQADLKKAVRQSLDTFQERQKFPVVSNLRMPR----KISADVDNGVLH  1487

Query  4201  EDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDP  4377
              D+     +  +++GTGLKNEVGEYNCFLNVIIQSLWH+R FRDE+LR S+SEH HVGDP
Sbjct  1488  NDITNENASETDIFGTGLKNEVGEYNCFLNVIIQSLWHVRLFRDEYLRXSTSEHGHVGDP  1547

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             CVVCALY+IFTALS AS++TRR+AVAP SLRIALSNLYP+   FQE QMNDASEVL VIF
Sbjct  1548  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQMNDASEVLVVIF  1607

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
             +CLH+SFT  S  S+ ESV+SSC GSWDC+N+AC+VHS+FGMD+FERMNCY CGLESRHL
Sbjct  1608  DCLHRSFTPGSSLSNAESVESSCPGSWDCSNNACMVHSIFGMDIFERMNCYYCGLESRHL  1667

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINASALRTMKVMC +SS+DELLN VEMNHQLACDP+A GCGK NHIHH L+T
Sbjct  1668  KYTSFFHNINASALRTMKVMCTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILTT  1727

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             PPHVFTTVLGWQ TCES +DI ATL AL+TEIDISVLYRGLDPK+ H LVSVVC +G
Sbjct  1728  PPHVFTTVLGWQKTCESADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCMFG  1784


 Score =   508 bits (1309),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 325/543 (60%), Positives = 406/543 (75%), Gaps = 15/543 (3%)
 Frame = +3

Query  2031  KLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLG  2210
             KLLERI+ +F+ LI++KYL +SHL++VI F ++ELQ+    SQLLN+ ++QTP+CI FLG
Sbjct  753   KLLERIHALFEVLIRHKYLAASHLNRVIQFTMDELQA--SCSQLLNHGVEQTPMCIXFLG  810

Query  2211  APELKKILKFLQELSHSCGLGRYPER-STAIDDISTGIQGVDAMEKIVFSEDGSCLLFDE  2387
             A +L+KILKFLQ+LSH+CGLGRY ++ S   DD ++  +GV+  E+IV + D SCL+ DE
Sbjct  811   ATQLRKILKFLQDLSHACGLGRYSDKGSIPADDANSTNKGVEIKERIVLNGDASCLILDE  870

Query  2388  HFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTS  2567
                  + T    H   V+D+ P +   +      NG   DSD LLSWIF G +SGEQLTS
Sbjct  871   SLLSSECTCDVGHL-TVSDAAPAAVVGN-----GNGVPPDSDALLSWIFAGPTSGEQLTS  924

Query  2568  WSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHT  2747
             W  ++EEK QQ MEI+++LEKEFY+LQ LCERKCEHL+YEEALQ VEDLC+EEGKKRE+ 
Sbjct  925   WVHAKEEKTQQGMEILQMLEKEFYDLQSLCERKCEHLSYEEALQAVEDLCIEEGKKRENV  984

Query  2748  IDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYG  2927
              +F  RS++  L+KRR+EL+E  ++    + R E++AIS+VLK+ E+LN+NQFG+E+TYG
Sbjct  985   TEFGHRSFESVLRKRREELLERENDVMFLSNRIELDAISNVLKEYEALNINQFGYEETYG  1044

Query  2928  GISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQ  3107
              ++S L DLE G DDDWR KDY +Q D CVEVAI+RQKE + VELSKID RIMR V+GMQ
Sbjct  1045  RVTSQLFDLEYGXDDDWRAKDYAHQVDXCVEVAIRRQKEQLYVELSKIDVRIMRNVTGMQ  1104

Query  3108  QLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKS  3287
             QLEVKLE VSAHDYR IL+PLVKSYLRAHLEDLAE DATEKSDAAREAFLAELA DSKK 
Sbjct  1105  QLEVKLEPVSAHDYRSILLPLVKSYLRAHLEDLAEXDATEKSDAAREAFLAELALDSKKG  1164

Query  3288  SNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSE  3467
                 ++N +H+ EKT+DKKK K++RK KD KG NG      HHD   E +F    DG   
Sbjct  1165  VRGENDNLRHTQEKTKDKKKNKEFRKAKDSKG-NGVSDEYFHHDETSELTFPEASDGELP  1223

Query  3468  DAEL---SNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             D EL    NG  N + Q+EEE +RRIELE EERKLEETLEYQR+IE EAK KHLAEQ+KK
Sbjct  1224  DPELVISVNG--NDLKQQEEECKRRIELEEEERKLEETLEYQRQIEKEAKQKHLAEQNKK  1281

Query  3639  GAR  3647
               +
Sbjct  1282  STQ  1284



>ref|XP_006841144.1| hypothetical protein AMTR_s00086p00132870 [Amborella trichopoda]
 gb|ERN02819.1| hypothetical protein AMTR_s00086p00132870 [Amborella trichopoda]
Length=1702

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/1057 (50%), Positives = 728/1057 (69%), Gaps = 69/1057 (7%)
 Frame = +3

Query  537   SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
             SE + +S  +++K +CERAL +LRRGNH KALRLM+D C+K+   P+ AL++RVQGT+ V
Sbjct  49    SEVSITSPNSSVKADCERALMALRRGNHTKALRLMRDSCSKN---PDSALLHRVQGTIFV  105

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             K+AS+I+DPN K ++LKNA++SA+K+V++SP SIEFAHFYANLLYEA++D K++EEVVQE
Sbjct  106   KIASLIEDPNSKQKNLKNALESAKKAVILSPGSIEFAHFYANLLYEASSDTKDFEEVVQE  165

Query  897   CERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             CERAL+IENPIDP KE+LQE +QQK+STP ARIAHVQ ELR+L+Q++N+ASIS W+KN G
Sbjct  166   CERALSIENPIDPGKENLQEESQQKLSTPGARIAHVQQELRSLVQKANIASISAWMKNLG  225

Query  1074  --SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQ  1247
               SGEEKFRLIP+RR+SEDPME+R+  +R+PNEIKK TKT E+RRKEIEVR+AAARLLQQ
Sbjct  226   NGSGEEKFRLIPMRRLSEDPMEVRVSPSRRPNEIKKITKTEEDRRKEIEVRIAAARLLQQ  285

Query  1248  KSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARK--NVSSMERRDCVRSYWNSMSTD-  1418
                S+     G  SL     +    + RR+ G+ RK  N   ++R D  R YW +M  D 
Sbjct  286   TPLSSSLQEKGGESL----SSSDNHHPRRRPGSNRKSSNAVGLDRMDQFRVYWGTMGPDR  341

Query  1419  MKKKLLRIRIVDLK---SHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADS  1589
             ++++ L + I DL+   S   S +DGL+ ++LSE+ SF +ANK W FW CC C E+F D+
Sbjct  342   IRREFLMVDIGDLRDYCSASSSSRDGLSMDLLSESFSFFQANKTWVFWVCCQCNEKFVDA  401

Query  1590  ESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQ---LK  1760
             + H+QHV+ EHM +LSPKLQ +LPQ V+N  VE LL+ SW+P+D +AA KL+        
Sbjct  402   DVHLQHVVREHMRNLSPKLQMILPQEVDNILVEQLLHGSWRPVDTHAAIKLVTTTSGFKD  461

Query  1761  CRV-HGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIK------KTFGDGCNG-TTVD  1916
             C +  G +    TR   DE+   +  P      W            +T G+G N   T+ 
Sbjct  462   CSLGDGTIAEEDTRGYEDENGSAMCIPSSPEAVWREGTSNSGVVSSETLGEGTNCERTLS  521

Query  1917  SREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSS  2096
               E+ +    W      E   +    E+WP++DD ER KLLERI+ +FQ L+  K L + 
Sbjct  522   EIEHGR----WSHSSSKEALAV----ENWPLSDDAERLKLLERIHGMFQVLLMYKCLAAG  573

Query  2097  HLSKVIHFAVEELQSLGYGSQLLNYN-IDQTPLCICFLGAPELKKILKFLQELSHSCGLG  2273
              L KVI + ++ELQ +     + N   I +TPLCICFL   +L+K+LKFLQELSHSCGLG
Sbjct  574   QLHKVIQYTLDELQGI-----MPNVAAICETPLCICFLDVAQLQKVLKFLQELSHSCGLG  628

Query  2274  RYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnp  2453
             R  +++ + ++ +   +G    E+I F  D SCLL D+               + TD   
Sbjct  629   RNSDKNNSSEEGADVGEGERITERIEF--DSSCLLLDDQL-------------LKTDVGK  673

Query  2454  nsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKE  2633
             N    S      +GG   SD LLSWIFMG S GEQ   W R R EKA++ +E++++LEKE
Sbjct  674   NDERES------SGG---SDALLSWIFMGPSYGEQHLKWVRLRGEKARRGIELLQMLEKE  724

Query  2634  FYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKRE-HTIDFVRRSYDIALKKRRDELME  2810
             F  L+ LC+RKCEHL+YEEAL  VE L +EE K+RE H      R+Y+  L++R++EL+E
Sbjct  725   FDLLESLCKRKCEHLDYEEALNTVECLRVEEFKRREEHVTKLGSRTYEALLRRRQEELIE  784

Query  2811  SHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKD  2990
               ++      + E++AI+++LK+A++L++ QFG+++T  G++S L DL+  +D++WR++D
Sbjct  785   RENDLPCN--KIELDAIANILKEAQALSMTQFGYDETLSGVTSRLSDLDCADDEEWRMQD  842

Query  2991  YLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPL  3170
             +L+Q DSC+EVAIQRQKEH+S+ELSKIDA+IMR VSGMQQLE+KL  VS  DYR +++PL
Sbjct  843   FLHQPDSCIEVAIQRQKEHLSLELSKIDAKIMRNVSGMQQLEIKLGQVSCLDYRAVILPL  902

Query  3171  VKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkki  3350
             +KS+LRAHLE+L ++DATEKSDAAREAFL ELAR++KK++N G +  K   +K++DKKK 
Sbjct  903   IKSFLRAHLEELVDKDATEKSDAAREAFLTELAREAKKNTNSGGDFTKQVQDKSKDKKKN  962

Query  3351  kdyrktkdlkGSNGNGLHALHHDTAEEASF-SVVHDGGSEDAELSNGGSNSITQeeeeqr  3527
             KDYR++K+ KG   N  H L  +T+++ +F   V D   E   +    ++   Q+EEE +
Sbjct  963   KDYRRSKEFKGPAVNEQHVLQRETSDKFNFVDAVADDRQESEVIDAVTADDSKQQEEEFK  1022

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             R+IELEAEERKLEETLEYQRRIE EAK KHLAEQHK+
Sbjct  1023  RQIELEAEERKLEETLEYQRRIEEEAKQKHLAEQHKR  1059


 Score =   603 bits (1556),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 335/418 (80%), Gaps = 2/418 (0%)
 Frame = +1

Query  3973  VRPVDDSLEKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPR  4152
              R VD +L      E+G KTLRQLH E+DDEERFQADL KAVRQSLD + AH  LPL   
Sbjct  1279  TRVVDPNLSCGGDKENGIKTLRQLHAEEDDEERFQADLQKAVRQSLDIYQAHHGLPLPGG  1338

Query  4153  SGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRD  4332
                  + +M  + +       G++N  +V GTGL+NEVGEYNCFLNVIIQSLWH+RRFRD
Sbjct  1339  QSKRVLKQMDGIEIVPNGARVGVLNQSDVIGTGLQNEVGEYNCFLNVIIQSLWHIRRFRD  1398

Query  4333  EFL-RSSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLF  4509
             EFL + SS H+HVGDPCVVCAL+ IFT++S+AS+E R++ VAP  LR+ALSNLYPD   F
Sbjct  1399  EFLGKPSSLHVHVGDPCVVCALHYIFTSMSVASAEMRKETVAPTCLRVALSNLYPDSNFF  1458

Query  4510  QEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDV  4689
             QE QMNDASEVL VIF+CLH S TS S  SD ES + SCMGSWDCA+S C+ H+LFGMD+
Sbjct  1459  QEAQMNDASEVLAVIFDCLHGSSTSGSTFSDAES-EGSCMGSWDCASSTCVAHTLFGMDI  1517

Query  4690  FERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPD  4869
             +E+MNC  CGLESRHLKYTSFFHNINA+ALRTMK+ C D+S D LL LVEMNHQLACDP+
Sbjct  1518  YEQMNCSGCGLESRHLKYTSFFHNINANALRTMKITCSDNSLDMLLKLVEMNHQLACDPE  1577

Query  4870  ARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPK  5049
             A GCG+ N+IHH LS PPHVFT VLGWQNT ES++DI+ATL AL+TE+DI V+YRGL+  
Sbjct  1578  AGGCGRLNYIHHILSAPPHVFTIVLGWQNTSESLDDISATLAALTTELDIGVIYRGLEEG  1637

Query  5050  SKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             +KHC+VSVVCYYGQHYHCFAYSH+HE+WIMYDDKTVK++G W  VL  C+RGHLQPQV
Sbjct  1638  NKHCIVSVVCYYGQHYHCFAYSHEHEKWIMYDDKTVKLVGGWNQVLDTCQRGHLQPQV  1695



>gb|KHN48649.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Glycine soja]
Length=1452

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/959 (53%), Positives = 662/959 (69%), Gaps = 73/959 (8%)
 Frame = +3

Query  807   PNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPIDPAKESLQ-ENQQKVSTPE  983
             PNS+E+AHF A ++ EAA++GK+YEEVV ECER LAIENP DPAKE+LQ E++QK S+ E
Sbjct  2     PNSVEYAHFRATVMLEAASEGKDYEEVVHECERGLAIENPSDPAKETLQDESEQKASSLE  61

Query  984   ARIAHVQGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPN  1163
              RIAHVQ ELR LIQ+SN+AS+S+W+KN  +GEE+FRLIPIRR  EDPME+RLVQ R+PN
Sbjct  62    ERIAHVQNELRQLIQKSNIASLSSWMKNLSNGEERFRLIPIRRTPEDPMEVRLVQTRRPN  121

Query  1164  EIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGER---SLDLSAGTGQRGNERR  1334
             EIKK TKTPEERRKEIEVRVAAARL+Q+ SES QS N+G+R    LD SAG+GQR  +RR
Sbjct  122   EIKKVTKTPEERRKEIEVRVAAARLIQKNSESPQSANEGDRDDRQLDSSAGSGQRIGDRR  181

Query  1335  KSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEA  1514
             + GN RK+  S ER   V SYWNS+S DMKK  LR++I DLKSH+GS KD L N++LSEA
Sbjct  182   RHGNVRKSGFSAERMKWVHSYWNSVSMDMKKDFLRVKIYDLKSHYGSSKDTLPNDILSEA  241

Query  1515  LSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEML  1694
             L +A ANK WKFW CC+C E+ ++ +SH  HV+ EHM SLSP++Q +LP NV++EW+EM+
Sbjct  242   LFYAGANKTWKFWPCCNCEEKHSNPDSHRHHVVQEHMGSLSPQMQRLLPHNVDSEWIEMI  301

Query  1695  LNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRS---DMDESKDDISDPYCNVYGWDR  1865
             LNCSWKPLDI AA ++L  + K +     E+ Y      D ++   D S  Y        
Sbjct  302   LNCSWKPLDILAAVRMLYNKAKFKSSSLPEDLYLDHHALDYNDCFKDASSSYIE------  355

Query  1866  SPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTK-----ICPPSESWPIADDPERA  2030
                K++ GD     +V+   + K     ++ D  EG +       P  + WP++DDPERA
Sbjct  356   ---KESSGDSLPNCSVECNNHYK----IIENDVREGVEDQLSMANPIIDCWPVSDDPERA  408

Query  2031  KLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLG  2210
             KLL +I+ +F+TLIK+K L +SHL+KVI F + E+Q L  GSQLLN+ +DQTP+C+CFLG
Sbjct  409   KLLGKIHAIFETLIKHKCLAASHLNKVIQFTMGEIQGLAAGSQLLNHGVDQTPMCMCFLG  468

Query  2211  APELKKILKFLQELSHSCGLGRYPER-STAIDDISTGIQGVDAMEKIVFSEDGSCLLFDE  2387
             A +LK I +FLQE+SH+CGL R  ++  +  +D+    QG +  +KIV   D SCLL DE
Sbjct  469   ATQLKTIFQFLQEISHACGLARNADKGGSPTNDLLNISQGPEIKDKIVLDGDASCLLLDE  528

Query  2388  HFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTS  2567
                  ++T  T    V+ D    S+         +G    +D LLSWIF  +  G+Q  +
Sbjct  529   CLLQTQVTAGTVQGTVLDDVTTPSSP--------DGISCYNDALLSWIFSCSPIGDQ--A  578

Query  2568  WSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHT  2747
             + RS                                  YEEALQ VEDLCLEEGKKRE  
Sbjct  579   YVRS----------------------------------YEEALQTVEDLCLEEGKKRETV  604

Query  2748  IDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYG  2927
              +FV+RSY+  L+KRR+EL+ES ++    + RFE++AIS+VL++AE+ NVNQFG+++TY 
Sbjct  605   GEFVQRSYESVLRKRREELIESENDMMYVSNRFELDAISNVLQEAEARNVNQFGYDETYA  664

Query  2928  GISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQ  3107
             G++S LCDLESGE+D+WR+KDYL+Q D C+E AIQ+ KEH+S+ELSKIDARI+R V+ MQ
Sbjct  665   GVTSQLCDLESGEEDEWRMKDYLHQMDGCIENAIQKLKEHLSIELSKIDARIIRSVTEMQ  724

Query  3108  QLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKS  3287
             QLE KL  +SA+DYR ILVPLVKSYLRA L+DLAE+DA EKSDA  EA LAE+A DSKK+
Sbjct  725   QLEFKLGPISANDYRAILVPLVKSYLRALLDDLAEKDAREKSDAVSEALLAEIALDSKKA  784

Query  3288  SNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSE  3467
                GSE+ +H  EKT+DKKK KD+RK +DLK ++G+   +L   T +  S  V  +    
Sbjct  785   VKGGSESTRHV-EKTKDKKKNKDHRKARDLKVASGHAQFSLGSTTPD--SNLVAPESDFP  841

Query  3468  DAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKKGA  3644
             D E+     + + Q EEE RR+IELE EE+KLEETLE+QRRIENEAK KHLAEQ KK +
Sbjct  842   DNEVVAMNDDDLEQLEEEFRRKIELEEEEKKLEETLEFQRRIENEAKQKHLAEQQKKSS  900


 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/444 (69%), Positives = 345/444 (78%), Gaps = 11/444 (2%)
 Frame = +1

Query  3925  KCPPVTSGAENIE-------VGEVRPVDDSLEKKHAGES-GPKTLRQLHVEDDDEERFQA  4080
             K  PV+SG ENIE       + E   ++ + +  +  ++ G K + +L VED +EERFQA
Sbjct  1002  KFEPVSSGQENIEDTHTDYHLREQFKLNSNQDVNNVWQNNGSKVMGELQVEDAEEERFQA  1061

Query  4081  DLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDV--ATGIVNGIEVYGTGL  4254
             DL  AVRQSLDT+ A   L  +      Q +      V C  V  +T  VNG  + GTGL
Sbjct  1062  DLKMAVRQSLDTYQARGNLHSVSSLRMPQRASSQEDSVDCLPVEDSTDNVNGATLLGTGL  1121

Query  4255  KNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHVGDPCVVCALYDIFTALSLASS  4431
             KNEVGEYNCFLNVIIQSLWHLRRFR EFL RS SEH HVG+PCVVCALY+IFTAL  AS 
Sbjct  1122  KNEVGEYNCFLNVIIQSLWHLRRFRVEFLGRSRSEHDHVGNPCVVCALYEIFTALDTASK  1181

Query  4432  ETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTES  4611
             ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL VIF+CLH+SF   S  SD ES
Sbjct  1182  DSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLSVIFDCLHRSFICGSSVSDAES  1241

Query  4612  VDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMK  4791
              +S+CMGSWDCAN +CI HSLFGM++FE+MNCY CGLESRH+KYTSFFHNINASALRTMK
Sbjct  1242  AESNCMGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLESRHMKYTSFFHNINASALRTMK  1301

Query  4792  VMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESV  4971
                 +SSFD+LLNLVEMNHQLACD +A GCGK NHIHHFLSTPPHVF TVLGWQNT ES 
Sbjct  1302  DTFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESA  1361

Query  4972  EDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDK  5151
             +DIT TL ALST+ID SVLY GLDPK  H LVSVVCYYGQHYHCFAYSHDHE+WIMYDDK
Sbjct  1362  DDITETLAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDK  1421

Query  5152  TVKVIGNWADVLTMCERGHLQPQV  5223
             TVKVIG WADVLTMCERGHLQPQV
Sbjct  1422  TVKVIGGWADVLTMCERGHLQPQV  1445



>ref|XP_010932991.1| PREDICTED: uncharacterized protein LOC105053498 [Elaeis guineensis]
Length=1601

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/1040 (49%), Positives = 683/1040 (66%), Gaps = 116/1040 (11%)
 Frame = +3

Query  579   ECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNVKNR  758
             ECERALT+LRRGNH KALRLM+D C +HE+SP   L++RV GT+ VKVA+++DDPN K R
Sbjct  57    ECERALTALRRGNHKKALRLMRDACVQHESSP---LLHRVHGTILVKVAALLDDPNAKLR  113

Query  759   HLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPIDPA  938
             HL+ AIDSAR++V +SP+SIEFAHFYANLLYEAA DG+ Y+EV+QECERAL+I +PIDPA
Sbjct  114   HLRAAIDSARRAVALSPSSIEFAHFYANLLYEAATDGRGYDEVLQECERALSISDPIDPA  173

Query  939   KESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG-SGEEKFRLIPIRR  1112
             +ESLQ E   K+STPEARI  V+ ELR L  +SN+ASIS+W+KN G +GEEKFR+IP+ R
Sbjct  174   RESLQDEAHHKLSTPEARIDQVRQELRALNHKSNIASISSWMKNLGGAGEEKFRVIPMLR  233

Query  1113  MSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGERSL  1292
                                            E + R                   G+   
Sbjct  234   AG----------------------------GEDDARA------------------GDSPP  247

Query  1293  DLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFG  1472
               S+  G R  ERRK+ N+RK  SS +R D  R+YWNSMS + +   L + I DL++H+ 
Sbjct  248   SSSSSGGHRLAERRKA-NSRKLASSTDRMDQFRAYWNSMSIEKRLDFLAVSIPDLRAHYA  306

Query  1473  S--LKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKL  1646
             S   KD  A+++LSEALSFAE N  W+FW CC C ++F DS+SH+QHV+ EHM SL PKL
Sbjct  307   SSSPKDSFASDILSEALSFAETNGKWRFWVCCRCKQKFTDSDSHMQHVVREHMGSLLPKL  366

Query  1647  QSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLE-KQLKCRVHGFLENTYTRSDMDESKD  1823
             Q+VLP+ V  +W++ML+N +WKP+D +AA K+LE +QLKC       +    +D D    
Sbjct  367   QAVLPREVNGKWIDMLVNGTWKPIDASAAVKMLEDEQLKCC------SVLMDADSDAGVK  420

Query  1824  DISDPYCNVYGWDRSPIKKTFGDG-------CNGTTVDSREYDKNSEVWMDRDGNEGTKI  1982
             D    Y N    + S   + F  G       CNG  + +R  D              +  
Sbjct  421   DCLSGYWNAS--ENSDSSRPFQHGGLKDRDVCNGFALKNRNSD-------------ASDF  465

Query  1983  CPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQL  2162
                S  WP++DD ER KLLERI  +FQ L+K+K L +S+L+KV  FA+EE+Q    GS L
Sbjct  466   DHVSRRWPLSDDTERRKLLERIQGMFQLLVKHKSLAASNLNKVRQFAMEEIQGFQSGSLL  525

Query  2163  LNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAME  2342
             LN+++DQ+PLCICFLGA +L+K+LKFLQELS SCGLGRY E+ ++  D  +  QG + +E
Sbjct  526   LNHSLDQSPLCICFLGASQLRKVLKFLQELSQSCGLGRYSEKDSSAGDADSTRQGSEVIE  585

Query  2343  KIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGG-------L  2501
             +I  + D S LL D H    K+                          DN G        
Sbjct  586   EITLTCDSSTLLLDSHLFSGKI---------------------RLGNVDNSGSDEGTDSA  624

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
              D++ L SW+F G S+GE+L++W+R REE + + MEI+++LEKEFY LQ +CERKCEHL+
Sbjct  625   PDTNALFSWLFAGPSTGERLSAWTRMREENSHRGMEILQMLEKEFYLLQSMCERKCEHLS  684

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
             YEEAL  VE+LC EE K+REH   FV +SY+  L+KR+DEL+E  +     + RFE++AI
Sbjct  685   YEEALHNVENLCFEELKRREHAGKFVSQSYEAILRKRQDELVERENAEKFISSRFELDAI  744

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S++LK+A+ LN +QFG+++T  G +S LC+L+ GEDD+WR+ DYL+Q D+C+EVAIQRQK
Sbjct  745   SNILKEAQVLNASQFGYDETLSGATSRLCELDDGEDDEWRMHDYLHQTDTCIEVAIQRQK  804

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E +SVEL+KIDARI+R V+GM QLE+KL   S  DYR +++PLVKS+L+  LEDL ++DA
Sbjct  805   EQLSVELNKIDARIIRNVTGMHQLELKLGPASTFDYRTVILPLVKSFLQLQLEDLVDKDA  864

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
              EKSDAAREAFLAELA D+KK++N GS+ +K ++EK++DKKK KDY+K KD+K       
Sbjct  865   AEKSDAAREAFLAELALDAKKNANKGSD-SKQTNEKSKDKKKNKDYKKAKDIKAVGSTFQ  923

Query  3402  HALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleY  3581
                H +T+E+  F  + DG   + E    G     ++EEE + R+ELEAEERKLEETLEY
Sbjct  924   FPFHQETSEQLEF--LADGDLLEPEHITSGDR--LEQEEEFKLRVELEAEERKLEETLEY  979

Query  3582  QRRIENEAKLKHLAEQHKKG  3641
             QR+IE+EAK KH AEQ K G
Sbjct  980   QRQIEDEAKKKHFAEQFKNG  999


 Score =   576 bits (1485),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 276/403 (68%), Positives = 325/403 (81%), Gaps = 27/403 (7%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             ++G KTLRQLH E+DDEERFQADL KAV QSL+                       + G 
Sbjct  1219  DNGGKTLRQLHAEEDDEERFQADLKKAVCQSLEN----------------------DYGA  1256

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGD  4374
             S  + A+ I +  E++G+GLKN VGEYNCFLNVIIQSLWHLR FRDEFL++SS H+HVG+
Sbjct  1257  STNETAS-IPSTKEIFGSGLKNAVGEYNCFLNVIIQSLWHLRCFRDEFLKTSSLHVHVGN  1315

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PCVVCALYDIFTAL+ AS E +R+AVAP SLRIALSNLYPD   FQE QMNDASEVL VI
Sbjct  1316  PCVVCALYDIFTALTKAS-EGQREAVAPTSLRIALSNLYPDNKFFQEAQMNDASEVLAVI  1374

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             F+CLH+S+TS S   D ES +S+ +GSWDCAN +CI HSLFGMD++E+M CY CG+ESRH
Sbjct  1375  FDCLHKSYTSTS-ECDAESHESNSVGSWDCANDSCIAHSLFGMDIYEQMKCYSCGVESRH  1433

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINA++LRT K+MC +SSFD+LL +VEMNHQLACD DA GCGK N+IHH LS
Sbjct  1434  LKYTSFFHNINANSLRTTKIMCAESSFDKLLKIVEMNHQLACDLDAGGCGKSNYIHHILS  1493

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
             +PPHVFTTVLGWQN+ ES +DI+ATL A+STE+DI VLYRGLD  SKH LVSVVCYYGQH
Sbjct  1494  SPPHVFTTVLGWQNSNESADDISATLAAISTEVDIGVLYRGLDQGSKHSLVSVVCYYGQH  1553

Query  5095  YHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YHCFAY  +HE+W+MYDD+ VKVIG W DV+++CERGHLQPQV
Sbjct  1554  YHCFAY--EHEQWVMYDDQIVKVIGGWNDVISICERGHLQPQV  1594



>gb|KHN18514.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Glycine soja]
Length=1523

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/964 (52%), Positives = 661/964 (69%), Gaps = 50/964 (5%)
 Frame = +3

Query  804   SPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAI---ENPIDPAKESLQENQQKVS  974
             +P  IE A   +        +G +Y  +  ECERAL     +N     K+  +   ++  
Sbjct  40    NPRKIELATLQS--------EGFDYFIIKLECERALTTLRRQNHTKAMKQLKEIYAREEG  91

Query  975   TPEARIAHV--QGELRNLIQRSNLASISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQ  1148
             +P A   +     ELR LIQ+SN+AS+S+W+KN  +GEE+FRLIPIRR  EDPME+RLVQ
Sbjct  92    SPHAAFVNRVHNNELRQLIQKSNIASLSSWMKNLSNGEERFRLIPIRRTPEDPMEVRLVQ  151

Query  1149  ARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDGER---SLDLSAGTGQR  1319
              R+PNEIKK TKTPEERRKEIEVRVAAARL+Q+ SES Q  N+G+R    LD S G+GQR
Sbjct  152   TRRPNEIKKVTKTPEERRKEIEVRVAAARLIQKNSESPQLPNEGDRDDRPLDSSVGSGQR  211

Query  1320  GNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANE  1499
               +RR+  NARK+  S ER   V SYWNS+S D+KK  LR++I DLKSH+GS KD L N+
Sbjct  212   IGDRRRHVNARKSGFSAERMKWVHSYWNSVSMDLKKDFLRVKIYDLKSHYGSSKDTLPND  271

Query  1500  VLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENE  1679
             +LSEAL +AEANK WKFW CC+C E+ ++ +SH  HV+ EHM SLSP++Q +LPQNV++E
Sbjct  272   ILSEALFYAEANKTWKFWRCCNCEEKHSNPDSHRHHVVQEHMGSLSPQMQRLLPQNVDSE  331

Query  1680  WVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRS---DMDESKDDISDPYCNV  1850
             W+EM+LNCSW PLD+ AA ++L+ + K +     E+ Y      D ++   D S  Y   
Sbjct  332   WIEMILNCSWNPLDVLAAVRMLDNKAKLKSSPLPEDLYLDHHALDYNDCFKDASSSYIE-  390

Query  1851  YGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTK-----ICPPSESWPIAD  2015
                     K++ GD     +V+      N+   ++ D  EG +       P  + WP++D
Sbjct  391   --------KESSGDSRRNCSVEC-----NNHCKIENDVREGVEDQLSMANPIIDCWPVSD  437

Query  2016  DPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLC  2195
             DPERAKLL +I+ +F+TLI++K L +SHL+KVI F + E+Q L  GSQLLN+ +DQTP+C
Sbjct  438   DPERAKLLGKIHAIFETLIRHKCLAASHLNKVIQFTMGEIQGLAAGSQLLNHGVDQTPMC  497

Query  2196  ICFLGAPELKKILKFLQELSHSCGLGRYPERS-TAIDDISTGIQGVDAMEKIVFSEDGSC  2372
             ICFLGA +LK I +FLQE+SH+CGL R  ++  +  +D+    QG +  +KIV   D SC
Sbjct  498   ICFLGATQLKTIFQFLQEISHACGLARNADKGGSPTNDLLNISQGPEIKDKIVLDGDASC  557

Query  2373  LLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSG  2552
             LL DE+    ++T  T    ++ D    S+         +G    +D LLSWIF  +  G
Sbjct  558   LLLDEYLLQTQVTAGTVQGAILDDVTTPSSP--------DGISCYNDALLSWIFSCSPIG  609

Query  2553  EQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGK  2732
             +QLTSW R+RE+K  +  EIV+LLEKEFY LQGLCE+K E + YEEALQ VEDLCLEEGK
Sbjct  610   DQLTSWLRTREDKLNKGKEIVQLLEKEFYHLQGLCEKKGERIAYEEALQTVEDLCLEEGK  669

Query  2733  KREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGF  2912
             KRE   +FV+RSY+  L+KRR+EL+ES ++    + +FE++AIS+VL++AE+ NVNQFG+
Sbjct  670   KRETVGEFVQRSYESVLRKRREELIESENDMMYVSNKFELDAISNVLQEAEARNVNQFGY  729

Query  2913  EDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRV  3092
             ++TY G++S LCDLESGE+D+WR+KDYL+Q D C+E AIQ+ KEH+S+ELSKIDARI+R 
Sbjct  730   DETYAGVTSQLCDLESGEEDEWRMKDYLHQMDGCIENAIQKLKEHLSIELSKIDARIIRS  789

Query  3093  VSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelar  3272
             V+ MQQLE KL  +SA+DYR ILVPLVK YLRA LEDLAE+DA EKSDA  EA LAELA 
Sbjct  790   VTEMQQLEFKLGPISANDYRAILVPLVKLYLRALLEDLAEKDAREKSDAVSEALLAELAL  849

Query  3273  dSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVH  3452
             DSKK+   GSE+A+H  EKT+DKKK KD+RK +D K ++G+   +L   T +  S  V  
Sbjct  850   DSKKAVKGGSESARHV-EKTKDKKKNKDHRKARDFKVTSGHAHFSLGSTTPD--SNLVAP  906

Query  3453  DGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQH  3632
             +    D E+ +   + + Q EEE RR+IELE EE+KLEETLE+QRRIENEAK K LAEQ 
Sbjct  907   ESDFPDNEVVSMNDDDLEQLEEEFRRKIELEEEEKKLEETLEFQRRIENEAKQKQLAEQQ  966

Query  3633  KKGA  3644
             KK +
Sbjct  967   KKSS  970


 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/405 (74%), Positives = 328/405 (81%), Gaps = 3/405 (1%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             +G K + +L VED +EERFQADL  AVRQSLDT+ A      +     +Q +      V 
Sbjct  1112  NGSKVMGELQVEDAEEERFQADLKMAVRQSLDTYQARGNSHSVSSLRMSQRASSQEDSVD  1171

Query  4198  CEDV--ATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFL-RSSSEHIHV  4368
             C  V  +T  VNG  + GTGLKNEVGEYNCFLNVIIQSLWHLRRFR+EFL RS SEH HV
Sbjct  1172  CLPVEDSTDNVNGATLLGTGLKNEVGEYNCFLNVIIQSLWHLRRFREEFLGRSRSEHDHV  1231

Query  4369  GDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLG  4548
             G+PCVVCALY+IFTAL  AS ++RR+AVAP SLRIALSNLYP    FQE QMNDASEVL 
Sbjct  1232  GNPCVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQMNDASEVLA  1291

Query  4549  VIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLES  4728
             VIF+CLHQSFT  S  SD ES +S+C GSWDCAN +CI HSLFGM++FE+MNCY CGLES
Sbjct  1292  VIFDCLHQSFTRGSSVSDAESAESNCTGSWDCANGSCIAHSLFGMNIFEQMNCYHCGLES  1351

Query  4729  RHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHF  4908
             RHLKYTSFFHNINASALRTMK M  +SSFD+LLNLVEMNHQLACD +A GCGK NHIHH 
Sbjct  1352  RHLKYTSFFHNINASALRTMKDMFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHL  1411

Query  4909  LSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYG  5088
             LSTPPHVF TVLGWQNTCES  DIT TL ALST IDISVLY GLDPK  H LVSVVCYYG
Sbjct  1412  LSTPPHVFMTVLGWQNTCESANDITETLAALSTNIDISVLYPGLDPKCIHNLVSVVCYYG  1471

Query  5089  QHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             QHYHCFAYSHDHE+WIMYDDKTVKVIG WADVLTMCERGHLQPQV
Sbjct  1472  QHYHCFAYSHDHEQWIMYDDKTVKVIGGWADVLTMCERGHLQPQV  1516


 Score = 63.5 bits (153),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 11/113 (10%)
 Frame = +3

Query  363  MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
            MGHKKR  APRSK S+A      VA    A        T  V +     I  + A ++SE
Sbjct  1    MGHKKRNPAPRSKQSLAATTANGVATSPDAYT------TCNVSIDNPRKI--ELATLQSE  52

Query  543  TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQ  701
                  Y  IKLECERALT+LRR NH KA++ +K++ A+ E SP+ A + RV 
Sbjct  53   ---GFDYFIIKLECERALTTLRRQNHTKAMKQLKEIYAREEGSPHAAFVNRVH  102



>emb|CDY72442.1| BnaCnng77640D, partial [Brassica napus]
Length=667

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/680 (53%), Positives = 472/680 (69%), Gaps = 49/680 (7%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+P APRSK S++                     +SA   +  S +    A    +
Sbjct  1     MGQKKKPPAPRSKQSLS---------------------SSAAEAEPSSEV---SACTSYD  36

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
              +  S+ A IK+ECE+ALTS RRG++NKA+RLMK+ C++H++S   ALI+RVQGTVCVKV
Sbjct  37    GDEPSNLAEIKVECEKALTSFRRGSYNKAIRLMKESCSRHQHS---ALIHRVQGTVCVKV  93

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             +S+ +D   K +++++AI+SARK+V +SPNSIEFAHFYANLLYEAA+DG+EYEEV+QEC 
Sbjct  94    SSVYEDAVTKQKYIRSAIESARKAVELSPNSIEFAHFYANLLYEAASDGREYEEVLQECH  153

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RAL+IENPIDPAK+SLQ E+Q K+ TPEARIA+VQ ELR+LIQ+SNL S+STW+K+  +G
Sbjct  154   RALSIENPIDPAKDSLQDESQHKILTPEARIANVQDELRSLIQKSNLGSLSTWMKHLRNG  213

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             E +FRL  +R+M+EDP+E  LVQ R+PNEIKKATKT EERRKEIEVRVAA RLLQQKSES
Sbjct  214   EGEFRLFDMRKMAEDPIESNLVQTRRPNEIKKATKTLEERRKEIEVRVAAGRLLQQKSES  273

Query  1260  AQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +   +   +  D + G+GQR  ERRK GNARKN S++ERRD VRSYW S   +MKK+LLR
Sbjct  274   SSVDSVNSKGSDPALGSGQRSVERRKHGNARKNDSTVERRDRVRSYWESTGKEMKKELLR  333

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLKSHF + KDG AN++++EALSF EANK W+FW CC C E+F DSES++QH++ E
Sbjct  334   IKVSDLKSHFSASKDGDANDIITEALSFCEANKTWRFWVCCKCSEKFKDSESYMQHIVGE  393

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             H+ ++ PK+Q VLPQ++++E +EMLL   WKPLD  AA KL   Q K +   F E  Y  
Sbjct  394   HIGNVLPKMQMVLPQSLDSERIEMLLTSPWKPLDFPAAVKLRCSQQKIQNTEFNE-FYAE  452

Query  1800  SDMDESKDDISDPYCNVYGW-DRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGT  1976
               MD+  D   D       W D SP K+  GD CNG       Y+KN        G    
Sbjct  453   DYMDDGDDCFQD------AWNDTSPEKEKIGDACNG-------YEKNE----SEKGRLPN  495

Query  1977  KICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGS  2156
                 P E WPI+DDPER KLL+ I   F+ LIK+ YL +SH  KVI F ++EL++L   S
Sbjct  496   PFYLPDE-WPISDDPERTKLLKSIRAAFELLIKHSYLATSHYDKVIQFTLDELRNLPSVS  554

Query  2157  QLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQ-GVD  2333
             Q LN  + Q+P+CI FLGA +LKKIL+FLQ+LSH+CG+ RY E+S   D+++  +  G+ 
Sbjct  555   QFLNRGLCQSPICIRFLGASQLKKILQFLQDLSHACGVSRYSEQSNPNDEVNNFVDLGLQ  614

Query  2334  AMEKIVFSEDGSCLLFDEHF  2393
               E+I    +GSCLL DE  
Sbjct  615   ITEEICLDGEGSCLLLDEKL  634



>tpg|DAA43557.1| TPA: hypothetical protein ZEAMMB73_116284 [Zea mays]
Length=1175

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/1068 (42%), Positives = 648/1068 (61%), Gaps = 106/1068 (10%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALI  689
             R   A  E         A ++ E ++AL  L+RG+H +A RL +D  A+H E SP   L+
Sbjct  21    RRSPAAAEKPAGIGREDAAVRAEVDKALACLQRGSHARAQRLTRDAIARHGEASP---LL  77

Query  690   YRVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDG  869
              R  GTV  + AS++DD   + RH + A+ +A+++V ++P+SIE AHF+A LL++AA D 
Sbjct  78    LRAHGTVHARAASVLDDHASRARHQRTALQAAQRAVQLAPDSIELAHFHAMLLFDAATDS  137

Query  870   KEYEEVVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             + Y+EVV ECER L+IE P DPA  SL+        P   +  VQ ELRNLIQ++NLASI
Sbjct  138   RAYDEVVAECERGLSIEAPSDPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASI  190

Query  1050  STWVKNF-GSGEEKFRLIPIRRMSEDPMELRLV----QARKPNEIKKATKTPEERRKEIE  1214
             S+WVKN  G+G++K RLIP+RR++++PME RLV      R+PNEIKKATKT EERR+EIE
Sbjct  191   SSWVKNMGGAGDDKLRLIPVRRLADEPMEARLVPTAPSPRRPNEIKKATKTTEERRQEIE  250

Query  1215  VRVAAARLLQQKSE-----------SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNV  1361
             VR+AA RLLQQ+ E           S++S  D   S   S+  G R + RRK G+ +   
Sbjct  251   VRLAAMRLLQQQKEQSNDVVSATPASSRSHGDDAPSSSESSVGGHRAD-RRKGGSRKATG  309

Query  1362  SSM-ERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALS  1520
             SS  ER D VR+YW S+  + +   L   I +LKSH+ S     KD    A++VL+E + 
Sbjct  310   SSASERTDQVRAYWGSIPVEQRLAFLNTSISELKSHYASAMHKEKDAASAASDVLNEVIQ  369

Query  1521  FAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLN  1700
             FA  +  W+F  C  C E+F   E+H  HV+ EH+  LS +LQ ++PQ ++ +W EML  
Sbjct  370   FANKHDKWEFMVCGRCREQFTHVEAHRWHVMVEHVGLLSSELQEMVPQEIDADWAEMLSG  429

Query  1701  CSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKK  1880
             C+W+PLD  AA KL E+                           D + N+ G DR     
Sbjct  430   CNWRPLDATAALKLFEE---------------------------DQHNNL-GPDREDESN  461

Query  1881  TFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC--PPSESWPIADDPERAKLLERINV  2054
             +  D  +   +D  E    S  W   + + G  +        WP +DD ERAK+LERI+ 
Sbjct  462   SL-DSWSNKAMDMSE----SSAWSHNEESSGFGVVVREGDTKWPFSDDDERAKILERIHS  516

Query  2055  VFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKIL  2234
              F+ L+KN  L   +L++VI FAVEEL+ L  GS LLN+++D++PLCI FL A  L+K+ 
Sbjct  517   SFKILVKNHNLSVHNLNRVIRFAVEELRGLPSGSLLLNHSLDESPLCIRFLEASSLQKVD  576

Query  2235  KFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTP  2414
              FLQ+L  + GL R  +++  + D  + IQ  D +EK+  + D S L+ D H        
Sbjct  577   NFLQDLMQASGLNRNLQKAEGLGDGDSFIQNHDVLEKVTLNSDSSELIIDGH--------  628

Query  2415  ITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKA  2594
              TF     ++S                  +D+D LLSW++ G+S GEQL +W+R  +E++
Sbjct  629   -TFGGKFDSES------------------VDTDALLSWLYAGSSIGEQLLAWNRMIDERS  669

Query  2595  QQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYD  2774
              Q ++++R L +EF  LQ  CERK E L  E+A   VE L  EE  +RE    +  ++++
Sbjct  670   NQCVDLIRALGREFNNLQNSCERKLEQLRNEDAFTSVEGLFCEEQTRREQVGRYGFQTFE  729

Query  2775  IALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDL  2954
               L+KR+ E +E + E  S + R EI+AIS++LK+   L+ + FG+++   G++    D 
Sbjct  730   ELLRKRQ-EFLEHNTEEQSDSNRSEIDAISAILKE---LHTSHFGYDEALTGMAPRFSDF  785

Query  2955  ESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESV  3134
             + GE+D+WR+ D+++  DS V + + + KEHV++E+SKIDA+IMR +S M+QLE KL  V
Sbjct  786   DGGEEDEWRLHDFIHPNDSMVHMVVSKMKEHVTMEISKIDAKIMRTLSVMRQLEHKLGPV  845

Query  3135  SAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAK  3314
             SA DYR IL+PL++S+L++HLE+L ++DA E+SDAAREAFLAELA D+KK+++ G  + K
Sbjct  846   SALDYRMILLPLMRSFLQSHLEELVDKDARERSDAAREAFLAELALDAKKNASKGG-DMK  904

Query  3315  HSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEE---ASFSVVHDGGSEDAELSN  3485
              SHEK++DKKK KD R+ K+ K S+ +    +H D+A+E    +F ++ D    D + S 
Sbjct  905   QSHEKSKDKKKFKDSRRAKEFKDSSWSDQSLIHQDSADEETTETFQILADCDDLDCKFST  964

Query  3486  GGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
                +   ++EEE R +++LEAEERKLEETLEYQRRIE EAK KHLAEQ
Sbjct  965   -SDDYFNEQEEELRHKVQLEAEERKLEETLEYQRRIEEEAKQKHLAEQ  1011



>ref|XP_008668323.1| PREDICTED: uncharacterized protein LOC100274180 isoform X1 [Zea 
mays]
Length=1517

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/1067 (41%), Positives = 644/1067 (60%), Gaps = 104/1067 (10%)
 Frame = +3

Query  513   RHDQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALI  689
             R   A  E         A ++ E ++AL  L+RG+H +A RL +D  A+H E SP   L+
Sbjct  21    RRSPAAAEKPAGIGREDAAVRAEVDKALACLQRGSHARAQRLTRDAIARHGEASP---LL  77

Query  690   YRVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDG  869
              R  GTV  + AS++DD   + RH + A+ +A+++V ++P+SIE AHF+A LL++AA D 
Sbjct  78    LRAHGTVHARAASVLDDHASRARHQRTALQAAQRAVQLAPDSIELAHFHAMLLFDAATDS  137

Query  870   KEYEEVVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASI  1049
             + Y+EVV ECER L+IE P DPA  SL+        P   +  VQ ELRNLIQ++NLASI
Sbjct  138   RAYDEVVAECERGLSIEAPSDPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASI  190

Query  1050  STWVKNF-GSGEEKFRLIPIRRMSEDPMELRLV----QARKPNEIKKATKTPEERRKEIE  1214
             S+WVKN  G+G++K RLIP+RR++++PME RLV      R+PNEIKKATKT EERR+EIE
Sbjct  191   SSWVKNMGGAGDDKLRLIPVRRLADEPMEARLVPTAPSPRRPNEIKKATKTTEERRQEIE  250

Query  1215  VRVAAARLLQQKSE-----------SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNV  1361
             VR+AA RLLQQ+ E           S++S  D   S   S+  G R + R+         
Sbjct  251   VRLAAMRLLQQQKEQSNDVVSATPASSRSHGDDAPSSSESSVGGHRADRRKGGSRKATGS  310

Query  1362  SSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALSF  1523
             S+ ER D VR+YW S+  + +   L   I +LKSH+ S     KD    A++VL+E + F
Sbjct  311   SASERTDQVRAYWGSIPVEQRLAFLNTSISELKSHYASAMHKEKDAASAASDVLNEVIQF  370

Query  1524  AEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNC  1703
             A  +  W+F  C  C E+F   E+H  HV+ EH+  LS +LQ ++PQ ++ +W EML  C
Sbjct  371   ANKHDKWEFMVCGRCREQFTHVEAHRWHVMVEHVGLLSSELQEMVPQEIDADWAEMLSGC  430

Query  1704  SWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKT  1883
             +W+PLD  AA KL E+                           D + N+ G DR     +
Sbjct  431   NWRPLDATAALKLFEE---------------------------DQHNNL-GPDREDESNS  462

Query  1884  FGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKIC--PPSESWPIADDPERAKLLERINVV  2057
               D  +   +D  E    S  W   + + G  +        WP +DD ERAK+LERI+  
Sbjct  463   L-DSWSNKAMDMSE----SSAWSHNEESSGFGVVVREGDTKWPFSDDDERAKILERIHSS  517

Query  2058  FQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILK  2237
             F+ L+KN  L   +L++VI FAVEEL+ L  GS LLN+++D++PLCI FL A  L+K+  
Sbjct  518   FKILVKNHNLSVHNLNRVIRFAVEELRGLPSGSLLLNHSLDESPLCIRFLEASSLQKVDN  577

Query  2238  FLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPI  2417
             FLQ+L  + GL R  +++  + D  + IQ  D +EK+  + D S L+ D H         
Sbjct  578   FLQDLMQASGLNRNLQKAEGLGDGDSFIQNHDVLEKVTLNSDSSELIIDGH---------  628

Query  2418  TFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQ  2597
             TF     ++S                  +D+D LLSW++ G+S GEQL +W+R  +E++ 
Sbjct  629   TFGGKFDSES------------------VDTDALLSWLYAGSSIGEQLLAWNRMIDERSN  670

Query  2598  QAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDI  2777
             Q ++++R L +EF  LQ  CERK E L  E+A   VE L  EE  +RE    +  ++++ 
Sbjct  671   QCVDLIRALGREFNNLQNSCERKLEQLRNEDAFTSVEGLFCEEQTRREQVGRYGFQTFEE  730

Query  2778  ALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLE  2957
              L+KR+ E +E + E  S + R EI+AIS++LK+   L+ + FG+++   G++    D +
Sbjct  731   LLRKRQ-EFLEHNTEEQSDSNRSEIDAISAILKE---LHTSHFGYDEALTGMAPRFSDFD  786

Query  2958  SGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVS  3137
              GE+D+WR+ D+++  DS V + + + KEHV++E+SKIDA+IMR +S M+QLE KL  VS
Sbjct  787   GGEEDEWRLHDFIHPNDSMVHMVVSKMKEHVTMEISKIDAKIMRTLSVMRQLEHKLGPVS  846

Query  3138  AHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKH  3317
             A DYR IL+PL++S+L++HLE+L ++DA E+SDAAREAFLAELA D+KK+++ G  + K 
Sbjct  847   ALDYRMILLPLMRSFLQSHLEELVDKDARERSDAAREAFLAELALDAKKNASKGG-DMKQ  905

Query  3318  SHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEE---ASFSVVHDGGSEDAELSNG  3488
             SHEK++DKKK KD R+ K+ K S+ +    +H D+A+E    +F ++ D    D + S  
Sbjct  906   SHEKSKDKKKFKDSRRAKEFKDSSWSDQSLIHQDSADEETTETFQILADCDDLDCKFST-  964

Query  3489  GSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
               +   ++EEE R +++LEAEERKLEETLEYQRRIE EAK KHLAEQ
Sbjct  965   SDDYFNEQEEELRHKVQLEAEERKLEETLEYQRRIEEEAKQKHLAEQ  1011


 Score =   519 bits (1336),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 258/402 (64%), Positives = 297/402 (74%), Gaps = 29/402 (7%)
 Frame = +1

Query  4018  SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVS  4197
             SG      L ++DD ++RFQ DL +AVRQSL     +   P    +GT   S        
Sbjct  1138  SGAIPSADLCIKDDFDKRFQEDLDEAVRQSL----GYDAYP----AGTISTS--------  1181

Query  4198  CEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDP  4377
                      N  EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++SS H HV DP
Sbjct  1182  ---------NETEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSSLHKHVEDP  1232

Query  4378  CVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIF  4557
             C VCALY IF  LS A+ +   +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIF
Sbjct  1233  CAVCALYGIFIDLSKAA-KGHGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIF  1291

Query  4558  ECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHL  4737
             ECLH+S+TS +     +  + + +GSWDCAN +CI HSLFGMDV+ERMNC+ C +ESR L
Sbjct  1292  ECLHKSYTSRT-VCHGKPHEKNSIGSWDCANISCIAHSLFGMDVYERMNCHNCKMESRRL  1350

Query  4738  KYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLST  4917
             KYTSFFHNINAS+LRT K+MC DSSFDELL +V MN QLACD D  GCGK NHIHH LST
Sbjct  1351  KYTSFFHNINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGKPNHIHHILST  1410

Query  4918  PPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHY  5097
             PPHVFT VLGWQN  E+V+DI+ATL  +STEIDIS+ YRGLD  SKH LVSVVCYYGQHY
Sbjct  1411  PPHVFTVVLGWQNNKENVDDISATLAGISTEIDISIFYRGLDQGSKHTLVSVVCYYGQHY  1470

Query  5098  HCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             HCFA+     RW+MYDD+TVKV+G+W DVL MCE+GHLQPQV
Sbjct  1471  HCFAFKDG--RWVMYDDQTVKVVGSWGDVLVMCEKGHLQPQV  1510



>gb|AFW89723.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1124

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G+ + K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGA-DMKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010



>gb|AFW89722.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1184

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G+ + K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGA-DMKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010



>ref|XP_010515103.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 54-like 
[Camelina sativa]
Length=478

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/406 (71%), Positives = 337/406 (83%), Gaps = 10/406 (2%)
 Frame = +1

Query  4012  GESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMAN-L  4188
             G+ G KTLRQL  EDD+EERFQADL KAVRQSLD +   + +        + + E+ N  
Sbjct  75    GDVGTKTLRQLQAEDDEEERFQADLQKAVRQSLDAYQGGRNM--------STLLEVNNDG  126

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             G+S     +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLR S+ EH H
Sbjct  127   GLSYVTTESWSPTGVPIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRRSTLEHHH  186

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVC+LY++FTALS+ASSE+R++ VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  187   VGDPCVVCSLYEVFTALSVASSESRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  246

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF  +S  SDTES +S+  GSWDCAN  CI HSLFGMD+FE++NCY CGLE
Sbjct  247   AVIFDCLHRSFAQSSSLSDTESAESNSTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLE  306

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRH+KYTSFFHNINASALRTMKV   ++SFDELLNLVE+NHQLACDP+  GCGK NHIHH
Sbjct  307   SRHMKYTSFFHNINASALRTMKVTYPENSFDELLNLVEVNHQLACDPETGGCGKPNHIHH  366

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPP+VFTTVLGWQNTCE+VEDI  TL AL+TEIDIS++YRGLDPKS + LVSVVCYY
Sbjct  367   ILTTPPNVFTTVLGWQNTCETVEDIADTLAALNTEIDISIMYRGLDPKSTYSLVSVVCYY  426

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFAYSH+H++WIMYDDK VKVIG+W+DVLTMCERGHLQPQV
Sbjct  427   GQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVLTMCERGHLQPQV  472



>ref|XP_008658139.1| PREDICTED: uncharacterized protein LOC100194097 isoform X3 [Zea 
mays]
Length=1505

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010


 Score =   417 bits (1073),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 244/341 (72%), Gaps = 31/341 (9%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSL--DTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             +EDD ++RFQ DL +AVRQSL  D + A          GT   S                
Sbjct  1157  IEDDFDKRFQEDLDEAVRQSLGCDAYPA----------GTVSTS----------------  1190

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              NG EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++S  H HV DPC VCALY 
Sbjct  1191  -NGTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALYG  1249

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IF  LS A S+ +R+AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  1250  IFIDLSKA-SKGQREAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  1308

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFHN
Sbjct  1309  SRTVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFHN  1367

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS  PHVFT V
Sbjct  1368  INASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVV  1427

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCL  5064
             LGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L
Sbjct  1428  LGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTL  1468



>gb|AFW89724.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1485

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010


 Score =   507 bits (1306),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 250/392 (64%), Positives = 284/392 (72%), Gaps = 39/392 (10%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVN  4227
             +EDD ++RFQ DL +AVRQSL                                   G  N
Sbjct  1126  IEDDFDKRFQEDLDEAVRQSL-----------------------------------GTSN  1150

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIF  4407
             G EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++S  H HV DPC VCALY IF
Sbjct  1151  GTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALYGIF  1210

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
               LS AS + +R+AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+TS 
Sbjct  1211  IDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYTSR  1269

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFHNIN
Sbjct  1270  TVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFHNIN  1328

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             AS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS  PHVFT VLG
Sbjct  1329  ASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLG  1388

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L SVVCYYGQHYHCFA+     
Sbjct  1389  WQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--  1446

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1447  RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1478



>ref|XP_004987161.1| PREDICTED: uncharacterized protein LOC101782159, partial [Setaria 
italica]
Length=1371

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/914 (41%), Positives = 550/914 (60%), Gaps = 96/914 (11%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A ++ E ++AL  L+RG+H +ALRLMKD  A+H    +  L+ R  GTV  + AS++DDP
Sbjct  8     AAVRAEVDKALACLQRGSHARALRLMKDAVARHGEGAS-PLLLRAHGTVHARAASVLDDP  66

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
               + RH + A+ +A+++V ++P+S+E AHF+A LL++AA D + YEEVV ECER L+IE 
Sbjct  67    AARARHQRAALQAAQRAVELAPDSVELAHFHAMLLFDAATDARGYEEVVSECERGLSIEA  126

Query  924   PIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNF-GSGEEKFRLI  1100
             P DPA  SL+        P   +  VQ ELRNLIQ++NLASISTWVK   G+G++K RLI
Sbjct  127   PSDPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASISTWVKTLGGAGDDKLRLI  179

Query  1101  PIRRMSEDPMELRLV----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE----  1256
             P+RR++E+PME RLV      R+PNEIKKATKTPEERR+EIEVR+AA RLLQQ+ E    
Sbjct  180   PVRRLAEEPMEGRLVPTLPSPRRPNEIKKATKTPEERRQEIEVRLAAMRLLQQQKEQSNG  239

Query  1257  -------SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSM-ERRDCVRSYWNSMS  1412
                    S+QS  D   S    +  G    +RR+ G+ +  VSS  +R D VR+YW ++ 
Sbjct  240   AVAATPTSSQSQGDDAPSSSSQSSVGGHRADRRRGGSRKVTVSSTSDRMDQVRAYWAAIP  299

Query  1413  TDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALSFAEANKAWKFWTCCHCVE  1574
              + +   L   I +LKS++ ++    KD   +A++VL+E L FA  +  W+FW C  C E
Sbjct  300   VEQRLAFLNTSISELKSYYAAMMHKEKDAASVASDVLNEVLGFAAKSGKWEFWVCGRCRE  359

Query  1575  RFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQ  1754
             +FAD+ESH  HV+ EH+  LSP+LQ ++P  ++  W  ML+  +W+PLD  AA KL E  
Sbjct  360   QFADAESHRLHVLREHVGILSPELQDMVPHEIDAGWARMLIGWNWRPLDATAALKLFE--  417

Query  1755  LKCRVHGFLENTYTRSDMDESKDDI-SDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYD  1931
                      E       +D  KD + SD + N          K   D    +     E  
Sbjct  418   ---------EEQADNLGLDRDKDSMSSDSWSN----------KDKSDTSESSVSPHNEES  458

Query  1932  KNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKV  2111
                 V M     EG +       WP++DD ERA +LERI+ +FQ L+KNK L  S+L+KV
Sbjct  459   DGFAVVM----REGYR------KWPLSDDVERANILERIHSLFQILVKNKNLSVSNLNKV  508

Query  2112  IHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERS  2291
             I FA+EEL+ +   S LLN+++D++P CICFL A  L+K++KFLQ+L  S GL R+ E+ 
Sbjct  509   IQFAMEELRGMLSESLLLNHSLDESPHCICFLEASSLRKVVKFLQDLMQSSGLNRHLEKD  568

Query  2292  TAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
               + D  T  +  D +EK+  + D S L+ D           +F    V+++        
Sbjct  569   EGLGDGDTFPKNHDGLEKVTLNSDSSELIIDGE---------SFGRKFVSEN--------  611

Query  2472  sniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQG  2651
                       +D+D LLSW++ G+S GEQL  W+R  EE++ Q ++++R LE+EF  LQ 
Sbjct  612   ----------VDTDALLSWLYAGSSIGEQLLGWNRMLEERSNQGVDLLRALEREFNSLQN  661

Query  2652  LCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATS  2831
             LCERK E L  EEAL  VE +  +E   R+    +  + Y+  L+KR++EL++ + E  +
Sbjct  662   LCERKLEQLRNEEALISVESIFAQEQADRDEMGHY--QGYEELLRKRQEELLDFNAEVMT  719

Query  2832  TNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADS  3011
                R E++ +SS+LK+   ++ + FG+++ +  ++  LCD +  E++ WR+ D L   DS
Sbjct  720   NRSRSELDVVSSILKE---VHTSHFGYDEAFSSMAPRLCDYDGTEEEGWRLPD-LQSNDS  775

Query  3012  CVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRA  3191
              V V + + KE +++ELSKIDA+IMR V+ M QLE KL   S+ DYR +L+PL+KS+L+ 
Sbjct  776   VVHVVVSKMKEQITMELSKIDAKIMRNVAVMHQLEHKLGPASSLDYRTVLIPLMKSFLQT  835

Query  3192  HLEDLAERDATEKS  3233
             HLE+L ++DA E+S
Sbjct  836   HLEELVDKDARERS  849


 Score =   509 bits (1310),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 293/392 (75%), Gaps = 29/392 (7%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVN  4227
             +EDD ++RFQ DL +AVRQSL     +   P    +GT   S                 N
Sbjct  1002  IEDDFDKRFQEDLNEAVRQSL----GYDTCP----AGTISAS-----------------N  1036

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIF  4407
             G EV G GLKN  GEYNCFLNVIIQSLWH+RRFR EF+++S  H HV DPC VCALYDIF
Sbjct  1037  GAEVCGAGLKNAAGEYNCFLNVIIQSLWHIRRFRYEFVKTSLLHKHVEDPCAVCALYDIF  1096

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
             + LS AS + + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+TS 
Sbjct  1097  SDLSKAS-KGQGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYTSR  1155

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             +  S  +S + +C+GSWDCAN +CI H+LFGMD++ERMNC+ C  ESR LKYTSFFHNIN
Sbjct  1156  T-VSHGKSHEKNCVGSWDCANISCIAHNLFGMDIYERMNCHNCKFESRRLKYTSFFHNIN  1214

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             AS+LRT K+MC D SFDELL +VEMN QLACD D  GCGK NH HH LS+ PHVFT VLG
Sbjct  1215  ASSLRTAKMMCPDYSFDELLKIVEMNDQLACDQDVGGCGKLNHKHHILSSRPHVFTVVLG  1274

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQN  ESV+DI+ATL  +STEIDIS+ + G+D  SKH LVSVVCYYGQHYHCFA+     
Sbjct  1275  WQNNKESVDDISATLAGISTEIDISIFFHGIDQGSKHTLVSVVCYYGQHYHCFAFKDG--  1332

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1333  RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1364



>ref|XP_008658138.1| PREDICTED: uncharacterized protein LOC100194097 isoform X2 [Zea 
mays]
Length=1524

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010


 Score =   500 bits (1287),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 250/395 (63%), Positives = 285/395 (72%), Gaps = 37/395 (9%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIV-  4224
             +EDD ++RFQ DL +AVRQSL                             C+    G V 
Sbjct  1157  IEDDFDKRFQEDLDEAVRQSL----------------------------GCDAYPAGTVS  1188

Query  4225  --NGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALY  4398
               NG EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++S  H HV DPC VCALY
Sbjct  1189  TSNGTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALY  1248

Query  4399  DIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSF  4578
              IF  LS A S+ +R+AVAP SLRIALS  YP+   FQE  MNDASEVLGVIFECLH+S+
Sbjct  1249  GIFIDLSKA-SKGQREAVAPTSLRIALSKSYPNSKFFQE--MNDASEVLGVIFECLHKSY  1305

Query  4579  TSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFH  4758
             TS +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFH
Sbjct  1306  TSRTVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFH  1364

Query  4759  NINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTT  4938
             NINAS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS  PHVFT 
Sbjct  1365  NINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTV  1424

Query  4939  VLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSH  5118
             VLGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L SVVCYYGQHYHCFA+  
Sbjct  1425  VLGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKD  1484

Query  5119  DHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
                RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1485  G--RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1517



>ref|XP_008658140.1| PREDICTED: uncharacterized protein LOC100194097 isoform X4 [Zea 
mays]
 gb|AFW89725.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1495

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010


 Score =   509 bits (1312),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 287/395 (73%), Gaps = 35/395 (9%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIV-  4224
             +EDD ++RFQ DL +AVRQSL                             C+    G V 
Sbjct  1126  IEDDFDKRFQEDLDEAVRQSL----------------------------GCDAYPAGTVS  1157

Query  4225  --NGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALY  4398
               NG EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++S  H HV DPC VCALY
Sbjct  1158  TSNGTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALY  1217

Query  4399  DIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSF  4578
              IF  LS A S+ +R+AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+
Sbjct  1218  GIFIDLSKA-SKGQREAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSY  1276

Query  4579  TSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFH  4758
             TS +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFH
Sbjct  1277  TSRTVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFH  1335

Query  4759  NINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTT  4938
             NINAS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS  PHVFT 
Sbjct  1336  NINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTV  1395

Query  4939  VLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSH  5118
             VLGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L SVVCYYGQHYHCFA+  
Sbjct  1396  VLGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKD  1455

Query  5119  DHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
                RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1456  G--RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1488



>ref|XP_008658137.1| PREDICTED: uncharacterized protein LOC100194097 isoform X1 [Zea 
mays]
Length=1526

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1054 (42%), Positives = 636/1054 (60%), Gaps = 115/1054 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             ++ E E+AL  L+RGNH +A+RLM+D  A H    +  L+ R  GTV  + AS++DDP  
Sbjct  38    VRAEVEKALACLQRGNHARAVRLMRDAIA-HHGEASTPLLLRAHGTVLARAASVLDDPAA  96

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             + R  + A+ +A+++V ++P+SIE +HF+A LL++AA D + YEEVV ECER L+IE P 
Sbjct  97    RARRHRAALQAAQRAVELAPDSIELSHFHAMLLFDAATDTRAYEEVVAECERGLSIEAPS  156

Query  930   DPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS-GEEKFRLIPI  1106
             DPA  SL+        P   +  VQ ELRNLIQ++NLAS+STW K   S G++KFRLIP+
Sbjct  157   DPAPHSLR-------LPGPDVDQVQSELRNLIQKANLASVSTWFKTLRSAGDDKFRLIPV  209

Query  1107  RRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE------  1256
              R +++PME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E      
Sbjct  210   HRFADEPMEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVV  269

Query  1257  -----SAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDM  1421
                  S+QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D 
Sbjct  270   SATPASSQSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQ  329

Query  1422  KKKLLRIRIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             +   L   I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F 
Sbjct  330   RLAFLNTSISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFT  389

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKC  1763
             D E+H  HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E     
Sbjct  390   DVEAHRWHVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----  444

Query  1764  RVHGFLENTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYDKN  1937
                   E+       D  K+ D +D + N    D S    +  +G CNG  V  RE D  
Sbjct  445   ------EDQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD--  496

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
                        GT        WP++DD ERAK+LERI+ +F+ L+KN  L   +L++VI 
Sbjct  497   -----------GT--------WPLSDDDERAKILERIHSLFKILVKNHNLSVCNLNRVIR  537

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             FAVEEL+ L  GS LLN+++D++PLCICFL A  L K+ KFLQ+L  + G+ R  E +  
Sbjct  538   FAVEELRGLSSGSLLLNHSLDKSPLCICFLEASSLWKVAKFLQDLVQASGINRNLE-NDG  596

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
             + D  +  Q  + +EK++ S D S L+ D           TF     ++S          
Sbjct  597   LGDRDSSPQNHNVLEKVILSSDSSELIIDGQ---------TFGGKFDSES----------  637

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                     +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  C
Sbjct  638   --------VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSC  689

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
             ERK E L  EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S +
Sbjct  690   ERKLEQLRNEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDS  749

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
              R EI+AIS+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V
Sbjct  750   NRSEIDAISAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMV  805

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
                I + KE V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL
Sbjct  806   HTVISKMKEKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHL  865

Query  3198  EDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdl  3377
              +L ++DA E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+L
Sbjct  866   GELVDKDAKERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKEL  924

Query  3378  kGSNGNGLHALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqr  3527
             K S+ +    +H D+ +E        G SE +++           +   +   ++EEE R
Sbjct  925   KDSSWSNQSLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELR  976

Query  3528  rrieleaeerkleetleYQRRIENEAKLKHLAEQ  3629
              R++LEAEERKLEE LEYQR IE EAK KHLAEQ
Sbjct  977   HRVQLEAEERKLEEALEYQRWIEEEAKQKHLAEQ  1010


 Score =   509 bits (1312),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 287/395 (73%), Gaps = 35/395 (9%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIV-  4224
             +EDD ++RFQ DL +AVRQSL                             C+    G V 
Sbjct  1157  IEDDFDKRFQEDLDEAVRQSL----------------------------GCDAYPAGTVS  1188

Query  4225  --NGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALY  4398
               NG EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++S  H HV DPC VCALY
Sbjct  1189  TSNGTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALY  1248

Query  4399  DIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSF  4578
              IF  LS A S+ +R+AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+
Sbjct  1249  GIFIDLSKA-SKGQREAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSY  1307

Query  4579  TSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFH  4758
             TS +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFH
Sbjct  1308  TSRTVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFH  1366

Query  4759  NINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTT  4938
             NINAS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS  PHVFT 
Sbjct  1367  NINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTV  1426

Query  4939  VLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSH  5118
             VLGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L SVVCYYGQHYHCFA+  
Sbjct  1427  VLGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKD  1486

Query  5119  DHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
                RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1487  G--RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1519



>dbj|BAE98837.1| hypothetical protein [Arabidopsis thaliana]
Length=783

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/410 (70%), Positives = 337/410 (82%), Gaps = 4/410 (1%)
 Frame = +1

Query  3997  EKKHAGESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISE  4176
             E   + ++GPKTLRQL  EDD+EERFQADL +A  QSLD +   + +    R+     ++
Sbjct  370   ETLRSNDAGPKTLRQLQAEDDEEERFQADLKRAKLQSLDVYRGRRNMTSCLRTSLEDNND  429

Query  4177  MANLGVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-  4353
                  V+ E  ++    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ 
Sbjct  430   WVLSDVTKESQSSP---GVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGMFRAEFLRSSTL  486

Query  4354  EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDA  4533
             EH H GDPCVVC+LY IFTALS ASSETR++ VAP+SLRIALSNLYPD   FQE QMNDA
Sbjct  487   EHHHFGDPCVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDA  546

Query  4534  SEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYE  4713
             SEVL VIF+CLH+SF  +S  SDTES +S+  GSWDCAN +CI HSLFGMDV E++NCY 
Sbjct  547   SEVLAVIFDCLHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFGMDVSEQLNCYS  606

Query  4714  CGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHN  4893
             CGLESRHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACD +A GCGK N
Sbjct  607   CGLESRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDREAGGCGKRN  666

Query  4894  HIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSV  5073
             HIHH L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRG+DPK+ + LVSV
Sbjct  667   HIHHILTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGVDPKNTYSLVSV  726

Query  5074  VCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             VCYYGQHYHCFAYSH+H++WIMYDD+ VKVIG+W+DVL+MC+RGHLQPQV
Sbjct  727   VCYYGQHYHCFAYSHEHDQWIMYDDQNVKVIGSWSDVLSMCKRGHLQPQV  776


 Score =   162 bits (411),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 178/230 (77%), Gaps = 1/230 (0%)
 Frame = +3

Query  2949  DLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLE  3128
             DLESGE D+W +KD L++ADS +EVAIQ+QKE +S ELS+IDA++MR V+GMQQLE+KL 
Sbjct  3     DLESGEADEWGMKDSLHEADSFIEVAIQKQKEQLSAELSRIDAQMMRNVTGMQQLELKLG  62

Query  3129  SVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSEN  3308
              VS++DY+ +L+PLVKSY+RAHLE LAE+DATEKSDAAREA L ELA DSKK     ++N
Sbjct  63    PVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAAREALLFELALDSKKEGRGRNDN  122

Query  3309  AKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNG  3488
             +KH+ EK++DKKKIKD RK K+LK + GN  H  + D+ E +  SV   G   +A++ + 
Sbjct  123   SKHTLEKSKDKKKIKDTRKLKNLKATIGND-HRFNGDSIEHSLLSVASFGDHSEADVVSE  181

Query  3489  GSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHKK  3638
                +++ EEEE RR  ELE EERKL +TLEYQRRIENEAK KH+AEQ KK
Sbjct  182   AIEALSDEEEEYRRCNELEEEERKLAKTLEYQRRIENEAKEKHIAEQKKK  231



>ref|XP_002465805.1| hypothetical protein SORBIDRAFT_01g046140 [Sorghum bicolor]
 gb|EER92803.1| hypothetical protein SORBIDRAFT_01g046140 [Sorghum bicolor]
Length=1582

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/1051 (42%), Positives = 648/1051 (62%), Gaps = 103/1051 (10%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A ++ E ++AL  L+RG+H +ALRLMKD  A+H  + +  L+ R  GTV  + AS++DDP
Sbjct  35    AAVRAEVDKALACLQRGSHARALRLMKDALARHGEASS-PLLLRAHGTVHARAASVLDDP  93

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
               + RH + A+ +A+++V ++P SIE AHF+A LL++AAND + YEEVV ECER L+IE 
Sbjct  94    AARARHHRAALQAAQRAVELAPESIELAHFHAMLLFDAANDARAYEEVVAECERGLSIEV  153

Query  924   PIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG-SGEEKFRLI  1100
             P DP+  SL+        P   +  VQ ELR+LIQ++NLASISTWVK  G +G++K RLI
Sbjct  154   PSDPSPHSLR-------LPGPDVDQVQSELRSLIQKANLASISTWVKTLGGAGDDKLRLI  206

Query  1101  PIRRMSEDPMELRLV----QARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQS  1268
             P+RR++++PME RLV      R+PNEIKKATKTPEERR+EIEVR+AA RLLQQ+ E +  
Sbjct  207   PVRRIADEPMEGRLVPTAPSPRRPNEIKKATKTPEERRQEIEVRLAAMRLLQQQKEQSNG  266

Query  1269  FNDGERSLDLSAG----------TGQRGNERRKSGNARKNVSSM-ERRDCVRSYWNSMST  1415
                   +  LS G           G    +RRK G+ +   SS  ER D VR+YW S+  
Sbjct  267   VVSATPASSLSQGDEAPSSSQSSVGGHRADRRKGGSRKATGSSASERTDQVRAYWGSIPV  326

Query  1416  DMKKKLLRIRIVDLKSHFGSL----KDGL--ANEVLSEALSFAEANKAWKFWTCCHCVER  1577
             + +   L   I +LKSH+ S     KD    A++VL+EA+ FA  +  W F  C  C ++
Sbjct  327   EQRLAFLNTSISELKSHYASAIHKEKDAASAASDVLNEAIQFAIKHSKWDFMVCGRCRDQ  386

Query  1578  FADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQL  1757
             FAD E+   HV  EH+  LS +LQ ++PQ ++ +W EML+  +W+PLD  AA KL E+  
Sbjct  387   FADVEALRWHVTGEHVGLLSSELQEMVPQEIDADWAEMLIGWNWRPLDATAALKLFEED-  445

Query  1758  KCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKT----FGDGCNGTTVDSRE  1925
                     +N    +D D+ + ++ D + N    D+S + ++      +GCNG  V   E
Sbjct  446   --------QNDNLGTDRDK-ESNLLDNWSNK---DKSDMSESSALPHNEGCNGFGVVVSE  493

Query  1926  YDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLS  2105
              D                     + WP++DD ERA +LERI+  F+ L+K+  L   +L+
Sbjct  494   GD---------------------DKWPLSDDGERANILERIHSSFKILVKSHNLSVGNLN  532

Query  2106  KVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPE  2285
             +VI FAVEEL+ L  GS LLN+++D++PLCI FL A  L+K+ KFLQ+L  + GL R  E
Sbjct  533   RVIRFAVEELRGLPSGSLLLNHSLDESPLCIRFLEASSLRKVAKFLQDLMQASGLNRNLE  592

Query  2286  RSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaa  2465
             ++  + D  +  +    +EK+  + D S L+ D           TF     ++S      
Sbjct  593   KAEGLGDEDSSPKNHYVLEKVTLNSDSSELIIDGQ---------TFGGKFDSES------  637

Query  2466  issniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYEL  2645
                         +D+D LLSW++ G+S GEQL +W+R  +E++ Q ++++R L +EF  L
Sbjct  638   ------------VDTDALLSWLYAGSSVGEQLLAWNRMIDERSNQCVDLIRALGREFNSL  685

Query  2646  QGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEA  2825
             Q  CERK E L  EEA   VE L  EE  +RE    +  ++++  L+KR+ EL+E + E 
Sbjct  686   QNSCERKLEQLRNEEAFISVEGLFYEEQTRREQVGRYGFQTFEELLRKRQVELLECNTEE  745

Query  2826  TSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQA  3005
              S + R EI+ IS++LK+   L+ + FG+++   G++  L D +  E+D+WR+ D+++  
Sbjct  746   QSDSNRSEIDTISAILKE---LHTSHFGYDEALSGMAPRLYDFDGAEEDEWRLHDFIHPN  802

Query  3006  DSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYL  3185
             DS V++ + + KE V +E+SK+DA+IMR    ++QLE KL  VSA DYR IL+PL++S+L
Sbjct  803   DSMVQMVVSKMKEQVCMEISKVDAKIMRNFCVIRQLEHKLGPVSALDYRMILLPLMRSFL  862

Query  3186  RAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrk  3365
             ++HLE+L ++DA E+SDAAREAFLAELA D+KK++N G +  K SHEK++DKKK KD R+
Sbjct  863   QSHLEELVDKDARERSDAAREAFLAELALDAKKNANKGGD-MKQSHEKSKDKKKFKDSRR  921

Query  3366  tkdlkGSNGNGLHALHHDTAEE---ASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrri  3536
             +K+LK S+ +       D+A+E    +F ++ D    D +LS    + + ++EEE R R+
Sbjct  922   SKELKDSSWSDQSLSRQDSADEETAETFQMLADCDDLDCKLST-SDDYLNEQEEELRHRV  980

Query  3537  eleaeerkleetleYQRRIENEAKLKHLAEQ  3629
             +LEAEERKLEETLEYQRRIE EAK KHLAEQ
Sbjct  981   QLEAEERKLEETLEYQRRIEEEAKQKHLAEQ  1011


 Score =   523 bits (1347),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 259/392 (66%), Positives = 296/392 (76%), Gaps = 29/392 (7%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVN  4227
             +EDD ++RFQ DL +A+RQSL     +   P    +GT   S                 N
Sbjct  1213  IEDDFDKRFQEDLDEAMRQSL----GYDAYP----AGTISTS-----------------N  1247

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIF  4407
             G EVYGTGLKN  GEYNCFLNVIIQSLWH+RRFRDEFL++SS H HV DPC VCALY IF
Sbjct  1248  GTEVYGTGLKNAAGEYNCFLNVIIQSLWHIRRFRDEFLKTSSLHKHVEDPCAVCALYGIF  1307

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
               LS A+ + + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+TS 
Sbjct  1308  IDLSKAA-KGQGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYTSR  1366

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             +     +S D + +GSWDCAN +CI HSLFGMDV+ERMNC+ C +ESR LKYTSFFHNIN
Sbjct  1367  T-VYHGKSHDKNSIGSWDCANISCIAHSLFGMDVYERMNCHNCKMESRRLKYTSFFHNIN  1425

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             AS+LRT K+MC DSSFDELL +V MN QLACD D  GCGK NHIHH LST PHVFT VLG
Sbjct  1426  ASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGKPNHIHHILSTFPHVFTVVLG  1485

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQN  ESV+DI+ATL  +STEIDIS+ YRGLD  SKH LVSVVCYYGQHYHCFA+     
Sbjct  1486  WQNNKESVDDISATLAGISTEIDISIFYRGLDHGSKHTLVSVVCYYGQHYHCFAFKDG--  1543

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1544  RWVMYDDQTVKVIGSWDDVLVMCEKGHLQPQV  1575



>ref|XP_008346826.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
[Malus domestica]
Length=384

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/377 (75%), Positives = 317/377 (84%), Gaps = 10/377 (3%)
 Frame = +1

Query  4111  DTFHAHQKLPLI-----PRSGTAQISEMANLGVSCEDVATGIVNGIEVYGTGLKNEVGEY  4275
             DTF   QK P++     PR  +A +      GV   D+     +  +++GTGLKNEVGEY
Sbjct  5     DTFQERQKFPVVSNLRMPRKISADVDN----GVLHNDITNENASETDIFGTGLKNEVGEY  60

Query  4276  NCFLNVIIQSLWHLRRFRDEFLR-SSSEHIHVGDPCVVCALYDIFTALSLASSETRRDAV  4452
             NCFLNVIIQSLWH+R FRDE+LR S+SEH HVGDPCVVCALY+IFTALS AS++TRR+AV
Sbjct  61    NCFLNVIIQSLWHVRLFRDEYLRXSTSEHGHVGDPCVVCALYEIFTALSNASADTRREAV  120

Query  4453  APNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMG  4632
             AP SLRIALSNLYP+   FQE QMNDASEVL VIF+CLH+SFT  S  S+ ESV+SSC G
Sbjct  121   APTSLRIALSNLYPESNFFQEAQMNDASEVLVVIFDCLHRSFTPGSSLSNAESVESSCPG  180

Query  4633  SWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSS  4812
             SWDC+N+AC+VHS+FGMD+FERMNCY CGLESRHLKYTSFFHNINASALRTMKVMC +SS
Sbjct  181   SWDCSNNACMVHSIFGMDIFERMNCYYCGLESRHLKYTSFFHNINASALRTMKVMCTESS  240

Query  4813  FDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATL  4992
             +DELLN VEMNHQLACDP+A GCGK NHIHH L+TPPHVFTTVLGWQ TCES +DI ATL
Sbjct  241   YDELLNHVEMNHQLACDPEAGGCGKLNHIHHILTTPPHVFTTVLGWQKTCESADDIKATL  300

Query  4993  VALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGN  5172
              AL+TEIDISVLYRGLDPK+ H LVSVVCYYGQHYHCFAYSHD   WIMYDDKTVKVIG 
Sbjct  301   AALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHDRGCWIMYDDKTVKVIGG  360

Query  5173  WADVLTMCERGHLQPQV  5223
             WADVLTMCERGHLQPQV
Sbjct  361   WADVLTMCERGHLQPQV  377



>ref|XP_010229142.1| PREDICTED: uncharacterized protein LOC100846067 [Brachypodium 
distachyon]
Length=1554

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/1052 (41%), Positives = 641/1052 (61%), Gaps = 112/1052 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALIYRVQGTVCVKVASIIDDPN  746
             ++ +C++AL  L+RGN  KALRLMK+  A+H + SP   L+ R QGTV  + A+++ DP 
Sbjct  42    VRADCDKALACLQRGNQPKALRLMKEALARHGDGSP---LLLRAQGTVHARAAAVLTDPA  98

Query  747   VKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENP  926
              + RH + A+ +A ++V ++P+S+E AHF A LLYEAA+D + YE+VV ECER L IE+P
Sbjct  99    ARARHHRAALQAASRAVDLAPDSVELAHFRAMLLYEAASDNRSYEDVVAECERGLGIESP  158

Query  927   IDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG-SGEEKFRLIP  1103
              DPA  SL     +V  PE     VQ ELRNL+Q+++L+S+STWVK  G +G++K     
Sbjct  159   SDPAPHSL-----RVPPPEPE--QVQAELRNLVQKAHLSSLSTWVKTLGGTGDDKLGFF-  210

Query  1104  IRRMSEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQK-------  1250
               R+++DP EL L+ A    R+PNE+KKATKTPEERRKE+EV+VAA RLL+Q+       
Sbjct  211   --RLADDPTELHLLPAAPAPRRPNELKKATKTPEERRKEVEVQVAAMRLLEQQQLQHNAA  268

Query  1251  ---SESAQSFNDGERSLDLSAGTGQRGN--ERRKSGNARKNVSSMERR-DCVRSYWNSMS  1412
                S S+   + G+ +   S+     G+  +RRK G+ +  VSS   R D VR++W +M 
Sbjct  269   AASSSSSPPQSQGDEAPSSSSSQSIAGHRVDRRKGGSKKTTVSSASNRMDQVRAFWVTMP  328

Query  1413  TDMKKKLLRIRIVDLKSHFGSLKD------GLANEVLSEALSFAEANKAWKFWTCCHCVE  1574
              + +   L I I +LKSH+ +  +        A+ VL+E L F   N  W+FW C  C E
Sbjct  329   IEQRLAFLNISISELKSHYDTATEKEKDVATAASAVLNEVLEFVTENGDWQFWACGVCEE  388

Query  1575  RFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQ  1754
             R+AD    +QH + EH+  L P+LQ ++PQ ++ +W  ML +  WKP+D+ AA K+LE++
Sbjct  389   RYAD----LQHTLREHVGVLPPQLQEMVPQLIDADWAAMLTSSIWKPVDVAAALKVLEEE  444

Query  1755  LKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDK  1934
                 +             D  KD +S         D   IK          T +S     
Sbjct  445   QADNI-----------GPDRDKDSMSS--------DNWSIKD------KSDTSESSASPH  479

Query  1935  NSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVI  2114
             N E       + G  +   +  WP++DD ERAK+LERI+ +FQ L+K K +   HL++VI
Sbjct  480   NEEC-----DSFGAAMREGARKWPLSDDDERAKILERIHSLFQILVKYKNISVGHLNRVI  534

Query  2115  HFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST  2294
             HFA+EEL+ +  GS LLN++ID++PLCICFL AP L+K+LKFLQ+L+ SCGL R  E+  
Sbjct  535   HFAMEELRGMPSGSLLLNHSIDESPLCICFLEAPSLRKVLKFLQDLTQSCGLNRCSEKDG  594

Query  2295  AIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaiss  2474
              + D     +  D ++K+      S L+ D      K  P                    
Sbjct  595   ELGDEDCFRKNHDVLQKVTLDSGSSKLILDSQVFGGKSGP--------------------  634

Query  2475  niQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGL  2654
                 +N    D+DE +SW++ G+  G+QL+ W+   EE++ Q ++++++LEKEF  L+  
Sbjct  635   ----ENA---DTDEFISWLYAGSPIGDQLSEWTCKLEERSNQGVQVLQMLEKEFAVLKHC  687

Query  2655  CERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATST  2834
             CERK E L+ EE +  VE++ LEE ++R+    +  + Y+  LKKR DEL   + E   T
Sbjct  688   CERKHEQLSNEEGVLAVENILLEEQRQRDCLGRYSYQGYEELLKKRHDELSNLNAEQLLT  747

Query  2835  NYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSC  3014
              YR E++AIS+ LK+   +  + FG+++ + G++S LCD +  E  DWR+ D+++  DS 
Sbjct  748   -YRSELDAISTALKE---VCTSPFGYDEGFSGMTSRLCDFDGAEVSDWRLHDFVHPNDSV  803

Query  3015  VEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAH  3194
             V+ A+ + KE +++ELSK+DARIMR V+ MQQL++KL   S  DYR I +PL+KS+LR+ 
Sbjct  804   VQTAVLKLKEQIAMELSKLDARIMRSVAVMQQLDLKLAPASFLDYRTIFLPLLKSFLRSR  863

Query  3195  LEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkd  3374
             LE+L ++DA EKSDAAREAFLAELA D++K++N G +  K S+EK++DKKK+KD R+ KD
Sbjct  864   LEELMDKDAREKSDAAREAFLAELALDAEKNANKGGDK-KLSNEKSKDKKKMKDSRRYKD  922

Query  3375  lkGSNGNGLH-----ALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrrie  3539
             LK  + +  +     ++  +T+E++   V  D       + NG SN   ++EEE RRR +
Sbjct  923   LKDMSWSDQYIVRPNSVDEETSEQSQTLVDCDDFDHKLSICNGHSN---EQEEELRRRAQ  979

Query  3540  leaeerkleetleYQRRIENEAKLKHLAEQHK  3635
             LEAEERKLEETLEYQRRIE EAK +HLAEQ +
Sbjct  980   LEAEERKLEETLEYQRRIEEEAKQRHLAEQSR  1011


 Score =   515 bits (1326),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 255/403 (63%), Positives = 295/403 (73%), Gaps = 40/403 (10%)
 Frame = +1

Query  4015  ESGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGV  4194
             +SG  T   + +EDD ++RFQ DL KAV QSL                            
Sbjct  1185  DSGVITPATVCIEDDSDKRFQEDLRKAVSQSL----------------------------  1216

Query  4195  SCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGD  4374
                    G  NG +V+G GLKN  GEYNCFLNVIIQSLWHLRRFR EFL++SS+H H+ D
Sbjct  1217  -------GTSNGKDVHGAGLKNAAGEYNCFLNVIIQSLWHLRRFRHEFLKTSSQHKHIED  1269

Query  4375  PCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVI  4554
             PC VCALYDIF  LS AS + + + VAP SLRIALS  YP+   FQEGQMNDASEVLGVI
Sbjct  1270  PCAVCALYDIFIDLSKAS-KGQGEPVAPTSLRIALSKSYPNNRFFQEGQMNDASEVLGVI  1328

Query  4555  FECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRH  4734
             FECLH+S+T     S  +S +S+ +GSWDCAN++CI H LFGMDV+ERMNC+ CGLESR 
Sbjct  1329  FECLHKSYTCLVD-SHAKSHESNSIGSWDCANNSCIAHHLFGMDVYERMNCHNCGLESRR  1387

Query  4735  LKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLS  4914
             LKYTSFFHNINAS+LRT K+MC D  FD+LL  V MN QLACDPD  GCGK NHIHH LS
Sbjct  1388  LKYTSFFHNINASSLRTAKMMCPDP-FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILS  1446

Query  4915  TPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQH  5094
               PHVFT VLGWQN+ ESV+DI+ATL  +STEIDISV YRGLD  +KH LVSVVCYYGQH
Sbjct  1447  RSPHVFTVVLGWQNSKESVDDISATLAGISTEIDISVFYRGLDQGTKHSLVSVVCYYGQH  1506

Query  5095  YHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             YHCFA+  +H  W+MYDD+TVK+IG+WADVL MCE+GHLQPQV
Sbjct  1507  YHCFAFEDEH--WVMYDDQTVKIIGDWADVLIMCEKGHLQPQV  1547



>emb|CDY61846.1| BnaAnng17800D [Brassica napus]
Length=415

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/400 (68%), Positives = 326/400 (82%), Gaps = 5/400 (1%)
 Frame = +1

Query  4027  KTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCED  4206
             KTLRQL  E+D+EE+FQADL KAVRQSLDT+   + +    R+      E+ +  +S   
Sbjct  13    KTLRQLQAEEDEEEKFQADLKKAVRQSLDTYQGGRNMTSCLRTPL----EVNSHKISDST  68

Query  4207  VATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIHVGDPCV  4383
               +     + ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS  +H HVGDPCV
Sbjct  69    KESPTSTEVGIFGTGLQNEVGEYNCFLNVIIQSLWNLGVFRAEFLRSSMLDHHHVGDPCV  128

Query  4384  VCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFEC  4563
             VC+LY++ TALS AS E R++ V P++LRIALSNLYPD   FQE QMNDASEVL VIF+C
Sbjct  129   VCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEAQMNDASEVLAVIFDC  188

Query  4564  LHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKY  4743
             LH+SF  +S  SDT+S +S+  GSWDCAN  CI H+LFGM++FE++NC  C LESRH+KY
Sbjct  189   LHRSFAQSSSVSDTDSSESNYTGSWDCANRTCIAHTLFGMNIFEQLNCNSCELESRHMKY  248

Query  4744  TSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPP  4923
             TSFFHNINASALR MKV C +++FDELLNLVEMNHQLACDP+  GCGK NHI HFL+TPP
Sbjct  249   TSFFHNINASALRNMKVTCPETAFDELLNLVEMNHQLACDPETGGCGKPNHIRHFLNTPP  308

Query  4924  HVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHC  5103
             HVFT VLGWQNTCESVEDI ATL AL+TEIDIS++YRGLDPKS + L SVVCYYGQHYHC
Sbjct  309   HVFTAVLGWQNTCESVEDIAATLAALNTEIDISIMYRGLDPKSIYSLASVVCYYGQHYHC  368

Query  5104  FAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             FAYSH+H+RWIMYDDKTVKVIG+W+DVL+MC++GHLQPQ+
Sbjct  369   FAYSHEHDRWIMYDDKTVKVIGSWSDVLSMCKKGHLQPQL  408



>gb|ABL66740.1| At3g47900 [Arabidopsis thaliana]
Length=367

 Score =   552 bits (1423),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 263/346 (76%), Positives = 301/346 (87%), Gaps = 1/346 (0%)
 Frame = +1

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             G+S + + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH H
Sbjct  16    GLSDDTMESRSSTGVTIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRSSTREHHH  75

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVC+LY+IFTALS ASSE + + VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  76    VGDPCVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  135

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF  +S  SD +S DS+C GSWDCAN  CI HSLFGMD+FE++NCY CGLE
Sbjct  136   AVIFDCLHRSFAQSSSVSDVDSSDSNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLE  195

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+  GCGK NHIHH
Sbjct  196   SRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPETGGCGKLNHIHH  255

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPPHVFTTVLGWQNTCE+VEDI ATL AL+TEIDIS++YRGLDPKS + LVSVVCYY
Sbjct  256   ILTTPPHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYY  315

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFA+S +H++WIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  316   GQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVLSMCERGHLQPQV  361



>emb|CAB41149.1| putative protein [Arabidopsis thaliana]
Length=365

 Score =   543 bits (1398),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 299/346 (86%), Gaps = 3/346 (1%)
 Frame = +1

Query  4189  GVSCEDVATGIVNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSS-EHIH  4365
             G+S + + +    G+ ++GTGL+NEVGEYNCFLNVIIQSLW+L  FR EFLRSS+ EH H
Sbjct  16    GLSDDTMESRSSTGVTIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRSSTREHHH  75

Query  4366  VGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVL  4545
             VGDPCVVC+LY+IFTALS ASSE + + VAP+SLRIALSNLYPD   FQE QMNDASEVL
Sbjct  76    VGDPCVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVL  135

Query  4546  GVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLE  4725
              VIF+CLH+SF  +S  SD +S DS+C GSWDCAN  CI HSLFGMD+FE++NCY CGLE
Sbjct  136   AVIFDCLHRSFAQSSSVSDVDSSDSNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLE  195

Query  4726  SRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHH  4905
             SRHLKYTSFFHNINASALRTMKV C ++SFDELLNLVEMNHQLACDP+  GCGK NHIHH
Sbjct  196   SRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPETGGCGKLNHIHH  255

Query  4906  FLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYY  5085
              L+TPPHVFTT  GWQNTCE+VEDI ATL AL+TEIDI+++YRGLDPKS + LVSVVCYY
Sbjct  256   ILTTPPHVFTT--GWQNTCETVEDIAATLAALNTEIDINIMYRGLDPKSTYSLVSVVCYY  313

Query  5086  GQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             GQHYHCFA+S +H++WIMYDDKTVKVIG+W DVL+MCERGHLQPQV
Sbjct  314   GQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVLSMCERGHLQPQV  359



>gb|EEC74581.1| hypothetical protein OsI_10153 [Oryza sativa Indica Group]
Length=1598

 Score =   581 bits (1497),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 413/1051 (39%), Positives = 617/1051 (59%), Gaps = 112/1051 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALIYRVQGTVCVKVASIIDDPN  746
             ++  CE+AL +L+RGNH KALR++KD   KH E SP   L+ R QGTV  + A+++D+P 
Sbjct  39    VRAVCEKALAALQRGNHAKALRVVKDAVGKHGEGSP---LLLRAQGTVLARYAAVLDEPV  95

Query  747   VKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENP  926
              + RH + A+++ARK+V ++P+SIE AHF+A LLYE A+D   YE    EC R +AI++P
Sbjct  96    SRARHQRLALEAARKAVELAPDSIELAHFHAMLLYEIASDTTGYEAASSECNRGMAIQSP  155

Query  927   IDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG---EEKFRL  1097
              DPA  SL+        P   +  V+ EL NL+QRSN+ SIS WVKN   G   E+K R+
Sbjct  156   TDPAPHSLR-------LPAPDVEQVKAELSNLLQRSNMTSISLWVKNMNMGYTPEDKVRV  208

Query  1098  IPIRRM-SEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESA  1262
              PIRR  ++D  E+RL+ A    R+PNEIKKA KTPEERRKEIEVR+AA RL++Q+  +A
Sbjct  209   FPIRRGGADDSSEVRLLPAAPAPRRPNEIKKANKTPEERRKEIEVRLAAMRLMEQQKHNA  268

Query  1263  QSF-----------NDGERSLDLSAGTGQRGNERRKSGNARKNVSSME-RRDCVRSYWNS  1406
              S            ++   S   S+ +G R + RRK G+ +   S +  R + VR +W +
Sbjct  269   TSASSSTSQSQSPGDEAPSSSCQSSVSGHRAD-RRKGGSRKAAASPVSGRMNQVREFWAT  327

Query  1407  MSTDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALSFAEANKAWKFWTCCHC  1568
             +  D +   L   I +LKSH+ +     KD   L ++VL+EA+ FA  +  W+F  C  C
Sbjct  328   VPMDRRLAFLSTSISELKSHYATAMHKEKDAASLVSDVLNEAIRFATRSGKWEFLVCGRC  387

Query  1569  VERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLE  1748
              E FAD+ESH+ H + EH+  L P+L  V+P+ +++ W E L   +W+P+D  AA K+LE
Sbjct  388   EEHFADAESHVHHAMEEHVGVLPPRLNDVVPEEIDDAWAEKLTGSTWRPVDATAALKILE  447

Query  1749  KQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREY  1928
             ++L        +N  +  D D    DI                    + C      +RE 
Sbjct  448   EELA-------DNVGSDRDKDSMSSDIWSTKDKSDT--SDSSTSPHNEECESFGAVTREG  498

Query  1929  DKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSK  2108
             D+                      WP++DD ERA +LERI+ +F+ L+K+K L  SHL+K
Sbjct  499   DRK---------------------WPLSDDEERANILERIHSLFKILVKHKNLSLSHLNK  537

Query  2109  VIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLG-RYPE  2285
             V+H  +EEL+ +   S LLN+++D++PLCICFL    L+K+LKFLQEL  + GL  R  +
Sbjct  538   VLHITMEELRKMHSASLLLNHSLDESPLCICFLDVSSLRKVLKFLQELMQASGLNDRNTD  597

Query  2286  RSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaa  2465
             +   + D  +  +    +EK+    D S L+ D      +    +  D VV         
Sbjct  598   KDEEVADKDSFPKNRSNLEKVTLDSDSSLLILDGQAFEMR----SDRDNVV---------  644

Query  2466  issniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYEL  2645
                           +D  LSW++ G S  EQL  W+   E ++ Q M I+  LEKEF  L
Sbjct  645   --------------ADPFLSWLYTGPSVEEQLLDWNHMLEVRSDQCMHILHELEKEFSAL  690

Query  2646  QGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEA  2825
             Q   E+K + L+ EE L  V+ L  EE ++R+    +  + Y+  LKKR+++L E + E 
Sbjct  691   QNSYEQKHDQLSSEEGLLAVDSLLCEEQRRRDDVDPYPFQGYEELLKKRQEQL-ELNAEE  749

Query  2826  TSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQA  3005
               +  R E+ AIS++L++ ++     F +++T+ G++++  D +  E+D+W   D+ +  
Sbjct  750   LFSGCRSELHAISTILREVKTA---PFRYDETFSGMTTNHRDYDGTEEDEWGFYDFEHSN  806

Query  3006  DSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYL  3185
             DS V++ + R KEHV++EL+KIDARIMR+ + ++QL++KL   S  DYR I++PL+KS+L
Sbjct  807   DSVVQLVVSRLKEHVAMELNKIDARIMRISAVIEQLKLKLGPASVLDYRTIILPLLKSFL  866

Query  3186  RAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrk  3365
             R HLE+L ++DA E+SDAA EAFLAELA D+K+++N  S + K SH+K++DKKK+KD RK
Sbjct  867   RTHLEELVDKDARERSDAASEAFLAELALDAKRNANKVS-DTKQSHDKSKDKKKVKDSRK  925

Query  3366  tkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrriele  3545
             +KDLK  + +  + +  D+ +E           E +E S   S++   ++EE R R+ LE
Sbjct  926   SKDLKDLSWSDQYLVRPDSVDE-----------ETSEQSLSTSDNYLNDQEEFRNRLRLE  974

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             AEERKLEETLEYQR IE EAK KHLAEQH++
Sbjct  975   AEERKLEETLEYQRWIEEEAKKKHLAEQHRR  1005


 Score =   503 bits (1295),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 287/394 (73%), Gaps = 41/394 (10%)
 Frame = +1

Query  4042  LHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             L++EDD  +RF+ADL +AV QSL                                   G 
Sbjct  1239  LYIEDD--KRFKADLERAVLQSL-----------------------------------GT  1261

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              N  EVYGTGLKN  GEYNCFLNVIIQSLWHL+RFRD FL++SS H HV DPC VCALYD
Sbjct  1262  SNEKEVYGTGLKNAAGEYNCFLNVIIQSLWHLKRFRDGFLKTSSLHKHVEDPCAVCALYD  1321

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IFT LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  1322  IFTDLSKASEE-QGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  1380

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +     +S + + +GSWDCA+S+CI H LFGMD+ ERMNC  C LESR LKYTSFFHN
Sbjct  1381  SRADCQ-VKSHEINYIGSWDCASSSCIAHCLFGMDILERMNCQSCRLESRRLKYTSFFHN  1439

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K M  D SFD+LL +V MN  LACDP+  GCGK NHIHH LS+PPHVFT V
Sbjct  1440  INASSLRTAKDMFPDHSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHHILSSPPHVFTVV  1499

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN  ESV+DI+ TL  +STEIDIS  YRGLD  SKH LVSVVCYYGQHYHCFA+  +
Sbjct  1500  LGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--E  1557

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               +W+MYDD+TVKV+GNW DVL MC++GHLQPQV
Sbjct  1558  DGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQV  1591



>gb|ABF94151.1| Ubiquitin carboxyl-terminal hydrolase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1579

 Score =   579 bits (1492),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 412/1051 (39%), Positives = 616/1051 (59%), Gaps = 112/1051 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALIYRVQGTVCVKVASIIDDPN  746
             ++  CE+AL +L+RGNH KALR++KD   KH E SP   L+ R QGTV  + A+++D+P 
Sbjct  39    VRAVCEKALAALQRGNHAKALRVVKDAVGKHGEGSP---LLLRAQGTVLARYAAVLDEPV  95

Query  747   VKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENP  926
              + RH + A+++ARK+V ++P+SIE AHF+A LLYE A+D   YE    EC R +AI++P
Sbjct  96    SRARHQRLALEAARKAVELAPDSIELAHFHAMLLYEIASDTTGYEAASSECNRGMAIQSP  155

Query  927   IDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG---EEKFRL  1097
              DPA  SL+        P   +  V+ EL NL+QRSN+ SIS WVKN   G   E+K R+
Sbjct  156   TDPAPHSLR-------LPAPDVEQVKAELSNLLQRSNMTSISLWVKNMNMGYTPEDKVRV  208

Query  1098  IPIRRM-SEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESA  1262
              PIRR  ++D  E+RL+ A    R+PNEIKKA KTPEERRKEIEVR+AA RL++Q+  +A
Sbjct  209   FPIRRGGADDSSEVRLLPAAPAPRRPNEIKKANKTPEERRKEIEVRLAAMRLMEQQKHNA  268

Query  1263  QSF-----------NDGERSLDLSAGTGQRGNERRKSGNARKNVSSME-RRDCVRSYWNS  1406
              S            ++   S   S+ +G R + RRK G+ +   S +  R + VR +W +
Sbjct  269   TSASSSTSQSQSPGDEAPSSSCQSSVSGHRAD-RRKGGSRKAAASPVSGRMNQVREFWAT  327

Query  1407  MSTDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALSFAEANKAWKFWTCCHC  1568
             +  D +   L   I +LKSH+ +     KD   L ++VL+EA+ FA  +  W+F  C  C
Sbjct  328   VPMDRRLAFLSTSISELKSHYATAMHKEKDAASLVSDVLNEAIRFATRSGKWEFLVCGRC  387

Query  1569  VERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLE  1748
              E FAD+ESH+ H + EH+  L P+L  V+P+ +++ W E L   +W+P+D  AA K+LE
Sbjct  388   EEHFADAESHVHHAMEEHVGVLPPRLNDVVPEEIDDAWAEKLTGSTWRPVDATAALKILE  447

Query  1749  KQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREY  1928
             ++L        +N  +  D D    DI                    + C      +RE 
Sbjct  448   EELA-------DNVGSDRDKDSMSSDIWSTKDKSDT--SDSSTSPHNEECESFGAVTREG  498

Query  1929  DKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSK  2108
             D+                      WP++DD ERA +LERI+ +F+ L+K+K L  SHL+K
Sbjct  499   DRK---------------------WPLSDDEERANILERIHSLFKILVKHKNLSLSHLNK  537

Query  2109  VIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLG-RYPE  2285
             V+H  +EEL+ +   S LLN+++D++PLCICFL    L+K+LKFLQEL  + GL  R  +
Sbjct  538   VLHITMEELRKMHSASLLLNHSLDESPLCICFLDVSSLRKVLKFLQELMQASGLNDRNTD  597

Query  2286  RSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaa  2465
             +   + D  +  +    +EK+    D S L+ D      +    +  D VV         
Sbjct  598   KDEEVADKDSFPKNRSNLEKVTLDSDSSLLILDGQAFEMR----SDRDNVV---------  644

Query  2466  issniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYEL  2645
                           +D  LSW++ G S  EQL  W+   + ++ Q   I+  LEKEF  L
Sbjct  645   --------------ADPFLSWLYTGPSVEEQLLDWNHMLDVRSDQCTHILHELEKEFSAL  690

Query  2646  QGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEA  2825
             Q   E+K + L+ EE L  V+ L  EE ++R+    +  + Y+  LKKR+++L E + E 
Sbjct  691   QNSYEQKHDQLSSEEGLLAVDSLLCEEQRRRDDVDPYPFQGYEELLKKRQEQL-ELNAEE  749

Query  2826  TSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQA  3005
               +  R E+ AIS++L++ ++     F +++T+ G++S+  D +  E+D+W   D+ +  
Sbjct  750   LFSGCRSELHAISTILREVKTA---PFRYDETFSGMTSNHRDYDGTEEDEWGFYDFEHSN  806

Query  3006  DSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYL  3185
             DS V++ + R KEHV++EL+KIDARIMR+ + ++QL++KL   S  DYR I++PL+KS+L
Sbjct  807   DSVVQLVVSRLKEHVAMELNKIDARIMRISAVIEQLKLKLGPASVLDYRTIILPLLKSFL  866

Query  3186  RAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrk  3365
             R HLE+L ++DA E+SDAA EAFLAELA D+K+++N  S + K SH+K++DKKK+KD RK
Sbjct  867   RTHLEELVDKDARERSDAASEAFLAELALDAKRNANKVS-DTKQSHDKSKDKKKVKDSRK  925

Query  3366  tkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrriele  3545
             +KDLK  + +  + +  D+ +E           E +E S   S++   ++EE R R+ LE
Sbjct  926   SKDLKDLSWSDQYLVRPDSVDE-----------ETSEQSLSTSDNYLNDQEEFRNRLRLE  974

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             AEERKLEETLEYQR IE EAK KHLAEQH++
Sbjct  975   AEERKLEETLEYQRWIEEEAKKKHLAEQHRR  1005


 Score =   451 bits (1161),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 269/394 (68%), Gaps = 63/394 (16%)
 Frame = +1

Query  4042  LHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             L++EDD  +RF+ADL +AV QSL                                   G 
Sbjct  1242  LYIEDD--KRFKADLERAVLQSL-----------------------------------GT  1264

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              N  EVYGTGLKN  GEYNCFLNVIIQSLWHL+RFRD FL++SS H HV DPC VCALYD
Sbjct  1265  SNEKEVYGTGLKNAAGEYNCFLNVIIQSLWHLKRFRDGFLKTSSLHKHVEDPCAVCALYD  1324

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IFT LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  1325  IFTDLSKASEE-QGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  1383

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +     +S + + +GSWDCA+S+CI H LFGMD+ ERMNC  C LESR LKYTSFFHN
Sbjct  1384  SRADCQ-VKSHEINYIGSWDCASSSCIAHCLFGMDILERMNCQSCRLESRRLKYTSFFHN  1442

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K M  D SFD+LL +V MN  LACDP+                       V
Sbjct  1443  INASSLRTAKDMFPDHSFDDLLKIVIMNDHLACDPE----------------------DV  1480

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN  ESV+DI+ TL  +STEIDIS  YRGLD  SKH LVSVVCYYGQHYHCFA+  +
Sbjct  1481  LGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--E  1538

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               +W+MYDD+TVKV+GNW DVL MC++GHLQPQV
Sbjct  1539  DGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQV  1572



>ref|XP_010661023.1| PREDICTED: uncharacterized protein LOC104881688 [Vitis vinifera]
Length=2418

 Score =   590 bits (1521),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 402/1039 (39%), Positives = 619/1039 (60%), Gaps = 88/1039 (8%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDPNV  749
             IK E ERA +  RRGNH KAL+LM++LC +H++S   AL + V+G +   +A++IDDPN+
Sbjct  35    IKPEIERAQSVFRRGNHKKALKLMQELCRRHQSS---ALAHNVRGAMLFNLAALIDDPNI  91

Query  750   KNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENPI  929
             K RHLKNA++ AR++  +SP S+E+AHFYA+LL+E A+D + Y+EV++EC+RAL      
Sbjct  92    KQRHLKNAVEPARRARFLSPKSVEYAHFYAHLLFELADDKESYQEVMRECQRALKF----  147

Query  930   DPAKESLQENQQ-KVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG--EEKFRLI  1100
                   LQE  Q     P++R+A +  EL  L+++S +   ST +   G G  EEKF+  
Sbjct  148   ------LQEGDQLDQLMPQSRMAELHQELEALVKKSTINMYSTMMIKLGLGDLEEKFKF-  200

Query  1101  PIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSFNDG  1280
                                  E KK  +T  E R+EIE ++  AR+ Q+  ES       
Sbjct  201   ------------------NSKEEKKKLRTSTEGRREIEAQMEVARVPQKTLESLPL----  238

Query  1281  ERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLK  1460
             E   +  +    R   R+KS N +K VS  +R   V+ YWNS+S+D ++ LL++RI DL+
Sbjct  239   EEGEEELSSRALRLERRKKSANIKKMVSLGDRIKQVKKYWNSLSSDTRRGLLQVRISDLR  298

Query  1461  SHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSP  1640
             ++F S KD LA  VLSEA++FAE NK WKF  CC C E+F D   +++H + EH+  LSP
Sbjct  299   AYFSSSKDDLAAAVLSEAIAFAENNKTWKFMACCVCDEKFTDLSPYVEHFMEEHVGKLSP  358

Query  1641  KLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESK  1820
             K+  V+PQ ++ +WV+++    WKP+D  A  +  E ++K      ++  +T  DMD+  
Sbjct  359   KMLKVMPQKIDRDWVQIIEKGIWKPVDALAVFQTSEDRVKSWSSSIVKR-HTMIDMDDYL  417

Query  1821  DDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKN-SEVWMDRDGNEGTKICPPSE  1997
             +      C    W+              T    +++D+   EV +    +EG    P   
Sbjct  418   E-----ICIKDHWE-----------SYSTEEKKKQFDEEFMEVEIGNQKDEGGNHEPREN  461

Query  1998  ---SWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLN  2168
                 WP++DDP+R + L+ I  +FQ L++ ++L + H+ +V+ + ++ELQ     SQLLN
Sbjct  462   DWPGWPLSDDPQRERTLKGIQAMFQILLRQRHLATRHIVQVMQYTMDELQIFASVSQLLN  521

Query  2169  YNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKI  2348
             + +D T LCICFLG  +L+K+L+FLQ +++ CG+ +  E+ ++ D +  G QG +  E+I
Sbjct  522   HGLDHTLLCICFLGVSQLEKVLRFLQSVAYICGVTKCSEKGSSKDKVFVGAQGSEIKERI  581

Query  2349  VFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSW  2528
             VFS D SCLL D+     +L   T++D +  D +  ++AI  +   +N  L D D L+ W
Sbjct  582   VFSSDSSCLLLDKRLLRGELNLSTYNDAIADDGSAATSAIDDH---ENDVLPDGDSLVPW  638

Query  2529  IFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVE  2708
             +F G S GEQL SW+  RE+K  Q M+I  +L+KE   L+GLC++K  H  YE+ALQ +E
Sbjct  639   LFSGCSIGEQLASWACLREDKKHQGMKIFHILQKELSHLEGLCQKKSMHSIYEDALQAIE  698

Query  2709  DLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAES  2888
              +CLEE K+R    +++ + Y+  L++ R E+     +    +++ E++ IS++LK+  +
Sbjct  699   RVCLEESKRRAQDPEYLPQYYEYLLEQLRREVKVDDGDML-LSHKCELDLISNILKEVHT  757

Query  2889  LNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSK  3068
             ++VN               C+     D     +++L ++D+ VE  I+R +  V++EL +
Sbjct  758   MSVNLLS------------CEASPSPD-----QEHLQKSDTVVEETIRRYEVQVTLELCR  800

Query  3069  IDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLR------AHLEDLAERDATEK  3230
             IDARIMRVV+ M+Q ++KL + SA DYR I+V L+KS++R      A LEDL ++DA +K
Sbjct  801   IDARIMRVVAAMRQQDLKLGAASALDYRSIMVILLKSFVRLKSPFQARLEDLVDKDAIKK  860

Query  3231  SdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHAL  3410
             SD AREA LA+LA DS+K+ + G  N K    K++DKKK K YRK KDLK S+GN    L
Sbjct  861   SDVAREALLAQLALDSEKNISRGGYNTKQMQRKSKDKKKNKSYRKAKDLKASSGNEQLLL  920

Query  3411  HHDTAEEASFSVVHDGGSEDAELSNGGSNS-ITQeeeeqrrrieleaeerkleetleYQR  3587
             H + A++A F    D  + ++++    S + I Q EEE R ++ELEAEERKL+E LE+Q 
Sbjct  921   HEEDAKQAYFPDAFDDQNPNSKIGIPVSAAEIKQPEEELRLQLELEAEERKLKEILEFQL  980

Query  3588  RIENEAKLKHLAEQHKKGA  3644
             +IENE+K KHLAEQ+K G 
Sbjct  981   QIENESKQKHLAEQNKVGG  999


 Score =   331 bits (849),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +1

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGD-PCVVCALYDI  4404
             G+   G GL+N     +C LN IIQSLWHLR FR E ++S++ H+H+ D  CV C+L  I
Sbjct  2084  GVPQGGAGLENYAN--DCSLNAIIQSLWHLRWFRRELMKSAA-HLHMIDEACVYCSLNSI  2140

Query  4405  FTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTS  4584
             F+ L+ AS  + + A++P  LR ALSNL P   L+++G+MNDASE+L  I E LH SF+ 
Sbjct  2141  FSLLNSASISSHKKAISPGPLRDALSNLDPQSNLYKKGEMNDASEILHKILEGLHLSFS-  2199

Query  4585  ASGASDTESVDSSCMGSWD---CANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFF  4755
                   T+  +S+   SWD   C +  CI HSLFG+ + ER+ CY CG ESR   Y S F
Sbjct  2200  ------TKKEESNGWESWDHLDCPSDICITHSLFGIKIRERVACYHCGCESRQHGYNSLF  2253

Query  4756  HNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFT  4935
             H INAS LR  K+   DSSFD LL LV+M+ Q+ C+P+  GCGK N I   LS PPH+F 
Sbjct  2254  HLINASELRKKKITHMDSSFDNLLKLVKMDDQVTCNPEEGGCGKLNSIDQILSDPPHLFV  2313

Query  4936  TVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYS  5115
              +LGWQ+  E+ ED++ TL AL+TEIDI+V+Y  LD   K+ L+S+VC++ +H  CFAY 
Sbjct  2314  VLLGWQSVSENSEDVSTTLAALTTEIDIAVIYGDLDEGRKYHLISMVCFHSRHLTCFAYD  2373

Query  5116  HDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             H H+ W+ Y+D  V+VIG+W DV+T C++G  QPQ+
Sbjct  2374  HQHKNWVHYNDAIVEVIGHWNDVVTKCQQGKFQPQL  2409


 Score =   323 bits (827),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 265/911 (29%), Positives = 433/911 (48%), Gaps = 131/911 (14%)
 Frame = +3

Query  519   DQAVVESETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRV  698
             D+AV E +T A     +I  E  RA  +  RGNH +AL +MK+L +++ +S  +   +  
Sbjct  1101  DKAVEEEKTEA-----HITSEIARAEKTSERGNHRRALMIMKELSSRNPSSAQVHFSH--  1153

Query  699   QGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEY  878
              G +C +  S+  DP  K R+LKNA++  ++++ + P+ +++  FY +L+++ A+    Y
Sbjct  1154  AGLICTQAKSM-KDPTAKKRYLKNALEPVQRAMSLDPDELKYFCFYPSLIFDLASHADAY  1212

Query  879   EEVVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLAS-IST  1055
              EV+Q   R           ++ LQE              V+G L   ++   L S    
Sbjct  1213  REVMQVVGRT----------RQRLQER-----------GLVRGILDKHMEALFLCSRYIV  1251

Query  1056  WV---KNFGSGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVA  1226
             W    KN    +E+F+                          K       + K+I+ +  
Sbjct  1252  WQLEQKNVNFDDEQFK-------------------------HKYMANAMRKMKQIKAKSE  1286

Query  1227  AARLLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKS-GNARKNVSSMERRDCVRSYWN  1403
             A R+ Q+  +S     D +   +++ G   R  ERRK+  N +K  +  ++   V+ YWN
Sbjct  1287  AVRVTQKTLQSMDFQEDFQEEEEMTLGA--RILERRKTLTNIKKLTALGDKITQVQGYWN  1344

Query  1404  SMSTDMKKKLLRIRIVDLKSHFGSLKDG-LANEVLSEALSFAEANKAWKFWTCCHCVERF  1580
             S+S D ++  L++RI DLK HF    +  LA  VLSEA+ F + N +WKF  CC C E+F
Sbjct  1345  SLSADTQRGFLKVRICDLKEHFIRFANNDLAVAVLSEAIGFLQENDSWKFMECCVCAEKF  1404

Query  1581  ADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLK  1760
              D   + +H   EHM  LS +L    PQ ++++WV+++    WKP D  A  ++ E +LK
Sbjct  1405  TDLLLYAEH-FAEHMGGLSERLSLFQPQEIDSDWVDIIEKGGWKPEDARAVLQISEDELK  1463

Query  1761  CRVHGFLENTYTRSDMD-ESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDKN  1937
              +    +E T    DMD   ++ I DP      +    +KK F +      +++   ++N
Sbjct  1464  RKSSSHVECTVM--DMDVHLQNCIKDPR---ESYSVEEMKKQFDE----MLMEAEIGNQN  1514

Query  1938  SEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVIH  2117
              E    + GN      P    WP+ D P RAK L +I  + Q L+K +YL  +H+ +VI 
Sbjct  1515  DE----KSGNHE----PEGSEWPLPDYPRRAKTLAKIQGMLQMLLKGRYLSRTHVLQVIR  1566

Query  2118  FAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTA  2297
             + +EELQ      QL N  +D T L IC L  P+L+K+L+FL  +++ CG+ ++PE   A
Sbjct  1567  YTLEELQIFASELQLRNLGLDNTLLGICLLEFPQLEKVLRFLHSIAYICGITKFPEEGGA  1626

Query  2298  IDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissn  2477
                   G Q  +  E I  S D S LL DE     +L          ++SN  S +  S 
Sbjct  1627  ----PAGAQKSEIKETIGVSIDSSYLLLDERLVTGEL---DVSTSNNSNSNEGSGSTFSL  1679

Query  2478  iQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLC  2657
                D+  L      + W+F+G S  E+L SW+   +++  + +E+   L+KEF  L  LC
Sbjct  1680  EDHDDDTLPGGGIFVPWLFVGRSIEEKLESWACLLDDRKHKKIEVHGFLDKEFPPLWSLC  1739

Query  2658  ERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTN  2837
               K  H   EE L+ +  +  +E  +      +V + Y   L KRR E+ E      +  
Sbjct  1740  NMKIVHSINEEELKEIRSISDDELNRSAQDPAYVPQ-YLEYLSKRRKEVHEVADVDDTPL  1798

Query  2838  YRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCV  3017
                +++ +S++L++A                             DD R            
Sbjct  1799  IHHQLDLLSNLLEEA-----------------------------DDLR------------  1817

Query  3018  EVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHL  3197
               AI++ +   ++EL +IDARI R+++ MQQ   ++   SA  YR I+V  +KS++ AHL
Sbjct  1818  -KAIRKYEVQTTLELCRIDARIARILAAMQQGGFEVGEASARAYRSIMVFSLKSFIGAHL  1876

Query  3198  EDLAERDATEK  3230
             EDL ++DATEK
Sbjct  1877  EDLTDKDATEK  1887



>gb|EEE58383.1| hypothetical protein OsJ_09540 [Oryza sativa Japonica Group]
Length=1601

 Score =   568 bits (1463),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 406/1051 (39%), Positives = 614/1051 (58%), Gaps = 112/1051 (11%)
 Frame = +3

Query  570   IKLECERALTSLRRGNHNKALRLMKDLCAKH-ENSPNLALIYRVQGTVCVKVASIIDDPN  746
             ++  CE+AL +L+RGNH KALR++KD   KH E SP   L+ R QGTV  + A+++D+P 
Sbjct  39    VRAVCEKALAALQRGNHAKALRVVKDAVGKHGEGSP---LLLRAQGTVLARYAAVLDEPV  95

Query  747   VKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIENP  926
              + RH + A+++ARK+V ++P+SIE AHF+A LLYE A+D   YE    EC R +AI++P
Sbjct  96    SRARHQRLALEAARKAVELAPDSIELAHFHAMLLYEIASDTTGYEAASSECNRGIAIQSP  155

Query  927   IDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSGEE---KFRL  1097
              DPA  SL+        P   +  V+ EL NL+QRSN+ SIS W++ +   +    +F +
Sbjct  156   TDPAPHSLR-------LPAPDVEQVKAELSNLLQRSNMTSISLWLRTWTWAKNLRIRFGV  208

Query  1098  IPIRRM-SEDPMELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESA  1262
              PIRR  ++D  E+RL+ A    R+PNEIKKA KTPEERRKEIEVR+AA RL++Q+  +A
Sbjct  209   FPIRRGGADDSSEVRLLPAAPAPRRPNEIKKANKTPEERRKEIEVRLAAMRLMEQQKHNA  268

Query  1263  QSF-----------NDGERSLDLSAGTGQRGNERRKSGNARKNVSSME-RRDCVRSYWNS  1406
              S            ++   S   S+ +G R + RRK G+ +   S +  R + VR +W +
Sbjct  269   TSASSSTSQSQSPGDEAPSSSCQSSVSGHRAD-RRKGGSRKAAASPVSGRMNQVREFWAT  327

Query  1407  MSTDMKKKLLRIRIVDLKSHFGSL----KDG--LANEVLSEALSFAEANKAWKFWTCCHC  1568
             +  D +   L   I +LKSH+ +     KD   L ++VL+EA+ FA  +  W+F  C  C
Sbjct  328   VPMDRRLAFLSTSISELKSHYATAMHKEKDAASLVSDVLNEAIRFATRSGKWEFLVCGRC  387

Query  1569  VERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLE  1748
              E FAD+ESH+ H + EH+  L P+L  V+P+ +++ W E L   +W+P+D  AA K+LE
Sbjct  388   EEHFADAESHVHHAMEEHVGVLPPRLNDVVPEEIDDAWAEKLTGSTWRPVDATAALKILE  447

Query  1749  KQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREY  1928
             ++L        +N  +  D D    DI                    + C      +RE 
Sbjct  448   EELA-------DNVGSDRDKDSMSSDIWSTKDKSDT--SDSSTSPHNEECESFGAVTREG  498

Query  1929  DKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSK  2108
             D+                      WP++DD ERA +LERI+ +F+ L+K+K L  SHL+K
Sbjct  499   DRK---------------------WPLSDDEERANILERIHSLFKILVKHKNLSLSHLNK  537

Query  2109  VIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLG-RYPE  2285
             V+H  +EEL+ +   S LLN+++D++PLCICFL    L+K+LKFLQEL  + GL  R  +
Sbjct  538   VLHITMEELRKMHSASLLLNHSLDESPLCICFLDVSSLRKVLKFLQELMQASGLNDRNTD  597

Query  2286  RSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaa  2465
             +   + D  +  +    +EK+    D S L+ D      +    +  D VV         
Sbjct  598   KDEEVADKDSFPKNRSNLEKVTLDSDSSLLILDGQAFEMR----SDRDNVV---------  644

Query  2466  issniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYEL  2645
                           +D  LSW++ G S  EQL  W+   + ++ Q   I+  LEKEF  L
Sbjct  645   --------------ADPFLSWLYTGPSVEEQLLDWNHMLDVRSDQCTHILHELEKEFSAL  690

Query  2646  QGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEA  2825
             Q   E+K + L+ EE L  V+ L  EE ++R+    +  + Y+  LKKR+++L E + E 
Sbjct  691   QNSYEQKHDQLSSEEGLLAVDSLLCEEQRRRDDVDPYPFQGYEELLKKRQEQL-ELNAEE  749

Query  2826  TSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQA  3005
               +  R E+ AIS++L++ ++     F +++T+ G++S+  D +  E+D+W   D+ +  
Sbjct  750   LFSGCRSELHAISTILREVKTA---PFRYDETFSGMTSNHRDYDGTEEDEWGFYDFEHSN  806

Query  3006  DSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYL  3185
             DS V++ + R KEHV++EL+KIDARIMR+ + ++QL++KL   S  DYR I++PL+KS+L
Sbjct  807   DSVVQLVVSRLKEHVAMELNKIDARIMRISAVIEQLKLKLGPASVLDYRTIILPLLKSFL  866

Query  3186  RAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrk  3365
             R HLE+L ++DA E+SDAA EAFLAELA D+K+++N  S + K SH+K++DKKK+KD RK
Sbjct  867   RTHLEELVDKDARERSDAASEAFLAELALDAKRNANKVS-DTKQSHDKSKDKKKVKDSRK  925

Query  3366  tkdlkGSNGNGLHALHHDTAEEASFSVVHDGGSEDAELSNGGSNSITQeeeeqrrriele  3545
             +KDLK  + +  + +  D+ +E           E +E S   S++   ++EE R R+ LE
Sbjct  926   SKDLKDLSWSDQYLVRPDSVDE-----------ETSEQSLSTSDNYLNDQEEFRNRLRLE  974

Query  3546  aeerkleetleYQRRIENEAKLKHLAEQHKK  3638
             AEERKLEETLEYQR IE EAK KHLAEQH++
Sbjct  975   AEERKLEETLEYQRWIEEEAKKKHLAEQHRR  1005


 Score =   502 bits (1293),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 287/394 (73%), Gaps = 41/394 (10%)
 Frame = +1

Query  4042  LHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             L++EDD  +RF+ADL +AV QSL                                   G 
Sbjct  1242  LYIEDD--KRFKADLERAVLQSL-----------------------------------GT  1264

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              N  EVYGTGLKN  GEYNCFLNVIIQSLWHL+RFRD FL++SS H HV DPC VCALYD
Sbjct  1265  SNEKEVYGTGLKNAAGEYNCFLNVIIQSLWHLKRFRDGFLKTSSLHKHVEDPCAVCALYD  1324

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IFT LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  1325  IFTDLSKASEE-QGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  1383

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +     +S + + +GSWDCA+S+CI H LFGMD+ ERMNC  C LESR LKYTSFFHN
Sbjct  1384  SRADCQ-VKSHEINYIGSWDCASSSCIAHCLFGMDILERMNCQSCRLESRRLKYTSFFHN  1442

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K M  D SFD+LL +V MN  LACDP+  GCGK NHIHH LS+PPHVFT V
Sbjct  1443  INASSLRTAKDMFPDHSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHHILSSPPHVFTVV  1502

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN  ESV+DI+ TL  +STEIDIS  YRGLD  SKH LVSVVCYYGQHYHCFA+  +
Sbjct  1503  LGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--E  1560

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               +W+MYDD+TVKV+GNW DVL MC++GHLQPQV
Sbjct  1561  DGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQV  1594



>emb|CDY36917.1| BnaA06g17020D [Brassica napus]
Length=785

 Score =   543 bits (1398),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 362/485 (75%), Gaps = 31/485 (6%)
 Frame = +3

Query  363   MGHKKRPIAPRSKpsvapvevaavavdeaappapLESDTSAVLVQEKSLIRHDQAVVESE  542
             MG KK+P APRSK S+                      +SA   +  S +    A   SE
Sbjct  1     MGQKKKPPAPRSKQSL---------------------SSSAAEAEPSSEV---SACTSSE  36

Query  543   TNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKV  722
                 S+ A IK ECE+ALTS RRG++NKA+RLMK+ C++H++S   ALI+RVQGTVCVKV
Sbjct  37    E--PSNLAEIKAECEKALTSFRRGSYNKAIRLMKESCSRHQHS---ALIHRVQGTVCVKV  91

Query  723   ASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECE  902
             +S+ +D   K +++++AI+SARK+V +SPNSIEF+HFYANLLYE+A+DG+EYEEVVQEC 
Sbjct  92    SSVYEDAVTKQKYIRSAIESARKAVELSPNSIEFSHFYANLLYESASDGREYEEVVQECH  151

Query  903   RALAIENPIDPAKESLQ-ENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             RALAIENPIDPAK+SLQ E+Q K+STPEARIA+VQ ELR+LIQ+SNL S+STW+K+ G+G
Sbjct  152   RALAIENPIDPAKDSLQDESQHKISTPEARIANVQDELRSLIQKSNLGSLSTWMKHLGNG  211

Query  1080  EEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSES  1259
             E +FRL  +R+M+EDP+E  LVQ R+PNEIKKATKT EE+RKEIEVRVAA RLLQQKSES
Sbjct  212   EGEFRLFDMRKMAEDPIESNLVQTRRPNEIKKATKTLEEKRKEIEVRVAAGRLLQQKSES  271

Query  1260  AQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLR  1439
             +   +   +  D + G+GQR  ERRK GNARKN S++ERRD VRSYW S S +MKK+LLR
Sbjct  272   SSVDSVNSKGSDPALGSGQRSGERRKHGNARKNGSTVERRDRVRSYWESTSKEMKKELLR  331

Query  1440  IRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINE  1619
             I++ DLKSHF + KDG AN++++EALSF EANK W+FW CC C E+F DSES++QH++ E
Sbjct  332   IKVSDLKSHFSASKDGDANDIITEALSFCEANKTWRFWVCCKCSEKFKDSESYMQHIVGE  391

Query  1620  HMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTR  1799
             HM ++ PK+Q VLPQ++++E +EMLL   WKPLD  AA KLL  Q K +   F E  Y  
Sbjct  392   HMGNVFPKMQMVLPQSLDSERIEMLLTSPWKPLDFPAAVKLLCSQQKIQNSEFSE-FYAG  450

Query  1800  SDMDE  1814
               MD+
Sbjct  451   GYMDD  455


 Score =   518 bits (1334),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 270/310 (87%), Gaps = 1/310 (0%)
 Frame = +1

Query  4297  IQSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRI  4473
             I SLW+L  FR EFLRSS+ +H HVGDPCVVC+LY++ TALS AS E R++ V P++LRI
Sbjct  469   IMSLWNLGVFRAEFLRSSTLDHHHVGDPCVVCSLYEVLTALSAASREIRKEPVTPSTLRI  528

Query  4474  ALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANS  4653
             ALSNLYPD   FQE QMNDASEVL VIF+CLH+SF  ++  SDT+S +S+C GSWDCAN 
Sbjct  529   ALSNLYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQSASVSDTDSSESNCTGSWDCANR  588

Query  4654  ACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNL  4833
              CI HSLFGM++FE++NCY CGLESRH+KYTSFFHNINASALR MKV C +++FDELLNL
Sbjct  589   TCIAHSLFGMNIFEQLNCYSCGLESRHMKYTSFFHNINASALRNMKVTCPETAFDELLNL  648

Query  4834  VEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEI  5013
             VEMNHQLACDP+  GCGK NHI HFL+TPPHVFT VLGWQNTCESVEDI ATL AL+TEI
Sbjct  649   VEMNHQLACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAATLAALNTEI  708

Query  5014  DISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTM  5193
             DIS++YRGLDPKS + L SVVCYYGQHYHCFAYSH+H+RWIMYDDKTVKVIG+W+D+L+M
Sbjct  709   DISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSWSDILSM  768

Query  5194  CERGHLQPQV  5223
             C++GHLQPQ+
Sbjct  769   CKKGHLQPQL  778



>dbj|BAK03191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   508 bits (1307),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 287/392 (73%), Gaps = 39/392 (10%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVN  4227
             +EDD ++RF+ DL KAV QSL                                   G  N
Sbjct  334   IEDDSDKRFEEDLRKAVHQSL----------------------------------AGTSN  359

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIF  4407
             G EVYG GLKN  GEYNCFLNVIIQSLWHL+RFR EFL++SS H H+ DPC VCALY+IF
Sbjct  360   GKEVYGAGLKNAAGEYNCFLNVIIQSLWHLKRFRHEFLKTSSLHKHIEDPCAVCALYNIF  419

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
               LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+TS 
Sbjct  420   VDLSKAS-EGQGEAVAPTSLRIALSKSYPNNRFFQEGQMNDASEVLGVIFECLHKSYTSR  478

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             +     +S + + +GSWDCA+  CI H LFGMDV+ERMNC+ CGLESR LKYTSFFHNIN
Sbjct  479   AECH-AKSHEGNSIGSWDCASDFCIAHCLFGMDVYERMNCHNCGLESRRLKYTSFFHNIN  537

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             AS+LRT K+MC D  FD+LL  V MN QLACDPD  GCGK NHIHH LS+ PHVFT VLG
Sbjct  538   ASSLRTAKMMCLDP-FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILSSSPHVFTVVLG  596

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQN+ ESV+DI ATL  +STEIDISV YRGLD  SKH LVSVVCYYGQHYHCFA+  +H 
Sbjct  597   WQNSKESVDDIAATLAGISTEIDISVFYRGLDRGSKHFLVSVVCYYGQHYHCFAFEDEH-  655

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
              W+MYDD+TVKVIG+W DV+ MCE+GHLQPQV
Sbjct  656   -WVMYDDQTVKVIGSWDDVVIMCEKGHLQPQV  686



>ref|NP_001049069.1| Os03g0165600 [Oryza sativa Japonica Group]
 dbj|BAF10983.1| Os03g0165600, partial [Oryza sativa Japonica Group]
Length=505

 Score =   498 bits (1282),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 287/394 (73%), Gaps = 41/394 (10%)
 Frame = +1

Query  4042  LHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             L++EDD  +RF+ADL +AV QSL                                   G 
Sbjct  146   LYIEDD--KRFKADLERAVLQSL-----------------------------------GT  168

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              N  EVYGTGLKN  GEYNCFLNVIIQSLWHL+RFRD FL++SS H HV DPC VCALYD
Sbjct  169   SNEKEVYGTGLKNAAGEYNCFLNVIIQSLWHLKRFRDGFLKTSSLHKHVEDPCAVCALYD  228

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IFT LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  229   IFTDLSKASEE-QGEAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  287

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +     +S + + +GSWDCA+S+CI H LFGMD+ ERMNC  C LESR LKYTSFFHN
Sbjct  288   SRADCQ-VKSHEINYIGSWDCASSSCIAHCLFGMDILERMNCQSCRLESRRLKYTSFFHN  346

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K M  D SFD+LL +V MN  LACDP+  GCGK NHIHH LS+PPHVFT V
Sbjct  347   INASSLRTAKDMFPDHSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHHILSSPPHVFTVV  406

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN  ESV+DI+ TL  +STEIDIS  YRGLD  SKH LVSVVCYYGQHYHCFA+  +
Sbjct  407   LGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--E  464

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               +W+MYDD+TVKV+GNW DVL MC++GHLQPQV
Sbjct  465   DGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQV  498



>gb|EMS52635.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Triticum urartu]
Length=1581

 Score =   525 bits (1353),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 392/1004 (39%), Positives = 580/1004 (58%), Gaps = 136/1004 (14%)
 Frame = +3

Query  672   PNLALIYRVQGTVCVKVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLY  851
             P L ++ R  GTV   VA+++ DP  + R  + A+ +AR+++ ++P+S+E AHF A LLY
Sbjct  127   PGLPVLLRAHGTVHSCVAAVLTDPAARARQHQAALLAARRAIDLAPDSLELAHFRALLLY  186

Query  852   EAANDGKEYEEVVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQR  1031
             EAA+D + YEEV+ ECER L I++P DP   SL+        P      ++ ELRNL+Q+
Sbjct  187   EAASDNRAYEEVIAECERGLRIDDPSDPEPHSLR-------LPAPDPDQLRAELRNLVQK  239

Query  1032  SNLASISTWVKNFGSGEEKFRLIPIRRMSEDPMELRLVQA----RKPNEIKKATKTPEER  1199
             +NLASISTWVKN G  ++K       R+++DP+EL+L+ A    R+PNEIKKATKT EER
Sbjct  240   ANLASISTWVKNLGGSDDKLGFF---RLADDPLELQLLPAAPAPRRPNEIKKATKTVEER  296

Query  1200  RKEIEVRVAAARLLQQKSESAQSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERR  1379
             RKEIEV+VAA RLL    E  Q  N+   +L  S    Q G E         +V S    
Sbjct  297   RKEIEVQVAALRLL----EQQQQQNNAAAALSSSPPQSQPGAEP-------PSVPS----  341

Query  1380  DCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKD----GLANEVLSEALSFAEANKAWK  1547
                                   I +LK+++ + KD      A  VL E + FA ++  W+
Sbjct  342   ---------------------HISELKAYYKTHKDKDVAAAAPAVLDEVVEFATSHGCWE  380

Query  1548  FWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDIN  1727
             FW C  C ER+ D    + H + EH+ +L  ++Q++LPQ ++ +W  ML+  SW+P+D++
Sbjct  381   FWLCGICEERYPD----VAHSLREHVSALPRQVQAMLPQEIDADWAAMLIGSSWRPVDVS  436

Query  1728  AAAKLLEKQLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKT----FGDG  1895
             AA K LE +    +             D  KD +S    ++   D+S   ++      + 
Sbjct  437   AALKALEDEQADNI-----------GQDRDKDSMSSDNWSIK--DKSDTSESSASPHNEE  483

Query  1896  CNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIK  2075
             C+G  V  RE                      +  WP++DD ERAK+LERI+ +FQ L+K
Sbjct  484   CDGFGVVMREG---------------------ARKWPLSDDDERAKILERIHSLFQILVK  522

Query  2076  NKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELS  2255
             +K +  +HLS+VIHFA++EL+ +  GS LLN++ID++PLCICFL A  LKK+LKFLQ+L 
Sbjct  523   HKNISMNHLSRVIHFAMDELRGMPSGSLLLNHSIDESPLCICFLDASSLKKVLKFLQDLM  582

Query  2256  HSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPITFHDGV  2435
              SCGL R  E+   + D     +    +E +      S L+                DG 
Sbjct  583   QSCGLSRSSEKDGELGDGDCFPKNNTILEGVTLDSVSSSLIL---------------DGR  627

Query  2436  VTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSS-GEQLTSWSRSREEKAQQAMEI  2612
             V      S   +          +D+DE LSW++ G+   GEQL+ W+    ++  Q M+I
Sbjct  628   VFCGKSKSGPEN----------VDTDEFLSWLYAGSPPIGEQLSEWNCMLVDRTSQGMQI  677

Query  2613  VRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKR  2792
             + +++KE   L+  CE K E LN EE +  V ++  EE + R+    +  + Y+  L+ R
Sbjct  678   LDMIDKEASALKNFCEMKHEQLNTEEGVLAVNNIIQEEQRLRDRGGRYSYQGYEDLLRNR  737

Query  2793  RDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDD  2972
             ++EL+E+   ++      E +AIS++LK+   +  + FG+++ + G++S  CD +    D
Sbjct  738   QEELLETRFRSS------EYDAISNILKE---VRTSHFGYDEGFSGMTSRQCDFDGAAID  788

Query  2973  DWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYR  3152
             DWR+ D+++ +DS V   + R KEHV+ EL KIDARIMR V+ MQQL++KLE  +  DYR
Sbjct  789   DWRLHDFMHPSDSIVPTIVLRMKEHVATELGKIDARIMRSVALMQQLDLKLEPAAFVDYR  848

Query  3153  QILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSKKSSNVGSENAKHSHEkt  3332
              IL+PL+KS+LR HLE+LA++DA E+SDAAR+AFLAELA D++K++N G +  K SHEK+
Sbjct  849   SILLPLLKSFLRNHLEELADKDARERSDAARDAFLAELALDAEKNANKGGDK-KPSHEKS  907

Query  3333  rdkkkikdyrktkdlkGSNGNGLHALHHDTAEEAS---FSVVHDGGSEDAELSNGGSNSI  3503
             +DKK++KD R+ KDLK  + +  + +  D+A+E +      + D    D +LS     S 
Sbjct  908   KDKKRMKDSRRYKDLKDLSWSDQYIVRQDSADEETSEQAQTLVDCDDFDGKLSLSDEYSN  967

Query  3504  TQeeeeqrrrieleaeerkleetleYQRRIENEAKLKHLAEQHK  3635
              Q EEE R R++LEAEERKLEETLEYQRRIE EAK KHLAEQ +
Sbjct  968   EQ-EEEHRHRVQLEAEERKLEETLEYQRRIEEEAKQKHLAEQSR  1010


 Score =   512 bits (1318),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 253/392 (65%), Positives = 288/392 (73%), Gaps = 39/392 (10%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGIVN  4227
             +EDD ++RF+ DL KAV QSL                                   G  N
Sbjct  1222  IEDDSDKRFEEDLRKAVHQSL----------------------------------AGASN  1247

Query  4228  GIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYDIF  4407
             G EVYG GLKN  GEYNCFLNVIIQSLWHL+RFR EFL++SS H H+ DPC VCALY+IF
Sbjct  1248  GKEVYGAGLKNAAGEYNCFLNVIIQSLWHLKRFRHEFLKTSSLHKHIEDPCAVCALYNIF  1307

Query  4408  TALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSA  4587
               LS AS E + +AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+TS 
Sbjct  1308  VDLSKAS-EGQGEAVAPTSLRIALSKSYPNNRFFQEGQMNDASEVLGVIFECLHKSYTSQ  1366

Query  4588  SGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNIN  4767
             +     +S +S+ +GSWDCA+  CI H LFGMDV+ERMNC+ CGLESR LKYTSFFHNIN
Sbjct  1367  ADCH-AKSHESNSIGSWDCASDFCIAHCLFGMDVYERMNCHSCGLESRRLKYTSFFHNIN  1425

Query  4768  ASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLG  4947
             AS+LRT K+MC D  FD+LL  V MN QLACDPD  GCGK NHIHH LS+ PHVFT VLG
Sbjct  1426  ASSLRTAKMMCPDP-FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILSSSPHVFTVVLG  1484

Query  4948  WQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHE  5127
             WQN+ ESV DI ATL  +STEIDISV YRGLD  SKH LVSVVCYYGQHYHCFA+  +H 
Sbjct  1485  WQNSKESVGDIAATLAGISTEIDISVFYRGLDQGSKHFLVSVVCYYGQHYHCFAFEDEH-  1543

Query  5128  RWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
              W+MYDD+TVKVIG+WADV+ MCE+GHLQPQV
Sbjct  1544  -WVMYDDQTVKVIGSWADVVIMCEKGHLQPQV  1574



>ref|XP_001762441.1| predicted protein [Physcomitrella patens]
 gb|EDQ72908.1| predicted protein [Physcomitrella patens]
Length=1559

 Score =   516 bits (1328),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 340/920 (37%), Positives = 510/920 (55%), Gaps = 91/920 (10%)
 Frame = +3

Query  564   ANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVKVASIIDDP  743
             A +K ECE+AL +LRRGN  KAL+LM+D+C+++E S    + +RV G + ++ A++I+D 
Sbjct  2     ALVKRECEKALVALRRGNSTKALKLMRDVCSRNEAS---GIAHRVHGHIFMRQAAVIEDS  58

Query  744   NVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQECERALAIEN  923
               K +H ++A++SARK+  +SP S+E+AHFYA LLYEAA D K YE+VVQECERAL I++
Sbjct  59    RTKQKHFQSALESARKAASLSPQSVEYAHFYAQLLYEAAKDSKGYEDVVQECERALRIDD  118

Query  924   PIDPAKESL-QENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGS--GEEKFR  1094
             P+DPA+E L  E QQ++ T EARIAHV  ELR+L+Q++NL SISTW+K  GS  GEEK R
Sbjct  119   PVDPAREDLHHEQQQELLTAEARIAHVHQELRSLMQKANLTSISTWMKTLGSGMGEEKLR  178

Query  1095  LIPIRRMS-EDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSESAQSF  1271
              + +R+ + +DPME R+   ++P+E+KK  KTPEERRKEIE+RVAAARLLQQ+  SA   
Sbjct  179   FVQMRKFANQDPMEQRVSLPKRPHEVKKVVKTPEERRKEIELRVAAARLLQQRDSSADGG  238

Query  1272  ----NDGERSLDLSAGTGQRGNERRKSG--NAR---KNVSSMERRDCVRSYWNSMSTDMK  1424
                  D E+SL       Q+  ERRKS   N+R   K +S  ER D VR +W  ++ + +
Sbjct  239   IDYPEDHEKSL-------QKKLERRKSSGLNSRKISKPLSIDERIDRVRQFWYDLTPEKR  291

Query  1425  KKLLRIRIVDLKSHFGSLKDG-------LANEVLSEALSFAEANKAWKFWTCCHCVERFA  1583
             + +L + I  LK H  S K G        A++ LSEAL FA+  K W+FW CC C ERF 
Sbjct  292   ESMLEVSIAKLKDHLASWKVGGGLVKSHAASDALSEALEFAQEYKTWRFWACCKCGERFV  351

Query  1584  DSESHIQHVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAA---AKLLEKQ  1754
                    H + +HM +L  +LQ ++PQ  + EW++ LL+   +P+D  AA   +K  +K 
Sbjct  352   SYHDLSHHTLEKHMPTLPQELQQMIPQEFDQEWMDQLLDEDCRPIDGVAACEDSKFSQKS  411

Query  1755  LKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKKTFGDGCNGTTVDSREYDK  1934
                 ++           ++  KD  + P     G  +  ++   GD  NG  +       
Sbjct  412   TDKVINAKSVEDAKEVSLETFKDIEAGPDQGASGVGQEYMRACKGDCRNGMQI-------  464

Query  1935  NSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVFQTLIKNKYLGSSHLSKVI  2114
                           K+  PS+  P+ DD  R KLLE+I+ +F+ LIKNK L   ++SK+I
Sbjct  465   ----------GRTAKVDVPSQDLPLVDDEARKKLLEKIHGLFKVLIKNKCLTRDYVSKII  514

Query  2115  HFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERST  2294
              ++ EE+QSL + S   +   + +PL I FL    L+ +  +L EL+ +CG+ RY E + 
Sbjct  515   EYSTEEIQSL-FSSPARHDEFNPSPLYIRFLELKPLQHVYNYLVELAQACGVNRYSENT-  572

Query  2295  AIDDISTGIQGVDAMEKIVF-SEDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaais  2471
              +   +      + +E  +F +ED + LL DE  +  K  P  F   VV     +     
Sbjct  573   -VHRGNGEGGEEETIEDRMFPNEDFTNLLLDE--RVLKEGPKEF---VVEKDAVSHRQRL  626

Query  2472  sniQCDNGGLLDS--DELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYEL  2645
               ++ +NG L     D  LSWIF  T    Q + W + REE+ +   ++ R  E +F  L
Sbjct  627   PLMKGNNGELSTKHMDRQLSWIFGTTGYEYQPSGWKQFREEQGRSGRDVCRAYENDFANL  686

Query  2646  QGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTID-FVRRSYDIALKKRRDELMESHHE  2822
               LC++K E ++ E+AL +V+  CLEE K+RE+  D  V RS D +L  R  +       
Sbjct  687   LDLCKQKYELVSDEDALNLVKRSCLEENKRREYQPDGSVSRSSDGSLGVRVSDWDGYETS  746

Query  2823  ATSTNYRFEIEAISSVLKDAESL----NVNQFGFEDTYGGISSHLCDLESGEDDDWRVKD  2990
             A  T    E    +    DA SL     + Q G        +SHL               
Sbjct  747   AWKTQ---EFVQCADRRADAYSLVDAARIRQRG---KLSNKASHLI--------------  786

Query  2991  YLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPL  3170
                  + C+++ I + ++ V ++++ +DA+IMR    + + E+KL  ++  +YR +++PL
Sbjct  787   -----EHCLKMCILKHRKLVMLQVNHLDAKIMRATDDLLKKEIKLGQLAVLNYRAVVLPL  841

Query  3171  VKSYLRAHLEDLAERDATEK  3230
             VKS L+  LE  AERDA +K
Sbjct  842   VKSLLQTRLETEAERDAQQK  861


 Score =   472 bits (1215),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 301/423 (71%), Gaps = 25/423 (6%)
 Frame = +1

Query  4009  AGE-SGPKTLRQLHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPL--IPRSGTA-----  4164
             AGE  G K+LRQL  E DDEERFQADL +A+RQSL   +     P+  +  +GT+     
Sbjct  1140  AGEHEGKKSLRQLQAEQDDEERFQADLEQAMRQSLVVPNHVPSSPIHTVRSNGTSGDHRA  1199

Query  4165  -QISEMANLGVSCEDVATGIVNG----IEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFR  4329
              Q+ E   +G       TG+V      IE +G GL+NE+G+YNCFLNV+IQSLWHLRRFR
Sbjct  1200  QQLLETGIIGP-----ITGVVETSSKEIEEFGKGLRNEIGQYNCFLNVVIQSLWHLRRFR  1254

Query  4330  DEFLR-SSSEHIHVGDPCVVCALYDIFTALSLA-SSETRRDAVAPNSLRIALSNLYPDRL  4503
             +E L  +S++H+H+G PCVVCAL DIF  L     + + RDAVAP +LR+ALS LYPD  
Sbjct  1255  EELLADTSTQHVHIGSPCVVCALRDIFLGLDAPIHNSSSRDAVAPIALRVALSALYPDSD  1314

Query  4504  LFQEGQMNDASEVLGVIFECLHQSFT-SASGASDTESVDSSCMGSWDCANS-ACIVHSLF  4677
             LF++GQMNDASEVLGVIFECLH++F  +A+   ++ES  S   GSWDC     C+ H+LF
Sbjct  1315  LFKQGQMNDASEVLGVIFECLHKAFVPNATSVGNSES--SITRGSWDCYEEFPCMAHALF  1372

Query  4678  GMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLA  4857
             G+ V E+MNC  C LESRH KYT+FFH+INASALR+ K + ++SS D+LL LV+MN QL 
Sbjct  1373  GLQVAEQMNCQGCHLESRHFKYTTFFHHINASALRSAKALYEESSMDDLLKLVDMNDQLT  1432

Query  4858  CD-PDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYR  5034
             CD  D  GCG+ NH+HHFL   PHVFTTVLGWQN  ES EDI+AT+ A+   +D+ V+Y 
Sbjct  1433  CDRTDDGGCGRQNHMHHFLQAAPHVFTTVLGWQNGRESFEDISATVDAIDVALDVGVIYC  1492

Query  5035  GLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQ  5214
             GLD   +H LVSVVCYYG HYHCFAY+ +  RW+M+DD TVKVIG W DV + C RGHLQ
Sbjct  1493  GLDKGFQHRLVSVVCYYGLHYHCFAYNQELGRWVMFDDSTVKVIGEWKDVASTCRRGHLQ  1552

Query  5215  PQV  5223
             PQV
Sbjct  1553  PQV  1555



>emb|CDY25237.1| BnaC02g30130D [Brassica napus]
Length=306

 Score =   462 bits (1189),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 252/311 (81%), Gaps = 17/311 (5%)
 Frame = +1

Query  4294  IIQSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLR  4470
              + SLW+L  FR EFLRSS+ +H HVGDPCVVC+LY++ TALS AS E R++ V P++LR
Sbjct  5     FLVSLWNLGVFRAEFLRSSTLDHHHVGDPCVVCSLYEVLTALSAASREIRKEPVTPSTLR  64

Query  4471  IALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCAN  4650
             IALSNLYPD   FQE QMNDASEVL VIF+CLH+SF  +   SDT+S +S+  GSWDCAN
Sbjct  65    IALSNLYPDSSFFQEAQMNDASEVLAVIFDCLHRSFAQSPSLSDTDSSESNYTGSWDCAN  124

Query  4651  SACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLN  4830
               C  HSLFGM++F++MNCY CGLESRH+KYTSFFHNINASALR MK             
Sbjct  125   RTCSAHSLFGMNIFDQMNCYSCGLESRHMKYTSFFHNINASALRNMK-------------  171

Query  4831  LVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTE  5010
                MNHQLACDP+  GCGK NHI HFL+TPPHVFT VLGWQNTCESVEDI ATL AL+TE
Sbjct  172   ---MNHQLACDPETGGCGKPNHIRHFLTTPPHVFTAVLGWQNTCESVEDIAATLAALNTE  228

Query  5011  IDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLT  5190
             IDIS++YRGLDPKS + L SVVCYYGQHYHCFAYSH+H+RWIMYDDKTVKVIG+ +DVL+
Sbjct  229   IDISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSRSDVLS  288

Query  5191  MCERGHLQPQV  5223
             MC++GHLQPQ+
Sbjct  289   MCKKGHLQPQL  299



>ref|XP_006651069.1| PREDICTED: uncharacterized protein LOC102718817 [Oryza brachyantha]
Length=1454

 Score =   499 bits (1284),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 285/394 (72%), Gaps = 41/394 (10%)
 Frame = +1

Query  4042  LHVEDDDEERFQADLMKAVRQSLDTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             L++EDD  +RF+ +L +AV QSL                                   G 
Sbjct  1095  LYIEDD--KRFEEELERAVLQSL-----------------------------------GT  1117

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
              N  EVYG GLKN  GEYNCFLNVIIQSLWHL+RFRD FL+ SS H HVGDPC VCALYD
Sbjct  1118  SNEKEVYGAGLKNAAGEYNCFLNVIIQSLWHLKRFRDGFLKKSSLHKHVGDPCAVCALYD  1177

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IFT LS AS E + +AVAP SLRIALS  YPD   FQEGQMNDASEVL VIF+CLH+S+T
Sbjct  1178  IFTDLSKASEE-QGEAVAPTSLRIALSKSYPDSKFFQEGQMNDASEVLEVIFQCLHRSYT  1236

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +     +S + +C+GSWDCA+S+C+ H LFGMD++ERMNC  CGLESR  KYTSFFHN
Sbjct  1237  SHTDLQ-VKSHEVNCIGSWDCASSSCVAHGLFGMDIYERMNCQSCGLESRRHKYTSFFHN  1295

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K M  D SFD+LL +V MN  L CDPD  GCGK NHIHH LS+PPHVFT V
Sbjct  1296  INASSLRTAKDMFPDYSFDDLLRIVIMNDHLVCDPDGGGCGKPNHIHHILSSPPHVFTVV  1355

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN+ ESV+DI+ TL  +STEID+S  YRGLD  SKH LVSVVCYYGQHYHCFA+  +
Sbjct  1356  LGWQNSKESVDDISGTLAGISTEIDVSTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--E  1413

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               +W+MYDD+TVK +G+W DVL MC++GHLQPQV
Sbjct  1414  DGQWVMYDDQTVKAVGSWDDVLIMCKKGHLQPQV  1447


 Score =   484 bits (1247),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 317/855 (37%), Positives = 485/855 (57%), Gaps = 102/855 (12%)
 Frame = +3

Query  843   LLYEAANDGKEYEEVVQECERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNL  1022
             L YE A+D   YE    EC R L I+NP DPA  SL+        P   +  V+ EL NL
Sbjct  2     LYYEIASDAVGYEVAAGECNRGLLIQNPTDPAPHSLR-------LPAPDVEQVRAELSNL  54

Query  1023  IQRSNLASISTWVKNFGSG---EEKFRLIPIRRMSEDPMELRLVQA----RKPNEIKKAT  1181
             +QRSN+ SIS WVK+   G   EEK R+ PIRR ++D  E+RL+ A    R+PNEIKKA 
Sbjct  55    MQRSNMTSISMWVKSVNMGYTPEEKVRVFPIRRGADDASEVRLLPAAPAPRRPNEIKKAN  114

Query  1182  KTPEERRKEIEVRVAAARLLQQKSESAQSF-----------NDGERSLDLSAGTGQRGNE  1328
             KTPEERRKEIEVR+AA RLL+Q+  +A +            ++   S   S+ +G R + 
Sbjct  115   KTPEERRKEIEVRLAAMRLLEQQQHNASTASSSTSQSQSMGDEAPSSSSQSSVSGHRAD-  173

Query  1329  RRKSGNARKNVSSMERR-DCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSL----KDG--  1487
             RRK G+ +   SS+  R + VR +W +   D +   L   + DLKSH+ +     KD   
Sbjct  174   RRKGGSRKTTASSVSGRIEQVREFWGTFPMDRRLAFLSTSVSDLKSHYAAAVHKEKDAAS  233

Query  1488  LANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHVINEHMCSLSPKLQSVLPQN  1667
             + ++VL+EA+ FA  +  W+FW C  C ERFAD+ESH+QH +++H+  LSP+L +++P+ 
Sbjct  234   VVSDVLNEAIRFATRSGKWEFWVCGRCGERFADAESHVQHAMDKHVDVLSPRLMNMVPEE  293

Query  1668  VENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENTYTRSDMDESKDDISDPYCN  1847
             +++ W E L   SW+P+D  AA K+LE++L        EN  +  D D +  DI      
Sbjct  294   IDDAWAEKLTGSSWRPVDATAALKILEEELT-------ENVGSDRDKDSTSSDIWS--MK  344

Query  1848  VYGWDRSPIKKTFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPER  2027
                           + C+   + +RE D+                      WP++DD ER
Sbjct  345   DKSDTSDSSTSPHNEECDSFGMVTREVDRK---------------------WPLSDDEER  383

Query  2028  AKLLERINVVFQTLIKNKYLGSSHLSKVIHFAVEELQS-LGYGSQLLNYNIDQTPLCICF  2204
              K+LERI+  F+ L+K+K L S HL++V+ F +EEL+  +  GS  LN+++D++PLCIC 
Sbjct  384   TKILERIHSSFKILVKHKNLSSRHLNRVLCFTMEELRGRMPSGSLPLNHSLDESPLCICL  443

Query  2205  LGAPELKKILKFLQELSHSCGL-GRYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLF  2381
             L    L+K+L+F+QEL H+ GL  R  E+   + D+ +  +    +EK++   D S L+ 
Sbjct  444   LDLSSLQKVLEFVQELMHASGLNNRSSEKDEKLADLDSFPKRRSNLEKVILDSDSSLLIL  503

Query  2382  DEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQL  2561
             D                            +   + D   +L +D  LSW++ G S  EQL
Sbjct  504   DSQ--------------------------AFEGRSDRDNVL-ADPFLSWLYTGPSVEEQL  536

Query  2562  TSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKRE  2741
               W+   E ++ Q MEI+  L+KEF  L+  CE+K + L+ EE L  V+ L  EE ++R+
Sbjct  537   LDWNHMLEVRSNQYMEILHELDKEFSALRNWCEQKHDQLSNEEGLLAVDSLLCEEQRRRD  596

Query  2742  HTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDT  2921
               +D     Y+  LKKR+ EL+E + E      R E+  IS++L++ ++       +++ 
Sbjct  597   -AVDLY-EGYEELLKKRQ-ELLELNAEELFNGCRSELSMISTILREVKTAR-----YDEA  648

Query  2922  YGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDARIMRVVSG  3101
             + G +S LCD    E+D+W + D+ +  DS V++ + R K+ V+VEL+KIDARIMR+ + 
Sbjct  649   FSGRTSRLCDFYGTEEDEWGLHDFEHSNDSVVQLVVSRLKDQVAVELNKIDARIMRISAV  708

Query  3102  MQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareaflaelardSK  3281
             +++L++K    S  DY+ IL+PL++S+LR HLE+L ++DA E+SDAA EAFLAELA D+K
Sbjct  709   IERLKLKFGPASVLDYQTILLPLLRSFLRTHLEELVDKDARERSDAASEAFLAELALDAK  768

Query  3282  KSSNVGSENAKHSHE  3326
             +++ VG  + K SH+
Sbjct  769   RNAKVG--DTKQSHD  781



>gb|AFW89587.1| hypothetical protein ZEAMMB73_931714 [Zea mays]
Length=1179

 Score =   454 bits (1168),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 273/394 (69%), Gaps = 45/394 (11%)
 Frame = +1

Query  4048  VEDDDEERFQADLMKAVRQSL--DTFHAHQKLPLIPRSGTAQISEMANLGVSCEDVATGI  4221
             +EDD ++RFQ DL +AVRQSL  D F A          GT  +     +G  C       
Sbjct  822   IEDDFDKRFQEDLDEAVRQSLGCDAFPA----------GTVAL----KMGQKC-------  860

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVIIQSLWHLRRFRDEFLRSSSEHIHVGDPCVVCALYD  4401
                    G  LK            ++ SLWH+RRFRDEFL++S  H HV DPC VCALY 
Sbjct  861   ------MGLDLK------------MLLSLWHIRRFRDEFLKTSLLHKHVEDPCAVCALYG  902

Query  4402  IFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFT  4581
             IF  LS AS + +R+AVAP SLRIALS  YP+   FQEGQMNDASEVLGVIFECLH+S+T
Sbjct  903   IFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQEGQMNDASEVLGVIFECLHKSYT  961

Query  4582  SASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHN  4761
             S +      S + + +GSWDCAN +CI H+LFGMDV+ERMNC+ C +ESR LKYTSFFHN
Sbjct  962   SRTVYHGV-SHEKNSIGSWDCANISCITHNLFGMDVYERMNCHNCKMESRQLKYTSFFHN  1020

Query  4762  INASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTV  4941
             INAS+LRT K+MC DSSFDELL +V MN QLACD D  GCG  NHI H LS+  HVF  V
Sbjct  1021  INASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSSSAHVFIVV  1080

Query  4942  LGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYSHD  5121
             LGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH L SVVCYYGQHYHCFA+   
Sbjct  1081  LGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG  1140

Query  5122  HERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
               RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  1141  --RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  1172


 Score =   222 bits (566),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 180/386 (47%), Positives = 261/386 (68%), Gaps = 23/386 (6%)
 Frame = +3

Query  2502  LDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLN  2681
             +D+D L SW++ G+S GEQL +W+R  +E++ Q M+++R L +EF  LQ  CERK E L 
Sbjct  303   VDTDTLFSWLYAGSSIGEQLLAWNRMIDERSNQCMDLIRALGREFNNLQNSCERKLEQLR  362

Query  2682  YEEALQVVEDLCLEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAI  2861
              EEA   VEDL  EE  +RE    +  +S++  L+KR+ EL+E + E  S + R EI+AI
Sbjct  363   NEEAFISVEDLLCEEQTRREQVEQYGFQSFEEILRKRQAELLERNTEVQSDSNRSEIDAI  422

Query  2862  SSVLKDAESLNVNQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQK  3041
             S+VLK    L+ + FG++D + G++  L DL+ G +D+WR+ D+++  DS V   I + K
Sbjct  423   SAVLK---KLHTSHFGYDDAFSGMAPRLFDLD-GVEDEWRLHDFIHPNDSMVHTVISKMK  478

Query  3042  EHVSVELSKIDARIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDA  3221
             E V+VE+SKIDA+IMR +S M+ LE KL   SA DYR IL+PL++S+L++HL +L ++DA
Sbjct  479   EKVTVEISKIDAQIMRNLSVMRHLEHKLGPASALDYRMILLPLMRSFLQSHLGELVDKDA  538

Query  3222  TEKSdaareaflaelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGL  3401
              E+SDAAREAFLAEL+ D+KK+++ G++  K SHEK++DKKK KD RK+K+LK S+ +  
Sbjct  539   KERSDAAREAFLAELSLDAKKNASKGAD-MKQSHEKSKDKKKFKDSRKSKELKDSSWSNQ  597

Query  3402  HALHHDTAEEASFSVVHDGGSEDAEL----------SNGGSNSITQeeeeqrrrieleae  3551
               +H D+ +E        G SE +++           +   +   ++EEE R R++LEAE
Sbjct  598   SLIHQDSTDE--------GTSETSQMLADCDDLCCKCSTSEDYFNEQEEELRHRVQLEAE  649

Query  3552  erkleetleYQRRIENEAKLKHLAEQ  3629
             ERKLEE LEYQR IE EAK KHLAEQ
Sbjct  650   ERKLEEALEYQRWIEEEAKQKHLAEQ  675


 Score =   169 bits (428),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 153/291 (53%), Gaps = 34/291 (12%)
 Frame = +3

Query  1128  MELRLVQA----RKPNEIKKATKTPEERRKEIEVRVAAARLLQQKSE-----------SA  1262
             ME RLV +    R+ NEIKKATKT EERR+EIEVR+AA RLLQQ+ E           S+
Sbjct  1     MEARLVPSAPSPRRSNEIKKATKTSEERRQEIEVRLAAMRLLQQQKEQSNGVVSATPASS  60

Query  1263  QSFNDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKKLLRI  1442
             QS  D   S  LS   G R + R+        +S+ ER D  R+YW S+  D +   L  
Sbjct  61    QSQGDEAPSSSLSLVGGHRADRRKGGSRKATGLSASERTDQARAYWGSIPVDQRLAFLNT  120

Query  1443  RIVDLKSHFGSL----KD--GLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQ  1604
              I +LKSH+ S     KD    A++VL+E + FA  +  W+F  C  C  +F D E+H  
Sbjct  121   SISELKSHYASAIHKEKDVASAASDVLNEVIRFANKHGNWEFMVCGRCRGQFTDVEAHRW  180

Query  1605  HVINEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLE  1784
             HV+ EH+  LS +LQ ++PQ ++ +WVEML+  +W PLD  AA KL E           E
Sbjct  181   HVMGEHVGLLSSELQEMVPQEIDADWVEMLIGWNWSPLDATAALKLFE-----------E  229

Query  1785  NTYTRSDMDESKD-DISDPYCNVYGWDRSPIKKTFGDG-CNGTTVDSREYD  1931
             +       D  K+ D +D + N    D S    +  +G CNG  V  RE D
Sbjct  230   DQTDNLGTDRGKESDPTDNWSNKDNPDMSESSASPHNGECNGFGVVVREGD  280



>gb|EYU35899.1| hypothetical protein MIMGU_mgv1a000927mg [Erythranthe guttata]
Length=940

 Score =   446 bits (1146),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 306/439 (70%), Gaps = 32/439 (7%)
 Frame = +3

Query  537   SETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCV  716
             S    S S++ IKLEC+RALT+LRRGN+ +ALRLM D  +K+ NSP+ +LI+RV G VCV
Sbjct  88    SSAKPSLSHSAIKLECQRALTALRRGNYTRALRLMNDFSSKYGNSPHASLIHRVHGIVCV  147

Query  717   KVASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQE  896
             KVA +++D N K RHL+NAI+SARK+ M+ PNS+EF  FYA+L+YEA ++ KEYEEVVQE
Sbjct  148   KVAFLMEDTNAKQRHLRNAIESARKAAMLCPNSVEFGLFYASLMYEAVDEAKEYEEVVQE  207

Query  897   CERALAIENPIDPAKESLQE-NQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFG  1073
             C+RALAIENP+DPA+E LQE +Q K+ST E R+A VQ ELR+LIQ+S LAS+    K   
Sbjct  208   CKRALAIENPVDPAEEGLQEESQNKISTAEERVARVQNELRSLIQKSVLASL----KALE  263

Query  1074  SGEEKFRLIPIRRMSEDPMELRLVQARKPNEIKKATKTPEERRKEIEVRVAAARLLQQKS  1253
               EE F  IPI R+ EDP           NEIKK  KTPEERRKEIE RV AAR +QQ S
Sbjct  264   IREENFCPIPITRVPEDP-----------NEIKKVAKTPEERRKEIEERVTAARFVQQNS  312

Query  1254  ESAQSF-NDGERSLDLSAGTGQRGNERRKSGNARKNVSSMERRDCVRSYWNSMSTDMKKK  1430
             E A +  ND             +G+E  +   +RKN S+ ERRD V ++WNSM+ D KK+
Sbjct  313   EYAHNTKNDS------------KGSENGRGSGSRKNTSTDERRDLVLTFWNSMNLDGKKE  360

Query  1431  LLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKAWKFWTCCHCVERFADSESHIQHV  1610
              LRI+I DLK+HF S KDGL +E+L EALSF E NK W+FW CC C E+FADS S +QHV
Sbjct  361   CLRIKISDLKAHFSSSKDGLPSEMLDEALSFGETNKVWRFWECCRCNEKFADSGSLMQHV  420

Query  1611  INEHMCSLSPKLQSVLPQNVENEWVEMLLNCSWKPLDINAAAKLLEKQLKCRVHGFLENT  1790
             + EHM SL P+ QSVLPQNV+NEW EMLLN  WKPLD+NA+  + +KQ K +    L+ +
Sbjct  421   VQEHMRSLLPETQSVLPQNVDNEWAEMLLNIPWKPLDLNASITMHQKQSKPKKPDLLDES  480

Query  1791  YTRSDMDESK---DDISDP  1838
                 + DE +   D + DP
Sbjct  481   SASQNADEYECDGDQMEDP  499


 Score =   250 bits (639),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 223/490 (46%), Positives = 279/490 (57%), Gaps = 101/490 (21%)
 Frame = +3

Query  2181  QTPLCICFLGAPELKKILKFLQELSHSCGLGRYPERSTAIDDISTGIQGV-DAMEKIVFS  2357
             + PL ICFLGAP L+KIL FLQE+S +CGL RY ++S   DD +T +  V D + KIVFS
Sbjct  497   EDPLSICFLGAPRLEKILIFLQEISQACGLNRYSDKSKGGDDSNTVMHSVDDTLGKIVFS  556

Query  2358  EDGSCLLFDEHFKPCKLTPITFHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFM  2537
              D S L+ DEHF P K   I   DGV                 +N     S  L S    
Sbjct  557   SDASFLVLDEHFLPDK---IPRGDGV-----------------NNA----SSALTSSDGS  592

Query  2538  GTSSGEQLTSWSRSREEKAQQAMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLC  2717
                  EQL  W   R EKAQQ MEI++LLE+E   L+ LCERK E L+YE ALQ + D C
Sbjct  593   YEHGSEQLAFWQHERAEKAQQGMEILQLLEEESSHLRNLCERKREQLSYEAALQALGDRC  652

Query  2718  LEEGKKREHTIDFVRRSYDIALKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNV  2897
             LEEGKKR H  DFV +SYD  L KRR+EL+E+ +  T  +   E++AIS+VL DA+S+N+
Sbjct  653   LEEGKKRVHVADFVFQSYDSVLNKRREELIENENGLTVMSNIVELDAISNVLADADSVNI  712

Query  2898  NQFGFEDTYGGISSHLCDLESGEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVELSKIDA  3077
             N+         ++S LC LESG  D+ R KDY+ Q DS +E AIQ+QKE VSVE      
Sbjct  713   NRC--------VTSLLCALESGGGDERRTKDYMQQMDSYIEAAIQKQKEAVSVE------  758

Query  3078  RIMRVVSGMQQLEVKLESVSAHDYRQILVPLVKSYLRAHLEDLAERDATEKSdaareafl  3257
                                                  A LEDLAE+DA EKSDAAREA L
Sbjct  759   -------------------------------------ARLEDLAEKDAVEKSDAAREAIL  781

Query  3258  aelardSKKSSNVGSENAKHSHEktrdkkkikdyrktkdlkGSNGNGLHALHHDTAEEAS  3437
             AELA DSKK S  G ++++HSH++T+DKKK KD RK KD KG  G               
Sbjct  782   AELALDSKKVS-AGVDSSRHSHDRTKDKKKSKDNRKNKDSKGGPG---------------  825

Query  3438  FSVVHDGGSEDAELSNGGSNSITQeeeeqrrrieleaeerkleetleYQRRIENEAKLKH  3617
              SV+     +D        +++   +EE +RRIE+EAEERKLEE LEYQRRIENEAK K 
Sbjct  826   -SVIAVPAPDD--------DALQLNDEEYKRRIEIEAEERKLEEMLEYQRRIENEAKQKR  876

Query  3618  LAEQHKKGAR  3647
             LAE+ ++ +R
Sbjct  877   LAEKQQELSR  886



>emb|CBI35030.3| unnamed protein product [Vitis vinifera]
Length=1213

 Score =   423 bits (1088),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 288/874 (33%), Positives = 465/874 (53%), Gaps = 118/874 (14%)
 Frame = +3

Query  540   ETNASSSYANIKLECERALTSLRRGNHNKALRLMKDLCAKHENSPNLALIYRVQGTVCVK  719
             E   ++    IKL+C+RA  + RRGNH+KAL+LMK  C+ +   PN   ++ +QGT+  +
Sbjct  40    EAKKAAEMEAIKLDCDRAFDAFRRGNHHKALKLMKKFCSSY---PNSGFVHTLQGTMYYQ  96

Query  720   VASIIDDPNVKNRHLKNAIDSARKSVMMSPNSIEFAHFYANLLYEAANDGKEYEEVVQEC  899
             +A  I D + K ++LK A DSA ++ ++SP  ++ AHF+A+LLY  +     Y+EVV+EC
Sbjct  97    LALTIADSSTKLQYLKTAADSASRATLLSPEKMDSAHFFAHLLYLTSEKNDGYQEVVREC  156

Query  900   ERALAIENPIDPAKESLQENQQKVSTPEARIAHVQGELRNLIQRSNLASISTWVKNFGSG  1079
             ERAL+I  P++ A   +  NQ + S   A+I+ +Q  LR+LI  SN        +   +G
Sbjct  157   ERALSI--PVEKASLLVGRNQLEGSILMAQISELQEGLRSLIGMSN--------ETMNNG  206

Query  1080  -----EEKFRLIPI-----------RRMSEDPMELRLVQARKPNEIKKATKTPEERRKEI  1211
                  E KF L+P             + SED MEL               K  EER KEI
Sbjct  207   VHLDLEAKFMLVPFSDLLKESKLLSLKYSEDGMEL---------------KDLEEREKEI  251

Query  1212  EVRVAAARLL---------QQKSESAQSF-NDGERSLDLSAGTGQRGNERRKSGNARKNV  1361
             E ++   +LL         Q +  S Q++  DG    + S+ +  +  + ++  N +K  
Sbjct  252   EAKIQKTKLLENLRVLPEWQTEEASLQNYLKDGVP--ESSSRSSYKQEKIKRVSNLKKMK  309

Query  1362  SSMERRDCVRSYWNSMSTDMKKKLLRIRIVDLKSHFGSLKDGLANEVLSEALSFAEANKA  1541
              S      V  YW+S+S D K++LL +RI DL  +FGS +      +  EA+SFA+ NK+
Sbjct  310   ESARMMPYVVMYWDSISFDQKRRLLNVRIGDLIEYFGSNEYVEEALIFCEAMSFAKDNKS  369

Query  1542  WKFWTCCHCVERFADSESHIQHVINEHMCS---LSPKLQSVLPQNVENEWVEMLLNCSWK  1712
             WKF  CC C +RF +   +++H+  +H+ +   L+P++ S+LP  + + WV+MLL   WK
Sbjct  370   WKFLGCCFCSQRFKELIPYLKHLEVQHLRNVKVLAPEMMSMLPLELNSYWVDMLLKDRWK  429

Query  1713  PLDINAAAKLLEK----QLKCRVHGFLENTYTRSDMDESKDDISDPYCNVYGWDRSPIKK  1880
             P+D +AA K++E     +L C V G  E+       D++  ++                 
Sbjct  430   PVDTSAALKMIESGPKGELSCTVGGDRESHGGEVGGDQNIKEV-----------------  472

Query  1881  TFGDGCNGTTVDSREYDKNSEVWMDRDGNEGTKICPPSESWPIADDPERAKLLERINVVF  2060
                DG  G   D+  +D N                     WP++ D ERA +L +I+++F
Sbjct  473   ---DGEKGLP-DAFPFDHN---------------------WPLSYDSERAGILSKIHIMF  507

Query  2061  QTLIKNKYLGSSHLSKVIHFAVEELQSLGYGSQLLNYNIDQTPLCICFLGAPELKKILKF  2240
             +   ++ YL    L  +I +++E+LQ+L    + L   +DQTPLC+CFL  P+L+ +  +
Sbjct  508   KLFFRHNYLSERLLKVLIKYSLEKLQTLVPELEPLIQGLDQTPLCLCFLQVPQLRYVYSY  567

Query  2241  LQELSHSCGLGRYPERSTAIDDISTGIQGVDAMEKIVFSEDGSCLLFDEHFKPCKLTPIT  2420
             L++L   C L    E+  ++ +   G  G D   +I  S +   LL D+H     +   T
Sbjct  568   LEDLVRLCRLDFRSEKDGSVAETPRG--GFDIKHRIGLSSESVSLLLDKHSNRGAVDFFT  625

Query  2421  FHDGVVTDsnpnsaaissniQCDNGGLLDSDELLSWIFMGTSSGEQLTSWSRSREEKAQQ  2600
             +HD +  D    S+   +    ++  L  SD L +WIF G S+ +QLTSW+R+ +EK  Q
Sbjct  626   YHDNISAD---ASSVAFTVDNLEDDALPGSDSLAAWIFGGPSNEQQLTSWARALQEKKHQ  682

Query  2601  AMEIVRLLEKEFYELQGLCERKCEHLNYEEALQVVEDLCLEEGKKREHTIDFVRRSYDIA  2780
             A++I+ +LEKEF E + LC+ KC HL  EEA Q VE++  EE  KR   ++FV + Y++ 
Sbjct  683   AIDILSILEKEFPEYKSLCDSKCIHLRQEEAFQAVENILAEEFTKRRENLEFVPQGYEVL  742

Query  2781  LKKRRDELMESHHEATSTNYRFEIEAISSVLKDAESLNVNQFGFEDTYGGISSHLCDLES  2960
             LKKR++EL  + ++   ++   E   IS VLK+ E+L++          G +SHL D ES
Sbjct  743   LKKRQEELARTSNDVFGSDAA-EFTFISKVLKEVEALSLR-------VAGGTSHLSDQES  794

Query  2961  GEDDDWRVKDYLNQADSCVEVAIQRQKEHVSVEL  3062
              ++D+ +  + L + DS +E+A+Q QKE VS+++
Sbjct  795   DQEDESKTFEDLLEQDSLLEMAVQDQKEEVSLKV  828


 Score =   322 bits (826),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 217/336 (65%), Gaps = 21/336 (6%)
 Frame = +1

Query  4222  VNGIEVYGTGLKNEVGEYNCFLNVII-QSLWHLRRFRDEFLRSSS-EHIHVGDPCVVCAL  4395
             +N  +V+GT LK  + +Y+CFL+VII QSLWHLR FR E  R     H H G+PCV C+L
Sbjct  887   MNASDVHGTSLKKSLAQYDCFLDVIITQSLWHLRWFRFELQRRREIPHAHAGNPCVFCSL  946

Query  4396  YDIFTALSLASSETRRDAVAPNSLRIALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQS  4575
              + FT LSL+    ++D VAP   ++ALS+LYPD + FQE Q ND   +L  IFECLHQS
Sbjct  947   CNTFTVLSLSPVCWKKDVVAPCLAKMALSDLYPDNIFFQEAQTNDVISILVGIFECLHQS  1006

Query  4576  FTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERMNCYECGLESRHLKYTSFF  4755
             F++       E+        WDC +  C+ H++ GM++ ER++C  CGLES + ++TSF 
Sbjct  1007  FSAPGEKYSGEN--------WDCTSDECLAHTIIGMNLLERISCCYCGLESGNEQFTSF-  1057

Query  4756  HNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFT  4935
                    LR    M  DSSFD+LL LV  +    CDP+A GCGK N   HFLS+PPHVF 
Sbjct  1058  -------LRMDTYM--DSSFDKLLKLVNASSLFPCDPEAGGCGKLNPTQHFLSSPPHVFI  1108

Query  4936  TVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHCLVSVVCYYGQHYHCFAYS  5115
             T + WQN  E   DI+ TL ALST+ID+ +LY GLD  + H L+S+VC+ G++Y CFAY 
Sbjct  1109  TGM-WQNGHERGADISTTLAALSTKIDLGILYEGLDEGNTHYLISLVCFTGKNYRCFAYR  1167

Query  5116  HDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             H+ E+WIM DD+  KVIG W DV+T+C   +LQP +
Sbjct  1168  HEVEKWIMLDDEECKVIGCWNDVITVCRTRNLQPLI  1203



>emb|CAB41871.1| putative protein [Arabidopsis thaliana]
Length=243

 Score =   360 bits (924),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 190/222 (86%), Gaps = 8/222 (4%)
 Frame = +1

Query  4522  MNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERM  4701
             MNDASEVL VIF+CLH+SF  +S  SDTES +S+  GSWDCAN +CI HSLFGMDV E++
Sbjct  1     MNDASEVLAVIFDCLHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFGMDVSEQL  60

Query  4702  NCYECGLESRHLKYTSFFHNINASALRTMKV--------MCQDSSFDELLNLVEMNHQLA  4857
             NCY CGLESRHLKYTSFFHNINASALRTMKV         C ++SFDELLNLVEMNHQLA
Sbjct  61    NCYSCGLESRHLKYTSFFHNINASALRTMKVSYECSLDVTCAENSFDELLNLVEMNHQLA  120

Query  4858  CDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRG  5037
             CD +A GCGK NHIHH L+TPPHVFT VLGWQNTCE+VEDI ATL AL+TEIDIS++YRG
Sbjct  121   CDREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRG  180

Query  5038  LDPKSKHCLVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKV  5163
             +DPK+ + LVSVVCYYGQHYHCFAYSH+H++WIMYDD+ VKV
Sbjct  181   VDPKNTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDQNVKV  222



>ref|NP_001142026.1| uncharacterized protein LOC100274180 [Zea mays]
 gb|ACF87499.1| unknown [Zea mays]
 tpg|DAA43556.1| TPA: hypothetical protein ZEAMMB73_116284 [Zea mays]
Length=238

 Score =   356 bits (913),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 193/234 (82%), Gaps = 3/234 (1%)
 Frame = +1

Query  4522  MNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERM  4701
             MNDASEVLGVIFECLH+S+TS +     +  + + +GSWDCAN +CI HSLFGMDV+ERM
Sbjct  1     MNDASEVLGVIFECLHKSYTSRT-VCHGKPHEKNSIGSWDCANISCIAHSLFGMDVYERM  59

Query  4702  NCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGC  4881
             NC+ C +ESR LKYTSFFHNINAS+LRT K+MC DSSFDELL +V MN QLACD D  GC
Sbjct  60    NCHNCKMESRRLKYTSFFHNINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGC  119

Query  4882  GKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHC  5061
             GK NHIHH LSTPPHVFT VLGWQN  E+V+DI+ATL  +STEIDIS+ YRGLD  SKH 
Sbjct  120   GKPNHIHHILSTPPHVFTVVLGWQNNKENVDDISATLAGISTEIDISIFYRGLDQGSKHT  179

Query  5062  LVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             LVSVVCYYGQHYHCFA+     RW+MYDD+TVKV+G+W DVL MCE+GHLQPQV
Sbjct  180   LVSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVVGSWGDVLVMCEKGHLQPQV  231



>emb|CDP06267.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   354 bits (908),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 225/376 (60%), Gaps = 113/376 (30%)
 Frame = +1

Query  4297  IQSLWHLRRFRDEFLRSS-SEHIHVGDPCVVCALYDIFTALSLASSETRRDAVAPNSLRI  4473
              Q LWHL+RFRDEFLR S SEH+HVGDPCVVCALYDIF+AL+ AS + RR+AVAP SLRI
Sbjct  7     FQFLWHLQRFRDEFLRRSLSEHVHVGDPCVVCALYDIFSALNTASVDARREAVAPTSLRI  66

Query  4474  ALSNLYPDRLLFQEGQMNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANS  4653
             ALSNLYPD   FQEGQMNDASEVLGVIF+CLH+ FTS                       
Sbjct  67    ALSNLYPDSNFFQEGQMNDASEVLGVIFDCLHRLFTST----------------------  104

Query  4654  ACIVHSLFGMDVFERMNCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNL  4833
               ++H +           Y+C                +A    T +VMC +SS DELLNL
Sbjct  105   --MLHFILPQ--------YQC--------------QCSAYYEDTFQVMCPESSLDELLNL  140

Query  4834  VEMNHQLACDPDARGCGKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEI  5013
             VEMNHQLACDP+A GCGK ++IHH LST PHVFTTVLGWQNTCE V+DITATL ALSTE+
Sbjct  141   VEMNHQLACDPEAGGCGKLSYIHHILSTTPHVFTTVLGWQNTCEHVDDITATLTALSTEM  200

Query  5014  DISVLYRGLDPKSKH-----------CLVSV----------------------------V  5076
             DISVLYRGLD K++            C +S+                            V
Sbjct  201   DISVLYRGLDLKNRQICQQRNLPIKGCSLSLLLSHTHIYTPLLKILLLKIPDLFSTMDKV  260

Query  5077  CYYGQHYHCFAYSHDHERWIMYDDKTVK---------------------------VIGNW  5175
             CYYGQHYHCFAYS DHERW+MY DKTVK                           VIG W
Sbjct  261   CYYGQHYHCFAYSQDHERWLMYVDKTVKVNPICLAFIPSIPLFHKTNKHLRFEIYVIGGW  320

Query  5176  ADVLTMCERGHLQPQV  5223
              DVLTMCERGHLQPQV
Sbjct  321   EDVLTMCERGHLQPQV  336



>ref|NP_001132623.1| uncharacterized protein LOC100194097 [Zea mays]
 gb|ACF81547.1| unknown [Zea mays]
Length=238

 Score =   342 bits (876),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = +1

Query  4522  MNDASEVLGVIFECLHQSFTSASGASDTESVDSSCMGSWDCANSACIVHSLFGMDVFERM  4701
             MNDASEVLGVIFECLH+S+TS +      S + + +GSWDCAN +CI H+LFGMDV+ERM
Sbjct  1     MNDASEVLGVIFECLHKSYTSRT-VYHGVSHEKNSIGSWDCANISCITHNLFGMDVYERM  59

Query  4702  NCYECGLESRHLKYTSFFHNINASALRTMKVMCQDSSFDELLNLVEMNHQLACDPDARGC  4881
             NC+ C +ESR LKYTSFFHNINAS+LRT K+MC DSSFDELL +V MN QLACD D  GC
Sbjct  60    NCHNCKMESRQLKYTSFFHNINASSLRTAKMMCPDSSFDELLKVVIMNDQLACDQDVGGC  119

Query  4882  GKHNHIHHFLSTPPHVFTTVLGWQNTCESVEDITATLVALSTEIDISVLYRGLDPKSKHC  5061
             G  NHI H LS  PHVFT VLGWQN  E V+DI+ATL  +STEIDIS+ YRGLD   KH 
Sbjct  120   GTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISATLAGISTEIDISIFYRGLDQGGKHT  179

Query  5062  LVSVVCYYGQHYHCFAYSHDHERWIMYDDKTVKVIGNWADVLTMCERGHLQPQV  5223
             L SVVCYYGQHYHCFA+     RW+MYDD+TVKVIG+W DVL MCE+GHLQPQV
Sbjct  180   LGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIGSWGDVLVMCEKGHLQPQV  231



>ref|XP_010661002.1| PREDICTED: uncharacterized protein LOC104881683 isoform X2 [Vitis 
vinifera]
Length=1391

 Score =   352 bits (903),  Expect = 7e-96, Method: Compositiona