BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21546_g1_i2 len=1675 path=[4973:0-435 458:436-467 1558:468-711
1802:712-761 1455:762-840 5552:841-860 3459:861-925 2250:926-1674]

Length=1675
                                                                      Score     E

ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             781   0.0      
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0      
gb|AAQ90182.1|  ntp101                                                  771   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             760   0.0      
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             759   0.0      
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             757   0.0      
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             756   0.0      
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             756   0.0      
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             755   0.0      
gb|AAQ90185.1|  ntp805                                                  754   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             751   0.0      
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             749   0.0      
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             750   0.0      
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    748   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             744   0.0      
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           726   0.0      Petunia x hybrida [garden petunia]
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                725   0.0      
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                725   0.0      
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                720   0.0      
emb|CDP18567.1|  unnamed protein product                                713   0.0      
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             711   0.0      
gb|ABI52585.1|  pollen-specific protein                                 704   0.0      Camellia sinensis [black tea]
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             696   0.0      
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             696   0.0      
gb|EPS72881.1|  pollen-specific protein                                 696   0.0      
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    693   0.0      
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             693   0.0      
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    693   0.0      
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    692   0.0      
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             692   0.0      
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             692   0.0      
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0      
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         686   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             686   0.0      
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             682   0.0      
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             682   0.0      
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             679   0.0      
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             678   0.0      
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             677   0.0      
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0      
emb|CDP04133.1|  unnamed protein product                                675   0.0      
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             674   0.0      
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                674   0.0      
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         673   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             673   0.0      
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         672   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             672   0.0      
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             672   0.0      
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             672   0.0      
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    671   0.0      
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    671   0.0      
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0      
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0      
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    670   0.0      
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             670   0.0      
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    670   0.0      
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             670   0.0      
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             668   0.0      
gb|EPS68478.1|  hypothetical protein M569_06286                         665   0.0      
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             665   0.0      
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             665   0.0      
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             664   0.0      
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    664   0.0      
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             663   0.0      
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             662   0.0      
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                661   0.0      
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    660   0.0      
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             658   0.0      
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             657   0.0      
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             657   0.0      
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             657   0.0      
dbj|BAL41449.1|  SKU5 similar 1                                         656   0.0      
emb|CAN69061.1|  hypothetical protein VITISV_032605                     656   0.0      Vitis vinifera
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             655   0.0      
ref|XP_002523381.1|  multicopper oxidase, putative                      655   0.0      Ricinus communis
ref|XP_002523382.1|  multicopper oxidase, putative                      654   0.0      Ricinus communis
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             654   0.0      
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             654   0.0      
ref|XP_007014658.1|  SKU5 similar 13                                    653   0.0      
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             653   0.0      
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             653   0.0      
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         653   0.0      
ref|NP_187947.1|  protein SKU5-like 11                                  652   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             652   0.0      
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             651   0.0      
emb|CDY23596.1|  BnaC05g39980D                                          651   0.0      
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   649   0.0      
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             650   0.0      
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             649   0.0      
gb|KHN44494.1|  L-ascorbate oxidase like                                649   0.0      
gb|AFC88081.1|  skewed-like protein                                     648   0.0      
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             648   0.0      
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    648   0.0      
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             647   0.0      
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    647   0.0      Brassica napus [oilseed rape]
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             647   0.0      
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             647   0.0      
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    645   0.0      
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
emb|CDX75708.1|  BnaC03g37910D                                          645   0.0      
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   645   0.0      
emb|CDY10549.1|  BnaC03g70650D                                          645   0.0      
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             645   0.0      
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0      
emb|CAA47177.1|  Bplo                                                   644   0.0      Brassica napus [oilseed rape]
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             644   0.0      
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             644   0.0      
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             644   0.0      
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             644   0.0      
ref|NP_175953.1|  protein SKU5 similar 12                               643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             643   0.0      
ref|XP_007014661.1|  SKU5 similar 12                                    643   0.0      
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             643   0.0      
emb|CDX82541.1|  BnaA03g32800D                                          643   0.0      
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             643   0.0      
emb|CDY56013.1|  BnaA08g29220D                                          642   0.0      
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             642   0.0      
emb|CDX75707.1|  BnaC03g37900D                                          642   0.0      
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             642   0.0      
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    642   0.0      
emb|CAA47178.1|  Bplo                                                   642   0.0      Brassica napus [oilseed rape]
emb|CDX82540.1|  BnaA03g32810D                                          641   0.0      
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             640   0.0      
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    639   0.0      
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             639   0.0      
gb|AES71848.2|  L-ascorbate oxidase-like protein                        637   0.0      
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             638   0.0      
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             638   0.0      
emb|CDY23597.1|  BnaC05g39970D                                          638   0.0      
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   638   0.0      
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             637   0.0      
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   637   0.0      
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   638   0.0      
emb|CDY43994.1|  BnaA05g25890D                                          638   0.0      
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|NP_187948.1|  protein SKU5-like 13                                  637   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             637   0.0      
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             636   0.0      
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             637   0.0      
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             636   0.0      
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             636   0.0      
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    636   0.0      
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             635   0.0      
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             635   0.0      
gb|AGW80453.1|  pollen-specific protein                                 635   0.0      
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   635   0.0      
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             635   0.0      
emb|CDY24188.1|  BnaC01g37680D                                          635   0.0      
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             635   0.0      
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             634   0.0      
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   634   0.0      
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   634   0.0      
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             634   0.0      
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    632   0.0      
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             634   0.0      
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             634   0.0      
ref|NP_564697.1|  SKU5 similar 14                                       633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   633   0.0      
emb|CDY43353.1|  BnaA01g29840D                                          632   0.0      
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             632   0.0      
emb|CDX97352.1|  BnaA02g21430D                                          629   0.0      
emb|CDY24189.1|  BnaC01g37690D                                          631   0.0      
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             631   0.0      
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             631   0.0      
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             630   0.0      
emb|CAA47176.1|  Bplo                                                   629   0.0      Brassica napus [oilseed rape]
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             627   0.0      
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             633   0.0      
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             627   0.0      
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             626   0.0      
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             625   0.0      
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   624   0.0      
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             622   0.0      
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             622   0.0      
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             622   0.0      
gb|KHG27164.1|  L-ascorbate oxidase                                     619   0.0      
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             621   0.0      
dbj|BAK05994.1|  predicted protein                                      621   0.0      
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             623   0.0      
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             619   0.0      
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    619   0.0      
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             619   0.0      
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    619   0.0      
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             619   0.0      
gb|KHG03555.1|  L-ascorbate oxidase                                     619   0.0      
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             619   0.0      
gb|KHG05644.1|  L-ascorbate oxidase                                     618   0.0      
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             618   0.0      
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      618   0.0      Zea mays [maize]
gb|ACN34077.1|  unknown                                                 617   0.0      Zea mays [maize]
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             615   0.0      
dbj|BAK07214.1|  predicted protein                                      614   0.0      
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             613   0.0      
emb|CDM84722.1|  unnamed protein product                                613   0.0      
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    613   0.0      
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             613   0.0      
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             612   0.0      
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          612   0.0      
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             610   0.0      
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        610   0.0      
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        609   0.0      
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             608   0.0      
gb|EEE55579.1|  hypothetical protein OsJ_03867                          607   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044620.1|  Os01g0816700                                       607   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          607   0.0      Sorghum bicolor [broomcorn]
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             607   0.0      
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             606   0.0      
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             606   0.0      
emb|CDY50029.1|  BnaA06g00300D                                          604   0.0      
gb|AAT01329.1|  putative L-ascorbate oxidase                            603   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          600   0.0      Sorghum bicolor [broomcorn]
gb|KHN20513.1|  L-ascorbate oxidase like                                598   0.0      
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    600   0.0      
gb|ACF86554.2|  unknown                                                 599   0.0      Zea mays [maize]
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             598   0.0      
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           598   0.0      Zea mays [maize]
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         595   0.0      
gb|ACN26659.1|  unknown                                                 595   0.0      Zea mays [maize]
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             595   0.0      
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           595   0.0      Zea mays [maize]
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0      
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             590   0.0      
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        590   0.0      
gb|EEC79422.1|  hypothetical protein OsI_20394                          581   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0      
emb|CDY43352.1|  BnaA01g29830D                                          572   0.0      
emb|CDY54363.1|  BnaC06g07290D                                          572   0.0      
gb|AAD10639.1|  putative pollen specific protein                        572   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABV89619.1|  Sku5-like 11                                            563   0.0      Brassica rapa
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          560   0.0      
ref|XP_007041705.1|  SKU5 similar 5                                     530   1e-179   
gb|ABR18324.1|  unknown                                                 528   1e-178   Picea sitchensis
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             523   4e-177   
gb|AFK33666.1|  unknown                                                 521   4e-177   
emb|CDP10787.1|  unnamed protein product                                521   2e-176   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             519   3e-175   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           518   4e-175   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             518   4e-175   
gb|KHG21949.1|  L-ascorbate oxidase                                     518   6e-175   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             518   7e-175   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             517   1e-174   
gb|ABK25092.1|  unknown                                                 517   2e-174   Picea sitchensis
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             516   2e-174   
gb|KHG11003.1|  L-ascorbate oxidase                                     516   3e-174   
ref|XP_002528421.1|  multicopper oxidase, putative                      516   5e-174   Ricinus communis
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             516   5e-174   
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             515   9e-174   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             514   1e-173   
ref|XP_002524823.1|  multicopper oxidase, putative                      514   1e-173   Ricinus communis
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          514   2e-173   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             514   2e-173   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             514   3e-173   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             513   4e-173   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             513   5e-173   
emb|CBI18560.3|  unnamed protein product                                513   7e-173   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             513   7e-173   Vitis vinifera
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             512   8e-173   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             512   9e-173   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             512   9e-173   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       509   1e-172   
gb|AGJ03718.1|  multicopper oxidase                                     511   2e-172   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             511   3e-172   Vitis vinifera
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             511   3e-172   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    511   3e-172   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             511   4e-172   
ref|NP_001132891.1|  uncharacterized protein LOC100194388               506   5e-172   Zea mays [maize]
gb|KHG25743.1|  L-ascorbate oxidase                                     510   5e-172   
gb|KHG04142.1|  L-ascorbate oxidase                                     511   5e-172   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             510   5e-172   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             510   6e-172   
gb|AGE09595.1|  SKU5-like protein                                       509   9e-172   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          509   1e-171   
gb|KHN36198.1|  L-ascorbate oxidase like                                509   1e-171   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             509   1e-171   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             509   1e-171   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             509   1e-171   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             509   1e-171   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       507   2e-171   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             509   2e-171   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             509   2e-171   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             508   3e-171   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             509   3e-171   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             508   3e-171   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             508   3e-171   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             508   4e-171   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             508   4e-171   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             508   4e-171   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             508   4e-171   
emb|CDX81353.1|  BnaC09g07640D                                          508   4e-171   
emb|CDY18626.1|  BnaA09g07690D                                          508   5e-171   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             508   5e-171   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    508   5e-171   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         508   6e-171   
gb|KHN42054.1|  L-ascorbate oxidase like                                508   6e-171   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   508   6e-171   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    508   6e-171   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             507   8e-171   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             507   9e-171   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             507   1e-170   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         507   1e-170   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             507   1e-170   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   506   1e-170   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             506   1e-170   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-170   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-170   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-170   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                506   2e-170   
emb|CDY01453.1|  BnaA07g12260D                                          506   2e-170   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-170   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             506   3e-170   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     508   3e-170   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             506   3e-170   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         506   3e-170   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                506   5e-170   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             505   5e-170   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         505   5e-170   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             505   5e-170   
gb|KEH29685.1|  multi-copper oxidase-like protein                       505   5e-170   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             505   5e-170   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             506   5e-170   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             505   6e-170   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          505   7e-170   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             505   8e-170   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             504   8e-170   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             504   9e-170   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                504   9e-170   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             504   9e-170   
emb|CAA65634.1|  PS60                                                   504   1e-169   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             504   1e-169   
gb|EPS74059.1|  hypothetical protein M569_00695                         504   1e-169   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             504   1e-169   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          504   1e-169   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     504   1e-169   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             504   1e-169   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             504   2e-169   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             504   2e-169   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             504   2e-169   
gb|KHG03845.1|  L-ascorbate oxidase                                     504   2e-169   
ref|NP_001058365.1|  Os06g0678800                                       504   2e-169   
gb|KEH40258.1|  multi-copper oxidase-like protein                       504   2e-169   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         503   3e-169   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             504   3e-169   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             503   3e-169   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             503   3e-169   
gb|KHG07318.1|  L-ascorbate oxidase                                     503   3e-169   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             503   4e-169   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         503   4e-169   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             503   4e-169   
dbj|BAJ91397.1|  predicted protein                                      503   5e-169   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             503   5e-169   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    503   7e-169   
ref|NP_173604.1|  SKU5 similar 7 protein                                502   8e-169   
dbj|BAK00459.1|  predicted protein                                      502   9e-169   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             502   1e-168   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             502   1e-168   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             502   1e-168   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             502   1e-168   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             502   1e-168   
ref|NP_001147597.1|  LOC100281206 precursor                             502   1e-168   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    501   2e-168   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             501   2e-168   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             501   2e-168   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             501   2e-168   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             501   2e-168   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             501   3e-168   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             501   3e-168   
gb|KHN33820.1|  L-ascorbate oxidase like                                501   3e-168   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             501   4e-168   
gb|AAL09733.1|  At1g76160/T23E18_10                                     500   4e-168   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             500   4e-168   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             500   5e-168   
gb|KHN44868.1|  L-ascorbate oxidase like                                498   5e-168   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    500   5e-168   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             500   5e-168   
gb|ACL53812.1|  unknown                                                 500   6e-168   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             500   6e-168   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             500   6e-168   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             499   7e-168   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             500   8e-168   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             499   1e-167   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    499   1e-167   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             499   1e-167   
gb|AGT57427.1|  ascorbate oxidase                                       499   1e-167   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             499   1e-167   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             499   1e-167   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             499   1e-167   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             499   1e-167   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             499   2e-167   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             499   2e-167   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             499   2e-167   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             495   2e-167   
gb|KEH36280.1|  multi-copper oxidase-like protein                       499   2e-167   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    499   2e-167   
gb|ACJ85585.1|  unknown                                                 499   2e-167   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             499   2e-167   
gb|AFK35121.1|  unknown                                                 499   2e-167   
ref|NP_177743.1|  SKU5-like 5 protein                                   498   2e-167   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             499   3e-167   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                499   3e-167   
dbj|BAK04971.1|  predicted protein                                      499   3e-167   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             498   4e-167   
ref|XP_002522337.1|  multicopper oxidase, putative                      498   4e-167   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    498   4e-167   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    496   6e-167   
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             497   7e-167   
gb|EEC82126.1|  hypothetical protein OsI_26158                          498   7e-167   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             498   7e-167   
gb|KHN05478.1|  L-ascorbate oxidase like                                497   8e-167   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               497   9e-167   
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             497   9e-167   
gb|KEH20500.1|  multi-copper oxidase-like protein                       497   9e-167   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          497   9e-167   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             497   1e-166   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     496   1e-166   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             497   1e-166   
emb|CDX73238.1|  BnaC06g36860D                                          497   1e-166   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             497   1e-166   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    497   1e-166   
gb|AAM97070.1|  pectinesterase, putative                                497   1e-166   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             496   1e-166   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             496   1e-166   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             496   1e-166   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             496   2e-166   
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             496   2e-166   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             496   2e-166   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             496   2e-166   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             496   2e-166   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          496   2e-166   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    496   2e-166   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             496   2e-166   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             496   3e-166   
gb|KHF99506.1|  L-ascorbate oxidase                                     496   3e-166   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    493   4e-166   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             496   4e-166   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          495   4e-166   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             495   4e-166   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
emb|CDP19581.1|  unnamed protein product                                495   5e-166   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             495   5e-166   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             495   6e-166   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      495   6e-166   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             495   6e-166   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             495   6e-166   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             495   6e-166   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             495   6e-166   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           495   7e-166   
emb|CDP04415.1|  unnamed protein product                                495   7e-166   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             494   7e-166   
dbj|BAC83966.1|  putative PS60                                          495   7e-166   
ref|XP_002518462.1|  multicopper oxidase, putative                      494   8e-166   
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             494   9e-166   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          494   1e-165   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        494   1e-165   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             494   1e-165   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   492   1e-165   
emb|CDX87633.1|  BnaA07g32400D                                          494   1e-165   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             494   1e-165   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    494   1e-165   
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           494   1e-165   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   494   2e-165   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             494   2e-165   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   493   3e-165   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|NP_193932.1|  protein SKU5 similar 4                                493   3e-165   
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             493   3e-165   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             493   4e-165   
emb|CBI18561.3|  unnamed protein product                                495   4e-165   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             493   4e-165   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             493   4e-165   
emb|CDY43557.1|  BnaC02g16540D                                          493   4e-165   
gb|KEH30611.1|  multi-copper oxidase-like protein                       493   5e-165   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     494   7e-165   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             492   7e-165   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             492   7e-165   
emb|CDY31468.1|  BnaC05g15770D                                          492   8e-165   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             492   8e-165   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             492   9e-165   
gb|KEH20499.1|  multi-copper oxidase-like protein                       491   1e-164   
emb|CDP07321.1|  unnamed protein product                                492   1e-164   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    491   1e-164   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   491   1e-164   
gb|KHN21220.1|  L-ascorbate oxidase like                                491   2e-164   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             491   2e-164   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             491   2e-164   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             491   2e-164   
gb|ABK95805.1|  unknown                                                 491   2e-164   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             491   2e-164   
ref|NP_173603.1|  SKU5 similar 8 protein                                491   2e-164   



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/485 (75%), Positives = 420/485 (87%), Gaps = 4/485 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TWSGIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFP+T L RA
Sbjct  77    LDEPLLLTWSGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPSTGLHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G ++VHSR LIP+PFD+PAEE+NVF+ DWY KG++TLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGAVDVHSRNLIPIPFDKPAEEYNVFLGDWYNKGHRTLKKILDGGRTIGRPDGIHIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKATEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQCLSVLVTA++E KDYY+V +SRF KQE S+VA++R  NG G  ++    PP
Sbjct  257   DSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQELSSVAILRYANGKGPASSELPAPP  316

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN++S+  GKLR
Sbjct  317   PD-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +A+NG+SH D DTPLKL+E+F +    E +FKYDLM D+P  D SKV ++PNVKNATFRN
Sbjct  376   FALNGISHMDTDTPLKLVEFFGV---PEKTFKYDLMADEPPSDLSKVTISPNVKNATFRN  432

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQ+YH++GYSFFAVGIEPGKWSPEKRKNYNLVDA++RH+IQVYPN WA
Sbjct  433   FVEIIFENEEKTIQTYHLDGYSFFAVGIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWA  492

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVMTTLDNAGMWN+RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VKG P+
Sbjct  493   AVMTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPM  552

Query  213   PKPYT  199
             P PYT
Sbjct  553   PAPYT  557



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/485 (74%), Positives = 418/485 (86%), Gaps = 4/485 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L RA
Sbjct  77    LDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTGLHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+KTLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG G  ++    PP
Sbjct  257   DSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPASSELPTPP  316

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN++S+  GKLR
Sbjct  317   PD-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +A+NG+SH D DTPLKL+E+F +    E +FKYDL+ D+P  D SKV ++PNVKNATFRN
Sbjct  376   FALNGISHMDTDTPLKLVEFFGV---PEKTFKYDLIADEPPSDLSKVTISPNVKNATFRN  432

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQ+YH++GYSFFAV IEPGKWSPEKRKNYNLVDA++RH+IQVYPN WA
Sbjct  433   FVEIIFENQEKTIQTYHLDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWA  492

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVMTTLDNAGMWN+RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VKG P+
Sbjct  493   AVMTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPM  552

Query  213   PKPYT  199
             P PYT
Sbjct  553   PAPYT  557



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/485 (74%), Positives = 417/485 (86%), Gaps = 4/485 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L RA
Sbjct  77    LDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTGLHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+KTLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG G  ++    PP
Sbjct  257   DSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPASSELPTPP  316

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN++S+  GKLR
Sbjct  317   PD-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +A+NG+SH D DTPLKL+E+F +    E +FKYDL+ D+P  D SKV ++ NVKNATFRN
Sbjct  376   FALNGISHMDTDTPLKLVEFFGV---PEKTFKYDLIADEPPSDLSKVTISSNVKNATFRN  432

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQ+YH++GYSFFAV IEPGKWSPEKRKNYNLVDA++RH+IQVYPN WA
Sbjct  433   FVEIIFENQEKTIQTYHLDGYSFFAVSIEPGKWSPEKRKNYNLVDAVSRHSIQVYPNSWA  492

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVMTTLDNAGMWN+RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VKG P+
Sbjct  493   AVMTTLDNAGMWNLRSEMWERFYLGQQLYFSVLSPSRSLRDEYNLPDNHPLCGIVKGMPM  552

Query  213   PKPYT  199
             P PYT
Sbjct  553   PAPYT  557



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/486 (74%), Positives = 412/486 (85%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L R
Sbjct  74    HLDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G INVHSR LIPVPFD PA++++VFV DWY KGYK+LKKILD G+TI RPDG+ +
Sbjct  134   AAGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ KVG+    PL+ ME  KTYRYR CNVG+RTSVN R QGH M LVEIEGSHTVQNV
Sbjct  194   NGKSVKVGDKAAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNV  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelp  940
             Y+SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ E S+V++IR  NG G  ++    
Sbjct  254   YESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYTNGKGPASSDLPA  313

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             PPP  NT+GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VN++SE  GK
Sbjct  314   PPPE-NTKGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGK  372

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
             LRYA+NG+SHTD +TP KL EYF   D     FKYDLM D+P+  + KV +A N+KNATF
Sbjct  373   LRYALNGISHTDSETPFKLAEYFGATDK---VFKYDLMDDEPSTSSDKVTVASNIKNATF  429

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEIIFENHEK IQ+YH++GYSFFAVG+EPGKW+PEKRKNYNLVDAINRH+IQVYPN 
Sbjct  430   RNFVEIIFENHEKTIQTYHLDGYSFFAVGVEPGKWTPEKRKNYNLVDAINRHSIQVYPNS  489

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAAVMTTLDNAG+W++RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VK  
Sbjct  490   WAAVMTTLDNAGLWSLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKSM  549

Query  219   PLPKPY  202
             P+P PY
Sbjct  550   PMPSPY  555



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/484 (73%), Positives = 409/484 (85%), Gaps = 5/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYGPINVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKK+LD G T+ RPDG+++N
Sbjct  134   AGGYGPINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQE S+VA+IR  NG G  +      P
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQELSSVAIIRYANGKGPASPELPASP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K++N+  +  GKLR
Sbjct  313   PD-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIINSMGQVNGKLR  371

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NG+SH+D +TPLKL+EYF   D    +FKYDLM D+   D SK+ +APNVKNAT+RN
Sbjct  372   YGLNGISHSDTETPLKLVEYFGAADK---TFKYDLMADEAPADPSKLTVAPNVKNATYRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK I++YH++GYSFFAV +EPGKWS EKRKNYNLVDA +R+NIQVYPN WA
Sbjct  429   FVEIIFENHEKSIRTYHLDGYSFFAVAVEPGKWSAEKRKNYNLVDATSRNNIQVYPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYN+PDN  LCG VKG PL
Sbjct  489   AIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPGRSLRDEYNLPDNHPLCGVVKGMPL  548

Query  213   PKPY  202
             P PY
Sbjct  549   PTPY  552



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/486 (73%), Positives = 411/486 (85%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L R
Sbjct  74    HLDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G INVHSR LIPVPFD PA++++VFV DWY KGYK+LKKILD G+TI RPDG+ +
Sbjct  134   AAGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ KVGE    PL+ ME  KTYRYR CNVG+RTSVN R QGH M LVEIEGSHTVQNV
Sbjct  194   NGKSEKVGEKVAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNV  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelp  940
             Y+SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ E S+V++IR  NG G  ++    
Sbjct  254   YESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYVNGKGPASSDLPA  313

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             PPP  NT+GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VN+++E  GK
Sbjct  314   PPPE-NTQGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGK  372

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
             LRYA+NG+SHTD +TP KL EYF   D     FKYDLMPDQP+    KV +A N+KNATF
Sbjct  373   LRYALNGISHTDSETPFKLAEYFGATDK---VFKYDLMPDQPSTPDDKVTIASNIKNATF  429

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEI+FENHEK IQ+YH++GYSFFAV +EPGKW+PEKRKNYNLVDAI+RH+IQVYPN 
Sbjct  430   RNFVEIVFENHEKTIQTYHLDGYSFFAVAVEPGKWTPEKRKNYNLVDAISRHSIQVYPNS  489

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAAVMTTLDNAG+W++RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VK  
Sbjct  490   WAAVMTTLDNAGLWSLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKTM  549

Query  219   PLPKPY  202
             P+P PY
Sbjct  550   PMPSPY  555



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/485 (73%), Positives = 410/485 (85%), Gaps = 5/485 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLLFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L R
Sbjct  74    QLDEPLLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++
Sbjct  134   AAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIII  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+
Sbjct  194   NGKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNI  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC SVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG G  +     P
Sbjct  253   YDSLDLHVGQCFSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPASPELPTP  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N+KS+  GKL
Sbjct  313   PPE-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKL  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RY +NG+SHTD +TPLKL+EYF   D    +FKYDLM D+   D +K+ +  NVKNAT+R
Sbjct  372   RYGLNGISHTDGETPLKLVEYFGATDK---AFKYDLMADEAPADATKLTITANVKNATYR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK I++YH++GYSFFAV +EPG+WSPEKRKNYNLVD ++R+NIQVYPN W
Sbjct  429   NFVEIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYNIPDN  LCG VKG P
Sbjct  489   AAIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMP  548

Query  216   LPKPY  202
             +P PY
Sbjct  549   MPAPY  553



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/484 (73%), Positives = 406/484 (84%), Gaps = 5/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG INVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKK+LD G T+ RPDG+++N
Sbjct  134   AGGYGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN R QGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNVRLQGHPMKLVELEGSHTVQNIY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQCLSVLVTAN+E KDYYLV +SRF KQE S+VA+IR  NG G  +      P
Sbjct  253   DSLDIHVGQCLSVLVTANQEPKDYYLVVSSRFLKQELSSVAIIRYANGKGPASPELPASP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+  +  GKLR
Sbjct  313   PD-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSMGQVNGKLR  371

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NG+SH+D +TPLKL+EYF   D    SFKYDLM D+   D SK+ +APNVKN T+RN
Sbjct  372   YGLNGISHSDTETPLKLVEYFGAADK---SFKYDLMADEAPADPSKLTVAPNVKNTTYRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK I++YH++GYSFFAV +EPG+WS EKRKNYNLVDA +R+NIQVYPN WA
Sbjct  429   FVEIIFENHEKSIRTYHLDGYSFFAVAVEPGRWSAEKRKNYNLVDATSRNNIQVYPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYN+PDN  LCG VKG PL
Sbjct  489   AIMLTFDNAGMWNLRSEMWEKTYLGEQMYFSVLSPSRSLRDEYNLPDNHPLCGVVKGMPL  548

Query  213   PKPY  202
             P PY
Sbjct  549   PAPY  552



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/487 (74%), Positives = 414/487 (85%), Gaps = 7/487 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+    PLFTME  KTYRYRVCN G+RTSVNFR QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  937
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG G  ++    P
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPASSDLPAP  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  NT+GIAWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VN++SE  GKL
Sbjct  315   PPE-NTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKL  373

Query  756   RYAINGVSHTD-PDTPLKLIEYFELKDNKEASFKYDLMPDQP-TGDTSKVILAPNVKNAT  583
             R+A+NG+SHT+  +TP KL EYF +    E  FKYDLM D+P T D +KV +APN+KNAT
Sbjct  374   RFALNGISHTNAAETPFKLAEYFGV---TEKMFKYDLMADEPQTDDLNKVTVAPNIKNAT  430

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FRNFVEIIFEN EK IQ+YH++GYSFFAV IEPGKWS EKRKNYNLVDA++RH+IQVYPN
Sbjct  431   FRNFVEIIFENREKTIQTYHLDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPN  490

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              WAAVMTTLDNAG+WN+RSEMWER+YLGQQ YFSVLSP RSLRDEYN+PDN  LCG VK 
Sbjct  491   SWAAVMTTLDNAGLWNLRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKS  550

Query  222   KPLPKPY  202
              P+P PY
Sbjct  551   MPMPSPY  557



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/487 (74%), Positives = 414/487 (85%), Gaps = 7/487 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+    PLFTME  KTYRYRVCN G+RTSVNFR QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  937
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG G  ++    P
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPASSDLPAP  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  NT+GIAWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VN+++E  GKL
Sbjct  315   PPE-NTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKL  373

Query  756   RYAINGVSHTD-PDTPLKLIEYFELKDNKEASFKYDLMPDQP-TGDTSKVILAPNVKNAT  583
             R+A+NG+SHT+  +TP KL EYF +    E  FKYDLM D+P T D +KV +APN+KNAT
Sbjct  374   RFALNGISHTNAAETPFKLAEYFGV---TEKMFKYDLMADEPQTDDLNKVTVAPNIKNAT  430

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FRNFVEIIFEN EK IQ+YH++GYSFFAV IEPGKWS EKRKNYNLVDA++RH+IQVYPN
Sbjct  431   FRNFVEIIFENREKTIQTYHLDGYSFFAVAIEPGKWSAEKRKNYNLVDAVSRHSIQVYPN  490

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              WAAVMTTLDNAG+WN+RSEMWER+YLGQQ YFSVLSP RSLRDEYN+PDN  LCG VK 
Sbjct  491   SWAAVMTTLDNAGLWNLRSEMWERYYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKS  550

Query  222   KPLPKPY  202
              P+P PY
Sbjct  551   MPMPSPY  557



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/487 (74%), Positives = 411/487 (84%), Gaps = 7/487 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+PLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDDPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+    PLFTME  KTYRYR+CN G+RTSVN R QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSLKVGDKVAEPLFTMEAGKTYRYRMCNAGMRTSVNVRIQGHPMKLVEMEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  937
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG G  ++    P
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPASSDLPAP  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  NT+GIAWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VN++SE  GKL
Sbjct  315   PPE-NTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKL  373

Query  756   RYAINGVSHTDP-DTPLKLIEYFELKDNKEASFKYDLMPDQP-TGDTSKVILAPNVKNAT  583
             R+A+NG+SHT   +TP KL EYF   D     FKYDLM D+P T D +KV + PN+KNAT
Sbjct  374   RFALNGISHTAAGETPFKLAEYFGATDKL---FKYDLMADEPQTEDLNKVTVVPNIKNAT  430

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FRNFVEIIFEN EK IQ+YH++GYSFFAV IEPG+WSPEKRKNYNLVDA++RH+IQVYPN
Sbjct  431   FRNFVEIIFENREKTIQTYHLDGYSFFAVAIEPGRWSPEKRKNYNLVDAVSRHSIQVYPN  490

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              WAAVMTTLDNAG+WN+RSEMWERFYLGQQ YFSVLSP RSLRDEYN+PDN  LCG VK 
Sbjct  491   SWAAVMTTLDNAGLWNLRSEMWERFYLGQQLYFSVLSPARSLRDEYNLPDNHPLCGIVKS  550

Query  222   KPLPKPY  202
              PLP PY
Sbjct  551   MPLPSPY  557



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/484 (73%), Positives = 408/484 (84%), Gaps = 5/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+G+Q RKNSW DGT GTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTSGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI R DG+++N
Sbjct  134   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRADGIIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVGE K   LFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-ESLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG G  +     PP
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPASPELPTPP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N+KS+  GKLR
Sbjct  313   PE-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLR  371

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NG+SHTD +TPLKL+EYF   D    +FKYDLM D+   D++K+ +A NVKNAT+RN
Sbjct  372   YGLNGISHTDSETPLKLVEYFGATDK---AFKYDLMADEAPADSTKLTIAANVKNATYRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK I++YH++GYSFFAV +EPG+WSPEKRKNYNLVD ++R+NIQVYPN WA
Sbjct  429   FVEIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYNIPDN  LCG VKG P+
Sbjct  489   AIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGMPM  548

Query  213   PKPY  202
             P PY
Sbjct  549   PAPY  552



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/484 (73%), Positives = 408/484 (84%), Gaps = 5/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY YFPTT+L RA
Sbjct  109   LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYSYFPTTALHRA  168

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++N
Sbjct  169   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIIN  228

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  229   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIY  287

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG G  +     PP
Sbjct  288   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPASPELPTPP  347

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N+ S+ GGKLR
Sbjct  348   PE-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLR  406

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NG+SHT+ +TPLKL+EYF   D    +FKYDLM D+   D SK+ +A NVKNAT+RN
Sbjct  407   YGLNGISHTNGETPLKLVEYFGATDK---AFKYDLMADEAPADPSKLTIATNVKNATYRN  463

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK I++YH++GYSFFAV +EPG+WSPEKRKNYNLVD ++R+NIQVYPN WA
Sbjct  464   FVEIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWA  523

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYNIPDN  LCG VKG  +
Sbjct  524   AIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSM  583

Query  213   PKPY  202
             P PY
Sbjct  584   PAPY  587



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/484 (73%), Positives = 408/484 (84%), Gaps = 5/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYSYFPTTALHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++N
Sbjct  134   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG G  +     PP
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPASPELPTPP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P  NTEGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N+ S+ GGKLR
Sbjct  313   PE-NTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLR  371

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NG+SHT+ +TPLKL+EYF   +    +FKYDLM D+   D SK+ +A NVKNAT+RN
Sbjct  372   YGLNGISHTNGETPLKLVEYFGATNK---AFKYDLMADEAPADPSKLTIATNVKNATYRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK I++YH++GYSFFAV +EPG+WSPEKRKNYNLVD ++R+NIQVYPN WA
Sbjct  429   FVEIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEMWE+ YLG+Q YFSVLSP RSLRDEYNIPDN  LCG VKG  +
Sbjct  489   AIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKGLSM  548

Query  213   PKPY  202
             P PY
Sbjct  549   PAPY  552



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/492 (71%), Positives = 413/492 (84%), Gaps = 11/492 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTTSL R
Sbjct  78    KLDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTSLHR  137

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+K LKK LD G+TI RPDG+ +
Sbjct  138   ASGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKALKKTLDGGRTIGRPDGIHI  197

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ K+G+ K  PLF+ME  K YRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQN+
Sbjct  198   NGKSNKLGD-KAEPLFSMEAGKIYRYRMCNVGMRTSVNVRIQGHAMKLVEMEGSHTVQNM  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG G  +T     
Sbjct  257   YDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQAISSVAILRYANGKGVGSTSISDH  316

Query  936   ppPV---NTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEG  766
              P     NT+GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN++S+  
Sbjct  317   LPTPPPNNTQGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSRSQVN  376

Query  765   GKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSK----VILAPN  598
             GKLR+A+NG+SH D DTPLKL+EYF +    E +FKYD+M D+P   +S     V +APN
Sbjct  377   GKLRFALNGISHMDSDTPLKLVEYFGVA---EKTFKYDVMGDEPPTPSSNNNKVVTIAPN  433

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             VKNATFRNFVEIIFEN EK IQ+YH++GYSFFAVGIEPGKW PEKRKNYNLVDA++RH+I
Sbjct  434   VKNATFRNFVEIIFENEEKTIQTYHLDGYSFFAVGIEPGKWKPEKRKNYNLVDAVSRHSI  493

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QVYPN WAA+MTTLDNAG+WN+RS+MWER YLGQQ YFSVLSP RSLRDEYN+PDN  LC
Sbjct  494   QVYPNSWAAIMTTLDNAGIWNLRSDMWERNYLGQQLYFSVLSPSRSLRDEYNLPDNHPLC  553

Query  237   GAVKGKPLPKPY  202
             G VK  P+P PY
Sbjct  554   GIVKSMPMPPPY  565



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/488 (72%), Positives = 405/488 (83%), Gaps = 9/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L R
Sbjct  76    HLDEPLLITWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTDLHR  135

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+GPINVHSR LIP+PFD PA E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +
Sbjct  136   AAGGFGPINVHSRNLIPIPFDSPAAEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHI  195

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GKVG+N   PLFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNV
Sbjct  196   NGKSGKVGDNAAEPLFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNV  255

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelp  940
             Y+SLDLHVGQCLSVLVTA++E K YY+V +SRF KQ E S+VA++R  NG G  ++    
Sbjct  256   YESLDLHVGQCLSVLVTADQEPKGYYMVVSSRFLKQAELSSVAIVRYANGKGPASSDLPA  315

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             PPP  NTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N++S+ GGK
Sbjct  316   PPPD-NTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIANSRSQVGGK  374

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNAT  583
             LR+A+NG+SH+  +TP KL EYF   D     FKYDLM D+ P+GD  KV +  N+KNAT
Sbjct  375   LRFALNGISHSPAETPFKLAEYFGATDK---VFKYDLMADEPPSGD--KVTVDHNIKNAT  429

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             +RN+VEIIFEN EK IQ+YH++GYSFFAV IEPGKWSPEKRKNYNLVDA++RH+IQVYPN
Sbjct  430   YRNYVEIIFENREKTIQTYHLDGYSFFAVAIEPGKWSPEKRKNYNLVDAVSRHSIQVYPN  489

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAV-K  226
              WAAVMTTLDNAG+WN+RS+MWER+YLGQQ YFSVL P RSLRDE        L   + K
Sbjct  490   SWAAVMTTLDNAGLWNLRSDMWERYYLGQQLYFSVLLPTRSLRDELQPSLTTTLSVVLSK  549

Query  225   GKPLPKPY  202
             G P+P PY
Sbjct  550   GMPMPPPY  557



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/484 (71%), Positives = 399/484 (82%), Gaps = 4/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+GIQQRKNSW DGTPGTMCPILPGTN+TYKFQVKDQIGSY YFPTT LQRA
Sbjct  75    LDEPLLLTWAGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYFPTTGLQRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G + VHSRELIPVPFD PA+EF V + DWY KG+KTLK+ILD+G++I +PDG+ +N
Sbjct  135   SGGMGMLKVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKRILDSGRSIGKPDGIQIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+  VG+    PL  MEP KTYRYRVCNVG++ SVNFRFQGH+M LVE+EGSHTVQNVY
Sbjct  195   GKSSSVGDAAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTA++  KDYYLV +SRF K+  STVA+IR  NGNG  +    PPP
Sbjct  255   DSLDLHVGQCLSVLVTADQAPKDYYLVVSSRFSKKVMSTVAVIRYKNGNGAASLSIPPPP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                N  GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ N+ +   GKLR
Sbjct  315   AE-NRAGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANSHAVVDGKLR  373

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + ING+SH + +TPLKL EYF L D     F Y+LM D+PT   +K+ LAP+V NATFRN
Sbjct  374   FGINGISHVNTETPLKLAEYFGLGDK---VFTYNLMKDEPTEGDNKLALAPSVVNATFRN  430

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQ++H++GYSFFAV +EPG+W+PEKRKNYNL+DA++RH IQVYPN WA
Sbjct  431   FVEIIFENREKTIQTWHLDGYSFFAVAVEPGRWAPEKRKNYNLLDAVSRHTIQVYPNSWA  490

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVMTTLDNAGMWN+RS+M ER YLGQQFYFSVLSPE SLRDEYNI   Q LCG V G P+
Sbjct  491   AVMTTLDNAGMWNLRSDMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPM  550

Query  213   PKPY  202
             P PY
Sbjct  551   PAPY  554



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/484 (72%), Positives = 399/484 (82%), Gaps = 4/484 (1%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW GIQQRKNSW DGTPGTMCPILPGTN+TYKFQVKDQIGSY YFPTT LQRA
Sbjct  75    LDEPLLLTWGGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYFPTTGLQRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G + VHSRELIPVPFD PA+EF V + DWY KG+KTLKKILD+G++I +PDG+ +N
Sbjct  135   SGGMGMLQVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKKILDSGRSIGKPDGIQIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ KVG+    PL  MEP KTYRYRVCNVG++ SVNFRFQGH+M LVE+EGSHTVQNVY
Sbjct  195   GKSSKVGDVAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLHVGQCLSVLVTAN+  KDYYLV +SRF KQ  S+VA+I+  N NG  +T   PPP
Sbjct  255   DSLDLHVGQCLSVLVTANQAPKDYYLVVSSRFSKQVMSSVAVIKYKNANGAASTVIPPPP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                N  GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+ NT +   GKLR
Sbjct  315   AE-NRVGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANTHAVVDGKLR  373

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + ING+SH + +TPLKL EYF L D     F Y+LM D+PT   +K+++AP+V NATFRN
Sbjct  374   FGINGISHVNTETPLKLAEYFGLGDK---VFTYNLMKDEPTEGDNKLVVAPSVVNATFRN  430

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQ++H++GYSFFAV +EPG+WSPEKRK YNL+DA++RH IQVYPN W+
Sbjct  431   FVEIIFENREKTIQTWHLDGYSFFAVAVEPGRWSPEKRKTYNLLDAVSRHTIQVYPNSWS  490

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVMTTLDNAGMWN+RS+M ER YLGQQFYFSVLSPE SLRDEYNI   Q LCG V G P+
Sbjct  491   AVMTTLDNAGMWNLRSDMLERTYLGQQFYFSVLSPENSLRDEYNIFPTQQLCGIVSGLPM  550

Query  213   PKPY  202
             P PY
Sbjct  551   PAPY  554



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/486 (72%), Positives = 405/486 (83%), Gaps = 4/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEPLLFTW+GIQQRKNSW+DGT GTMCPILPG NFTYKFQVKDQIGSYFYFPTT+  R
Sbjct  77    HLDEPLLFTWTGIQQRKNSWMDGTLGTMCPILPGQNFTYKFQVKDQIGSYFYFPTTAFHR  136

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + +HSR+LIPVPFD PA+EF V + DWY KG+KTLKKILD+G TI  P+G+ +
Sbjct  137   AAGGMGMLQIHSRDLIPVPFDTPADEFAVLLGDWYNKGHKTLKKILDSGATIGLPNGIHI  196

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++GKVG   L PL  +EP KTYRYRVCNVGLRTS+NFRFQ H M LVE+EGSHTVQNV
Sbjct  197   NGQSGKVGSAPLTPLAIVEPGKTYRYRVCNVGLRTSINFRFQSHIMKLVEVEGSHTVQNV  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLH GQC+SVLVTA++  KDYYLVA+SRF K+  S+VA+IR  NG G PA+PELPP
Sbjct  257   YDSLDLHAGQCVSVLVTADQAPKDYYLVASSRFSKKPLSSVAIIRYANGKGAPASPELPP  316

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PPP NT GIAWS+NQFRS+RWNLTASAARPNPQGSYHYG+I ITRT+K+ N++ +  GKL
Sbjct  317   PPPENTAGIAWSVNQFRSYRWNLTASAARPNPQGSYHYGKINITRTIKIANSRYQVNGKL  376

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH + +TPLKL EYF L D    +F YDL+ D+P+ D  KV+LAP+V NATFR
Sbjct  377   RFGINGVSHIESETPLKLAEYFGLADK---AFNYDLVKDEPSND-KKVVLAPSVVNATFR  432

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFEN+E  IQ++H++GYSFFAV IE GKW+PEKRKNYNL+DA++RH I VYP  W
Sbjct  433   NFVEIIFENNENTIQTWHLDGYSFFAVAIEAGKWNPEKRKNYNLLDAVSRHTIHVYPKSW  492

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RS+M ER YLGQQ YFSVLSP RSLRDEYNIP  Q LCG V+  P
Sbjct  493   AAVMTTLDNAGMWNLRSDMAERAYLGQQLYFSVLSPARSLRDEYNIPLTQQLCGIVQNLP  552

Query  216   LPKPYT  199
              P PY+
Sbjct  553   KPTPYS  558



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/488 (72%), Positives = 408/488 (84%), Gaps = 7/488 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLL TW+G+QQRKNSW DGT GTMCPILPG N+TY FQVKDQIGSYFY+PT  LQ+
Sbjct  74    QLDEPLLLTWAGVQQRKNSWQDGTLGTMCPILPGQNYTYHFQVKDQIGSYFYYPTVGLQK  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG GP+NVHSR+LIPVPFD PA+E+NV V DWY KG+K LK +LD+G+++ RPDG+ +
Sbjct  134   AAGGMGPLNVHSRDLIPVPFDWPADEYNVLVGDWYTKGHKALKNMLDSGRSLGRPDGIQI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ KVG+N + PLFTMEP KTYRYRVCNVGL+TS+NFR QGH + LVEIEGSHTVQ  
Sbjct  194   NGKSAKVGDN-VEPLFTMEPGKTYRYRVCNVGLKTSINFRIQGHPLKLVEIEGSHTVQYD  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             +DSLD+HVGQCLSVLVTA+KE KDYY VA+SRF +   S+V +IR  NG G PA+PELPP
Sbjct  253   FDSLDVHVGQCLSVLVTADKEPKDYYFVASSRFIQAPLSSVGIIRYTNGKG-PASPELPP  311

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
              PPV + GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN++S  GGKL
Sbjct  312   SPPVGSAGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSESRVGGKL  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTG-DTSKVILAPNVKNATF  580
             RYAINGVSH D  TPLK  EYF + D     F+Y+L+ D  +  +T   I+AP+V NATF
Sbjct  372   RYAINGVSHIDTPTPLKHAEYFGVADKL---FQYNLVKDDGSAVNTPAPIIAPSVVNATF  428

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEIIFENHEK IQ+Y+++GYSFFAV +EPG WSPEKRKNYNL+DAI+RHN+QVYP  
Sbjct  429   RNFVEIIFENHEKTIQTYNLDGYSFFAVAVEPGTWSPEKRKNYNLLDAISRHNVQVYPGS  488

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA+MTTLDNAGMWN+RSEM  R YLGQQ YFSVLSP RSLRDEYN+PDNQ LCG +  K
Sbjct  489   WAAIMTTLDNAGMWNLRSEMQHRAYLGQQLYFSVLSPARSLRDEYNLPDNQPLCGGIVEK  548

Query  219   -PLPKPYT  199
              PLP PYT
Sbjct  549   LPLPAPYT  556



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/486 (70%), Positives = 399/486 (82%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+G+QQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT L R
Sbjct  74    QLDEPFLLTWAGVQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTGLHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G I +HSR LIP+PFD+PA+E+ V + DWY KG+K+LK ILD+G++I RPDG+ +
Sbjct  134   ASGGMGMIQIHSRNLIPIPFDKPADEYPVLLGDWYNKGHKSLKNILDSGRSIGRPDGIQI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E  KTYR+RVCNVGLR SVNFR Q HSMT+VE+EGSHTVQNV
Sbjct  194   NGQSSKVGDANAKPLFTFEAGKTYRFRVCNVGLRLSVNFRIQAHSMTVVEVEGSHTVQNV  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  254   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPASPELPPP  313

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  NT GIAWSI+QFRSFRWNLTASAARPNPQGSY YG+I ITRT+KLVNT+S   GKL
Sbjct  314   PPQ-NTMGIAWSISQFRSFRWNLTASAARPNPQGSYKYGKINITRTIKLVNTRSSSNGKL  372

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  + +KV +APNV N T+R
Sbjct  373   RFGINGVSHVDTETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGNKVEVAPNVVNGTYR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++GYSFFAV IEPG+WSPEKRKNYNL+DA++R+ IQVYPN W
Sbjct  429   NFVEIIFENHEKTIQTWHLDGYSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNTW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQFYFSV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  489   AAVMTTLDNAGMWNLRSEMRERAYLGQQFYFSVVSEARSLRDEYSLPETQELCGIVKSLP  548

Query  216   LPKPYT  199
              P PYT
Sbjct  549   KPAPYT  554



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/489 (69%), Positives = 400/489 (82%), Gaps = 8/489 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW GIQQRKNSW DGT GTMCPI PGTN+T+KFQVKDQIGSY+YFPTT LQR
Sbjct  78    KLDEPFLLTWYGIQQRKNSWQDGTLGTMCPIQPGTNYTFKFQVKDQIGSYYYFPTTGLQR  137

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIPVPFD PA+E+ V   DWY KG+K+++K LD G+++ RPDG+ +
Sbjct  138   ASGGIGGLQVHSRLLIPVPFDAPADEYFVIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQI  197

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GKVG +   P+F ME  K YRYRVCNVG++TS+NFR QGHS+ LVE+EGSHTVQNV
Sbjct  198   NGKSGKVGGSN-EPMFNMEAGKIYRYRVCNVGMKTSLNFRIQGHSLKLVEMEGSHTVQNV  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+H+GQC SVLV AN+E  DYY+V +SRF KQ  ++VA+IR  NG   P++    P
Sbjct  257   YDSLDVHIGQCFSVLVEANQEPNDYYMVFSSRFTKQPLTSVAVIRYANGKNSPSSELPAP  316

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP   T GIAWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+++   GKL
Sbjct  317   PPETAT-GIAWSINQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSRNNVDGKL  375

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS---KVILAPNVKNA  586
             RYAINGVSH +P TPLKL+EY+ ++D     FKYD++ D+P   +    K++LAPNV NA
Sbjct  376   RYAINGVSHVEPTTPLKLVEYYGIQDK---VFKYDIIKDEPEAASESNEKIVLAPNVLNA  432

Query  585   TFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYP  406
             TFRNFVEII ENHEK IQ++H++GYSFFAV IEPG+W+PEKRKNYNLVDA++RHNIQVYP
Sbjct  433   TFRNFVEIILENHEKTIQTWHLDGYSFFAVAIEPGRWTPEKRKNYNLVDAVSRHNIQVYP  492

Query  405   NCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
               WAA+MTTLDNAGMWN+RSEMWER YLGQQFYFSVLSP RSLRDEYN+P+   +CG VK
Sbjct  493   GSWAAIMTTLDNAGMWNMRSEMWERAYLGQQFYFSVLSPARSLRDEYNLPEKTPVCGLVK  552

Query  225   GKPLPKPYT  199
               P P PY+
Sbjct  553   DLPEPPPYS  561



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/486 (69%), Positives = 400/486 (82%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E   TY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGNTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  A+PELPP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPHSTVAVIRYANGNGA-ASPELPP  313

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PPP NT+GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+I ITRT+K+ N++S   GKL
Sbjct  314   PPPENTKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  +  KV +APNV N T+R
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGDKVEVAPNVVNGTYR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++G+SFFAV IEPG+WSPEKRKNYNL+DA++R+ IQVYPN W
Sbjct  430   NFVEIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQFY SV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  490   AAVMTTLDNAGMWNLRSEMRERAYLGQQFYLSVVSEARSLRDEYSLPETQELCGIVKSLP  549

Query  216   LPKPYT  199
              P PYT
Sbjct  550   KPAPYT  555



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/486 (69%), Positives = 400/486 (82%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  74    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  134   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  194   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  A+PELPP
Sbjct  254   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGA-ASPELPP  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PPP NT+GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+I ITRT+K+ N++S   GKL
Sbjct  313   PPPENTKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  372

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  + +KV +APNV N T+R
Sbjct  373   RFGINGVSHVDAETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGNKVEVAPNVVNGTYR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++G+SFFAV IEPG+WS EKRKNYNL+DA++R+ IQVYPN W
Sbjct  429   NFVEIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQ Y SV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  489   AAVMTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLP  548

Query  216   LPKPYT  199
              P PYT
Sbjct  549   KPAPYT  554



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/519 (68%), Positives = 404/519 (78%), Gaps = 32/519 (6%)
 Frame = -2

Query  1671  VNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQV------------  1528
             VNVFNELDEPLLFTW+GIQQRKNSW DG P T CPI PG N+TYKFQV            
Sbjct  69    VNVFNELDEPLLFTWNGIQQRKNSWQDGLPATNCPIPPGKNWTYKFQVCAFHDPWRVGEC  128

Query  1527  ---------------KDQIGSYFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFN  1393
                            KDQIGS+FYFPTT LQRA GG G + VHSR+LIPVPFDRPA+EF 
Sbjct  129   KIHGGWVIFGWVSQVKDQIGSFFYFPTTGLQRAGGGMGMMQVHSRDLIPVPFDRPADEFA  188

Query  1392  VFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRV  1213
             V V DWY KG+KTLK ILD+G++I  PDG+ +NGK GKVG     P+FT+E  KTYRYRV
Sbjct  189   VLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGS-PPMFTVEKGKTYRYRV  247

Query  1212  CNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLV  1033
             CNVG+R SVNFR QGH + LVE+EGSHTVQNVYDSLDLHVGQC+SVL+TA++   DY+ V
Sbjct  248   CNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLITADQAPADYHFV  307

Query  1032  ATSRFFKQEFSTVALIRNGNGNGGpatpelppppPVNTEGIAWSINQFRSFRWNLTASAA  853
              +SRF K+  STVA+IR     G   +  +PPPPP N+ GIAWSINQFRSFRWNLTASAA
Sbjct  308   VSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQFRSFRWNLTASAA  367

Query  852   RPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNK  673
             RPNPQGSYHYG+I ITRT+K+VN + +  GKLR+ INGVSH D +TPLKL EYF + D  
Sbjct  368   RPNPQGSYHYGKINITRTIKVVNARYQVNGKLRFGINGVSHVDGETPLKLAEYFGVGDK-  426

Query  672   EASFKYDLMPDQPTG-DTSKVILAPNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAV  496
                FKYD+M D+PTG D  K  LAPNV NATFRNFVEI+FENHE+ IQ++H++GY+FFAV
Sbjct  427   --VFKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTIQTWHLDGYAFFAV  484

Query  495   GIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQ  316
              +EPG+WSPEKRKNYNL DA++RH IQVYPN WAAVMTTLDNAG+WN+RSEM ER YLGQ
Sbjct  485   AVEPGRWSPEKRKNYNLEDAVSRHTIQVYPNSWAAVMTTLDNAGLWNLRSEMRERAYLGQ  544

Query  315   QFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLPKPYT  199
             QFYFSVLSP RSLRDEYNI  +Q LCG VKG PLP PY+
Sbjct  545   QFYFSVLSPARSLRDEYNILPDQPLCGIVKGLPLPMPYS  583



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 385/487 (79%), Gaps = 9/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  134   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  194   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  254   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVNT     GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFR  577
             YAING+SH D DTPLKL EYF + D     FKYD +PD+P G  S K+++ PNV NATFR
Sbjct  369   YAINGMSHVDKDTPLKLAEYFGVADK---VFKYDSIPDEPKGKGSEKIVMGPNVLNATFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEII ENHEK IQS+H++GYSFFAVGIEPGKW+PE+RKNYNL+DA++RH +QV+PN W
Sbjct  426   NFVEIILENHEKSIQSWHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSE+W+RFYLGQQ Y SVLSP RSLRDEYNIPD   LCG VKG P
Sbjct  486   AAILLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLP  545

Query  216   LPKPYTI  196
              P PYTI
Sbjct  546   KPPPYTI  552



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/486 (67%), Positives = 395/486 (81%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGAASPELPPP  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  +T+GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+I ITRT+K+ N++S   GKL
Sbjct  315   PPD-STKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  + +KV +APNV N T+R
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGNKVEVAPNVVNGTYR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++G+SFFAV IEPG+WS EKRKNYNL+DA++R+ IQVYPN W
Sbjct  430   NFVEIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSAEKRKNYNLLDAVSRNTIQVYPNSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQ Y SV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  490   AAVMTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLP  549

Query  216   LPKPYT  199
              P PYT
Sbjct  550   KPAPYT  555



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 385/487 (79%), Gaps = 9/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  75    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  135   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  195   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  255   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVNT     GKLR
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFR  577
             YAING+SH D DTPLKL EYF + D     FKYD +PD+P G  S K+++ PNV NATFR
Sbjct  370   YAINGMSHVDKDTPLKLAEYFGVADK---VFKYDSIPDEPKGKGSEKIVMGPNVLNATFR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEII ENHEK IQS+H++GYSFFAVGIEPGKW+PE+RKNYNL+DA++RH +QV+PN W
Sbjct  427   NFVEIILENHEKSIQSWHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSE+W+RFYLGQQ Y SVLSP RSLRDEYNIPD   LCG VKG P
Sbjct  487   AAILLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLP  546

Query  216   LPKPYTI  196
              P PYTI
Sbjct  547   KPPPYTI  553



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 385/487 (79%), Gaps = 9/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  73    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  133   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  193   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  253   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVNT     GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFR  577
             YAING+SH D DTPLKL EYF + D     FKYD +PD+P G  S K+++ PNV NATFR
Sbjct  368   YAINGMSHVDKDTPLKLAEYFGVADK---VFKYDSIPDEPKGKGSEKIVMGPNVLNATFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEII ENHEK IQS+H++GYSFFAVGIEPGKW+PE+RKNYNL+DA++RH +QV+PN W
Sbjct  425   NFVEIILENHEKSIQSWHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPNSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSE+W+RFYLGQQ Y SVLSP RSLRDEYNIPD   LCG VKG P
Sbjct  485   AAILLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLP  544

Query  216   LPKPYTI  196
              P PYTI
Sbjct  545   KPPPYTI  551



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/487 (67%), Positives = 384/487 (79%), Gaps = 9/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  134   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  194   GKSGKVEGDKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  254   DSLDVHVGQCYSVLVTANQTPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVNT     GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFR  577
             YAING+SH D DTPLKL EYF + D     FKYD +PD+P G  S K+++ PNV NATFR
Sbjct  369   YAINGMSHVDKDTPLKLAEYFGVADK---VFKYDSIPDEPKGKGSEKIVMGPNVLNATFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEII ENHEK IQS+H++GYSFFAVGIEPGKW+PE+RKNYNL+DA++RH +QV+P  W
Sbjct  426   NFVEIILENHEKSIQSWHLDGYSFFAVGIEPGKWTPERRKNYNLLDAVSRHTVQVFPKSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSE+W+RFYLGQQ Y SVLSP RSLRDEYNIPD   LCG VKG P
Sbjct  486   AAILLTFDNAGMWNLRSEIWDRFYLGQQLYVSVLSPARSLRDEYNIPDGTKLCGIVKGLP  545

Query  216   LPKPYTI  196
              P PYTI
Sbjct  546   KPPPYTI  552



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 394/486 (81%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWVGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPASPELPPP  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PP  +T+GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+I ITRT+K+ N++S   GKL
Sbjct  315   PPD-STKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  +  KV +APNV N T+R
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGDKVEVAPNVVNGTYR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++G+SFFAV IEPG+WSPEKRKNYNL+DA++R+ IQVYPN W
Sbjct  430   NFVEIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSPEKRKNYNLLDAVSRNTIQVYPNSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQ Y SV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  490   AAVMTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLP  549

Query  216   LPKPYT  199
              P PYT
Sbjct  550   KPAPYT  555



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/486 (69%), Positives = 399/486 (82%), Gaps = 5/486 (1%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH++ +VE+EGSH VQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTLKVVEVEGSHNVQNL  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  A+PELPP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYVNGNGA-ASPELPP  313

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             PPP NT+GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+I ITRT+K+ N++S   GKL
Sbjct  314   PPPENTKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH D +TPLKL EY+ + D     F Y+LM D+P  +  KV +APNV N T+R
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADK---VFTYNLMKDEPQ-EGDKVEVAPNVVNGTYR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQ++H++G+SFFAV IEPG+WSPEKRKNYNL+DA++R+ IQVYPN W
Sbjct  430   NFVEIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSPEKRKNYNLLDALSRNTIQVYPNSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAVMTTLDNAGMWN+RSEM ER YLGQQ Y SV+S  RSLRDEY++P+ Q LCG VK  P
Sbjct  490   AAVMTTLDNAGMWNLRSEMRERAYLGQQLYLSVVSEARSLRDEYSLPETQELCGIVKSLP  549

Query  216   LPKPYT  199
              P PYT
Sbjct  550   KPAPYT  555



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/493 (65%), Positives = 386/493 (78%), Gaps = 9/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TWSG+QQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT + RA GG+G + ++SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  128   TTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NGKN K G+ K  PLFTM+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGS
Sbjct  188   PTGVLINGKNAK-GDGKDEPLFTMKPGKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQNVY++LD+HVGQC SVLVTAN+  KDYY+V T+RF KQ  +   +IR  NG G  +
Sbjct  247   HVVQNVYEALDVHVGQCFSVLVTANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
              EGGKLRYA+NGVSH DP+TPLK+ EY+ + D     FKY+ + D P+    KV+  PNV
Sbjct  362   REGGKLRYALNGVSHVDPETPLKIAEYYGIADK---VFKYNTIKDMPSAKIGKVVTQPNV  418

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              N TFRNFVEIIFENHEK +QSYH++GYSFFAV IEPG W+PEKRKNYNL+DA++R  IQ
Sbjct  419   LNQTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQ  478

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             V+P  WAA+  T DNAGMWN+RSEMWE+ YLGQQ Y SVLSPE SLRDEYNIPDN LLCG
Sbjct  479   VFPKSWAAIFLTFDNAGMWNIRSEMWEKTYLGQQLYVSVLSPELSLRDEYNIPDNALLCG  538

Query  234   AVKGKPLPKPYTI  196
              VKG P PKPYTI
Sbjct  539   KVKGLPKPKPYTI  551



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/493 (65%), Positives = 387/493 (78%), Gaps = 9/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TWSG+QQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT + RA GG+G + ++SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  128   TTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NGKN K G+ K  PLF M+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGS
Sbjct  188   PTGVLINGKNAK-GDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQNVY+SLD+HVGQC SVLVTAN+  KDYY+VA++RF KQ  +   +IR  NG G  +
Sbjct  247   HVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S
Sbjct  307   PEFPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
              EGGKLRY++NGVSH DP+TPLK+ EY+ + D     FKY+ + D P+    KV+  PNV
Sbjct  362   REGGKLRYSLNGVSHVDPETPLKIAEYYGIADK---VFKYNTIKDMPSAKIGKVVTQPNV  418

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              N TFRNFVEIIFENHEK +QSYH++GYSFFAV IEPG W+PEKRKNYNL+DA++R  IQ
Sbjct  419   LNQTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRTTIQ  478

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             V+P  WAA++ T DNAGMWN+RSEMWE+ YLGQQ Y SVLSPE SLRDEYNIPDN LLCG
Sbjct  479   VFPKSWAAILLTFDNAGMWNIRSEMWEKAYLGQQLYVSVLSPELSLRDEYNIPDNALLCG  538

Query  234   AVKGKPLPKPYTI  196
              VKG P PKPYTI
Sbjct  539   KVKGLPKPKPYTI  551



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/492 (67%), Positives = 400/492 (81%), Gaps = 13/492 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP LFTW+G+QQRKNSW +GT GT CPI PG+NFTY+FQVKDQIGS++Y+PTT+L R
Sbjct  74    QLDEPFLFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSFYYYPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  1300
             A GGYG I+VHSR LIP+PFD  PA+EF V VSDWY K +  L+K+LD+G++  RP+G++
Sbjct  134   AAGGYGGISVHSRALIPIPFDVNPADEFFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVI  193

Query  1299  MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             +NGK+GK G+NK  P+FTM P KTYRYR CNVG++ S+N R QGH M LVEIEGSHTVQN
Sbjct  194   INGKSGK-GDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHIMKLVEIEGSHTVQN  252

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLD+H+GQC+SVLVTA+K+ KDY+LVA++RF K+  +  A IR GNG G PA+ ELP
Sbjct  253   MYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYGNGKGAPASLELP  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
               P     G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT     GK
Sbjct  313   KAPI----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGSVDGK  368

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTS-KVILAPNVK  592
             LRYAINGVSH +P+TP+KL EY+ + D     FKYD++ D    PT  T  K+ LAPNV 
Sbjct  369   LRYAINGVSHVNPETPIKLAEYYSVADK---VFKYDIIKDDYEAPTAKTEEKITLAPNVV  425

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
             N T+RNFVEIIFENHEK +QS+H+ GYSFFAV IEPGKW+ EKRKNYNL+DA++R+ IQV
Sbjct  426   NGTYRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTAEKRKNYNLLDAVSRNTIQV  485

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAA+MTT+DNAG+WN+RS   ER YLGQQ YFSVLSP+R L+DEYN+PDN +LCG 
Sbjct  486   YPNSWAAIMTTIDNAGLWNLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGI  545

Query  231   VKGKPLPKPYTI  196
             +K  PLPKPY++
Sbjct  546   IKDMPLPKPYSV  557



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/493 (66%), Positives = 392/493 (80%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEPLLFTWSG+QQRKNSW DGT GTMCPI PG N+TY+FQVKDQIGSYFY+P
Sbjct  68    VLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQIGSYFYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ RA GG+G + ++SR LIPVP+  P +++ V + DWY KG+  LKK LD+G+++AR
Sbjct  128   ITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKGHTALKKHLDSGRSMAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  188   PDGVIINGKSAK-GDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K+  +   ++R  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKKVLTGKGIMRYENGNGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRTLK+VN+ +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTLKIVNSAT  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EY+ + D     FKYD + D P      KV LAPN
Sbjct  362   KVDGKLRYAINGVSHVDPETPLKLAEYYGVADK---VFKYDTIQDDPPATVEDKVTLAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNFVEIIFENHEK IQS++++GYSFFAV IEPG+W+PEKRKNYNL+D ++RH I
Sbjct  419   VVNQTFRNFVEIIFENHEKSIQSWNLDGYSFFAVAIEPGRWAPEKRKNYNLLDGVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWNVRSE  ER YLGQQFY SVLSP RSLRDEYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNVRSEQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVC  538

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  539   GIVKDLPKPPPYS  551



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 398/492 (81%), Gaps = 13/492 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP LFTW+G+QQRKNSW +GT GT CPI PG+NFTY+FQVKDQIGS++Y+PTT+L R
Sbjct  74    QLDEPFLFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSFYYYPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  1300
             A GGYG I+VHSR LIPVPFD  PA+EF V VSDWY K +  ++K+LD+G+ + RP+G++
Sbjct  134   AAGGYGGISVHSRALIPVPFDVNPADEFFVLVSDWYTKSHSQMRKLLDSGRALGRPNGVI  193

Query  1299  MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             +NGK+GK G+NK  P+FTM P KTYRYR CNVG++ S+N R QGH M LVEIEGSHTVQN
Sbjct  194   INGKSGK-GDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHVMKLVEIEGSHTVQN  252

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLD+H+GQC+SVLVTA+K+ KDY+LVA++RF K+  +  A IR  NG G PA+ ELP
Sbjct  253   MYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYANGKGAPASLELP  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
               P     G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I  TRT+KLVN      GK
Sbjct  313   KAPI----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINFTRTIKLVNAAGSVDGK  368

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTS-KVILAPNVK  592
             LRYAINGVSH +P+TP+KL EY+ + +     FKYDL+ D    PT  T  K+ LAPNV 
Sbjct  369   LRYAINGVSHVNPETPIKLAEYYGVANK---VFKYDLIKDDYEAPTAKTEEKITLAPNVV  425

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
             N T+RNFVEIIFENHEK +QS+H+ GYSFFAV IEPGKW+PEKRKNYNL+DA++R+ IQV
Sbjct  426   NGTYRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQV  485

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAA+MTT+DNAG+WN+RS   ER YLGQQ YFSVLSP+R L+DEYN+PDN +LCG 
Sbjct  486   YPNSWAAIMTTIDNAGLWNLRSNSLERQYLGQQLYFSVLSPKRDLKDEYNMPDNDILCGI  545

Query  231   VKGKPLPKPYTI  196
             +K  PLPKPY++
Sbjct  546   IKDMPLPKPYSV  557



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/494 (65%), Positives = 390/494 (79%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPILPGTN+TY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  LK++LD+G++IAR
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQLLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKSAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  +G G  +
Sbjct  248   HTVQNDYESLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKGPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S
Sbjct  308   PEIPEAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSIS  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+   +  + V +APN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEVADK---VFKYDTISDEGLAEGATTVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NATFRNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH I
Sbjct  420   VVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA++ T DNAGMWN+RSE+ E  YLG Q Y SVLSP RSLRDEYNIPDN LLC
Sbjct  480   QVFPKSWAAILLTFDNAGMWNLRSELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLPKPYTI
Sbjct  540   GLVKDMPLPKPYTI  553



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/490 (65%), Positives = 386/490 (79%), Gaps = 11/490 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLLFTWSGIQQRKNSW DGTPGTMCPI PGTN+TY+FQVKDQIGSYFYFPTT   R
Sbjct  77    QLDEPLLFTWSGIQQRKNSWQDGTPGTMCPIQPGTNYTYRFQVKDQIGSYFYFPTTGFMR  136

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + V+SR LIPVPF  P +++ + V DWYK+ +  L+K L+NG+++ARPD ++M
Sbjct  137   AAGGFGGLRVNSRLLIPVPFADPEDDYTIMVGDWYKESHAVLRKHLENGKSLARPDAVLM  196

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK GKVG+ K  PLFTM+P KTYRYR+CNVG++ S+NFR QGH+M LVE+EGSHTVQN+
Sbjct  197   NGKQGKVGDPKEEPLFTMKPGKTYRYRICNVGMKNSINFRMQGHTMKLVEVEGSHTVQNM  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+H+GQC SVLVTA+KE KDYY+VA++RF K       ++R   G G P+T     
Sbjct  257   YDSLDIHLGQCYSVLVTADKEPKDYYMVASTRFTKYHLQATGIVRYEGGKGAPSTVLPEA  316

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRS RWNLTASAARPNPQGSYHYG+I ITRT+KL NT     GKL
Sbjct  317   PV-----GWAWSLNQFRSLRWNLTASAARPNPQGSYHYGQINITRTIKLANTAGTVDGKL  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT---SKVILAPNVKNA  586
             RYAING SHTD DTPLKL+EY+++    + +FKYD++ D+P  +     K    PNV N 
Sbjct  372   RYAINGHSHTDVDTPLKLLEYYQV---AQKAFKYDVIKDEPPANVETLDKFTTGPNVLNG  428

Query  585   TFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYP  406
             TFRNF+EIIFENHEK IQS+H++GYSFF V IE G+W+PEKRKNYNL+DA++R+ IQVYP
Sbjct  429   TFRNFIEIIFENHEKSIQSWHLDGYSFFPVAIEVGQWTPEKRKNYNLLDAVSRYTIQVYP  488

Query  405   NCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
               WAA+M T DNAGMW++R+E  ER +LGQQ Y SVLSPERSLRDEYN+PDN L+CG VK
Sbjct  489   KSWAAIMLTTDNAGMWHLRNEAPERSFLGQQMYISVLSPERSLRDEYNLPDNSLICGLVK  548

Query  225   GKPLPKPYTI  196
               P P PY+I
Sbjct  549   DMPKPPPYSI  558



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/494 (65%), Positives = 387/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPILPGTN+TY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  LK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK  K G+    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  +G G  +
Sbjct  248   HTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKGPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S
Sbjct  308   PEIPEAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSIS  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+   +  + V +APN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEVADK---VFKYDTISDEGLAEGATTVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NATFRNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH I
Sbjct  420   VVNATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRANYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA++ T DNAGMWN+RSE+ E  YLG Q Y SVLSP RSLRDEYNIPDN LLC
Sbjct  480   QVFPKSWAAILLTFDNAGMWNLRSELLENRYLGSQLYVSVLSPARSLRDEYNIPDNTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLPKPYTI
Sbjct  540   GLVKDMPLPKPYTI  553



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/490 (65%), Positives = 387/490 (79%), Gaps = 13/490 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+G+QQRKNSW +G  GT CPI PGTN T++FQVKDQIGSY+Y+P+T+L RA
Sbjct  77    LDEPLLFTWNGVQQRKNSWQEGLLGTSCPIPPGTNHTFRFQVKDQIGSYYYYPSTALHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYGP+ V SR+LIPVPFD P  ++ +   DWY K +  L+K+LD+G+T+ RPDG+++N
Sbjct  137   AGGYGPLTVVSRDLIPVPFDAPEADYTIMAGDWYSKSHVALRKLLDSGRTLGRPDGVLIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK  + K  P+FTM P KTYRYRVCNVG++ S+NFRFQGH+M LVE+EGSHT+Q +Y
Sbjct  197   GKSGK-ADGKDEPMFTMIPGKTYRYRVCNVGMKNSLNFRFQGHTMKLVEMEGSHTMQYLY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLH+GQC SVLVTA+KE KDYY VA++RF KQ  S  A IR   G G  +    P P
Sbjct  256   DSLDLHLGQCASVLVTADKEPKDYYFVASTRFTKQILSATATIRYTTGKGPASPELPPAP  315

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+++VN+  E  GKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIRIVNSAGEADGKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSK----VILAPNVKNA  586
             YAINGVSH DP+TPLKL EYF + D     FKY+++ D+P+ D +     + LAPNV NA
Sbjct  371   YAINGVSHVDPETPLKLAEYFGVADK---VFKYNIIQDEPSADATAKNHAITLAPNVVNA  427

Query  585   TFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYP  406
             TFRNF+EII ENHEK +QS+H++GYSFFAV IEPG W+PE+RK YNL+DAI+R+ IQVYP
Sbjct  428   TFRNFIEIILENHEKTVQSWHLDGYSFFAVAIEPGTWTPERRKVYNLLDAISRNTIQVYP  487

Query  405   NCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
               WAA+M T+DNAGMWN+RS + ER YLGQQ YFSVLSP  SLRDEYN+PD+ LLCG VK
Sbjct  488   KSWAAIMLTMDNAGMWNLRSTLLERQYLGQQLYFSVLSPNYSLRDEYNVPDDALLCGIVK  547

Query  225   GKPLPKPYTI  196
               P PKPY+I
Sbjct  548   DMPKPKPYSI  557



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/493 (65%), Positives = 384/493 (78%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TWSGIQQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ RA GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKK+LD+G+T+ R
Sbjct  128   VTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGKN K G+ K  PLFTM+P KTY+YRVCNVGL+ S+NFR QGH + LVE+EGS
Sbjct  188   PDGILINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENGNGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ S
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
                GKLRYAINGVSH + +TPLKL EYF + D     FKYD + D+P      KV LAPN
Sbjct  362   RVNGKLRYAINGVSHVESETPLKLAEYFGVADK---VFKYDTIQDEPRATVEDKVTLAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFR+FVEIIFENHEK IQS+H++GYSFFAV IEPG+W+PEKRKNYNL+D ++RH I
Sbjct  419   VVNQTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWNVRSE  ER YLGQQFY SVLSP  SLRDEYN+P+   LC
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPAHSLRDEYNLPETTQLC  538

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  539   GIVKDLPKPPPYS  551



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/486 (67%), Positives = 378/486 (78%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+GIQQRKNSW +G  GT CPI PGTNFTYKFQVKDQIGSYFY+PTTSL RA
Sbjct  74    LDEPLLFTWNGIQQRKNSWQEGVLGTNCPIQPGTNFTYKFQVKDQIGSYFYYPTTSLHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYGP+ VHSRELIPVPFD P EE+ V   DWY+K +  LK+ +DNG+TI R DG+++N
Sbjct  134   AGGYGPLTVHSRELIPVPFDWPEEEYIVLTGDWYRKSHTELKRHMDNGKTIGRTDGVIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    P+FTM P KTYRYR CNVG++ S+N R QGH+M LVEIEGSHTVQNVY
Sbjct  194   GKQGK-GDGSDPPMFTMIPGKTYRYRFCNVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC SVLVTA+++ KDYYLV+++RF K    T A IR    N   +      P
Sbjct  253   DSLDVHMGQCYSVLVTADQKPKDYYLVSSTRFTKTVLMTTATIRYTGSNEPASPVLPEAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VNT      KLR
Sbjct  313   T-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTAGTVDRKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATFR  577
             YAING+SH + DTPLKL EY+ ++D     FKYD++ D P  D  +KV +APNV    FR
Sbjct  368   YAINGLSHMNTDTPLKLAEYYGIQDQ---VFKYDIITDDPPADVGTKVTIAPNVITGIFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK +QS+H++GYSFFAV IEPG WSPEKRKNYNLVDA++RH IQVYP  W
Sbjct  425   NFVEIIFENHEKSVQSWHLSGYSFFAVAIEPGTWSPEKRKNYNLVDAVSRHTIQVYPKGW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+MTTLDNAGMWN+RS + ER YLGQQ Y SVLSP RSLRDEYN+P+ QLLCG VK  P
Sbjct  485   AAIMTTLDNAGMWNMRSLLLERNYLGQQLYVSVLSPARSLRDEYNMPETQLLCGKVKNLP  544

Query  216   LPKPYT  199
              P PY+
Sbjct  545   FPAPYS  550



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/488 (64%), Positives = 385/488 (79%), Gaps = 11/488 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQQRKNSW DG  GT CPILPGTN+TY FQVKDQIGSY Y+PTT + RA
Sbjct  75    LDEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNYTYHFQVKDQIGSYIYYPTTGMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+T+ARPDG+++N
Sbjct  135   TGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY
Sbjct  195   GKNAK-GDGKDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC SVLVTAN++ KDYY+VA++RF KQ  +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGKGPASPELPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KL+N+ S+EGGKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLINSASQEGGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS--KVILAPNVKNATF  580
             YA+NGVSH +P+TPLKL EY+ + D     FKYD + D P  + +  K++  PNV N TF
Sbjct  369   YALNGVSHVNPETPLKLAEYYGVADK---VFKYDTILDSPQANVANAKIVTQPNVLNLTF  425

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEIIFENHEK +QSYH++GYSFFAV +EPG W+PEKRK+YNL+DA++R  +QVYP  
Sbjct  426   RNFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVYPKS  485

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DNAG+WN+RSEMWER YLGQQ Y SVLSP RSLRDEYN+PDN LLCG VK  
Sbjct  486   WAAILLTFDNAGLWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDM  545

Query  219   PLPKPYTI  196
             P P PY+I
Sbjct  546   PKPAPYSI  553



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/494 (64%), Positives = 388/494 (79%), Gaps = 8/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN +DEPLLFTW+GIQQRKNSW DG  GT CPI PG NFTY+FQVKDQIGSYFY+P
Sbjct  66    VINVFNNIDEPLLFTWNGIQQRKNSWQDGVLGTNCPIPPGKNFTYRFQVKDQIGSYFYYP  125

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  L++ LD G+ +AR
Sbjct  126   TTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTVLRQKLDAGRPLAR  185

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+ GK     + PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  186   PDGVLINGQTGKGKGKDVKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGS  245

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN YDSLD+HVGQC SVL+TA+K+ +DYY+VA++RF K   +   +IR  NGNG PA
Sbjct  246   HTVQNTYDSLDVHVGQCFSVLITADKDPRDYYMVASTRFTKSVLTATGIIRYTNGNGAPA  305

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
             +  LP       EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV++ S
Sbjct  306   SSILPKA----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVSSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPN  598
               GGKLRY INGVSH +P TPLKL EY+ + D     FKYD +PD+P  +  + V  APN
Sbjct  362   SAGGKLRYGINGVSHVNPPTPLKLAEYYGVADK---VFKYDTIPDEPLLEKATPVTPAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFR FVEII ENHEK +QS+H++GYSFF V IEPG+W+PEKRK+YNL+DA++RH I
Sbjct  419   VMNITFRTFVEIILENHEKSVQSWHLDGYSFFGVAIEPGRWTPEKRKSYNLLDAVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWN+RSE+ ER YLGQ+ Y SVLSPERSLRDEYN+PD+  LC
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNLRSELAERRYLGQELYISVLSPERSLRDEYNMPDDAELC  538

Query  237   GAVKGKPLPKPYTI  196
             GAV   P P PY+I
Sbjct  539   GAVTSLPKPTPYSI  552



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 382/487 (78%), Gaps = 11/487 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  135

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  136   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  195

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR Q H+M LVE+EGSH VQNVY+
Sbjct  196   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQDHTMKLVEMEGSHVVQNVYE  254

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+  KDYY+VA++RF KQ  +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPASPELPEAPV  314

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S EGGKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  369

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS--KVILAPNVKNATFR  577
             A+NGVSH DP+TPLK+ EY+ + D     FKYD M D P  D +  K++  PNV N TFR
Sbjct  370   ALNGVSHVDPETPLKIAEYYGVADKL---FKYDTMQDSPQADIAHAKIVSQPNVLNLTFR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK +QSYH++GYSFFAV +EPG W+PEKRK+YNL+DA++R  +QV+P  W
Sbjct  427   NFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSEMWER YLGQQ Y SVLSP RSLRDEYNIPDN LLCG VK  P
Sbjct  487   AAILLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLP  546

Query  216   LPKPYTI  196
              P+PY+I
Sbjct  547   KPEPYSI  553



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/488 (66%), Positives = 385/488 (79%), Gaps = 11/488 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             L+EP L  WSGIQ RKNSW DG  GT CPILPGTNFTY FQVKDQIGS+FY+P  ++ RA
Sbjct  75    LNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQIGSFFYYPPIAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVM  1297
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN 
Sbjct  195   NGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQND  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      
Sbjct  254   YQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKA  313

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KL N+ ++  GKL
Sbjct  314   PM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKL  368

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNATF  580
             RYAINGVSH DP+TPLKL EYFE+    E  FKYD++ D+ PT   + V +APNV NATF
Sbjct  369   RYAINGVSHVDPETPLKLAEYFEIA---EKVFKYDMISDEGPTEGATAVTIAPNVVNATF  425

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH IQV+PN 
Sbjct  426   RNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNS  485

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DNAGMWN+RSE+ E  YLGQQ Y SVLSP RSLRDEYNIPD+ LLCG VKG 
Sbjct  486   WAAILLTFDNAGMWNLRSELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGM  545

Query  219   PLPKPYTI  196
             PLPKPYTI
Sbjct  546   PLPKPYTI  553



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/488 (65%), Positives = 382/488 (78%), Gaps = 10/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP L TWSG+Q RKNSW DGT GT CPILPG NFTY FQVKDQIGSYFY+PTTS  R
Sbjct  74    HLDEPFLLTWSGVQHRKNSWQDGTLGTNCPILPGQNFTYHFQVKDQIGSYFYYPTTSTHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + V+SR LIPVP+  P +++ V + DWY K +K LK  LD+G+++ARPDG+V+
Sbjct  134   AAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKTHKQLKTFLDSGRSLARPDGVVI  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GK G     P+FTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSH VQNV
Sbjct  194   NGKSGK-GPGGDKPVFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHVVQNV  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+HVGQC SVLVTA++E +DYY+VA++RF K+  +   ++R  NG G  +T     
Sbjct  253   YESLDVHVGQCFSVLVTADQEPRDYYMVASTRFTKEVITATRILRYTNGKGPASTVLPKA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ S  GGKL
Sbjct  313   -----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASRAGGKL  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYAINGVSH +P TPLK  EYF   D     FKYD++PD P     K++ L PNV N TF
Sbjct  368   RYAINGVSHVNPTTPLKFAEYFGTADK---VFKYDVIPDSPPEQEPKLVTLEPNVGNITF  424

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R FVEIIFENHEK IQS+H++GYSFFAV +EPG+W+PEKRK+YNL+DA++RH +QV+P  
Sbjct  425   RTFVEIIFENHEKSIQSWHLDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKS  484

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA+M T DNAGMWN+RSE+ ER YLGQ+ Y SVLSPERSLRDEYN+PDN  LCG+V G 
Sbjct  485   WAAIMLTFDNAGMWNLRSELLERRYLGQEMYISVLSPERSLRDEYNLPDNAPLCGSVVGL  544

Query  219   PLPKPYTI  196
             PLP PYTI
Sbjct  545   PLPAPYTI  552



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/494 (64%), Positives = 386/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ +AVG +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHKAVGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+  K G+    PLFTM+P KTY+YR+CNVGL+TS+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVY SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K       +IR  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKAPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+K+VN+ +
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPN  598
                GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+    T+ ++ +APN
Sbjct  363   NVDGKLRYAINGVSHVDPETPLKLAEYFEVADK---VFKYDTISDEGLSKTANIVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NATFRNFVEI+FEN EK +QS+H++GYSFFAV +EPG+WSPEKRKNYNL+DA++RH I
Sbjct  420   VLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA++ TLDNAGMWN+RSE+ E  YLGQQ YFSV SP RSLRDEYNIPDN LLC
Sbjct  480   QVFPKSWAAILLTLDNAGMWNLRSELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLP PYTI
Sbjct  540   GLVKDMPLPPPYTI  553



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 384/487 (79%), Gaps = 11/487 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  60    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  119

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  120   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  179

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY+
Sbjct  180   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYE  238

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+  KDYY++A++RF KQ  + + +IR  NG G  +      P 
Sbjct  239   SLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQVLTYMGIIRYTNGKGPASPEFPEAPV  298

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S EGGKLRY
Sbjct  299   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  353

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS--KVILAPNVKNATFR  577
             A+NGVSH DP+TPLK+ EY+ + D     FKYD M D P  + +  K++  PNV N TFR
Sbjct  354   ALNGVSHVDPETPLKIAEYYGVADKL---FKYDTMQDSPQANIAHAKIVSQPNVLNLTFR  410

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK +QSYH++GYSFFAV +EPG W+PEKRK+YNL+DA++R  +QV+P  W
Sbjct  411   NFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSW  470

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSEMWER YLGQQ Y SVLSP RSLRDEYNIPDN LLCG VK  P
Sbjct  471   AAILLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLP  530

Query  216   LPKPYTI  196
              P+PY++
Sbjct  531   KPEPYSV  537



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 383/487 (79%), Gaps = 11/487 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  135

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  136   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  195

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY+
Sbjct  196   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYE  254

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+  KDYY++A++RF KQ  +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQVLTAKGIIRYTNGKGPASPEFPEAPV  314

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S EGGKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  369

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS--KVILAPNVKNATFR  577
             A+NGVSH DP+TPLK+ EY+ + D     FKYD M D P  + +  K++  PNV N TFR
Sbjct  370   ALNGVSHVDPETPLKIAEYYGVADKL---FKYDTMQDSPQANIAHAKIVSQPNVLNLTFR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK +QSYH++GYSFFAV +EPG W+PEKRK+YNL+DA++R  +QV+P  W
Sbjct  427   NFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSEMWER YLGQQ Y SVLSP RSLRDEYNIPDN LLCG VK  P
Sbjct  487   AAILLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLP  546

Query  216   LPKPYTI  196
              P+PY++
Sbjct  547   KPEPYSV  553



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/494 (65%), Positives = 384/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G I V+SR LIPVP+  P +++ V + DWY K + TLK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK  K  +    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTSK-DDGIDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  NG G  +
Sbjct  248   HTVQNDYKSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKSALVGKGIVRYTNGKGPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ +
Sbjct  308   PEIPNAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAT  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+   +  + V +APN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEITDK---VFKYDTISDEGLAEGVTTVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH I
Sbjct  420   VVNTTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA++ T DNAGMWN+RSE+ E  YLGQQ Y SV SP RSLRDEYNIPD  LLC
Sbjct  480   QVFPKSWAAILLTFDNAGMWNLRSELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLPKPYTI
Sbjct  540   GLVKDLPLPKPYTI  553



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/494 (65%), Positives = 384/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G I V+SR LIPVP+  P +++ V + DWY K + TLK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK  K  +    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTSK-DDGIDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y SLD+HVGQC SVLVTA++E KDYY+VA++RF K       ++R  NG G  +
Sbjct  248   HTVQNDYKSLDVHVGQCFSVLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKGPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ +
Sbjct  308   PEIPNAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAT  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+   +  + V +APN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEITDK---VFKYDTISDEGLAEGVTTVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH I
Sbjct  420   VVNTTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA++ T DNAGMWN+RSE+ E  YLGQQ Y SV SP RSLRDEYNIPD  LLC
Sbjct  480   QVFPKSWAAILLTFDNAGMWNLRSELTENRYLGQQLYMSVQSPARSLRDEYNIPDKTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLPKPYTI
Sbjct  540   GLVKDLPLPKPYTI  553



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 390/490 (80%), Gaps = 15/490 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW +GT GT CPILPG NFTY FQVKDQIGSY+Y+PTT+L R
Sbjct  72    QLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGSYYYYPTTALHR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYGPI++HSR LIPVPFD P EEF+VFVSDWY K +KTL+ ILD G++I RP+G+++
Sbjct  132   ATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIII  191

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKNGK G+ K  P+F+M   KTYRYR CNVG++ S+N RFQGH+M LVE+EGSHTVQN+
Sbjct  192   NGKNGK-GDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNM  250

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+H+GQCLSVLVTA++E KDY+LVA+SRF K+     A IR  N    P  P+   
Sbjct  251   YESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTNDPASPELPKA--  308

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   EG  WS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT++LV+T  +  GK 
Sbjct  309   -----PEGWEWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKR  363

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTSKVILAPNVKNA  586
             RYAINGVSH DP TP+KL E + + D     FKYDL+ D+   P+G+  K+ LAPNV NA
Sbjct  364   RYAINGVSHVDPTTPIKLAELYGVADK---VFKYDLIKDEYIAPSGN-EKITLAPNVVNA  419

Query  585   TFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYP  406
             T+RNFVEII ENHEK +QS+H+ GY+FFAV IE G+W PE+R+NYNL+DA++R+ IQVYP
Sbjct  420   TYRNFVEIILENHEKSVQSWHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYP  479

Query  405   NCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
             N WAA+MTTLDNAG+WN+RS   ER YLG Q YFSVLSP  SL+DEYN+PDN +LCG +K
Sbjct  480   NSWAAIMTTLDNAGLWNLRSNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIK  539

Query  225   GKPLPKPYTI  196
               PLPKPY+I
Sbjct  540   DLPLPKPYSI  549



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/493 (64%), Positives = 384/493 (78%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW+G+QQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWNGVQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ +A GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKKILD+G+++ R
Sbjct  128   VTAMHKAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKILDSGRSMGR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NGKN K G+ K  PLFTM+P KTY+YRVCNVGL+ S+NFR QGH + LVE+EGS
Sbjct  188   PAGVLINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKEPKDYYMVASTRFTKTVLTGKGIIRYENGNGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ S
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
                GKLRYA+NGVSH + +TPLKL EYF + D     FKYD + D+P      K+ LAPN
Sbjct  362   RVDGKLRYAVNGVSHVESETPLKLAEYFGVADK---VFKYDTIEDEPPATVEDKITLAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFR+FVEIIFENHEK IQS+H++GYSFFAV IEPG+W+PEKRKNYNL+D ++RH I
Sbjct  419   VVNQTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAAVM T DNAGMWNVRSE  ER YLGQQFY SVLSP RSLRDEYN+P+   LC
Sbjct  479   QVFPKSWAAVMLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPARSLRDEYNLPETAQLC  538

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  539   GIVKDSPKPPPYS  551



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/494 (64%), Positives = 385/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ +AVG +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHKAVGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+  K G+    PLFTM+P KTY+YR+CNVGL+TS+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVY SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K       +IR  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKAPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+K+VN+ +
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPN  598
                GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+    T+ ++ +APN
Sbjct  363   NVDGKLRYAINGVSHVDPETPLKLAEYFEVADK---VFKYDTISDEGLSKTANIVTVAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NATFRNFVEI+FEN EK +QS+H++GYSFFAV +EPG+WSPEKRKNYNL+DA++RH I
Sbjct  420   VLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAVEPGRWSPEKRKNYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             Q +P  WAA++ TLDNAGMWN+RSE+ E  YLGQQ YFSV SP RSLRDEYNIPDN LLC
Sbjct  480   QXFPKSWAAILLTLDNAGMWNLRSELTENRYLGQQMYFSVQSPARSLRDEYNIPDNTLLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK  PLP PYTI
Sbjct  540   GLVKDMPLPPPYTI  553



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/493 (64%), Positives = 388/493 (79%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEPLLFTWSG+QQRKNSW DGT GTMCPI PG N+TY+FQVKDQIGSYFY+P
Sbjct  68    VLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQIGSYFYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ RA GG+G + ++SR LIPVP+  P +++ V + DWY K +  LKK LD+G+++ R
Sbjct  128   ITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKHLDSGRSMGR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  188   PDGVIINGKSAK-GDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN Y+SLD+H+GQC SVLVTA+K+  DYY+VA++RF K+  +   ++R  NGNG  +
Sbjct  247   HTMQNTYESLDVHLGQCFSVLVTADKDPMDYYMVASTRFTKKVLTGKGIMRYENGNGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSAT  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
             +  GKLRYAINGVSH DP+TPLKL EY+ + D     FKYD + D+P      KV LAPN
Sbjct  362   KVDGKLRYAINGVSHVDPETPLKLAEYYGVADK---VFKYDTIQDEPPATVEDKVTLAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNFVEIIFENHEK IQS++++GYSFF V IEPG+W+PEKR NYNL+D ++RH I
Sbjct  419   VVNQTFRNFVEIIFENHEKSIQSWNLDGYSFFTVAIEPGRWTPEKRNNYNLLDGVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWNVRSE  ER YLGQQFY SVLSP RSLRDEYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNVRSEQSERRYLGQQFYVSVLSPARSLRDEYNLPDNTLVC  538

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  539   GVVKDLPKPPPYS  551



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/488 (64%), Positives = 382/488 (78%), Gaps = 11/488 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQQRKNSW DG  GT CPILPGTN+TY FQVKDQIGSY Y+PTT + RA
Sbjct  75    LDEPFLLTWSGIQQRKNSWQDGMLGTNCPILPGTNYTYHFQVKDQIGSYIYYPTTGMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+T+ARPDG+++N
Sbjct  135   TGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+ K  PLF M+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGSH VQNVY
Sbjct  195   GKNAK-GDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC SVLVTAN++ KDYY+VA++RF KQ  +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPASPELPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S  GGKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS--KVILAPNVKNATF  580
             YA+NGVSH +P+TPLKL EY+ + D     FKYD + D P  + +  K++  PNV N TF
Sbjct  369   YALNGVSHVNPETPLKLAEYYGVADK---VFKYDTILDSPQANVANAKIVTQPNVLNLTF  425

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEIIFENHEK +QSYH++GYSFFAV +EPG W+PEKRK+YNL+DA++R  +QV+P  
Sbjct  426   RNFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRTTVQVFPKS  485

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DNAG+WN+RSEMWER YLGQQ Y SVLSP RSLRDEYN+PDN LLCG VK  
Sbjct  486   WAAILLTFDNAGLWNIRSEMWERVYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDM  545

Query  219   PLPKPYTI  196
             P P PY+I
Sbjct  546   PKPAPYSI  553



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/488 (66%), Positives = 381/488 (78%), Gaps = 16/488 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+GIQQRKNSW +GT  T CPI PGTN+TYKFQVKDQIG+YFY+PTTS  RA
Sbjct  60    LDEPLLFTWNGIQQRKNSWQEGTLATNCPIPPGTNYTYKFQVKDQIGTYFYYPTTSTHRA  119

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYGP+++HSR+LIPVPF  P  E+NV V DWYKKG  +LKK+LD G+T+ RPDG+++N
Sbjct  120   AGGYGPLSIHSRDLIPVPFPWPHAEYNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIIN  179

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+     +   P+F+ E  KT+R+RVCNVGL+ S+NFR Q H++TLVEIEGSHTVQNVY
Sbjct  180   GKH-----DSNEPMFSFEAGKTHRFRVCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVY  234

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIR-NGNGNGGpatpelpp  937
             DSLDLH+GQC SVLVTA++  KDYY VA++RF K   +T A+IR NG+           P
Sbjct  235   DSLDLHLGQCASVLVTADQTPKDYYFVASTRFTKTVLTTKAIIRYNGSSTPASPELPEAP  294

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN      GKL
Sbjct  295   V------GWAWSVNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNAPGTVDGKL  348

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATF  580
             RY++NGVSHTDP TPLKL EYF + D     FKYD++ D P+ D  SK+ +AP V NATF
Sbjct  349   RYSVNGVSHTDPATPLKLAEYFGVGDKL---FKYDIIKDDPSVDANSKITIAPIVLNATF  405

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNFVEIIFEN EK +QS+H++GYSFFAV I+PGKW+P +R  YNLVDA++RH I VYP  
Sbjct  406   RNFVEIIFENQEKSVQSWHLSGYSFFAVAIQPGKWTPARRAVYNLVDAVSRHTIHVYPKS  465

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA+MTTLDNAGMWN+RS M ER YLGQQ YFSVLSP +SLRDEYNIP+ QL CG V+G 
Sbjct  466   WAAIMTTLDNAGMWNLRSMMLERQYLGQQLYFSVLSPAKSLRDEYNIPETQLQCGIVEGL  525

Query  219   PLPKPYTI  196
             P P PYTI
Sbjct  526   PKPMPYTI  533



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/487 (66%), Positives = 383/487 (79%), Gaps = 13/487 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+GIQQRKNSW DG PGT CPI PGTNFTY+FQVKDQIG+YFYFP+  +QRA
Sbjct  76    LDEPLLFTWNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGTYFYFPSLGMQRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G + V+SR LIPVPFD P +++ V + DWYKK +  LKK LD+G +I RPDG+ +N
Sbjct  136   AGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+    E+K  PLFTM+P  TYRYR+CNVG+++S+NFR QGH+M LVE+EGSHTVQNVY
Sbjct  196   GKS----EDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC SVLVTAN++ KDYY+VA++RF KQ ++   +IR  NG G  +     P 
Sbjct  252   DSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKGPASPELPEP-  310

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G  WS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+K+VN+ S   GKLR
Sbjct  311   ----PSGWIWSLNQFRSFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFR  577
             YAINGVSHTDP TP KL EYF + D     FKY+ M D P  +++ K+++ PNV N TFR
Sbjct  367   YAINGVSHTDPTTPPKLAEYFGVVDK---VFKYNTMVDDPPPESAEKIVITPNVLNITFR  423

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFENHEK IQS+H+NGYSFFAV +EPG+W+P+KRKNYNL+DA++R+ IQVYP  W
Sbjct  424   TFVEIIFENHEKSIQSWHLNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRNTIQVYPGSW  483

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A++ T DNAG+WN+RSE WER YLGQQ Y SVLSP RSLRDEYNIPD   LCG VKG P
Sbjct  484   TAILLTFDNAGLWNLRSETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLP  543

Query  216   LPKPYTI  196
              P+PYTI
Sbjct  544   KPQPYTI  550



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/494 (64%), Positives = 383/494 (78%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA G +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHRAGGAFGGLRVNSRLLIPVPYVDPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK  K G+    PLFTM P KTY+YR+CNVGL+ S+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGKIAK-GDGTDEPLFTMNPGKTYKYRICNVGLKISLNFRIQGHTMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVY SLD+HVGQC SVLVTA+++ +DYY+VA+SRF K       ++R  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADQDPRDYYMVASSRFTKNILVGKGIVRYTNGKAPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWS+NQFR+FRWNLTA+AARPNPQGSYHYG I ITRT+K+VN+ +
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTANAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSK-VILAPN  598
                GKLRYAINGVSH DP+TPLKL EYFE+ D     FKYD + D+ +  T+  V +APN
Sbjct  363   NIDGKLRYAINGVSHIDPETPLKLAEYFEVADK---VFKYDTISDEGSAKTANTVTIAPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NATFRNFVEIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKRKNYNL+DA++RH I
Sbjct  420   VVNATFRNFVEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRKNYNLLDAVSRHTI  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  W A++ TLDNAGMWN+RSE+ E  YLGQQ YFSV SP RSLRDEYNIPDN LLC
Sbjct  480   QVFPKSWGAILLTLDNAGMWNLRSELTENRYLGQQLYFSVQSPARSLRDEYNIPDNALLC  539

Query  237   GAVKGKPLPKPYTI  196
             G VK   LP+PYTI
Sbjct  540   GLVKDMSLPQPYTI  553



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/490 (64%), Positives = 386/490 (79%), Gaps = 14/490 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLLFTW+G+QQRKNSW +GTPGT CPI PG N TY+FQVKDQIGSY+Y+P+T+L R
Sbjct  74    QLDEPLLFTWNGVQQRKNSWQEGTPGTNCPIPPGANITYRFQVKDQIGSYYYYPSTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G I+V SR LIPVPFD P ++F V V+DWY K +  LK +LDNG+ + RP G+++
Sbjct  134   AAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVII  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GK G+ K  P++T+ P KTYR+R CNVG++ S+N RFQGH+M LVEIEGSHTVQNV
Sbjct  194   NGKSGK-GDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNV  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+H+GQC+SVL+TA+++ KDY+LVA++RF K+     A IR  NG G  +      
Sbjct  253   YESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYANGKGPASPELPKA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV +     GKL
Sbjct  313   -----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKL  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPD--QPTGDT---SKVILAPNVK  592
             RYAINGVSH DP TP+KL EY+ + D     FKYDL+ D  +P        K+ LAPNV 
Sbjct  368   RYAINGVSHVDPATPIKLAEYYGVGDK---VFKYDLIKDDYEPASGKEAQDKITLAPNVV  424

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
             NAT+RNFVEIIFENH K +QS+H++GYSFFAVGIEPG+W+PEKR+NYNL+DA++R+ IQV
Sbjct  425   NATYRNFVEIIFENHGKSVQSWHLSGYSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQV  484

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAAVMTTLDNAG+WN+RS   ER YLG Q YFSVLSP RS++DEYN+PDN+LLCG 
Sbjct  485   YPNSWAAVMTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNRSIKDEYNMPDNELLCGL  544

Query  231   VKGKPLPKPY  202
             VK  P P PY
Sbjct  545   VKDMPRPTPY  554



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 381/486 (78%), Gaps = 11/486 (2%)
 Frame = -2

Query  1647  EPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVG  1468
             EP L  WSGIQ RKNSW DG  GT CPI PG NFTY FQVKDQIGS+FY+P+ ++ RA G
Sbjct  78    EPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQIGSFFYYPSIAMHRAAG  137

Query  1467  GYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVMNG  1291
             G+G + ++SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++NG
Sbjct  138   GFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLING  197

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN Y 
Sbjct  198   KTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQ  256

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      P 
Sbjct  257   SLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM  316

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KL N+ ++  GKLRY
Sbjct  317   -----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRY  371

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNATFRN  574
             AINGVSH DP+TPLKL EYF + D     FKYD++ D+ PT   + V +APNV NATFRN
Sbjct  372   AINGVSHIDPETPLKLAEYFGIADK---VFKYDIISDEGPTEGATAVTIAPNVVNATFRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH IQV+PN WA
Sbjct  429   FIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE+ E  YLGQQ Y SVLSP RSLRDEYNIPD+ LLCG VKG PL
Sbjct  489   AILLTFDNAGMWNLRSELTENRYLGQQLYMSVLSPARSLRDEYNIPDHTLLCGLVKGMPL  548

Query  213   PKPYTI  196
             PKPYTI
Sbjct  549   PKPYTI  554



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/492 (64%), Positives = 380/492 (77%), Gaps = 10/492 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TWSGIQQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIXPGTNFTYRFQVKDQIGSYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ RA GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKK+LD+G+T+ R
Sbjct  128   VTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PD +++NGKN K G+ K  PLFTM+P KTY+YRVCNVG + S+NFR QGH + LVE+EGS
Sbjct  188   PDXILINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGFKNSLNFRIQGHPLKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  N NG  +
Sbjct  247   HTVQNTYESLDVHLGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENXNGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ S
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
                GKLRYAINGVS+ + +TPLKL +YF + D     FKYD + D+P      KV LAPN
Sbjct  362   XVNGKLRYAINGVSYVESETPLKLAQYFGVADK---VFKYDTIQDEPPATVEDKVTLAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFR FVEIIFENHEK IQS+H++GYSFFAV IEPG+W+PEKRKNYNL+D ++RH I
Sbjct  419   VVNQTFRXFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTPEKRKNYNLLDGVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWNVRSE  ER YLGQQFY SVLSP RSLRDEYN+P+   LC
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNVRSEQPERRYLGQQFYVSVLSPARSLRDEYNLPETTQLC  538

Query  237   GAVKGKPLPKPY  202
             G VK  P P PY
Sbjct  539   GIVKDLPKPPPY  550



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/492 (65%), Positives = 390/492 (79%), Gaps = 14/492 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP LFTW+GIQQRKNSW +GT GT CPI PG+NFTY FQVKDQIGS+FY+PTT+L R
Sbjct  74    QLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGSNFTYHFQVKDQIGSFFYYPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  1300
             A GGYG I+VHSR LIP+PFD  PA+EF V VSDWY K +  L+K LD+G+++ RPDG++
Sbjct  134   AAGGYGGISVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGII  193

Query  1299  MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             +NGK GK  + K  PLF+M P KTYRYR CN G++ S+N R QGH+M LVE+EGSH VQN
Sbjct  194   INGKGGKG-DGKDEPLFSMTPGKTYRYRFCNAGMKDSINVRIQGHTMKLVEMEGSHVVQN  252

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLD+H+GQC+SVLVTA+K+ KDY LVA++RF K+  +  ++IR  NGNG  +     
Sbjct  253   MYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGNGPASPELPK  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
              P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT     GK
Sbjct  313   API-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGK  367

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTS-KVILAPNVK  592
             LRYAINGVSH +P TP+KL+EY+ ++D     FKYDLM D+   P G    K+ LAPNV 
Sbjct  368   LRYAINGVSHVNPTTPIKLVEYYGVEDK---IFKYDLMKDEYEPPAGKAEEKITLAPNVV  424

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
               T+RNFVEIIFENHEK +QS+H+ GYSFFAV IEPGKW+PEKRKNYNL+DA++R+ IQV
Sbjct  425   KVTYRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQV  484

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAA+MTTLDNAG+WN+RS   ER YLGQQ YFS LSP+R L+DEYN+PDN +LCG 
Sbjct  485   YPNSWAAIMTTLDNAGLWNLRSNSVERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGI  544

Query  231   VKGKPLPKPYTI  196
             +K  PLPKPY++
Sbjct  545   IKDMPLPKPYSV  556



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/493 (64%), Positives = 387/493 (78%), Gaps = 15/493 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLL TW+G+QQRKNSW +GT GT CPILPGTN+TYKFQVKDQIGSY+Y+PTT L RA
Sbjct  80    LDEPLLLTWNGVQQRKNSWQEGTLGTNCPILPGTNYTYKFQVKDQIGSYYYYPTTPLHRA  139

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             +GGYGP+ VHSR+LIPVPFD P +++ VFV DWYKKG+ +L+K+LD G+++ RPDG+++N
Sbjct  140   MGGYGPLAVHSRDLIPVPFDLPEDDYFVFVGDWYKKGHASLRKLLDGGRSLGRPDGVIIN  199

Query  1293  GKNGKVGENKL----NPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTV  1126
             GK      NK     +P+FTM   KTYRYR CNVG++ SVN R QGH+M +VEIEGSHTV
Sbjct  200   GKGSFGTGNKTGGEDSPMFTMIAKKTYRYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTV  259

Query  1125  QNVYDSLDLHVGQCLSVLVTAN-KEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatp  949
             QNVYDSLD+H+GQC SVLVTA+ K   DYYLVA++RF K+  ++ A+IR   G       
Sbjct  260   QNVYDSLDVHLGQCYSVLVTADQKPESDYYLVASTRFSKKALTSTAIIRYVGGG----QV  315

Query  948   elppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLV-NTKSE  772
                P  P    G+ WSINQFRSFRWNLTASAARPNPQGSYHYG+I+ITRT+K V    S+
Sbjct  316   PPSPELPPAPVGLPWSINQFRSFRWNLTASAARPNPQGSYHYGKIDITRTIKFVLKPFSK  375

Query  771   EGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD--TSKVILAPN  598
              GGK RY+INGVSH DP+TPLKL EY+ + D     FKYD++ DQP+     ++VI+APN
Sbjct  376   VGGKRRYSINGVSHVDPETPLKLAEYYGVADK---VFKYDMIKDQPSDSDLAAEVIVAPN  432

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNFVEII ENH+K +Q++H++GYSFFAV +EPG+W+ EKRKNYNL+DAI++H +
Sbjct  433   VINGTFRNFVEIILENHDKSVQTFHVSGYSFFAVAVEPGRWTEEKRKNYNLIDAISKHTV  492

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QVYPN W A+MTTLDNAGMWN+RS   ER YLG+Q Y SVLSP RSLRDEYN+PD QLLC
Sbjct  493   QVYPNSWTAIMTTLDNAGMWNMRSMSLERQYLGEQIYVSVLSPNRSLRDEYNLPDTQLLC  552

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  553   GIVKDMPKPPPYS  565



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/486 (65%), Positives = 379/486 (78%), Gaps = 11/486 (2%)
 Frame = -2

Query  1647  EPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVG  1468
             EP L  WSGIQ RKNSW DG  GT CPI PG NFTY FQVKDQIGS+FY+P+ ++ RA G
Sbjct  78    EPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQIGSFFYYPSIAMHRAAG  137

Query  1467  GYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVMNG  1291
             G+G + ++SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++NG
Sbjct  138   GFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLING  197

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN Y 
Sbjct  198   KTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQ  256

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      P 
Sbjct  257   SLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM  316

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KL N+ ++  GKLRY
Sbjct  317   -----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRY  371

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNATFRN  574
             AINGVSH DP+TPLKL EYF + D     FKYD++ D+ PT   + V +APNV NATFRN
Sbjct  372   AINGVSHIDPETPLKLAEYFGIADK---VFKYDIISDEGPTEGATAVTIAPNVVNATFRN  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH IQV+PN WA
Sbjct  429   FIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE+ E  YLG Q Y SVLSP RSLRDEYNIPDN LLCG VK  P+
Sbjct  489   AILLTFDNAGMWNLRSELTENRYLGSQLYISVLSPARSLRDEYNIPDNTLLCGLVKDMPM  548

Query  213   PKPYTI  196
             PKPYTI
Sbjct  549   PKPYTI  554



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 376/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTNFTYKFQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLITWNGIQHRKNCWQDGTPGTMCPIMPGTNFTYKFQPKDQIGSYFYYPSTALHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLF ++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFNLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   ++TAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYD + D PT + +K I + PNV N T R
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADK---VFKYDTITDNPTPEQTKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   NFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKGKP
Sbjct  487   AAILLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 377/487 (77%), Gaps = 10/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQQRKNSW DGT GT CPI PG N+TY FQVKDQIGSY Y+P T++ RA
Sbjct  74    LDEPFLLTWNGIQQRKNSWQDGTLGTSCPIPPGQNYTYHFQVKDQIGSYIYYPITAMHRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TL K LD+G+ + RPDG+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K  + K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHT+QN Y
Sbjct  194   GKSSK-SKGKEEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE KDYY+VA++R+ K   +T A+I   NG G  +      P
Sbjct  253   DSLDVHVGQCFAVLVTADKEPKDYYMVASTRYTKTVLTTTAVISYTNGKGPASPVLPEAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AW++NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ S EGGKLR
Sbjct  313   V-----GWAWTLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASREGGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNATFR  577
             YAING+SH +P TPLKL EY+ + D     FKYD M D  P   + K+ + PNV N T+R
Sbjct  368   YAINGISHANPATPLKLAEYYGVADK---IFKYDTMSDDAPATASDKITVEPNVANITYR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE+IFENHEK IQS+H++GYSFFAV +EPG+W+PEKRK+YNL+DA++RH +QV+P  W
Sbjct  425   TFVEVIFENHEKSIQSWHLDGYSFFAVAVEPGRWTPEKRKSYNLLDAVSRHTVQVFPKSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DNAGMWN+RSE+ ER YLGQ+ Y SVLSPERSLRDEYNIPD+ LLCG VK   
Sbjct  485   AAIMLTFDNAGMWNLRSELAERRYLGQELYISVLSPERSLRDEYNIPDDALLCGIVKDLA  544

Query  216   LPKPYTI  196
              P PYTI
Sbjct  545   KPPPYTI  551



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 384/490 (78%), Gaps = 14/490 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLLFTW+G+QQRKNSW +GT GT CPI PG NFTY+FQVKDQIGSY+Y+PTT+L R
Sbjct  74    QLDEPLLFTWNGVQQRKNSWQEGTHGTNCPIPPGANFTYRFQVKDQIGSYYYYPTTTLHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G I+V SR LIPVPFD P ++F V V+DWY K +  LK +LDNG+ + RP G+++
Sbjct  134   AAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVII  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GK G+ K  P++T+ P KTYR+R CNVG++ S+N RFQGH+M LVEIEGSHTVQNV
Sbjct  194   NGKSGK-GDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNV  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+H+GQC+SVL+TA+++ KDY+LVA++RF K+     A IR  NG G  +      
Sbjct  253   YESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYANGKGPASPQLPKA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV +     GKL
Sbjct  313   -----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKL  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPD--QPTGD---TSKVILAPNVK  592
             RYAINGVSH DP TP+KL EY+ + D     FKYDL+ D  +P        K+ LAPNV 
Sbjct  368   RYAINGVSHVDPATPIKLAEYYGVGDK---VFKYDLIKDDYEPASGKEAQDKITLAPNVV  424

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
             NAT+RNFVEIIFENH K +QS+H++G+SFFAVGIEPG+W+PEKR+NYNL+DA++R+ IQV
Sbjct  425   NATYRNFVEIIFENHGKSVQSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTIQV  484

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAA+MTTLDNAG+WN+RS   ER YLG Q YFSVLSP  S++DEYN+PDN L+CG 
Sbjct  485   YPNSWAAIMTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNHSVKDEYNMPDNDLVCGF  544

Query  231   VKGKPLPKPY  202
             VK  P P PY
Sbjct  545   VKDMPRPTPY  554



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/477 (67%), Positives = 374/477 (78%), Gaps = 10/477 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+GIQQRKNSW DGT GT CPI PGTN+TY+FQVKDQIGSY+YFPTT+L RA
Sbjct  76    LDEPLLFTWNGIQQRKNSWQDGTLGTNCPIPPGTNYTYQFQVKDQIGSYYYFPTTALHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYGPINVHSR LIP+PF+ P  EFNV V DWY KG+ TLKK LD+G+++ RPDG+V+N
Sbjct  136   AGGYGPINVHSRNLIPIPFNSPEAEFNVLVGDWYSKGHVTLKKFLDSGRSLGRPDGVVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+G        P + + P KTYRYR+CNVG++ SVN R QGH+M LVEIEGSHTVQNVY
Sbjct  196   GKSGNEA-----PKWNLIPGKTYRYRICNVGMKNSVNVRIQGHTMKLVEIEGSHTVQNVY  250

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC SVLVTA++  KDY  V ++RF K   +T   I     N   +T     P
Sbjct  251   DSLDIHLGQCNSVLVTADQTPKDYAFVVSTRFTKTVLTTTGTIHYEGSNIPASTELPAAP  310

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                  EGIAWSINQFRS RWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ S    KLR
Sbjct  311   GNA-PEGIAWSINQFRSLRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRGEDKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYDL+ D+P+ D    + +APNV N TFR
Sbjct  370   YAVNGVSHTDPETPLKLAEYFGVSDK---VFKYDLIKDEPSADAEDHITIAPNVVNGTFR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+EIIFENHEK IQS+H++GYSFFAV IEPG+W+P KR NYNL+DAI+RH IQVYPN W
Sbjct  427   NFIEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWAPAKRANYNLIDAISRHTIQVYPNSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
             AA+MTTLDN GMWN+RS   ER YLGQQ YFSV+SPE SLRDEY +P+ QLLCG VK
Sbjct  487   AAIMTTLDNCGMWNLRSVSLERNYLGQQLYFSVVSPEHSLRDEYLLPEGQLLCGIVK  543



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 377/487 (77%), Gaps = 10/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQQRKNSW DG PGT CPI PGTN+TY FQVKDQIGS+ YFP+T++ ++
Sbjct  75    LDEPFLVTWSGIQQRKNSWQDGMPGTQCPIPPGTNYTYHFQVKDQIGSFMYFPSTAMHKS  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G I+++SR LIPVP+  P  ++ V ++DW+ K +  L+ +LD+G+T+ARP+G+++N
Sbjct  135   AGGFGGIHINSRLLIPVPYADPEADYTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+ K  PLFTM+  KTY+YR+CN GL+TS+NFR QGH+M LVE+EGSH VQN+Y
Sbjct  195   GKNAK-GDGKDEPLFTMKAGKTYKYRICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVG C++VLVTA+++ KDYY++A++RF K   +   +IR   G G   T     P
Sbjct  254   DSLDVHVGGCMAVLVTADQDPKDYYMIASTRFTKTVTTGKGIIRYEGGKGPADTEIPAAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRTL+L NT     GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTLRLANTAGRSNGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQP-TGDTSKVILAPNVKNATFR  577
             YA NG+SH DP TPLKL EY+ + D     FKYD M D P + D   +++ PNV N TFR
Sbjct  369   YAFNGISHVDPPTPLKLAEYYGVADK---VFKYDTMKDTPPSSDKVDIVMQPNVMNFTFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NFVEIIFENHEK IQSYH++GY+FFAVGIEPG WSPEKRKNYNL+DA++R  IQVYP  W
Sbjct  426   NFVEIIFENHEKSIQSYHLDGYAFFAVGIEPGIWSPEKRKNYNLLDAVSRTTIQVYPKSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWNVRSEMWER YLGQQFY S LSP RSLRDEY++P+  LLCG VK  P
Sbjct  486   AAILLTFDNAGMWNVRSEMWERTYLGQQFYVSTLSPGRSLRDEYSLPEGTLLCGIVKDMP  545

Query  216   LPKPYTI  196
              P PYT+
Sbjct  546   KPAPYTL  552



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/499 (64%), Positives = 383/499 (77%), Gaps = 25/499 (5%)
 Frame = -2

Query  1653  LDEPLLFTW------------SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGS  1510
             LDEPLLFTW            +GIQQRKNSW DG PGT CPI PGTNFTY+FQVKDQIG+
Sbjct  76    LDEPLLFTWYCIFHVLVRXGRNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGT  135

Query  1509  YFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG  1330
             YFYFP+  +QRA GG G + V+SR LIPVPFD P +++ V + DWYKK +  LKK LD+G
Sbjct  136   YFYFPSLGMQRAAGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSG  195

Query  1329  QTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLV  1150
              +I RPDG+ +NGK+    E+K  PLFTM+P  TYRYR+CNVG+++S+NFR QGH+M LV
Sbjct  196   HSIGRPDGVQINGKS----EDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLV  251

Query  1149  EIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNG  970
             E+EGSHTVQNVYDSLD+H+GQC SVLVTAN++ KDYY+VA++RF KQ ++   +IR  NG
Sbjct  252   ELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNG  311

Query  969   NGGpatpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKL  790
              G  +     P       G  WS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+K+
Sbjct  312   KGPASPELPEP-----PSGWIWSLNQFRSFRWNLTASAARPNPQGSYHYGFINITRTIKI  366

Query  789   VNTKSEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KV  613
             VN+ S   GKLRYAINGVSHTDP TP KL EYF + D     FKY+ M D P  +++ K+
Sbjct  367   VNSASTVDGKLRYAINGVSHTDPTTPPKLAEYFGVVDK---VFKYNTMVDDPPPESAEKI  423

Query  612   ILAPNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAI  433
             ++ PNV N TFR FVEIIFENHEK IQS+H+NGYSFFAV +EPG+W+P+KRKNYNL+DA+
Sbjct  424   VITPNVLNITFRTFVEIIFENHEKSIQSWHLNGYSFFAVAMEPGRWNPDKRKNYNLLDAV  483

Query  432   NRHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPD  253
             +R+ IQVYP  W A++ T DNAG+WN+RSE WER YLGQQ Y SVLSP RSLRDEYNIPD
Sbjct  484   SRNTIQVYPGSWTAILLTFDNAGLWNLRSETWERNYLGQQLYVSVLSPARSLRDEYNIPD  543

Query  252   NQLLCGAVKGKPLPKPYTI  196
                LCG VKG P P+PYTI
Sbjct  544   VAELCGIVKGLPKPQPYTI  562



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/493 (62%), Positives = 384/493 (78%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP LFTW+GIQ RKNSW DG  GT CPI PGTNFTY+ QVKDQIGSYFY+P
Sbjct  69    VINVFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIGSYFYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G + V+SR LIPVP+  P +E+ V + DWY K +  L+K+LD+G+++ R
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGR  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P+G+++NGK  K G+ K  PLFTM+P+KTY+YR+CNVGL+ S+N+R QGHSM LVE+EGS
Sbjct  189   PEGVLINGKTAK-GDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGS  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQN+YDSLD+HVG+C SVLVTA+KE KDYY+VA++RF K       +IR  NG G  +
Sbjct  248   HVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKGPAS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                 P P      G AWS+NQF +FRWNLTASAARPNPQGSY YG+I ITRT+KLVN+ S
Sbjct  308   PDIPPAPV-----GWAWSLNQFHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVS  362

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
             +  GKLRYA+NGVSH DP+TPLKL EYF + D     FKYD +PD P+ +  + V + PN
Sbjct  363   KSNGKLRYALNGVSHVDPETPLKLAEYFGISDK---VFKYDTIPDNPSPNIGNAVTVQPN  419

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T RNF+EIIFEN EK IQSYH++GYSFF +GIEPG W+PEKRK+YNL+DA++RH +
Sbjct  420   VLNITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTV  479

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
              V+P CWAA+M T DNAGMWN+RS++ E  YLGQQ Y SVLSPE SLRDEYN+PD+ LLC
Sbjct  480   HVFPKCWAAIMLTFDNAGMWNLRSDIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLC  539

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  540   GLVKNLPKPAPYS  552



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 377/485 (78%), Gaps = 9/485 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSGIQQRKNSW +G PGT CPI PG+N+TY FQVKDQIGS+ Y+P+T+L RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQEGVPGTNCPIPPGSNYTYHFQVKDQIGSFIYYPSTALHRAS  135

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             G +G ++++SR LIPVP+  P +++ V ++DWY K +K+L+  LD+G+++ RPDG+++NG
Sbjct  136   GAFGGLHINSRLLIPVPYPDPEDDYTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLING  195

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             KN K G+ K  PLFTM+P KTY+YRVCN G++TS+NFR QGH M LVE+EGSH VQNVY+
Sbjct  196   KNAK-GDGKDEPLFTMKPDKTYKYRVCNAGIKTSLNFRIQGHEMKLVEMEGSHVVQNVYE  254

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQCLSVLV AN+  KDYY+VA++RF K   +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCLSVLVRANQAPKDYYMVASTRFMKTVQTAKGIIRYTNGKGPASPELPEAPV  314

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S  GGKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRY  369

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRNF  571
             AINGVSHTD +TPLKL EY+ + D     FKYD + D P    ++V+  PNV N TFRNF
Sbjct  370   AINGVSHTDTETPLKLAEYYGIADK---VFKYDTIKDDPPPKITEVVTQPNVLNMTFRNF  426

Query  570   VEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAA  391
             VEIIFEN EK IQS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++R  +QV+P  WAA
Sbjct  427   VEIIFENPEKSIQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAA  486

Query  390   VMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLP  211
             +  T DNAGMWN+RSE+WER YLGQQ Y SV+SP RSLRDEYNIPDN LLCG VK  P P
Sbjct  487   IFLTFDNAGMWNIRSEVWERTYLGQQLYASVISPARSLRDEYNIPDNALLCGLVKDLPKP  546

Query  210   KPYTI  196
              PY++
Sbjct  547   PPYSV  551



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/485 (63%), Positives = 371/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSG+QQRKNSW +G  GT CPI PGTN TY FQVKDQIGS+ Y+P+T++ RA 
Sbjct  76    DEPFLLTWSGVQQRKNSWQEGVLGTNCPIPPGTNHTYHFQVKDQIGSFIYYPSTAMHRAA  135

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G ++++SR LIPVP+  P +++ V V+DWY K + +L+K LD+G +I RP+G+++NG
Sbjct  136   GGFGGLHINSRLLIPVPYPDPEDDYTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLING  195

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K  K G  K  PLFTM+P KTY+YR+CN GL+TS+NFR QGH+M LVE+EGSH VQN+Y+
Sbjct  196   KTAK-GNGKDKPLFTMKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEMEGSHVVQNIYE  254

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTAN+  KDYY+VA++RF K       ++R  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKGQASPVLPKAPV  314

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S  GGKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRY  369

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRNF  571
             AIN VSH +P+TPLKL EYF + +     FKYD   D P     K++  PNV N TFRNF
Sbjct  370   AINSVSHVEPETPLKLAEYFGVANK---VFKYDTFQDNPPAKIGKIVSQPNVLNMTFRNF  426

Query  570   VEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAA  391
             VEIIFEN EK IQS+H++GYSFF V +EPG W+PEKRKNYNL+DA++R  +QV+P  WAA
Sbjct  427   VEIIFENPEKSIQSWHLDGYSFFVVAVEPGTWTPEKRKNYNLLDAVSRTTVQVFPKSWAA  486

Query  390   VMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLP  211
             ++ T DNAGMWN+RSEMWER YLGQQ Y SVLSP RSLRDEYNIPDN LLCG VKG P P
Sbjct  487   ILLTFDNAGMWNIRSEMWERTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKGLPKP  546

Query  210   KPYTI  196
              PYTI
Sbjct  547   PPYTI  551



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 375/485 (77%), Gaps = 13/485 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW+GIQ RKNSW DGT GT CPI PGTN+TY FQVKDQIGSYFY+PT  +QRA
Sbjct  75    LDEPLLFTWNGIQHRKNSWQDGTLGTQCPIQPGTNYTYHFQVKDQIGSYFYYPTIGMQRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + ++SR LIPVP+  PA+EF V + DW+ K ++TLK+ LD+G++I RP G+ +N
Sbjct  135   VGGFGGLRIYSRLLIPVPYADPADEFWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKNG      L P +TMEP KTY+YR+CNVGL+ S+NFR QGHS+ LVE+EGSH VQN Y
Sbjct  195   GKNGG-----LEPAYTMEPGKTYKYRICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQY  249

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTA++E KDYY+VA++RF K+      +IR  NG G  +    P  
Sbjct  250   DSLDVHVGQCFSVLVTADQEPKDYYMVASTRFAKKTLGATRIIRYSNGVGPASPELPPA-  308

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                  EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT S  GGKLR
Sbjct  309   ----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTLSRTGGKLR  364

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NGVSH DP+TPLKL EY+ + D     FKY+++ D P      +  APNV NATFR+
Sbjct  365   YGLNGVSHVDPETPLKLAEYYGVSDQ---VFKYNIISDDPASPIGDLACAPNVINATFRD  421

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN  KV QSY+++GYSFFAVG+EPGKWSPEKRKNYN +D ++RH IQV+P  W+
Sbjct  422   FIEIIFENPTKVPQSYNLDGYSFFAVGMEPGKWSPEKRKNYNNLDGVSRHTIQVFPKSWS  481

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSE+ E  YLGQQ Y SVLSP RSLRDEYN+PD Q+LCG V   P 
Sbjct  482   AIMLTFDNAGMWNLRSELGENRYLGQQLYVSVLSPNRSLRDEYNMPDTQVLCGIVTDLPE  541

Query  213   PKPYT  199
             P PY+
Sbjct  542   PPPYS  546



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 379/496 (76%), Gaps = 11/496 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN+LDEPLLFTW GIQQRKNSW DGTPGTMCPI PGTN+TY+FQVKDQIGS+FY+P
Sbjct  70    VLNVFNQLDEPLLFTWVGIQQRKNSWQDGTPGTMCPIPPGTNYTYRFQVKDQIGSFFYYP  129

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT   +A GG+G + V+SR LIPVP+  P +++ V + DWYK+ +  L+K+LD+G+++ R
Sbjct  130   TTGFLKAAGGFGGLRVNSRLLIPVPYPDPEDDYTVLIGDWYKQSHTALRKVLDSGKSLGR  189

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG++MNGK GKVG+ K  PLFTM+P KTY+YR+CNVGL+ ++NFR QGH + LVE+EGS
Sbjct  190   PDGVLMNGKQGKVGDAKEEPLFTMKPGKTYKYRICNVGLKNTLNFRIQGHKIKLVEVEGS  249

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H+VQN YDSLD+H+GQC +VLVTA+++ KDYY+VA+ RF K        IR  NG G  +
Sbjct  250   HSVQNSYDSLDVHLGQCYAVLVTADQDPKDYYMVASVRFTKYHLQATGKIRYENGKGPAS  309

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  T +
Sbjct  310   NILPEA-----PTGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTVKLATTAN  364

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT---SKVILA  604
                GKLRYA+NGVSHTDP+TP+KL EY+E        FKYD + D+P  +     K+ +A
Sbjct  365   TVDGKLRYAVNGVSHTDPETPMKLAEYYEA---PAKVFKYDPIGDEPPANIEKLDKITIA  421

Query  603   PNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRH  424
             P V N   R+F+E+IFENHEK +QS+ + GY+FF V IE G WSP KRKNYNL+DA++++
Sbjct  422   PIVLNFKHRDFIEVIFENHEKSVQSFRLAGYAFFPVAIEVGTWSPAKRKNYNLMDAVSKY  481

Query  423   NIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQL  244
             NIQVYP  WAA++ T DN GMWNVR+E  ER YLGQQ Y SV +PER LRDEYN+PDN L
Sbjct  482   NIQVYPKSWAAILLTFDNVGMWNVRNECMERAYLGQQLYISVPTPERVLRDEYNLPDNAL  541

Query  243   LCGAVKGKPLPKPYTI  196
             LCG VK  P PKPYT+
Sbjct  542   LCGMVKNMPKPKPYTL  557



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/486 (64%), Positives = 376/486 (77%), Gaps = 8/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG  GT CPI PG N+TY FQVKDQIGSY Y+P+T++ RA
Sbjct  76    LDEPFLLTWSGIQHRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIGSYIYYPSTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P  ++ V + DWY K +  LKK LD+G+++ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYSDPEADYTVLIGDWYTKSHTMLKKFLDSGRSLGRPDGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G  K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQNVY
Sbjct  196   GKVAK-GNGKDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHRMKLVEMEGSHTVQNVY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC +VLVTA++  KDY++VA++RF K   +   +IR  NG G  A+P+LPP 
Sbjct  255   ESLDVHVGQCFAVLVTADQGPKDYFMVASTRFTKNVLTATGIIRYTNGKGAAASPKLPPA  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
             P     G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I ITRT+KLVNT S  GGKLR
Sbjct  315   PV----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTASRAGGKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y INGVSH +P TPLKL EY+ + +     FKYD++ D+P    + V + PNV N TFRN
Sbjct  371   YGINGVSHINPPTPLKLAEYYNVANK---VFKYDVIGDEPPAKITGVTVQPNVLNMTFRN  427

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEII ENHEK IQSYH++GYSFFAV IEPG+W+PEKR+NYNL+DA++RH IQV+P  WA
Sbjct  428   FVEIILENHEKSIQSYHLDGYSFFAVAIEPGRWTPEKRRNYNLLDAVSRHTIQVFPKSWA  487

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE+WER YLGQQ Y SV SP RSLRDEYNIPDN  LCG V   P 
Sbjct  488   AILLTFDNAGMWNIRSEIWERTYLGQQLYASVASPVRSLRDEYNIPDNAPLCGVVTNLPK  547

Query  213   PKPYTI  196
             P PYTI
Sbjct  548   PPPYTI  553



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/484 (64%), Positives = 376/484 (78%), Gaps = 13/484 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEPLLFTW G+QQRKNSW +GTPGT CPILPGTN+TY FQVKDQIGSYFY+PTT LQR
Sbjct  72    HLDEPLLFTWHGVQQRKNSWQEGTPGTACPILPGTNYTYHFQVKDQIGSYFYYPTTGLQR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + + SR LIPVP+  P +E+ V + DWY KG+KTLK +LD+G++I RPDG++M
Sbjct  132   AAGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYNKGHKTLKMMLDSGRSIGRPDGVIM  191

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK          PL+TM+P KTY+YR+CNVGL+ ++NFRFQGH+M LVE EGSH VQ+ 
Sbjct  192   NGK-----ATNEEPLYTMKPGKTYKYRICNVGLKDALNFRFQGHAMKLVETEGSHVVQSF  246

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC +VLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +    P 
Sbjct  247   YDSLDVHVGQCYTVLVTADKDPKDYYMVASTRFTKYTHTATGIIRYTNGAGPASNVLPPA  306

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ ++  GKL
Sbjct  307   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSVAKVDGKL  361

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYAINGVSH D +TPLKL EY+ + D     FKY+++ D+P  D + + +APNV NATFR
Sbjct  362   RYAINGVSHVDGETPLKLAEYYGVADK---VFKYNIIGDEPPADLTAITIAPNVINATFR  418

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E+I EN  K IQSY+++GYSFFAV  EPGKWSPEKRKNYNL+DAI+RH IQV+P  W
Sbjct  419   TFIEVILENSGKSIQSYNLDGYSFFAVACEPGKWSPEKRKNYNLLDAISRHTIQVFPKSW  478

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DNAGMWN+RSE  E  YLGQQ Y SVLSPE SLRDEYN+P+ Q++CG VK  P
Sbjct  479   AAIMLTFDNAGMWNLRSEQAENRYLGQQLYISVLSPELSLRDEYNLPETQIVCGIVKSLP  538

Query  216   LPKP  205
              P P
Sbjct  539   KPAP  542



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/481 (66%), Positives = 373/481 (78%), Gaps = 13/481 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTWSGIQQRKNSW DGT GT CPI PG+N+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWSGIQQRKNSWQDGTLGTQCPIAPGSNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G I V+SR LIPVP+  PA+E+ V + DW+ K + TLKK LD+G+++ RPDG+ + 
Sbjct  133   AGGIGGIRVYSRLLIPVPYADPADEYWVLIGDWFGKSHTTLKKFLDSGRSMGRPDGVHIM  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+     N + PL+TME  KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGSHTVQN+Y
Sbjct  193   GKS-----NSVEPLYTMESGKTYKYRICNVGLKDTLNFRIQGHSMKLVEMEGSHTVQNMY  247

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTA+KE KDYYLVA++RF K   +T A+IR  NG G  +    P P
Sbjct  248   DSLDVHVGQCYSVLVTADKEPKDYYLVASTRFTKNVLTTTAVIRYSNGVGPASPIIPPAP  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT S   GKLR
Sbjct  308   V-----GWAWSLNQLRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTASRVNGKLR  362

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH D +TPLKL EY+ + D     FKYD++ D P    + + LAPNV NATFR 
Sbjct  363   YAINGVSHVDSETPLKLAEYYGVADK---VFKYDIISDDPPTVITDITLAPNVINATFRT  419

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EII EN  K IQSY+++GYSFFAV +EPGKW+PEKRKNYNL+D ++RH IQV+P  WA
Sbjct  420   FIEIILENPTKTIQSYNLDGYSFFAVAVEPGKWTPEKRKNYNLLDGVSRHTIQVFPKSWA  479

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSE  E  YLGQQ Y SVLSPE S RDEYN+PD QL+CG VK  P 
Sbjct  480   AIMLTFDNAGMWNLRSENTENKYLGQQLYISVLSPEFSNRDEYNLPDTQLVCGIVKDLPR  539

Query  213   P  211
             P
Sbjct  540   P  540



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 371/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             +DEP L TWSGIQQRKNSW +G  GT CPI PGTN TY FQVKDQIGS+ Y+P+T++ RA
Sbjct  75    IDEPFLLTWSGIQQRKNSWQEGMLGTNCPIQPGTNHTYHFQVKDQIGSFIYYPSTAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + ++SR LIPVP+  P +++ V ++DWY K +K L+  LD G+ + RPDG+++N
Sbjct  135   SGAFGGLRINSRLLIPVPYAPPEDDYTVIINDWYTKDHKALRSFLDEGRVLGRPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+ K  PLF M+P K Y+YR+CN GL+ S+NFR QGH+M LVE+EGSHTVQNVY
Sbjct  195   GKNAK-GDGKDEPLFEMKPEKVYKYRICNAGLKASLNFRIQGHTMMLVEMEGSHTVQNVY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC SVLVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTADKEPKDYYMVASTRFLKTVLTAKGIIRYTNGKGPASPELPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGS+HYG I ITRT+K ++  ++ GGKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSFHYGSINITRTIKFISQATKAGGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVSHT+P+TPLKL EYF + D     FKYD + D P     +  LAPNV N TFR+
Sbjct  369   YAVNGVSHTNPETPLKLAEYFGIADK---VFKYDTIKDDPPAKVEEATLAPNVMNMTFRD  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK IQS+H++GYSFFAV +EPG W+PEKR NYNL+DA++RH +QVYP  WA
Sbjct  426   FVEIIFENPEKTIQSWHLDGYSFFAVAVEPGTWTPEKRNNYNLLDAVSRHTVQVYPKSWA  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE+WE+ YLGQQ Y SVLSP RSLRDEYNIPDN LLCG VK  P 
Sbjct  486   AILLTFDNAGMWNIRSEIWEKTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKDLPK  545

Query  213   PKPYTI  196
             P PY I
Sbjct  546   PPPYVI  551



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 374/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T++ R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTAMHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   ++TAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPPGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTDPETPLKLAEYFGVADK---VFKYDSITDNPTPEQIKSIKIVPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWNVRSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNVRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 373/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   ++TA++EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADK---VFKYDTITDNPTPEQIKTIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 373/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   ++TA++EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADK---VFKYDTITDNPTPEQIKTIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/487 (63%), Positives = 371/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             +A+NGVSHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   FALNGVSHTDPETPLKLAEYFGISDK---VFKYDTITDDPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H++GYSFF+V +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   NFIEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWNVRSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 384/494 (78%), Gaps = 9/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN +DEP+LFTW GIQQRKNSW DG  GT CPILPGTNFTY+FQVKDQIGSYFY+P
Sbjct  50    VLNVFNNIDEPILFTWLGIQQRKNSWQDGVLGTNCPILPGTNFTYRFQVKDQIGSYFYYP  109

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT++ RA GG+G + V+SR LIPVP+  P +++ + + DWY + + TL+K LD G+++ R
Sbjct  110   TTAIHRAAGGFGGLRVNSRLLIPVPYADPEDDYTILIGDWYTESHSTLRKFLDIGRSLGR  169

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K  +    PLFTM+P K Y+YR+CNVGL+ S+NFR QGH + LVE+EGS
Sbjct  170   PDGVLINGKSAK-SDGSDEPLFTMKPGKIYKYRICNVGLKNSLNFRIQGHPLKLVEMEGS  228

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQC +VLVTA+K  KDY +VA++RF K   +   +IR  N    P 
Sbjct  229   HTVQNTYESLDVHVGQCFAVLVTADKAPKDYLVVASTRFTKNVLTGKGIIRYTNAKPAPP  288

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
             +P++   P     G AWS+NQFRSFRWNLT+SAARPNPQGSYHYG+I ITRT+KLVN+  
Sbjct  289   SPDVVEAPV----GWAWSLNQFRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNSAV  344

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
                GKLRYAINGVSH DP TPLKL EY+++ D     FKYD++ D+P  +   K+ +A N
Sbjct  345   RVQGKLRYAINGVSHVDPYTPLKLAEYYQVADK---VFKYDIISDEPPANAGDKITVATN  401

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N TFRNFVEIIFENHEK +Q++H++GYSFFAV IEPG+WSP+KR  YNL+DA++RH I
Sbjct  402   VVNQTFRNFVEIIFENHEKSLQTWHLDGYSFFAVAIEPGRWSPDKRSRYNLLDAVSRHTI  461

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWN+RSE+ ER YLGQQ Y SV SP RSLRDEYN+PDN LLC
Sbjct  462   QVFPKSWAAIMLTFDNAGMWNLRSELTERRYLGQQLYISVQSPARSLRDEYNMPDNALLC  521

Query  237   GAVKGKPLPKPYTI  196
             G VK  P P PY+I
Sbjct  522   GVVKDLPWPPPYSI  535



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/492 (63%), Positives = 380/492 (77%), Gaps = 14/492 (3%)
 Frame = -2

Query  1662  FNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSL  1483
             FN+LDEPLLFTWSGIQQRKNSW +GT G  CPI PGTNFTY+FQVKDQIGSY+Y+PTTS+
Sbjct  73    FNQLDEPLLFTWSGIQQRKNSWQEGTLGNNCPIPPGTNFTYRFQVKDQIGSYYYYPTTSM  132

Query  1482  QRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
              RA GG+G I+V SR LIPVPF+ P  +  V V DWY K +  LK++LD+G+ + RP G+
Sbjct  133   HRAAGGFGGISVLSRALIPVPFETPEADHMVLVGDWYTKSHTELKRLLDSGRALGRPQGV  192

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             V+NGK+GK G+ K  P+FT+ P KTYR+R+CNVGL+ S+N R QGH++ LVEIEGSHTVQ
Sbjct  193   VINGKSGK-GDGKDEPMFTVTPGKTYRFRICNVGLKDSINVRMQGHTLKLVEIEGSHTVQ  251

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             NVY+SLD+H+GQC SVLVTAN+E KDY+LVA++RF K        IR  NG G  +    
Sbjct  252   NVYESLDIHLGQCFSVLVTANQEPKDYFLVASTRFTKDSHVATTTIRYANGKGPASPELP  311

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
                     EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV +  +  G
Sbjct  312   KA-----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDG  366

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ--PT---GDTSKVILAPN  598
             KLRYA+NGVSH DP TP+KL EY+   D     FKYDL+ D+  P+       K+ +APN
Sbjct  367   KLRYALNGVSHVDPTTPIKLAEYYGAGDK---VFKYDLIKDEYEPSPGQAGQDKITVAPN  423

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NAT+RNFVEI+ ENH K +QS+H++G+SFFAVGIEPG+W+PEKR+NYNL+DA++R+ I
Sbjct  424   VVNATYRNFVEIVIENHGKSVQSWHLSGHSFFAVGIEPGRWTPEKRRNYNLLDAVSRNTI  483

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QVYP  +A +MTTLDNAG+WN+RS   ER YLG Q YFSVLSP +S++DEYN+PDN LLC
Sbjct  484   QVYPKSFAVIMTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLC  543

Query  237   GAVKGKPLPKPY  202
             G VK  P P PY
Sbjct  544   GIVKDMPKPTPY  555



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 372/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P KTYR RVCNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRVCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +++AN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILSANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPPGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVNGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTDPETPLKLAEYFGVADK---VFKYDSITDNPTPEQIKSIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 383/493 (78%), Gaps = 11/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP LFTW+GIQ RKNSW DG  GT CPI PGTNFTY+ QVKDQIG YFY+P
Sbjct  69    VINVFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIG-YFYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T++ RA GG+G + V+SR LIPVP+  P +E+ V + DWY K +  L+K+LD+G+++ R
Sbjct  128   STAMHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P+G+++NGK  K G+ K  PLFTM+P+KTY+YR+CNVGL+ S+N+R QGHSM LVE+EGS
Sbjct  188   PEGVLINGKTAK-GDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQN+YDSLD+HVG+C SVLVTA+KE KDYY+VA++RF K       +IR  NG G  +
Sbjct  247   HVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                 P P      G AWS+NQF +FRWNLTASAARPNPQGSY YG+I ITRT+KLVN+ S
Sbjct  307   PDIPPAPV-----GWAWSLNQFHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
             +  GKLRYA+NGVSH DP+TPLKL EYF + D     FKYD +PD P+ +  + V + PN
Sbjct  362   KSNGKLRYALNGVSHVDPETPLKLAEYFGISDK---VFKYDTIPDNPSPNIGNAVTVQPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T RNF+EIIFEN EK IQSYH++GYSFF +GIEPG W+PEKRK+YNL+DA++RH +
Sbjct  419   VLNITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGIEPGTWTPEKRKSYNLLDAVSRHTV  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
              V+P CWAA+M T DNAGMWN+RS++ E  YLGQQ Y SVLSPE SLRDEYN+PD+ LLC
Sbjct  479   HVFPKCWAAIMLTFDNAGMWNLRSDIAESRYLGQQLYISVLSPEHSLRDEYNMPDSNLLC  538

Query  237   GAVKGKPLPKPYT  199
             G VK  P P PY+
Sbjct  539   GLVKNLPKPAPYS  551



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 370/486 (76%), Gaps = 11/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             +A+NGVSHT+P+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   FALNGVSHTEPETPLKLAEYFGISDK---VFKYDTITDDPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFF+V +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWNVRSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPY  202
              P  PY
Sbjct  547   KPVNPY  552



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/485 (63%), Positives = 373/485 (77%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPRKTYKYRLCNVGFKSTLNFRIQNHMMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N   +T     P
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSNVQASTELPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVNTKS   GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH DP+TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGLNGVSHVDPETPLKLAEYFQMA---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  EPGKW+PE RKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMQSFHLDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+R+E WER YLG+Q Y SV SPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PTVYT  549



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/486 (62%), Positives = 373/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTNFTY FQ KDQIGSYFY+P+T++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNFTYHFQPKDQIGSYFYYPSTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRLRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +++A+++AKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILSADQQAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRS+RWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPPGPVGWAWSLNQFRSYRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NG+SHTDP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGISHTDPETPLKLAEYFGIGDK---VFKYDSITDNPTPEQIKSIKILPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQMYASVLSPEKSLRDEYNMPETSLQCGLVKGMP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 377/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTAN+EAKDYY+VA++RF K+  +T  L+R   G G  ++     
Sbjct  255   YDSLDVHVGQCFGVIVTANQEAKDYYMVASTRFLKKPLTTTGLLRYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKY+++ D P  +  K I + PNV N T 
Sbjct  370   RYAMSGVSHTDPETPLKLAEYFGVADK---VFKYNIITDNPNPEQIKTIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP C
Sbjct  427   RTFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKVNPYA  553



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 370/486 (76%), Gaps = 11/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             +A+NGVSHT+P+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   FALNGVSHTEPETPLKLAEYFGISDK---VFKYDTITDDPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFF+V +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWNVRSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPY  202
              P  PY
Sbjct  547   KPVNPY  552



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 377/487 (77%), Gaps = 14/487 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPI PGTN+TY+FQVKDQIG+YFY+PTT LQRA
Sbjct  75    LDEPLLFTWHGVQQRKNSWQDGTLGAQCPIAPGTNYTYRFQVKDQIGTYFYYPTTGLQRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  PA+E+ V + DW+ K +  LK+ LD+G++I RP G+ +N
Sbjct  135   VGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQTLDSGRSIGRPSGVHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKNG      L  L+TMEP KTY+YR+CNVGL+ ++NFR QGH M LVE EGSH VQN Y
Sbjct  195   GKNGG-----LEALYTMEPGKTYKYRICNVGLKEALNFRIQGHPMKLVETEGSHVVQNTY  249

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++E +DY++VA++RF K+  +   +IR  NG G  +    P P
Sbjct  250   DSLDVHVGQCFTVLVTADQEPRDYFMVASTRFTKKVITATRVIRYSNGVGPASPLLPPAP  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                  +G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV T+S+ GGKLR
Sbjct  310   H----QGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVGTRSKIGGKLR  365

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKV--ILAPNVKNATF  580
             YA+NGVSH DP+TPLKL EY+ + D     FKY+L+ D P    +    I+APNV NATF
Sbjct  366   YALNGVSHVDPETPLKLAEYYGVADK---VFKYNLISDAPDAAIASRDPIIAPNVINATF  422

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNF+E+I EN  KV QSY+++GYSFFAV +EPG+WSPEKRK YNL+DA++RH IQV+P  
Sbjct  423   RNFIEVILENPTKVTQSYNLDGYSFFAVAVEPGQWSPEKRKCYNLLDAVSRHTIQVFPKS  482

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA+M T DNAGMWN+RSEM E  YLGQQ Y SVLSP RSLRDEYN+P+ QL+CG VK  
Sbjct  483   WAAIMLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLVCGIVKDM  542

Query  219   PLPKPYT  199
             P P PY+
Sbjct  543   PKPPPYS  549



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/487 (62%), Positives = 375/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G  ++     
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKYD + D P  D  K I + PNV N T 
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDK---VFKYDSISDNPNADQIKTIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QV+P C
Sbjct  427   RTFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKINPYA  553



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 370/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALKSLLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N   +      P
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSNVQASAELPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVNTKS   GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF++ D     FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMADK---VFKYNVIKDEPAAKITALTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  EPGKW+PE RKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMQSFHLDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+R+E WER YLG+Q Y SV SPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PTVYT  549



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/488 (64%), Positives = 376/488 (77%), Gaps = 18/488 (4%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             L+EP L  WSGIQ RKNSW DG  GT CPILPGTNFTY FQVKDQIGS+FY+P  ++ RA
Sbjct  75    LNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQIGSFFYYPPIAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVM  1297
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN 
Sbjct  195   NGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQND  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      
Sbjct  254   YQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKA  313

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFR+F       +  PNPQGSYHYG I ITRT+KL N+ ++  GKL
Sbjct  314   PM-----GWAWSLNQFRTF-------SLEPNPQGSYHYGSINITRTIKLFNSATKVDGKL  361

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ-PTGDTSKVILAPNVKNATF  580
             RYAINGVSH DP+TPLKL EYFE+    E  FKYD++ D+ PT   + V +APNV NATF
Sbjct  362   RYAINGVSHVDPETPLKLAEYFEIA---EKVFKYDMISDEGPTEGATAVTIAPNVVNATF  418

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             RNF+EIIFENHEK +QS+H++GYSFFAV IEPG+WSPEKR NYNL+DA++RH IQV+PN 
Sbjct  419   RNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPNS  478

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DNAGMWN+RSE+ E  YLGQQ Y SVLSP RSLRDEYNIPD+ LLCG VKG 
Sbjct  479   WAAILLTFDNAGMWNLRSELIENRYLGQQLYISVLSPARSLRDEYNIPDHTLLCGLVKGM  538

Query  219   PLPKPYTI  196
             PLPKPYTI
Sbjct  539   PLPKPYTI  546



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 375/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N  P++     P
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQPSSELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTKS   GK+R
Sbjct  314   V-----GWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIEDEPAAKVTTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFFAV  EPGKW+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIVFENHEKSMQSFHLDGYSFFAVASEPGKWTPEKRKNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/486 (64%), Positives = 375/486 (77%), Gaps = 11/486 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TW+G+Q RKNSW DG  GT CPI PG NFTY FQVKDQIGSY Y+PTT++ RA 
Sbjct  75    DEPFLLTWTGVQHRKNSWQDGVVGTNCPIPPGKNFTYHFQVKDQIGSYIYYPTTAVHRAA  134

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             G +G + V+SR LIPVP+  P +++ V + DWY K +KTLK  LD+G+++ RPDG+++NG
Sbjct  135   GAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYVKSHKTLKNFLDSGRSLGRPDGVLING  194

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K+G    N   PLFTM+P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQN Y+
Sbjct  195   KSG----NDKKPLFTMKPGKTYKYRICNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNTYE  250

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLD+HVGQC SVLVTA+K  K+YY+VA++RF K   +  A+IR  NG  G A+ +  P  
Sbjct  251   SLDVHVGQCFSVLVTADKAPKEYYMVASTRFTKTVLTGKAIIRYTNGRKGSASLKNIPEA  310

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRY  751
             PV   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K+VN+ S   GKLRY
Sbjct  311   PV---GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKIPITRTIKIVNSASRVKGKLRY  367

Query  750   AINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPNVKNATFRN  574
              INGVSH +P TPLKL EY+ + D     FKYDL+ D+P    S +V LAPNV N TFRN
Sbjct  368   GINGVSHVNPVTPLKLAEYYGVADK---VFKYDLIKDEPPKKLSGEVTLAPNVVNQTFRN  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H+ GYSFFAV IEPG+W PEKRKNYNL+DA++RH IQVYP  +A
Sbjct  425   FVEIIFENHEKSLQSWHLAGYSFFAVSIEPGRWRPEKRKNYNLLDAVSRHTIQVYPKSYA  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AV+ T DNAGMWN+RSE+ E  YLGQQ Y SVLSP RSLRDEYN+PDN LLCG VK  P 
Sbjct  485   AVLLTFDNAGMWNLRSELTENRYLGQQLYISVLSPARSLRDEYNMPDNALLCGIVKDLPK  544

Query  213   PKPYTI  196
             P PYTI
Sbjct  545   PHPYTI  550



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 371/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASTE  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVNTK+   GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y  NGVSH D +TPLKL EYF++    E  FKYD++ D+P    + + + PNV N TFR 
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMA---EKVFKYDVIKDEPAAQITALTVQPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK ++S+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMESFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PASYT  549



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/492 (64%), Positives = 383/492 (78%), Gaps = 14/492 (3%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP LFTW+GIQQRKNSW +GT GT CPI PG NFTY FQVKDQIG++FY+PTT+L R
Sbjct  74    QLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGGNFTYHFQVKDQIGTFFYYPTTALHR  133

Query  1476  AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  1300
             A GGYG ++VHSR LIP+PFD  PA+EF V VSDWY K +  L+K LD+G+++ RPDG++
Sbjct  134   AAGGYGGLSVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGVI  193

Query  1299  MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             +NGK G   + K  P+F+M P KTYRYR CN G + S+N R QGH+M LVEIEGSH VQN
Sbjct  194   INGKGGNG-DGKDEPMFSMTPGKTYRYRFCNAGNKDSINVRIQGHTMKLVEIEGSHVVQN  252

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLD+H+GQC+SVLVTA+K+ KDY LVA++RF K+  +  ++IR  NG G  +     
Sbjct  253   MYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGKGPASPELPK  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
              P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT     GK
Sbjct  313   API-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGK  367

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTS-KVILAPNVK  592
             LRYA NG+SH +P TP+KL EY+ ++D     FKYDLM D+   P G    K+ LAPNV 
Sbjct  368   LRYAFNGISHVNPTTPIKLAEYYGVEDK---VFKYDLMKDEYEPPAGKAEEKITLAPNVV  424

Query  591   NATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQV  412
                +RN+VEIIFENHEK +QS+H+ GYSFFAV IEPGKW+PEKRKNYNL+DA++R+ IQV
Sbjct  425   KVIYRNYVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTPEKRKNYNLLDAVSRNTIQV  484

Query  411   YPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGA  232
             YPN WAA+MTTLDNAG+WN+RS   ER YLGQQ YFS LSP+R L+DEYN+PDN +LCG 
Sbjct  485   YPNSWAAIMTTLDNAGLWNLRSNSLERQYLGQQLYFSALSPKRDLKDEYNMPDNDVLCGI  544

Query  231   VKGKPLPKPYTI  196
             +K  PLPKPY++
Sbjct  545   IKDMPLPKPYSV  556



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 372/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  75    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGKNFTYHFQPKDQIGSYFYYPTTAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ + ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  135   AGAFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  195   GKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC  VLVTAN+E KDYY+VA++RF K   +T  L+R   G G  ++     P
Sbjct  254   DSLDVHVGQCFGVLVTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKGPASSQLPAAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA++GVSHTDP+TPLKL EYF + D     FKYD + D PT D  K I + PNV N T R
Sbjct  369   YALSGVSHTDPETPLKLAEYFGVVDK---VFKYDSISDNPTSDQIKNIKIEPNVLNITHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+EI+FENHE+ +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  426   NFIEIVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VK KP
Sbjct  486   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKP  545

Query  216   LPKPYT  199
                PY 
Sbjct  546   KINPYA  551



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/485 (64%), Positives = 373/485 (77%), Gaps = 13/485 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+Q RKNSW DGT G  CPI PGTN+TY FQVKDQIG+YFY+PTT LQRA
Sbjct  85    LDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVKDQIGTYFYYPTTGLQRA  144

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             +GG+G + + SR LIPVP+  PA+E+ V + DW+ K +  LK+ LD+G++I RP G+ +N
Sbjct  145   IGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQKLDSGRSIGRPVGVHIN  204

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKNG      L PL+TMEP KTY+YR+CNVGL+ S+NFR QGH + LVE EGSH VQN Y
Sbjct  205   GKNGG-----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNNY  259

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++E KDY++VA++RF K+  +   +IR  NG G  +    P  
Sbjct  260   DSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVGPASGGLPPA-  318

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                  +G AWSINQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT S   GKLR
Sbjct  319   ----PQGWAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKLR  374

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NGVSH D  TPLKL EY+ + D     FKY+L+ D P      + +APNV NATFR+
Sbjct  375   YGLNGVSHVDTQTPLKLAEYYGVADK---VFKYNLISDSPDTAFPDLTVAPNVINATFRD  431

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+E+IFEN  KVIQSY+++GYSFFA+ +EPGKW+PEKRKNYNL+DAI+RH IQV+PN WA
Sbjct  432   FIEVIFENPGKVIQSYNLDGYSFFALAVEPGKWTPEKRKNYNLLDAISRHTIQVFPNSWA  491

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEM E  YLGQQ Y SVLSP RSLRDEYN+P+ QLLCG VK  P 
Sbjct  492   AIMLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLLCGIVKDMPK  551

Query  213   PKPYT  199
             P PY+
Sbjct  552   PPPYS  556



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/487 (62%), Positives = 375/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G  ++     
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKYD + D P  D  K I + PNV N T 
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDK---VFKYDSISDNPNPDQIKTIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QV+P C
Sbjct  427   RTFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKINPYA  553



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/487 (63%), Positives = 371/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVTANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHT+P+TPLKL EYF + D     FKYD++ D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDK---VFKYDIITDNPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/486 (62%), Positives = 368/486 (76%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I I+RT+ L NT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINISRTIVLKNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSH DP+TPLKL EYF + D     FKYD + D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHIDPETPLKLAEYFGIADK---VFKYDSITDNPTPEQIKTIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKG P
Sbjct  487   AAILLTFDNCGMWNIRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGTP  546

Query  216   LPKPYT  199
              P PY 
Sbjct  547   KPNPYA  552



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/487 (62%), Positives = 374/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLITWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTA++E KDYY+VA++RF K+  +T  L+R   G G  ++     
Sbjct  255   YDSLDVHVGQCFGVIVTADQELKDYYMVASTRFLKKPLTTTGLLRYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKYD + D P  D  K I + PNV N T 
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVADK---VFKYDTISDNPNPDQIKNIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHE+ +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP C
Sbjct  427   RTFIEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKVNPYA  553



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 370/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYAAPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E  TV +IR    N   +T     P
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELGTVGVIRYEGSNVQASTKLPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVNTKS   GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMA---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  EPGKW+PE RKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMQSFHLDGYSFFAVASEPGKWTPESRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+R+E WER YLG+Q Y SV SPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRAENWERRYLGEQLYVSVQSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PTVYT  549



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 375/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++        P++     P
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSTVQPSSELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTKS   GK+R
Sbjct  314   V-----GWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKVTTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYPN W+
Sbjct  426   FVEIVFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPNSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 374/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLITWAGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ + ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTA++E KDYY++A++RF K+  +T  L+R   G G  ++     
Sbjct  255   YDSLDVHVGQCFGVIVTADQEPKDYYMIASTRFLKKPLTTTGLLRYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKYD + D P  D  K I + PNV N T 
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVADK---VFKYDTISDNPNPDQIKNIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHE+ +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP C
Sbjct  427   RTFIEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENAERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKVNPYA  553



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 375/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGNN-EPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVIQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   +      P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASNELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH DP+TPLKL EYF L    E  FKY+++ D+P    + +++ PNV N TFR 
Sbjct  369   FGLNGVSHVDPETPLKLAEYFGLA---EKVFKYNVIKDEPAAKITTLVVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS++++GYSFF V  EPG+W+PEKRKNYNL+DA++RH +QV+P  W+
Sbjct  426   FVEIVFENHEKSMQSFNLDGYSFFNVASEPGRWTPEKRKNYNLLDAVSRHTVQVFPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 375/487 (77%), Gaps = 10/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+G+QQRKNSW DG  GT CPI PG N+TY FQVKDQIGSY Y+P+T++ +A
Sbjct  75    LDEPFLLTWTGVQQRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIGSYMYYPSTAMHKA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  P +++ +   DW+ KG+ TLKK+LD+G+ + R DG+ +N
Sbjct  135   AGGFGGLRINSRLLIPVPYPDPEDDYTILAGDWFSKGHTTLKKMLDSGRNLGRCDGVHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+ K  PLFTMEP KTY+YR+CNVG++TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  195   GKVAK-GDGKDEPLFTMEPGKTYKYRICNVGIKTSLNVRFQGHNMKLVEMEGSHTVQNTY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC  VLVTA++E +DYY+VA++RF K+  +   +IR  NG G  +    P P
Sbjct  254   ESLDVHVGQCFGVLVTADQEPRDYYVVASTRFTKRVITATGIIRYTNGKGPASPELPPAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I+ITRT+KL NT  + GGKLR
Sbjct  314   I-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGAIDITRTIKLANTAGKVGGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSK-VILAPNVKNATFR  577
             YAING+SH DP TPLKL EY+ + D    SFKYD++ D P    S+ + + P V N T+R
Sbjct  369   YAINGISHVDPPTPLKLAEYYNVADK---SFKYDILRDDPPAKISEEITVQPIVVNLTYR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFEN E  IQS+H++GYSFFAV +E G W+PEKRKNYNL+DA++RH IQV+PN W
Sbjct  426   TFVEIIFENRETAIQSWHLSGYSFFAVAVETGTWTPEKRKNYNLLDAVSRHTIQVFPNSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE+W+R YLGQQ Y SVLSPE SLRDEYNIPDN LLCG V+  P
Sbjct  486   AAILLTFDNCGMWNIRSEIWDRHYLGQQLYASVLSPEHSLRDEYNIPDNALLCGVVESMP  545

Query  216   LPKPYTI  196
              P PY+I
Sbjct  546   KPPPYSI  552



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 371/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAE  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITR++KLVNTKS   GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKSFVDGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y  NGVSH D +TPLKL EYF++    E  FKYD++ D+P    + + + PNV N TFR 
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMA---EKVFKYDVIKDEPAAQITALTVQPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK ++S+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMESFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PARYT  549



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 370/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +V AN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHT+P+TPLKL EYF + D     FKYD++ D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDK---VFKYDIITDNPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 374/487 (77%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  1293  GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+    G G  ++     
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLLYEGGKGPASSQLPAA  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKL
Sbjct  315   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATF  580
             RYA++GVSHTDP+TPLKL EYF + D     FKYD + D P  D  K I + PNV N T 
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDK---VFKYDSISDNPNPDQIKTIKIEPNVLNITH  426

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QV+P C
Sbjct  427   RTFIEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVFPKC  486

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VKGK
Sbjct  487   WAAILLTFDNCGMWNIRSENSERRYLGQQLYVSVLSPEKSLRDEYNLPESSLQCGLVKGK  546

Query  219   PLPKPYT  199
             P   PY 
Sbjct  547   PKINPYA  553



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 371/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAE  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITR++KLVNTK+   GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y  NGVSH D +TPLKL EYF++    E  FKYD++ D+P    + + + PNV N TFR 
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMA---EKVFKYDVIKDEPAAQITALTVQPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK ++S+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMESFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRSENLERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PASYT  549



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/487 (62%), Positives = 370/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +V AN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHT+P+TPLKL EYF + D     FKYD++ D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDK---VFKYDIITDNPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y S+LSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 371/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  +KK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +V+AN+E KDYY+VA+SRF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHT+P+TPLKL EYF + D     FKYD++ D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDK---VFKYDIITDDPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y S+LSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/492 (61%), Positives = 370/492 (75%), Gaps = 12/492 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP LF+W+GIQQRKNSW DG  GT CPI PG NFTY FQVKDQIGS++Y+P
Sbjct  69    VINVFNNLDEPFLFSWNGIQQRKNSWQDGVSGTSCPIAPGQNFTYHFQVKDQIGSFYYYP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + ++ +A GG+G + ++SR LIPVPFD PA+++ V + DWY K +KTL +ILD G++I  
Sbjct  129   SLAMHKAAGGFGGLRINSRLLIPVPFDPPADDYTVMIGDWYTKDHKTLARILDTGRSIGL  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NGK GK  E    PLF ME  K YRYRVCN+G +TS+NFR QGHSM LVE++GS
Sbjct  189   PAGVLINGKAGKDDE----PLFVMEAGKVYRYRVCNIGTKTSLNFRIQGHSMLLVEMDGS  244

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN Y+SLD+HVGQC SVLVTAN+   DYY+VA++RF ++E +   +IR    +    
Sbjct  245   HTMQNTYESLDIHVGQCFSVLVTANQAPGDYYMVASTRFLRKELTATGVIRYSGSH----  300

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P  P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG I+ITRT+KL ++++
Sbjct  301   -TLPSPVLPKAPSGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLASSRA  359

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RY +NGVSH + DTPLKL EYF +      SFKY+L  D+P    +  ILA NV
Sbjct  360   IIAGKNRYTLNGVSHVEADTPLKLAEYFGIGGK---SFKYNLTSDEPPSGGAPAILATNV  416

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
                 FR FVEIIFEN EK +QSYH+NGYSFF VG+ PGKW+PE RK YNL+DA++RH +Q
Sbjct  417   ITIEFRTFVEIIFENPEKNVQSYHLNGYSFFLVGMGPGKWTPESRKTYNLLDAVSRHAVQ  476

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  WAA+M T DNAGMWN+RSE+WER YLGQQ Y SV SP RSLRDEYN+PD  LLCG
Sbjct  477   VYPKSWAAIMLTFDNAGMWNLRSELWERRYLGQQLYISVQSPARSLRDEYNLPDTALLCG  536

Query  234   AVKGKPLPKPYT  199
             AV+G P P PYT
Sbjct  537   AVEGLPKPAPYT  548



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 370/486 (76%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT + RA
Sbjct  77    LDEPFLLTWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTGMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++  KTYR R+CNVGL++S+NFR Q H M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKSSLNFRIQNHKMRLVEMEGSHVLQNDY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC  V+VTA++E KDYY+ A++RF K   ST  L+R   G G  ++     P
Sbjct  256   DSLDVHVGQCYGVIVTADQEPKDYYMAASTRFLKNALSTTGLLRYEGGKGPASSQLPAAP  315

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD-TSKVILAPNVKNATFR  577
             YA+NGVSHTD +TPLKL EYF + D     FKYD++ D PT +   K+ + PNV N T R
Sbjct  371   YALNGVSHTDSETPLKLAEYFGVADK---VFKYDIISDNPTPEQIKKIKMEPNVLNITHR  427

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E+IFENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  428   TFIEVIFENHEKSVQSWHLDGYSFFAVAVEPGVWTPEKRKNYNLLDAVSRHTVQVYPKCW  487

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VKGKP
Sbjct  488   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKP  547

Query  216   LPKPYT  199
                PY 
Sbjct  548   KVNPYA  553



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/487 (62%), Positives = 370/487 (76%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  +KK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +V+AN+E KDYY+VA+SRF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSHT+P+TPLKL EYF + D     FKYD++ D PT +  K I + PNV N T R
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDK---VFKYDIITDDPTPEQIKNIKIEPNVLNITHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE++FENHEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  427   TFVEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y S+LSPE+SLRDEYN+P+  L CG VK  P
Sbjct  487   AAILLTFDNCGMWNIRSENSERRYLGQQLYASILSPEKSLRDEYNMPETSLQCGLVKNTP  546

Query  216   LP-KPYT  199
              P  PY 
Sbjct  547   KPVNPYA  553



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/486 (62%), Positives = 374/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++        P++     P
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSTVQPSSELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTKS   GK+R
Sbjct  314   V-----GWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKATTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIVFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 366/485 (75%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+GIQQRKNSW DGT G+ CPILPG NFTY FQVKDQIGS+ YFPT  +QRA
Sbjct  73    LDEPFLFTWNGIQQRKNSWQDGTAGSNCPILPGKNFTYHFQVKDQIGSFVYFPTLGMQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + V+SR LIPVPFD PA+++ V + DWY K +K L+KILD G+ + RP GL++N
Sbjct  133   VGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLIN  192

Query  1293  GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G +GK G  K  P LFTME  KTYRYR+CN+G++ ++NFR Q HSMTLVE++GSHTVQN 
Sbjct  193   GHSGKNGAGKDEPPLFTMEAKKTYRYRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNN  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQCLSVLVTAN+  +DYY+VA+SRF K   +   ++R       P+      
Sbjct  253   YDSLDIHVGQCLSVLVTANQSPRDYYMVASSRFTKYMLTVTGIVRYAGSQTPPSQDLPEA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT++LVNT     GK 
Sbjct  313   -----PAGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLVNTIGNVDGKR  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSH D DTPLKL EY+ + D     FKYD++ D+P  D +++ LAPNV N TFR
Sbjct  368   RYALNGVSHQDTDTPLKLAEYYGIADK---VFKYDIISDEPPADGAQIKLAPNVVNTTFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFEN E+ +Q+YH++GYSFF VG+  GKW+P  RK YNL+DA++RH IQVY   W
Sbjct  425   TFVEIIFENPERSMQAYHLDGYSFFPVGMGHGKWTPASRKTYNLLDAVSRHTIQVYQRSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +AVM T DNAGMWN+RSE+WER YLGQQ YF+V SP RSLRDEYN+PDN LLCG V   P
Sbjct  485   SAVMLTFDNAGMWNLRSELWERRYLGQQLYFTVQSPARSLRDEYNMPDNALLCGDVANLP  544

Query  216   LPKPY  202
              P  Y
Sbjct  545   KPPSY  549



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 367/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP L TWSG+Q RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGLQHRKNCWQDGVAGTTCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK +LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVILGDWYTSGHTALKNLLDSGRTLGLPNGVLI  192

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GKVG N   PLFTM P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVGGNN-EPLFTMNPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQND  251

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC +VLVTAN+ AKDYY+VA++RF K+E STV +IR    N      +   
Sbjct  252   YDSLDVHVGQCFAVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASS  306

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITR++KLVN+KS   GK 
Sbjct  307   ELPKTPIGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGRINITRSIKLVNSKSSVNGKT  366

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+  NGVSH D DTPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR
Sbjct  367   RFGFNGVSHVDTDTPLKLAEYFQMS---EKVFKYNVIKDEPASKITTLTVQPNVLNITFR  423

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W
Sbjct  424   TFVEIIFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSW  483

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A++ T DNAGMWN+RSE  ER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG P
Sbjct  484   SAILLTFDNAGMWNIRSENSERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLP  543

Query  216   LPKPYT  199
             LP  YT
Sbjct  544   LPASYT  549



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/493 (60%), Positives = 379/493 (77%), Gaps = 10/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             + N+FN LDEPLLFTW+G+Q RKNSW DG PGT CPI PGTN+TY+ QVKDQIGS+FY+P
Sbjct  66    VFNIFNNLDEPLLFTWNGVQHRKNSWQDGVPGTNCPITPGTNYTYRLQVKDQIGSFFYYP  125

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T+L RA GG+G + ++SR LIPVP+  P +++ V +SDWY K + TLKK LD+G++I R
Sbjct  126   STALHRAAGGFGGLRINSRLLIPVPYHDPEDDYTVLISDWYTKSHTTLKKFLDSGRSIGR  185

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P+G+++NGK  K G+    P+FTM+P KTY+YR+CNVG++ S+N RFQGH M LVE+EGS
Sbjct  186   PEGVLINGKTAK-GDGSDKPMFTMKPGKTYKYRICNVGMKNSLNLRFQGHLMKLVEMEGS  244

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQN YDSLD+HVG C SVL+TA+K+ KDYY+VA++RF K   +  A++R  NG G P+
Sbjct  245   HVVQNNYDSLDVHVGGCFSVLITADKDPKDYYIVASTRFSKTVLTGKAIMRYTNGKGAPS  304

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQF++FRWNL+ASAARPNPQGSY Y +I+ITRT+KLVN+ S
Sbjct  305   PDIPESPL-----GWAWSLNQFKTFRWNLSASAARPNPQGSYKYSKIDITRTIKLVNSVS  359

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPN  598
              E GKLRYA+NGVSH DP+TPLKL EYF + D     FKY+ + D+P  D  + V + PN
Sbjct  360   RENGKLRYALNGVSHVDPETPLKLAEYFGVSDK---VFKYNTIQDEPPADLGASVKIQPN  416

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T R F+EIIFEN EK IQSYH++GY+FF VGIEPG W+P+KRK+YN  DA++RH +
Sbjct  417   VLNVTHRKFIEIIFENPEKSIQSYHLDGYAFFVVGIEPGTWTPDKRKSYNPFDAVSRHTV  476

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P CWAA++ + DN GMWN+RS   E  YLGQQ Y S++SPE SLRDEYN+PD+ LLC
Sbjct  477   QVFPKCWAAILLSTDNVGMWNLRSLTAENMYLGQQLYISIMSPEGSLRDEYNMPDDNLLC  536

Query  237   GAVKGKPLPKPYT  199
             G VKG P P PYT
Sbjct  537   GVVKGLPKPPPYT  549



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 367/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGTPG  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  37    LDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  96

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  97    VGGFGGLRIFSRLLIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIIN  156

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  157   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  215

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G  +    P P
Sbjct  216   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKGPASPVLPPAP  275

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKL 
Sbjct  276   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  330

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  331   YAINGVSHVDPETPVKLAEYYGIADK---VFKYNIISDEPPTDLKAITIAPNVMQTTFRT  387

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN EKV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  388   FIEIIFENPEKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  447

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  448   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  507

Query  213   PKP  205
             P P
Sbjct  508   PPP  510



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 370/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LKK+LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTTGHTALKKLLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTE  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVN+KS   GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMA---EKVFKYNVIKDEPEAKITALTVQPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  E GKW+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMQSFHLDGYSFFAVASEAGKWTPEKRSNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+R+E WER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRAENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PAVYT  549



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 374/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTTCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   ++     P
Sbjct  255   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASSELPKAP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  426

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFF+V  EPG W+PEKR NYNL+DA++RH +QV+P  W+
Sbjct  427   FVEIVFENHEKSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWS  486

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  487   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  546

Query  213   PKPYTI  196
             P PYTI
Sbjct  547   PTPYTI  552



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 374/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   ++     P
Sbjct  255   DSLDVHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASSELPKAP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  426

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFF+V  EPG W+PEKR NYNL+DA++RH +QV+P  W+
Sbjct  427   FVEIVFENHEKSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWS  486

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  487   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  546

Query  213   PKPYTI  196
             P PYTI
Sbjct  547   PTPYTI  552



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/483 (63%), Positives = 368/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+ +  PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGRDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G  +    P P
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKGPASPVLPPAP  311

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKLR
Sbjct  312   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADK---VFKYNIISDEPPTDLRAITIAPNVMQTTFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN EKV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  424   FIEIIFENPEKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  484   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  543

Query  213   PKP  205
             P P
Sbjct  544   PPP  546



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/485 (61%), Positives = 369/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N   +      P
Sbjct  253   DSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYAGSNVQASAELPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLV++K+   GK+R
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVSSKNMVNGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  N VSH D +TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGFNSVSHVDTETPLKLAEYFQMA---EKVFKYNVIKDEPAAKITALTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  425   FVEIIFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG P+
Sbjct  485   AILLTFDNAGMWNIRSENWERRYLGQQLYASVLSPEKSLRDEYNIPLNTNLCGIVKGLPM  544

Query  213   PKPYT  199
             P  YT
Sbjct  545   PAIYT  549



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 367/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G  +    P P
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKGPASPVLPPAP  311

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKLR
Sbjct  312   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADK---VFKYNIISDEPPTDLKAITIAPNVMQTTFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN EKV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  424   FIEIIFENPEKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  484   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  543

Query  213   PKP  205
             P P
Sbjct  544   PPP  546



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 367/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGTPG  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  78    LDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  137

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  138   VGGFGGLRIFSRLLIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIIN  197

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  198   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  256

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G  +    P P
Sbjct  257   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKGPASPVLPPAP  316

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKL 
Sbjct  317   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  371

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  372   YAINGVSHVDPETPVKLAEYYGIADK---VFKYNIISDEPPTDLKAITIAPNVMQTTFRT  428

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN EKV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  429   FIEIIFENPEKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  488

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  489   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  548

Query  213   PKP  205
             P P
Sbjct  549   PPP  551



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 374/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   ++     P
Sbjct  255   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASSELPKAP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  426

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFF+V  EPG W+PEKR NYNL+DA++RH +QV+P  W+
Sbjct  427   FVEIVFENHEKSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWS  486

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  487   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  546

Query  213   PKPYTI  196
             P PYTI
Sbjct  547   PTPYTI  552



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 381/494 (77%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF     +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ S
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPN  598
             +  GKLRYAING+SH DP+TPLKL +Y+++ D     FK+D M D P    + K+ + PN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDK---VFKFDTMKDTPPATAADKITMEPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T R+FVEIIFEN EK +Q++H++GYSFF+VG EPG W+PEKR NYNL+DA++R+ +
Sbjct  419   VVNITIRDFVEIIFENPEKSLQTWHLDGYSFFSVGSEPGTWTPEKRSNYNLLDAVSRYTV  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T D+AGMWNVRSE  ER YLGQQFY  V +  RSLR+EYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVC  538

Query  237   GAVKGKPLPKPYTI  196
             G VK  P P P+++
Sbjct  539   GIVKDMPKPAPFSM  552



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 372/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYAKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK+G N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKLGGNNA-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   ++     P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASSDIPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVE++FENHEK +QS+H++GYSFFAV  EPG+W+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  426   FVEVVFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 371/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW G+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWIGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK+G N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKIGGNNA-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   +      P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASNEIPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVE+IFENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  426   FVEVIFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 373/485 (77%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW G+QQRKN W DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LDEPFLITWVGVQQRKNPWQDGVXGTMCPIPPGTNYTYKFQVKDQIGSFMYYPATAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + ++SR LIPVP+  P +++ V + DWY K +  L+K LD+G+++ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGXGPVSPEVPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+N+ S+  GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAING+SH DP+TPLKL +Y+ ++   E  FK+D M   P     K+ + PNV N T ++
Sbjct  369   YAINGISHVDPETPLKLADYYGIR---EKVFKFDTMKVDPQSPAEKITMEPNVLNITIKD  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK +Q++H+NGY+FFAV +EPGKW+PEKRKNYNL+DA++RH IQV+P  WA
Sbjct  426   FVEIIFENPEKSLQTWHLNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWA  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE  ER YLGQQ Y  V + +RSLR+EYN+PDN L+CG VKG P+
Sbjct  486   AILLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPM  545

Query  213   PKPYT  199
             P PY+
Sbjct  546   PPPYS  550



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 373/489 (76%), Gaps = 10/489 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW GIQQRKNSW DGT GT CPI PG NFTY FQVKDQIGSY+Y PTT+L R
Sbjct  72    QLDEPFLITWKGIQQRKNSWQDGTLGTNCPIPPGKNFTYHFQVKDQIGSYYYHPTTALHR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             AVGGYGPI ++SR LIPVPFD PA++F V VSDWY   +K+LK +LD G+++ RPDG+V+
Sbjct  132   AVGGYGPITIYSRALIPVPFDTPADDFTVLVSDWYTNSHKSLKGLLDTGRSLGRPDGIVI  191

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GK G+ K  P+FTM   KTYR+R CNVG++ ++N R QGH+M LVE+EGSHTVQN+
Sbjct  192   NGKSGK-GDGKDEPMFTMVKGKTYRFRFCNVGMKDTINVRIQGHTMKLVEMEGSHTVQNL  250

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+ LD+H+GQCLSVL+TA++  KDY++VATSRF K+     A IR  NG G  +  E   
Sbjct  251   YELLDIHLGQCLSVLITADQNPKDYFIVATSRFTKESRVATATIRYANGKGPASPLEKKE  310

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   EG  WS+NQF SFRWNLTAS+ARPNPQGSYHYG+I ITRT++LV+T     GK 
Sbjct  311   A----PEGWEWSLNQFNSFRWNLTASSARPNPQGSYHYGQINITRTIRLVSTAGVVNGKH  366

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ--PTGDTSKVILAPNVKNAT  583
             RYAINGVSHTDP+TP+KL +Y+ + D     FKY L  D+  P      + +APNV N T
Sbjct  367   RYAINGVSHTDPETPIKLAQYYGVADK---VFKYGLCKDEYIPPSGNEVITIAPNVVNVT  423

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             +RNFVEII ENHEK +QS+H++G++FFAV I PG+W PE R+NYNL+DA++R  IQVYPN
Sbjct  424   YRNFVEIILENHEKSVQSWHLDGFNFFAVAIAPGRWKPEMRQNYNLLDAVSRSTIQVYPN  483

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              WAA++TTLDNAG+WN+RS   E+ YLG Q YFSV +P  SL+DEYN+PDN + CG +K 
Sbjct  484   SWAAIITTLDNAGLWNLRSNALEKQYLGHQLYFSVNAPNTSLKDEYNMPDNDISCGIIKD  543

Query  222   KPLPKPYTI  196
              P PKPY+I
Sbjct  544   LPHPKPYSI  552



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 372/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPIL GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPILAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   TGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVGE K   LFTM+P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGE-KNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   +      P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSNVEASAELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL N+K+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMA---EKVFKYNVIKDEPAAKITALTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++G+SFFAV  EPG+W+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIIFENHEKSMQSFHLDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PAPYTI  551



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 372/489 (76%), Gaps = 11/489 (2%)
 Frame = -2

Query  1662  FNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSL  1483
             FN+LDEPLL TWSGIQQRKNSW +GT G  CPI PG NFTY+FQVKDQIGSY+Y+PTTS 
Sbjct  73    FNQLDEPLLLTWSGIQQRKNSWQEGTLGNNCPIPPGANFTYRFQVKDQIGSYYYYPTTST  132

Query  1482  QRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
              RA GGYG I+V SR LIPVPF+ P  +  V   DWY K +  LK++LD+G+ + RP G+
Sbjct  133   HRAAGGYGGISVLSRALIPVPFETPEADHMVLAGDWYTKSHVELKRMLDSGRALGRPTGV  192

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK+GK G+ K  P+FT+   KTYR+R CNVG++ S+N R QGH+M LVEIEGSHTVQ
Sbjct  193   LINGKSGK-GDGKDEPMFTVIAGKTYRFRFCNVGMKDSINVRMQGHTMKLVEIEGSHTVQ  251

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             NVY+S+D+H+GQC SVLVTAN+E KDYYLV ++RF K      A IR  NG G  +    
Sbjct  252   NVYESIDIHLGQCFSVLVTANQEPKDYYLVVSTRFTKDSHVATATIRYANGKGPASPELP  311

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
                     EG AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLV +  +  G
Sbjct  312   KA-----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDG  366

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ--PTGDTSKVILAPNVKN  589
             KLRYA+NGVSH D  TP+KL EY+   D     FKY+L+ D+  P     K+ +APNV N
Sbjct  367   KLRYALNGVSHVDTATPIKLAEYYGAGDK---VFKYNLIKDEYEPNPGQDKITVAPNVVN  423

Query  588   ATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVY  409
             AT+RN+VEI+ ENH K +QS+H++G+SFFAVGIEPG+W+PE+RKNYNL+DA++R+ IQVY
Sbjct  424   ATYRNYVEIVIENHGKTVQSWHLSGHSFFAVGIEPGRWAPERRKNYNLLDAVSRNTIQVY  483

Query  408   PNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAV  229
             P  +A +MTTLDNAG+WN+RS   ER YLG Q YFSVLSP +S++DEYN+PDN LLCG V
Sbjct  484   PKSFAVIMTTLDNAGLWNLRSNSLERNYLGHQLYFSVLSPNKSIKDEYNMPDNDLLCGIV  543

Query  228   KGKPLPKPY  202
             K  P P PY
Sbjct  544   KDMPKPTPY  552



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 373/485 (77%), Gaps = 10/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW GIQ RKNSW +GTPGT+CPI PGTN+TY FQVKDQIGS+FY+P+T LQRA
Sbjct  74    LDEPFLMTWHGIQHRKNSWQEGTPGTLCPIAPGTNYTYHFQVKDQIGSFFYYPSTGLQRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + + SR LIPVP+  P +E+ V + DWY K + +L+K+LD+G++I RP+G+++N
Sbjct  134   AGGFGGLRIFSRLLIPVPYADPEDEYWVIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+    PL+TM P KTY+YR+CNVGL+ ++NFR QGHS+ LVE EGSH VQNVY
Sbjct  194   GKTAK-GDGSDQPLYTMIPGKTYKYRLCNVGLKDALNFRIQGHSLKLVETEGSHVVQNVY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+K+ KDYY+VA++RF K + S  A+I   N           P 
Sbjct  253   DSLDVHVGQCFTVLVTADKDPKDYYMVASTRFTKYDLSAKAIIHYTNS-----AAPASPE  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P +  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K  N+ S  G  LR
Sbjct  308   LPPSPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFANSVSR-GQGLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TPLKL EY+ + D     FKY+ + D+P  D S +  APNV NATFR+
Sbjct  367   YAINGVSHVDPETPLKLAEYYGVADK---VFKYNTISDEPPVDLSSITKAPNVINATFRD  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN  K +QSY+++GYSFFAV +EPGKWSP KRKNYNL+DA++RH +QV+P  W+
Sbjct  424   FIEIIFENDGKTVQSYNLDGYSFFAVAMEPGKWSPVKRKNYNLLDAVSRHTVQVFPKSWS  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSE  E  YLGQQ Y SVLSP+RSLRDEYN+PD QLLCG VK  P 
Sbjct  484   AIMLTFDNAGMWNLRSEHAENRYLGQQLYISVLSPQRSLRDEYNLPDTQLLCGIVKDLPK  543

Query  213   PKPYT  199
             P PY+
Sbjct  544   PPPYS  548



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 372/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG+NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGSNFTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD+G+++ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GK       PLFTM+P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGKGSSGSDAPLFTMKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTA+++ KDY +VA+SRF K   ST  ++R   G G  ++     P
Sbjct  256   DSLDVHVGQCYGTIVTADQDPKDYLMVASSRFLKSVISTTGVLRYDGGKGPASSEIPAAP  315

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VNT+ +  GKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTQGKADGKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA++GVSHTDP+TP+KL EYF + D     FKY+++ D PT D +K I + PN+ N T R
Sbjct  371   YALSGVSHTDPETPVKLAEYFGMADK---VFKYNIISDSPTSDQTKTIKIEPNILNVTHR  427

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE+IFENHE+ +QS+HI+GY+FFAV +EPG W+PEKR+NYNL+DA++RH +QV+P CW
Sbjct  428   TFVEVIFENHERSVQSWHIDGYAFFAVAVEPGTWTPEKRENYNLLDAVSRHTVQVFPKCW  487

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AAV+ + DN GMWNVRSE  ER YLGQQ Y SVLSPE SLRDEYN+P N L CG VKG P
Sbjct  488   AAVLLSFDNCGMWNVRSENMERRYLGQQLYLSVLSPESSLRDEYNMPQNSLQCGLVKGLP  547

Query  216   LPKPYT  199
              P+PY 
Sbjct  548   KPQPYA  553



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 370/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+PTT+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYYPTTALHRY  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P E+  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEEDHTILINDWYTKSHTALKNFLDSGRTLGLPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG  K  PLFT++P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVG-GKNEPLFTLKPGKTYKFRICNVGFKSTLNFRVQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E ST+ ++            E    
Sbjct  254   DSLDIHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTIGVMSYAGSK-----VEASAV  308

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  309   IPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNMVDGKIR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMA---EKIFKYNVIKDEPAAKITTLTVEPNVLNVTFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK + S+H++G+SFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIIFENHEKSMASFHLDGHSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 380/494 (77%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ S
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPN  598
             +  GKLRYAING+SH DP+TPLKL +Y+++ D     FK+D M D P    + K+ + PN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDK---VFKFDTMKDTPPATAADKITMEPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T R+FVEIIFEN EK  Q++H++GYSFF+V  EPG W+PEKR NYNL+DA++R+ +
Sbjct  419   VVNITIRDFVEIIFENPEKSPQTWHLDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTV  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T D+AGMWNVRSE  ER YLGQQFY  V +  RSLR+EYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVC  538

Query  237   GAVKGKPLPKPYTI  196
             G VK  P P P+++
Sbjct  539   GIVKDMPKPAPFSM  552



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 364/485 (75%), Gaps = 10/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LF W+GIQQRKNSW DG  GT CPILPGTNFTY +QVKDQIGSYFY+P+  + RA
Sbjct  77    LDEPFLFHWAGIQQRKNSWQDGVAGTNCPILPGTNFTYHYQVKDQIGSYFYYPSLGMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  P +++ V   DWY K + TL K+LD+G+ + RP  L++N
Sbjct  137   AGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWYTKSHSTLAKLLDSGRALGRPQALLVN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             G+N K G+    PLFTM P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQNVY
Sbjct  197   GQNAK-GDGTDKPLFTMLPGKTYKYRLCNVGLKNSINFRIQNHQMKLVEMEGSHTVQNVY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC  VLVTA++EAKDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  256   DSLDVHLGQCFGVLVTADQEAKDYYIVASTRFTKTVLTGKGIIRYANGKGPASPEIPEAP  315

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRTLK VN+ S + GKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTLKFVNSVSRDNGKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATFR  577
             YAINGVSH D DTPLKL +Y+ +       FK D +PDQP  D  S V LAPNV    +R
Sbjct  371   YAINGVSHVDGDTPLKLSDYYGIGSK---FFKNDTIPDQPAADLGSAVTLAPNVMKFEYR  427

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFENHEK +QSY++NGYSFFAV IEPG W+PEKRK YNL+D ++RH +QV+P  W
Sbjct  428   TFIEIIFENHEKSVQSYNLNGYSFFAVAIEPGTWTPEKRKGYNLLDGVSRHTVQVFPKSW  487

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DN GMWN+RSE+ E  YLGQQ Y SV +PE SLRDEYNIP+N +LCGAV G P
Sbjct  488   AAIMLTFDNVGMWNLRSEIAENRYLGQQLYISVPTPEGSLRDEYNIPENAVLCGAVVGLP  547

Query  216   LPKPY  202
              P PY
Sbjct  548   KPAPY  552



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/485 (61%), Positives = 378/485 (78%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+G+Q RKNSW DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +A
Sbjct  75    LDEPFLVTWNGVQHRKNSWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYIYYPVTAMHKA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + V+SR LIPVP+  PA+++ + V D++ KG+ +LKKILD+G+ + R DG+ +N
Sbjct  135   VGGFGGLRVNSRLLIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+ K  PLFTME  KTY+YR+CN G++TS+N RFQGH+M LVE+EGSHT+QN Y
Sbjct  195   GKVAK-GDRKDEPLFTMEAGKTYKYRICNTGIKTSLNVRFQGHTMKLVEMEGSHTMQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTAN+E +DYY+VA++RF ++E +   +IR  NG G  ++   PPP
Sbjct  254   DSLDVHVGQCFSVLVTANQEPRDYYVVASTRFTRREVTATGIIRYKNGKGAASSELPPPP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFR+FRWNLT++AARPNPQGSY YG I ITRT+KL NT  +  GKLR
Sbjct  314   V-----GWAWSLNQFRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQKVDGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVS+ +P TPLKL EY+ + D     FKYD +PD+P  D +KV LAP V N T RN
Sbjct  369   YALNGVSYVEPTTPLKLAEYYGVADK---VFKYDTIPDEPQSDNTKVTLAPIVLNMTHRN  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHE  IQSYH++GYSFFAVG++ GKWSPEKR NYNL+DA++RH IQV+PN W+
Sbjct  426   FVEIIFENHESAIQSYHLSGYSFFAVGMDVGKWSPEKRMNYNLLDAVSRHTIQVFPNSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DN GMWN+RSE+W+R YLGQQ Y SV+SP RSL+DEYN+P+  L CG V+G P 
Sbjct  486   AILLTFDNCGMWNLRSEIWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPR  545

Query  213   PKPYT  199
             P P++
Sbjct  546   PPPFS  550



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 365/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G  +      P
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLVGKGIVRYTNGKGPASPLLPSAP  311

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKLR
Sbjct  312   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADK---VFKYNIISDEPPTDLRAITIAPNVMQTTFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN  KV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  424   FIEIIFENPGKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  484   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  543

Query  213   PKP  205
             P P
Sbjct  544   PPP  546



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/486 (62%), Positives = 369/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLI  192

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQND  251

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N   +      
Sbjct  252   YDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYEGSNVQASAELPKA  311

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVN+KS   GK+
Sbjct  312   PI-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKV  366

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+  NGVSH D +TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR
Sbjct  367   RFGFNGVSHVDTETPLKLAEYFQMS---EKVFKYNVIKDEPAAKITALTVQPNVLNITFR  423

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFENHEK +QS+H++GYSFFAV  EPG+W+PEKRKNYNL+DA++RH +QVYP  W
Sbjct  424   TFVEIIFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSW  483

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A++ T DNAGMWN+RSE  ER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG P
Sbjct  484   SAILLTFDNAGMWNIRSENLERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLP  543

Query  216   LPKPYT  199
             LP  Y+
Sbjct  544   LPAHYS  549



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 372/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  74    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  134   SGGFGGLRVNSRLLIPVPYADPEDDHTILINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N  P+      P
Sbjct  253   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQPSNVLPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  368   FGLNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++GYSFF+V  EPG W+PEKR NYNL+DA++RH +QV+P  W+
Sbjct  425   FVEIVFENHEKSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  485   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  544

Query  213   PKPYTI  196
             P PYTI
Sbjct  545   PTPYTI  550



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 370/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GKVGE K   LFTM+P KTY+YR+CNVG ++S+NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKFGKVGE-KNEALFTMKPGKTYKYRICNVGFKSSLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   +      P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSNVEASAELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL N+K+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMA---EKVFKYNVIKDEPAAKITALTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++G+SFFAV  EPG+W+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIIFENHEKSMQSFHLDGHSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWNVRSE WER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNVRSENWERRYLGEQLYISVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PTPYTI  551



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 371/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVGE K   LFTM+P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGE-KNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N   +      P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSNVEASAELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL N+K+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF +    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMA---EKVFKYNVIKDEPAAKITALTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFENHEK +QS+H++GYSFFAV  EPG+W+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIIFENHEKSMQSFHLDGYSFFAVASEPGRWTPEKRSNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PAPYTI  551



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 366/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G  +    P P
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKGPASPVLPPAP  311

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKL 
Sbjct  312   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADK---VFKYNIISDEPPTDLKAITIAPNVMQTTFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN EKV+QSY++ GYSFFAV  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  424   FIEIIFENPEKVLQSYNLGGYSFFAVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  484   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  543

Query  213   PKP  205
             P P
Sbjct  544   PPP  546



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/485 (61%), Positives = 366/485 (75%), Gaps = 9/485 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             ELDEPLLFTW+G+QQRKN W DG PGT CPI PGTN+TY+FQVKDQIGSYFY+P+  + R
Sbjct  74    ELDEPLLFTWAGVQQRKNCWQDGVPGTNCPIAPGTNYTYRFQVKDQIGSYFYYPSLGMHR  133

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + ++SR LIPVP+  P +++ V + DW+ K + TL K+LD+G+ + RP  +++
Sbjct  134   AAGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWFTKSHSTLSKLLDSGRALGRPQAVLV  193

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG+N K G+    PLFTM+P KTY+YR+CNVGL+ S+NF  Q H M LVE EGSHTVQN 
Sbjct  194   NGQNAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFGIQNHPMKLVEFEGSHTVQNS  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC  VLVTA+KE KDYY+VA++RF K   +   ++R  NG G  +      
Sbjct  253   YDSLDVHVGQCFGVLVTADKEPKDYYMVASTRFTKTVITGKGIMRYANGKGPASPELPEA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+NT S EGGKL
Sbjct  313   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTVKLINTVSREGGKL  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSH D +TPLKL EY+ +    E  FKYD +PD P    + V LAPNV     R
Sbjct  368   RYALNGVSHVDTETPLKLAEYYNVA---EKVFKYDTIPDMPENLGTSVTLAPNVLKFKHR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EI+FENHEK +QSY+++GYSFFAV IEPG W+PEKRK YNL+DA++RH IQV+P  W
Sbjct  425   TFIEIVFENHEKSVQSYNLDGYSFFAVAIEPGLWTPEKRKTYNLLDAVSRHTIQVFPKSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M + DN G+WN+RSE+ E  YLGQQ Y SV +PERSLRDEYN+P+N LLCG VK  P
Sbjct  485   AAIMLSFDNVGVWNLRSEIAENRYLGQQLYISVPTPERSLRDEYNLPENSLLCGIVKDLP  544

Query  216   LPKPY  202
              P  Y
Sbjct  545   KPPSY  549



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/486 (61%), Positives = 372/486 (77%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW G+QQRKNSW DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LDEPFLITWVGVQQRKNSWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPVTAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + ++SR LIPVP+  P +++ V + DWY K +  LKK LD+G+ +ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC +VLVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFAVLVTADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKGPASPEVPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+N+ S+  GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQP-TGDTSKVILAPNVKNATFR  577
             YAING+SH DP+TPLKL +Y+ ++   E  FK+D M   P +    K+ + PNV N T +
Sbjct  369   YAINGISHVDPETPLKLADYYGIR---EKVFKFDTMKVDPQSTPAEKITMEPNVLNITIK  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             +FVEIIFEN EK +Q++H+NGY+FFAV +EPGKW+PEKRKNYNL+DA++RH IQV+P  W
Sbjct  426   DFVEIIFENPEKSLQTWHLNGYAFFAVAVEPGKWTPEKRKNYNLLDAVSRHTIQVFPKSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DNAGMWN+RSE  ER YLGQQ Y  V + +RSLR+EYN+PDN L+CG VKG P
Sbjct  486   AAILLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMP  545

Query  216   LPKPYT  199
              P PY+
Sbjct  546   KPPPYS  551



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/490 (62%), Positives = 371/490 (76%), Gaps = 44/490 (9%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L TW+GIQQRKNSW +GT GT CPILPG NFTY FQVKDQIGSY+Y+PTT+L R
Sbjct  72    QLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGSYYYYPTTALHR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYGPI++HSR LIPVPFD P EEF+VFVSDWY K +KTL+ ILD G++I RP+G+++
Sbjct  132   ATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIII  191

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKNGK G+ K  P+F+M   KTYRYR CNVG++ S+N RFQGH+M LVE+EGSHTVQN+
Sbjct  192   NGKNGK-GDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNM  250

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+H+GQCLSVLVTA++E KDY+LVA+SRF K+     A IR  N            
Sbjct  251   YESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTN------------  298

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                                     ASAARPNPQGSYHYG+I ITRT++LV+T  +  GK 
Sbjct  299   ------------------------ASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKR  334

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQ---PTGDTSKVILAPNVKNA  586
             RYAINGVSH DP TP+KL E + + D     FKYDL+ D+   P+G+  K+ LAPNV NA
Sbjct  335   RYAINGVSHVDPTTPIKLAELYGVADK---VFKYDLIKDEYIAPSGN-EKITLAPNVVNA  390

Query  585   TFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYP  406
             T+RNFVEII ENHEK +QS+H+ GY+FFAV IE G+W PE+R+NYNL+DA++R+ IQVYP
Sbjct  391   TYRNFVEIILENHEKSVQSWHLAGYNFFAVAIEAGRWKPERRQNYNLLDAVSRNTIQVYP  450

Query  405   NCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVK  226
             N WAA+MTTLDNAG+WN+RS   ER YLG Q YFSVLSP  SL+DEYN+PDN +LCG +K
Sbjct  451   NSWAAIMTTLDNAGLWNLRSNSLERQYLGHQLYFSVLSPSCSLKDEYNMPDNDILCGIIK  510

Query  225   GKPLPKPYTI  196
               PLPKPY+I
Sbjct  511   DLPLPKPYSI  520



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 373/486 (77%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVSGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P E+  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEEDNTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+GKVG +K  PLFTM P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVG-HKNEPLFTMNPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N  P+T     P
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSNVEPSTELPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNVVNGKVR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL+EYF   D     FKY+++ D+P    + + + PNV N TFR 
Sbjct  369   FGFNGVSHVDTETPLKLVEYFGFADK---VFKYNVIKDEPAAKITTLTVEPNVLNITFRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHEK +QS+H++G+SFFAV  EPG+W+PEKR NYNL+DA++RH +QVYP  W+
Sbjct  426   FVEIVFENHEKSMQSFHLDGHSFFAVASEPGRWTPEKRNNYNLLDAVSRHTVQVYPKSWS  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  486   AILLTFDNAGMWNIRSENWERRYLGEQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  545

Query  213   PKPYTI  196
             P PYTI
Sbjct  546   PAPYTI  551



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/494 (60%), Positives = 379/494 (77%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF     +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN+ S
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPN  598
             +  GKLRYAING+SH DP+TPLKL +Y+++ D     FK+D M D P    + K+ + PN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDK---VFKFDTMKDTPPATAADKITMEPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T R+FVEIIFEN E  +Q++H++GYSFF+V  EPG W+PEKR NYNL+DA++R+ +
Sbjct  419   VVNITIRDFVEIIFENPENSLQTWHLDGYSFFSVASEPGTWTPEKRSNYNLLDAVSRYTV  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T D+AGMWNVRSE  ER YLGQQFY  V +  RSLR+EYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDSAGMWNVRSEQPERRYLGQQFYVGVENIARSLRNEYNMPDNALVC  538

Query  237   GAVKGKPLPKPYTI  196
             G VK  P P P+++
Sbjct  539   GIVKDMPKPAPFSM  552



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 370/486 (76%), Gaps = 9/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLI  192

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQND  251

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N   +T     
Sbjct  252   YDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSNVQASTELPKA  311

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITR++KLVN+KS   GK+
Sbjct  312   PV-----GWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKV  366

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+  NGVSH D +TPLKL EYF++    E  FKY+++ D+P    + + + PNV N TFR
Sbjct  367   RFGFNGVSHVDTETPLKLAEYFQMS---EKVFKYNVIKDEPAAKITALTVQPNVLNITFR  423

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEIIFENHEK +QS+H++GYSFFAV  EPG+W+PEKR+NYNL+DA++RH +QVYP  W
Sbjct  424   TFVEIIFENHEKTMQSFHLDGYSFFAVASEPGRWTPEKRENYNLLDAVSRHTVQVYPKSW  483

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A++ T DNAGMWN+RSE  ER YLG+Q Y SVLSPE+SLRDEYNIP N  LCG VKG P
Sbjct  484   SAILLTFDNAGMWNIRSENLERKYLGEQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLP  543

Query  216   LPKPYT  199
             LP  Y+
Sbjct  544   LPAHYS  549



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 365/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  74    LDEPLLFTWHGVQQRKNSWQDGTLGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  134   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  194   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+KE KDYY+VA++R  K       +IR  NG G  +    P P
Sbjct  253   DSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRYTNGKGPASPMLPPAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+K VN+ S   GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH DP+TP+KL EY+ + D     FKY+++ D+P  D   + +APNV   TFR 
Sbjct  368   YAINGVSHVDPETPVKLAEYYGVADK---VFKYNIISDEPPIDLRAITIAPNVMQTTFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN  KV+QSY++ GYSFF V  EPG W+PEKRK YNL+DAI+RH IQV+P  WA
Sbjct  425   FIEIIFENPGKVLQSYNLGGYSFFVVAGEPGTWTPEKRKGYNLLDAISRHTIQVFPKSWA  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMW +RSE  E  YLGQQ Y SV S E+S RDEYN+P+ QL+CG VK  P 
Sbjct  485   AIMLTFDNAGMWQLRSEHAEHRYLGQQLYLSVESEEKSTRDEYNLPETQLVCGIVKDMPR  544

Query  213   PKP  205
             P P
Sbjct  545   PPP  547



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/487 (61%), Positives = 371/487 (76%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NG+SHTD +TPLKL EYF + D     FKY+ + D PT + +K I + P+V N T R
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADK---VFKYNSV-DNPTPEQTKSIKIEPHVLNITHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H+NGYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  426   NFIEVVFENHEKSVQSWHLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  486   AAILLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTP  545

Query  216   LPK-PYT  199
              P  PY 
Sbjct  546   KPANPYA  552



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/486 (62%), Positives = 365/486 (75%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+TI RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKNFLDSGRTIGRPDGILIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q   M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNLKMKLVEMEGSHVLQNDY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC  V++TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  256   DSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  310

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +   KLR
Sbjct  311   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSH D +TPLKL EYF + D     FKYD + D PT D  K I + PNV N T R
Sbjct  371   YALNGVSHIDTETPLKLAEYFGVTDK---VFKYDSISDNPTSDQIKNIKIEPNVLNITHR  427

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHE+ +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  428   NFIEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCW  487

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VK KP
Sbjct  488   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKP  547

Query  216   LPKPYT  199
                PY 
Sbjct  548   KINPYA  553



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/477 (62%), Positives = 365/477 (77%), Gaps = 10/477 (2%)
 Frame = -2

Query  1626  SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINV  1447
             +GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA G +G + V
Sbjct  19    NGIQHRKNSWQDGTAGTMCPIPPGKNFTYHFQPKDQIGSYFYYPTTAMHRAAGAFGGLRV  78

Query  1446  HSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGEN  1267
             +SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++NGK GK G+ 
Sbjct  79    NSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGK-GDG  137

Query  1266  KLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQ  1087
                PLFT++  KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN YDSLD+HVGQ
Sbjct  138   SDQPLFTLKQGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  197

Query  1086  CLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPVNTEGIA  907
             C  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G        P  P    G A
Sbjct  198   CFGVIVTANQEPKDYYMVASTRFLKKALATTGLLRYEGGKG-----LASPQLPAAPVGWA  252

Query  906   WSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRYAINGVSHT  727
             WS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLRYA++GVSHT
Sbjct  253   WSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHT  312

Query  726   DPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFRNFVEIIFEN  550
             DP+TPLKL EYF + D     FKYD++ D PT D  K I + PNV N T R F+E++FEN
Sbjct  313   DPETPLKLAEYFGVADK---VFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFEN  369

Query  549   HEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAAVMTTLDN  370
             HEK +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CWAA++ T DN
Sbjct  370   HEKSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDN  429

Query  369   AGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLPKPYT  199
              GMWN+RSE  ER YLGQQ Y SVLSPE+SLR EYN+P++ L CG VK KP   PY 
Sbjct  430   CGMWNIRSENSERRYLGQQLYASVLSPEKSLRGEYNMPESSLQCGLVKDKPKINPYA  486



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 370/487 (76%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPVGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P K++R R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSHRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT+SAARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NG+SHTD +TPLKL EYF + D     FKY+ + D PT + +K I + P+V N T R
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADK---VFKYNSV-DNPTAEQTKSIKIEPHVLNITHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H+NGYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  426   NFIEVVFENHEKSVQSWHLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  486   AAILLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTP  545

Query  216   LPK-PYT  199
              P  PY 
Sbjct  546   KPANPYA  552



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 373/485 (77%), Gaps = 10/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPL+FTW+GIQQRKNSW DGTPGTMCPI PG N+TY FQVKDQIGSYFY+P T++ RA
Sbjct  76    LDEPLMFTWNGIQQRKNSWQDGTPGTMCPIPPGKNYTYHFQVKDQIGSYFYYPITAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V + DWY K + +L+K LD G+++ RP+G+++N
Sbjct  136   GGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHNSLRKQLDMGRSLGRPEGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN + G+    PLFTM+P KTY++RVCNVGL+ S+NFR QGH+M LVE+EGSH VQN Y
Sbjct  196   GKNAR-GDGTDEPLFTMKPGKTYKFRVCNVGLKNSLNFRIQGHTMKLVEMEGSHVVQNTY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+H+GQC S LVTA+KE KDY++VA +RF K   + + LIR  NGNG        P 
Sbjct  255   ESLDVHLGQCFSALVTADKEPKDYWMVADTRFTKTMLTGLGLIRYTNGNG-----PANPE  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P+  EG+AWS+NQ RSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S+  GKLR
Sbjct  310   LPLPPEGLAWSLNQARSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNSASKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATFR  577
             YA+NGVSH D +TPLK  EYF + D     FKYD++ D P+ +  +K+ LAPNV N T+R
Sbjct  370   YAVNGVSHIDTETPLKYAEYFGVADK---VFKYDIIKDDPSPEAEAKITLAPNVVNQTYR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             +FVEIIFENH K IQS+H++GY+FF V IE G+W+PEKR+NYNL+DAI+RH +QVYP  W
Sbjct  427   DFVEIIFENHGKSIQSWHLDGYAFFPVAIEFGRWAPEKRRNYNLLDAISRHTVQVYPGSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DNAGMWN+RS   ER YLGQQ Y SV +  RSLRDEY + D   LCG VKG P
Sbjct  487   AAIMLTFDNAGMWNLRSAQAERAYLGQQLYLSVENVARSLRDEYMLLDTTPLCGVVKGLP  546

Query  216   LPKPY  202
              P PY
Sbjct  547   KPPPY  551



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 367/488 (75%), Gaps = 10/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP L TW+G+QQRKNSW DG  GT CP+ PG N+TY FQVKDQIGSYFY+P+T++ R
Sbjct  73    HLDEPFLITWNGVQQRKNSWQDGVLGTNCPVPPGKNYTYHFQVKDQIGSYFYYPSTAMHR  132

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + ++SR LIPVP+  P +++ V + DWY K +  LK  LD+G+ + RPDG+++
Sbjct  133   AAGGFGGLRINSRLLIPVPYADPKDDYTVMIGDWYTKSHTQLKSFLDSGRALGRPDGVLI  192

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+ K    K  PLFTM+P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQN 
Sbjct  193   NGKSNK-SRGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQDHPMKLVEMEGSHTVQNN  251

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+HVGQC  VLVTA+K+ KDY +VA++RF K   +T A++   NG G  +      
Sbjct  252   YESLDVHVGQCFGVLVTADKKPKDYLMVASTRFTKTVLTTTAVVSYTNGKGQASPEIPKA  311

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG I ITRT+KLVN+ S+   KL
Sbjct  312   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGHINITRTIKLVNSASKVNDKL  366

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDT-SKVILAPNVKNATF  580
             RYAINGVSH +P TPLKL EY+ + D     FKY+ + D P      KV + PNV N TF
Sbjct  367   RYAINGVSHEEPKTPLKLAEYYNVVDK---VFKYNAIQDDPPATVGDKVTVEPNVANITF  423

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R FVEII ENHE  IQS+H++GYSFFAV IEPG+W+P+KRKNYNL+DA++RH + V+P  
Sbjct  424   RTFVEIILENHENSIQSWHLDGYSFFAVAIEPGRWTPDKRKNYNLLDAVSRHTVPVFPKS  483

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             WAA+M T DNAG+WN+RSE+ ER YLGQQ Y SVLSPERSLRDEYNIPDN LLCG VK  
Sbjct  484   WAAIMLTFDNAGIWNLRSELLERRYLGQQMYLSVLSPERSLRDEYNIPDNALLCGIVKDM  543

Query  219   PLPKPYTI  196
             P P PY+I
Sbjct  544   PKPPPYSI  551



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 370/487 (76%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NG+SHTD +TPLKL EYF + D     FKY+ + D PT + +K I + P+V N T R
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADK---VFKYNSV-DNPTPEQTKSIKIEPHVLNITHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H+NGYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  426   NFIEVVFENHEKSVQSWHLNGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  486   AAILLTFDNCGMWNIRSENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTP  545

Query  216   LPK-PYT  199
              P  PY 
Sbjct  546   KPANPYA  552



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/487 (61%), Positives = 369/487 (76%), Gaps = 12/487 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITRT+KLVNT+ +  GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NG+SHTD +TPLKL EYF + D     FKY+ + D PT + +K I + P+V N T R
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADK---VFKYNSV-DNPTAEQTKSIKIEPHVLNITHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+E++FENHEK +QS+H+NGYSFFAV +EPG W+PEKRKNYNL+DA++RH +QVYP CW
Sbjct  426   NFIEVVFENHEKSVQSWHLNGYSFFAVAVEPGSWTPEKRKNYNLLDAVSRHTVQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+ SE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG VK  P
Sbjct  486   AAILLTFDNCGMWNIASENTERRYLGQQLYVSVLSPEKSLRDEYNMPETSLQCGLVKNTP  545

Query  216   LPK-PYT  199
              P  PY 
Sbjct  546   KPANPYA  552



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 366/485 (75%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L  WSGIQ RKN W DG P T CPI+PG NFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  74    LDEPFLLHWSGIQHRKNCWQDGLPATTCPIMPGQNFTYHFQPKDQIGSYFYYPSTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V +SDWY K + +LK +LD+G+ +  PDG+++N
Sbjct  134   SGGFGGLRVNSRLLIPVPYPDPEDDYTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K+ + K  PLFTM+  KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSAKM-DGKDQPLFTMKLGKTYKYRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ A DYY+VA+SRF K++ S   LIR   G G  +      P
Sbjct  253   DSLDVHVGQCFAVLVTADQTATDYYMVASSRFLKKQLSGTGLIRYEGGQGQASPVLPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN++     KLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQKVVDRKLR  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH D +TPLKL EYF++    E  FKY+++ D+P G  + + + PNV N TFR 
Sbjct  368   FGFNGVSHIDTETPLKLAEYFQMA---EKVFKYNVIKDEPAGKITGLTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVE+IFENHEK +QSYH++GYSFFAV  EPG+WSP KR+NYNL+DA++RH +QVYPN W+
Sbjct  425   FVEVIFENHEKSMQSYHLDGYSFFAVATEPGRWSPAKRENYNLLDAVSRHTVQVYPNSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VK  P 
Sbjct  485   AILLTFDNAGMWNIRSENWERRYLGQQLYVSVLSPEKSLRDEYNIPLNAGLCGIVKDLPK  544

Query  213   PKPYT  199
             P  Y+
Sbjct  545   PSIYS  549



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/485 (60%), Positives = 372/485 (77%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             L+EP L TW G+QQRKN W DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LEEPFLITWVGVQQRKNPWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPATAMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + ++SR LIPVP+  P +++ V + DWY K +  L+K LD+G+++ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGKGPVSPEVPKAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+N+ S+  GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAING+SH DP+TPLKL +Y+ ++   E  FK+D M   P     K+ + PNV N T ++
Sbjct  369   YAINGISHVDPETPLKLADYYGIR---EKVFKFDTMKVDPQSPAEKITMEPNVLNITIKD  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN EK +Q++H+NGY+FFAV +EPGKW+PEKRKNYNL+DA++RH IQV+P  WA
Sbjct  426   FVEIIFENPEKSLQTWHLNGYAFFAVAVEPGKWTPEKRKNYNLLDAMSRHTIQVFPKSWA  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE  ER YLGQQ Y  V + +RSLR+EYN+PDN L+CG VKG P 
Sbjct  486   AILLTFDNAGMWNLRSEQPERRYLGQQLYVGVENIKRSLRNEYNMPDNALVCGLVKGMPK  545

Query  213   PKPYT  199
             P PY+
Sbjct  546   PPPYS  550



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/494 (60%), Positives = 379/494 (77%), Gaps = 10/494 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW+GIQQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLVTWNGIQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGSYMYYP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
              T++ +A G +G + V+SR LIPVP+  P +++ V + DWY K +  LKK+LD+G+++AR
Sbjct  128   ITAMHKAGGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKLLDSGRSMAR  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ S+NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNSLNFRIQGHSMKLVELEGS  246

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKGPAS  306

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I I+RT+KLVN+ S
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINISRTIKLVNSAS  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTS-KVILAPN  598
             +  GKLRYAING+SH D +TPLKL +Y+++ D     FK D M D P    + K+ +  N
Sbjct  362   KVDGKLRYAINGISHVDSETPLKLADYYKVWDK---VFKPDTMKDTPPATAADKITMVTN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V N T ++FVEIIFEN EK +Q++H++GYSFF+V  EPG W+P KR NYNL+DA++R+++
Sbjct  419   VVNITIKDFVEIIFENPEKSLQTWHLDGYSFFSVASEPGTWTPAKRSNYNLLDAVSRYSV  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QV+P  WAA+M T DNAGMWN+RS+  ER YLGQQFY  V +  RSLR+EYN+PDN L+C
Sbjct  479   QVFPKSWAAIMLTFDNAGMWNIRSDQPERRYLGQQFYVDVENIARSLRNEYNMPDNALVC  538

Query  237   GAVKGKPLPKPYTI  196
             G VK  P P PY++
Sbjct  539   GIVKDMPKPAPYSM  552



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 365/493 (74%), Gaps = 9/493 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP LFTW+GIQQRKNSW DG PGT CPI PGTN+TY FQVKDQIGS+FYFP
Sbjct  67    VLNVFNNLDEPFLFTWNGIQQRKNSWQDGMPGTNCPIPPGTNYTYHFQVKDQIGSFFYFP  126

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +  + RA GG+G + ++SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  
Sbjct  127   SLGMHRAAGGFGGLRINSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAGILDAGRSIGN  186

Query  1314  PDGLVMNGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEG  1138
             P G++MNG +GK    K +P LFTME  KTYRYR+CNVGL+ S+NFR QGH M LVE++G
Sbjct  187   PAGVLMNGLSGKDATGKDDPPLFTMEAGKTYRYRICNVGLKLSLNFRIQGHLMKLVEMDG  246

Query  1137  SHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGp  958
             SHTVQN Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   ++R        
Sbjct  247   SHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVVRYAGSK---  303

Query  957   atpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTK  778
                   P  P    G AWS+NQ+RS RWNLTASAARPNPQGSYHYG I ITRT+KL ++ 
Sbjct  304   --VPPSPELPAGPVGWAWSLNQWRSLRWNLTASAARPNPQGSYHYGSINITRTIKLASSV  361

Query  777   SEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPN  598
                 GK R+ +NGVSH D  TPLKL EY+ + D     FKYD + D+P    + + +APN
Sbjct  362   GLVNGKRRFGLNGVSHVDSPTPLKLAEYYGISDK---VFKYDSIGDEPPASGASITVAPN  418

Query  597   VKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNI  418
             V NAT+R+++EII EN E+ IQ YH++GYSFFA G+  GKW+P  R+ YNL+DA++RH I
Sbjct  419   VLNATYRDYIEIILENPERSIQCYHLDGYSFFAAGMGHGKWTPASRRTYNLLDAVSRHTI  478

Query  417   QVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLC  238
             QVYP  W+A+M T DNAGMW++RSE+WER YLGQQ Y SV+SP RSLRDEYN+PDN LLC
Sbjct  479   QVYPRSWSAIMLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNMPDNTLLC  538

Query  237   GAVKGKPLPKPYT  199
             G V G P P  Y 
Sbjct  539   GDVVGLPKPPSYV  551



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/485 (61%), Positives = 362/485 (75%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+GIQQRKNSW DG  GT CPI  G+NFTY FQVKDQIGSYFY+P+  + RA
Sbjct  75    LDEPFLFTWAGIQQRKNSWQDGVAGTNCPIPVGSNFTYHFQVKDQIGSYFYYPSLGMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  L K+LD+G+++ RP  +++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             G+  K G+    PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE EGSHTVQN Y
Sbjct  195   GQVAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+H+GQC  VLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHLGQCFGVLVTADKDPKDYYMVASTRFTKSIVTGKGIIRYTNGKGPASPELPEAP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSF WNLTASAARPNPQGSYHYG+I ITRT+KL+N+ S +  KLR
Sbjct  314   V-----GWAWSLNQFRSFHWNLTASAARPNPQGSYHYGQINITRTVKLINSVSRDNSKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NG+SH DP+TPLKL EYF +    E  FKYD +PD P    S V L PNV N   R 
Sbjct  369   YALNGISHVDPETPLKLAEYFGIA---EKVFKYDSIPDMPQSVPSSVTLQPNVLNFKHRT  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFENHEK +QS+++NGYSFF V IEPG W+PEKRK YNL+DA++RH +QV+P  WA
Sbjct  426   FIEIIFENHEKSVQSFNLNGYSFFKVAIEPGTWTPEKRKCYNLLDAVSRHTVQVFPKSWA  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DN G+WN+RSE+ E  YLGQQ Y SV++PERSLRDEYNIP+N LLCG VKG P 
Sbjct  486   AIMLTFDNVGVWNLRSELAENRYLGQQLYISVITPERSLRDEYNIPENSLLCGLVKGLPK  545

Query  213   PKPYT  199
             P  Y 
Sbjct  546   PPSYV  550



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/481 (63%), Positives = 360/481 (75%), Gaps = 13/481 (3%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLFTWSGIQQRKNSW DGT G  CPI PGTN+TYKFQVKDQIGSYFY+PTT L RA
Sbjct  73    LDEPLLFTWSGIQQRKNSWADGTSGVQCPIAPGTNYTYKFQVKDQIGSYFYYPTTGLMRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G I V+SR LIPVP+  PA+E+ V + DWY K +  L+K LD+G+++ RPDG+ + 
Sbjct  133   AGGIGGIRVYSRLLIPVPYADPADEYWVLMGDWYGKSHTQLQKFLDSGRSMGRPDGVHIM  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+     N   PL+ MEP KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQNVY
Sbjct  193   GKS-----NSAEPLYKMEPGKTYKYRLCNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNVY  247

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC SVLVTA+KE K Y +VA++RF K   +T A+I   NGNG  +    P P
Sbjct  248   DSLDVHVGQCFSVLVTADKEPKQYKMVASTRFTKTVLTTTAVISYTNGNGPASPVLPPAP  307

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN      GKLR
Sbjct  308   V-----GWAWSLNQVRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNNPFNIDGKLR  362

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             Y +NGVSH D +TPLKL EY+ + +     F+YDL  D P      + +  NV N TFR 
Sbjct  363   YTLNGVSHEDDETPLKLAEYYGVANK---VFQYDLTSDNPPAVIGNLRVEANVLNVTFRT  419

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEIIFEN  KVIQSY+++GYSFFAV +EPGKW+PEKRKNYNL+DA++RH +QV+P  WA
Sbjct  420   FVEIIFENPTKVIQSYNLDGYSFFAVAVEPGKWTPEKRKNYNLLDAVSRHTVQVFPKSWA  479

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A+M T DNAGMWN+RSEM E  YLGQQ Y SVLSPE+S RDEYN+PD   +CG VK  P 
Sbjct  480   AIMLTFDNAGMWNLRSEMAENRYLGQQMYMSVLSPEKSNRDEYNLPDTHQVCGIVKDMPR  539

Query  213   P  211
             P
Sbjct  540   P  540



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/485 (59%), Positives = 370/485 (76%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L  WSGIQ RKN W DG PGT CPI+PG NFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  74    LDEPFLLHWSGIQHRKNCWQDGLPGTTCPIMPGQNFTYHFQPKDQIGSYFYYPSTSLHRF  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +++ V ++DWY K + ++K +LD+G+ +  PDG+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTSIKNLLDSGRALGSPDGVLIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK+ K+ + K  PLFTM+P KTY++R+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSAKM-DGKDQPLFTMKPGKTYKFRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++ AKDYY+VA++RF K+E ++  ++R   G+   +T     P
Sbjct  253   DSLDVHVGQCFAVLVTADQAAKDYYMVASTRFLKKEMTSTGVLRYVGGSAQASTVLPKAP  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVN++    GKL+
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQQVVNGKLK  367

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYF++    E  FKY+++ D+P     ++ + PNV N TFR 
Sbjct  368   FGLNGVSHIDTETPLKLAEYFQMA---EKVFKYNVIKDEPGAMIKQLTVEPNVLNITFRT  424

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVE+IFEN EK +QSYH++GYSFFAV  EPG+W+P KR+NYNL+DA++RH +QVYP  W+
Sbjct  425   FVEVIFENREKSMQSYHLDGYSFFAVATEPGRWTPAKRENYNLLDAVSRHTVQVYPKSWS  484

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG   
Sbjct  485   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNAGLCGIVKGLSK  544

Query  213   PKPYT  199
             P  Y+
Sbjct  545   PIIYS  549



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/485 (61%), Positives = 359/485 (74%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+GIQQRKNSW DG  GT CPI PGTN+TY FQVKDQIGS+FYFP+  + RA
Sbjct  73    LDEPFLFTWNGIQQRKNSWQDGMLGTNCPIPPGTNYTYHFQVKDQIGSFFYFPSVGMHRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  P G++MN
Sbjct  133   AGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKALAGILDAGRSIGNPTGILMN  192

Query  1293  GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G  GK    K + PLF ME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN 
Sbjct  193   GSPGKNAAGKDDAPLFAMEAGKTYRYRICNVGLKVSLNFRIQNHLMKLVEMDGSHTVQND  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   ++R    N          
Sbjct  253   YESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMLTATGIVRYAGSN-----VPPSS  307

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT+KL ++     GK 
Sbjct  308   ELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKR  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+A+NGVSH + +TPLKL EY+ + D     FKYD + D+P   ++ +  APNV NATFR
Sbjct  368   RFALNGVSHVETETPLKLAEYYGIADK---VFKYDSISDEPPAASATITAAPNVLNATFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             +++EII EN E+ IQS+H++GYSFFAVG+  GKW+P  RK YNL+DA++RH IQVYP  W
Sbjct  425   DYIEIILENPERSIQSFHLDGYSFFAVGMGHGKWTPASRKTYNLLDAVSRHTIQVYPRSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A+M T DNAGMW++RSE+WER YLGQQ Y SVLSP RSLRDEY+IPDN LLCG V   P
Sbjct  485   SAIMLTFDNAGMWSLRSELWERHYLGQQLYISVLSPARSLRDEYSIPDNTLLCGDVTTLP  544

Query  216   LPKPY  202
              P PY
Sbjct  545   KPPPY  549



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/487 (60%), Positives = 365/487 (75%), Gaps = 10/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             ++D+P LFTW GIQQRKNSW DG PGT CPI+PGTNFTYK Q KDQIG++FYFP+  +QR
Sbjct  80    QIDKPFLFTWHGIQQRKNSWQDGMPGTQCPIMPGTNFTYKMQSKDQIGTFFYFPSIGMQR  139

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG ++VHSR LIPVPFD PA++F+V V DWY K +  L+K +D G++I RP GL++
Sbjct  140   AAGGYGLMSVHSRPLIPVPFDPPADDFSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLI  199

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++ +E  KTYR+RVCNVG+++S+N R QGH + LVE+EGSHTVQN 
Sbjct  200   NGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNE  257

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQCLS LVTAN++  DY LVA++RF K+  +  A+IR     G         
Sbjct  258   YDSLDVHVGQCLSFLVTANQKPGDYLLVASTRFIKEVSTITAIIRY---KGSSVPASPKL  314

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
             P   N  G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  ++++  GK 
Sbjct  315   PEAPN--GWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRAKVDGKE  372

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSH DPDTP KL EYF   +     F+Y+L+ D P  + + + +APN+  A FR
Sbjct  373   RYALNGVSHVDPDTPPKLAEYF---NATTGVFEYNLIGDTPPKEGTPIKVAPNILTAEFR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FEN EK I S+H+NGY+FFA G+ PG W+P+ RK YNL+D ++RH IQVYP  W
Sbjct  430   TFIEVVFENPEKSIDSFHLNGYAFFAAGMGPGLWTPDCRKTYNLLDTVSRHTIQVYPRSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A+M T DNAGMWN+R+ +WER+Y+G+Q Y SV SP RSLRDEYN+PDN L CG V G P
Sbjct  490   TAIMLTFDNAGMWNLRTNIWERYYMGEQLYMSVTSPARSLRDEYNMPDNGLRCGKVVGMP  549

Query  216   LPKPYTI  196
             LP PY I
Sbjct  550   LPPPYII  556



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/476 (62%), Positives = 369/476 (78%), Gaps = 9/476 (2%)
 Frame = -2

Query  1626  SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINV  1447
             +GIQ RKNSW DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +AVGG+G + V
Sbjct  8     NGIQHRKNSWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYIYYPVTAMHKAVGGFGGLRV  67

Query  1446  HSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGEN  1267
             +SR LIPVP+  PA+++ + V D++ KG+ +LKKILD+G+ + R DG+ +NGK  K G+ 
Sbjct  68    NSRLLIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAK-GDG  126

Query  1266  KLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQ  1087
             K  PLFTME  KTY+YR+CN G +TS+N RFQGH+M LVE+EGSHT+QN YDSLD+HVGQ
Sbjct  127   KDEPLFTMEAGKTYKYRICNTGTKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQ  186

Query  1086  CLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPVNTEGIA  907
             C SVLVTAN+E +DYY+VA++RF K+E +   +IR  NG G  ++   PPP      G A
Sbjct  187   CFSVLVTANQEPRDYYVVASTRFTKREVTATGIIRYKNGKGAASSELPPPPV-----GWA  241

Query  906   WSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRYAINGVSHT  727
             WS+NQFR+FRWNLT++AARPNPQGSY YG I ITRT+KL NT     GKLRYA+NGVS+ 
Sbjct  242   WSLNQFRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQIVDGKLRYALNGVSYV  301

Query  726   DPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRNFVEIIFENH  547
             +P TPLKL EY+ + D     FKYD +PD+P  D +KV LAP V N T RNFVEIIFENH
Sbjct  302   EPTTPLKLAEYYGVADK---VFKYDTIPDEPPSDNTKVTLAPIVLNMTHRNFVEIIFENH  358

Query  546   EKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAAVMTTLDNA  367
             E  IQSYH++GYSFFAVG++ GKWSPEKR NYNL+DA++RH IQV+PN W+A++ T DN 
Sbjct  359   ETAIQSYHLSGYSFFAVGMDIGKWSPEKRMNYNLLDAVSRHTIQVFPNSWSAILLTFDNC  418

Query  366   GMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLPKPYT  199
             GMWN+RSE+W+R YLGQQ Y SV+SP RSL+DEYN+P+  L CG V+G P P P++
Sbjct  419   GMWNLRSEIWDRHYLGQQLYASVISPNRSLKDEYNLPEGVLTCGIVQGMPRPPPFS  474



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 362/486 (74%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LF+W+GIQQRKNSW DG PGT CPI PG NFTY FQVKDQIGS++YFP+ ++ +A
Sbjct  75    LDEPFLFSWNGIQQRKNSWQDGVPGTNCPIQPGKNFTYHFQVKDQIGSFYYFPSLAMHKA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + ++SR LIPVPFD PA+++ V V DWY K +K L K LD G++I  P G+++N
Sbjct  135   VGGFGGLRINSRLLIPVPFDPPADDYTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLIN  194

Query  1293  GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK G  K + PLF ME  K YRYR+CN G++ S+NFR QGH+M LVE++GSHT+QN+
Sbjct  195   GKSGKHGSGKDDKPLFVMEAGKVYRYRICNTGIKASINFRIQGHTMELVEMDGSHTMQNM  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC SVLVTA++  KDYYLVA++RF ++E +  A++R    N          
Sbjct  255   YDSLDIHVGQCFSVLVTADRAPKDYYLVASTRFLRKEITATAVVRYAGSN-----TPPSA  309

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G  WS+NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT+KL +++  +GGK+
Sbjct  310   VLPKGPTGWGWSLNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLSSSRVVDGGKI  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ +NG+SH D DTPLK  EYF + D     FKY+L+ D P    +   LAPNV    FR
Sbjct  370   RFTLNGLSHVDTDTPLKHGEYFGVGDK---FFKYNLIGDVPPASKAPFTLAPNVITIEFR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              +VEII EN E+ +QSYH++GYSFF VG+ PGKW+P  RK YNL+DA++RH IQVYP  W
Sbjct  427   TYVEIILENPERNLQSYHLDGYSFFPVGMGPGKWTPASRKGYNLLDAVSRHTIQVYPRSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A+M T DNAGMWN+RSE+WER Y GQQ Y SV SP RSLRDEY++PD  LLCGAV   P
Sbjct  487   SAIMLTFDNAGMWNLRSELWERRYQGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLP  546

Query  216   LPKPYT  199
              P PYT
Sbjct  547   KPPPYT  552



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/491 (59%), Positives = 364/491 (74%), Gaps = 10/491 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +VNVFN+LD+PLLFTW+GIQ RKNSW DG PGT CP+ PGTN+TY +Q KDQIG++FYFP
Sbjct  77    MVNVFNQLDQPLLFTWNGIQHRKNSWQDGVPGTNCPVAPGTNYTYHWQPKDQIGTFFYFP  136

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +  +QRAVGG+G I+V SR LIPVPFD PA++  V + DW+ K +  +  +LD G++  R
Sbjct  137   SIGMQRAVGGFGLISVVSRLLIPVPFDPPADDLQVVIGDWFTKDHAVMASLLDAGRSFGR  196

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NGK GK   N   P+FT E +KTYR R+CNVG+++S+NFR QGH M LVEI+GS
Sbjct  197   PAGVLINGKGGKEATNP--PMFTWEAAKTYRLRICNVGIKSSLNFRIQGHDMKLVEIDGS  254

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+Q+ YDSLD+HVGQCLSVLV A+++  DY +VA++RF     S  A++R    N    
Sbjct  255   HTLQDSYDSLDVHVGQCLSVLVDADQKPADYLMVASTRFMADASSVSAVVRYAGSN----  310

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P  P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+ T+ 
Sbjct  311   -TPPAPNVPEPPAGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRG  369

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GKL+Y  NGVSH D DTPLKL EYF + D     FKY+ M D P      + +APNV
Sbjct  370   HIDGKLKYGFNGVSHVDADTPLKLAEYFNISDQ---VFKYNQMADTPPAVNGPMHVAPNV  426

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR F+E++FEN EK + S HI+GY+FFAVG+ PGKW+P++RK YNL+DA++RH IQ
Sbjct  427   ITAEFRTFIEVVFENPEKSMDSVHIDGYAFFAVGMGPGKWTPDQRKTYNLLDAVSRHTIQ  486

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W+AVM T DNAGMWNVRS +WER YLG+Q Y SV+SP RSLRDEYN+P+N L CG
Sbjct  487   VYPRSWSAVMLTFDNAGMWNVRSNLWERHYLGEQLYMSVVSPARSLRDEYNMPENALRCG  546

Query  234   AVKGKPLPKPY  202
              V G PLP  Y
Sbjct  547   KVVGLPLPPSY  557



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 360/486 (74%), Gaps = 9/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP LFTW+GIQQRKNSWVDGT GT CPI PG NFTY FQVKDQIGS+ YFP   + R
Sbjct  161   HLDEPFLFTWNGIQQRKNSWVDGTAGTNCPIPPGQNFTYHFQVKDQIGSFVYFPALDMHR  220

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + V+SR LIPVPF  PA+++ V V DWY K +K L ++LD G+TI RP G+++
Sbjct  221   AAGGFGGLRVNSRLLIPVPFADPADDYTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILI  280

Query  1296  NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NG+ GK    K +P LFTM+  KTYRYRVCNVG++ S+NFR Q H+M LVE++GSHTVQN
Sbjct  281   NGRPGKDSTGKDDPPLFTMKSGKTYRYRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQN  340

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             VYDSLD+HVGQCLSVLVTA++E +DYY+VA+SRF K   S   +IR    N         
Sbjct  341   VYDSLDVHVGQCLSVLVTAHQEHRDYYMVASSRFTKYALSATGVIRYAGSN-----TPPS  395

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             P  P    G AWS NQ+RSFR NLTASAARPNPQGSYHYG I ITRT+KLVN+     GK
Sbjct  396   PDLPAAPSGWAWSFNQWRSFRLNLTASAARPNPQGSYHYGSINITRTIKLVNSVGLVDGK  455

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              RYA+N VSH+D  TPLKL EY+ + D     FKYD + D+P    + + + PNV NAT+
Sbjct  456   RRYALNAVSHSDAATPLKLAEYYGIADK---VFKYDTIADEPAASDAPIKIVPNVVNATY  512

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+EI+FEN ++ +Q+YH++GYSFFA G+  GKW+PE RK YNL DA++RH IQVY   
Sbjct  513   RTFIEIVFENPDRSMQAYHLDGYSFFAAGMGHGKWTPESRKRYNLADAVSRHTIQVYQRS  572

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+A++ T DNAGMWN+RSE+WER YLGQQ Y SV+SPERSLRDE N+PDN LLCGAV   
Sbjct  573   WSAILLTFDNAGMWNLRSELWERRYLGQQLYISVVSPERSLRDESNMPDNALLCGAVAKL  632

Query  219   PLPKPY  202
             P P  Y
Sbjct  633   PRPPSY  638



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/487 (59%), Positives = 366/487 (75%), Gaps = 9/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP+LF+W+GIQ RKNSW+DGTPGT CPI+PGTN+TY FQ KDQIGSYFYFP+  +Q+
Sbjct  72    KLDEPILFSWNGIQHRKNSWMDGTPGTNCPIMPGTNWTYHFQPKDQIGSYFYFPSIGMQK  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G + VHSR LIPVP+  PAEEFNV   DWY K +K L ++LD+G+ + RP G+++
Sbjct  132   AAGGIGMLRVHSRLLIPVPYADPAEEFNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLI  191

Query  1296  NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NGK+GK    K  P +FTME  KTYRYRVCNVG++TS++FR Q H++ LVE+EGSHT+QN
Sbjct  192   NGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQN  251

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             VYDSLD+H+GQC SV VTA+++  DYY+V ++RF K      A+IR    N         
Sbjct  252   VYDSLDIHIGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----TPPS  306

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             P  P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT++L  +     GK
Sbjct  307   PDLPPAPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGK  366

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              RYA+NGVSH +P TPLKL EY+ +    E  FKY+++ D+P  D S ++++PNV N TF
Sbjct  367   RRYALNGVSHENPATPLKLSEYYGIA---EKEFKYNIIGDEPPADKSTIVISPNVVNCTF  423

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+EII EN E+ I +YH++GYSFF VG+  G+W+PE+R+ YNL+DA++RH +QVYP  
Sbjct  424   RTFIEIILENPERSIHAYHLDGYSFFPVGMGHGEWTPERRRTYNLLDAVSRHTVQVYPKS  483

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+AVM T DNAGMWN+R+ +W++ YLGQQ Y SV+SP RSLRDEYNIP+N LLCG V   
Sbjct  484   WSAVMLTFDNAGMWNLRTLIWDKQYLGQQLYISVVSPARSLRDEYNIPENTLLCGNVVNL  543

Query  219   PLPKPYT  199
             P P PYT
Sbjct  544   PKPPPYT  550



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 359/486 (74%), Gaps = 9/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP LFTW+GIQ RKNSW DG PGT CPI  GTN+TY FQVKDQIGSYFYFP+  + R
Sbjct  72    HLDEPFLFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L ++LD G++I  P G+++
Sbjct  132   AAGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVII  191

Query  1296  NGKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NG  GK    K + PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN
Sbjct  192   NGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQN  251

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
              Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K   +   +IR    +         
Sbjct  252   DYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPS  306

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             P  P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT+KL ++     GK
Sbjct  307   PELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGK  366

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              R+A+NG SH +  TPLKL EY+ + D     FKYD + D+P   ++ + +APNV NATF
Sbjct  367   RRFALNGASHVESPTPLKLAEYYGVADK---VFKYDTIGDEPPESSATITVAPNVLNATF  423

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R+++EII EN E+ IQSYH++GYSFFAVG+  GKW+P  R++YNL+DA++RH IQVYP  
Sbjct  424   RDYIEIILENPERSIQSYHLDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRS  483

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+A+M T DNAGMW++RSE+WER YLGQQ Y SV+SP RSLRDEYNIPDN LLCG V   
Sbjct  484   WSAIMLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASL  543

Query  219   PLPKPY  202
             P P PY
Sbjct  544   PKPPPY  549



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/485 (61%), Positives = 356/485 (73%), Gaps = 10/485 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD+PLLFTW GIQQRKNSW DG PGTMCPI PGTNFTY +Q KDQIGS+FYFP+  +QR
Sbjct  78    QLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPGTNFTYHWQPKDQIGSFFYFPSIGMQR  137

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K L+ G++I RP GLV+
Sbjct  138   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVI  197

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++TME  K YRYRVCNVG++TS+N R Q H + LVE+EGSHTVQN 
Sbjct  198   NGKNEKDASNP--PMYTMEAGKVYRYRVCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNT  255

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HV QC+S LV A+++  DY LVA++RF K+  S  A+IR    N         P
Sbjct  256   YDSLDVHVAQCVSFLVAADQKPGDYLLVASTRFMKETSSITAIIRYNGSN-----TPASP  310

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT++L   +++ GGK 
Sbjct  311   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLSAGRAKVGGKE  370

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+AINGVSH D +TPLKL EYF   +     F+Y+L+ D P    + V LAPNV    FR
Sbjct  371   RFAINGVSHVDAETPLKLAEYF---NATAGVFEYNLIGDVPPAAGAAVKLAPNVIQTEFR  427

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FEN EK I S+HINGY+FFA G+ PG W+P+ RK YNL+D ++RH IQVYP  W
Sbjct  428   TFIEVVFENPEKSIDSFHINGYAFFAAGMGPGTWTPDCRKTYNLLDTVSRHTIQVYPRSW  487

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              AVM T DNAGMWN+RS MWERFYLG+Q Y SV+SP RSLRDEYN+P+N L CG V G P
Sbjct  488   TAVMLTFDNAGMWNIRSNMWERFYLGEQLYVSVISPARSLRDEYNMPENGLRCGKVVGMP  547

Query  216   LPKPY  202
             +P  Y
Sbjct  548   MPPSY  552



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/487 (60%), Positives = 359/487 (74%), Gaps = 9/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
              LDEP LFTW+GIQ RKNSW DG PGT CPI  GTN+TY FQVKDQIGSYFYFP+  + R
Sbjct  78    HLDEPFLFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHR  137

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L ++LD G++I  P G+++
Sbjct  138   AAGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVII  197

Query  1296  NGKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NG  GK    K + PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN
Sbjct  198   NGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQN  257

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
              Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K   +   +IR    +         
Sbjct  258   DYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPS  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             P  P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT+KL ++     GK
Sbjct  313   PELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGK  372

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              R+A+NG SH +  TPLKL EY+ + D     FKYD + D+P   ++ + +APNV NATF
Sbjct  373   RRFALNGASHVESPTPLKLAEYYGVADK---VFKYDTIGDEPPESSATITVAPNVLNATF  429

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R+++EII EN E+ IQSYH++GYSFFAVG+  GKW+P  R++YNL+DA++RH IQVYP  
Sbjct  430   RDYIEIILENPERSIQSYHLDGYSFFAVGMGHGKWTPASRRSYNLLDAVSRHTIQVYPRS  489

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+A+M T DNAGMW++RSE+WER YLGQQ Y SV+SP RSLRDEYNIPDN LLCG V   
Sbjct  490   WSAIMLTFDNAGMWSLRSELWERHYLGQQLYISVVSPARSLRDEYNIPDNTLLCGVVASL  549

Query  219   PLPKPYT  199
             P P PY 
Sbjct  550   PKPPPYV  556



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/485 (60%), Positives = 366/485 (75%), Gaps = 10/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPLLF W+G+QQRKNSW DG  GT CPI PGTN+TY FQVKDQIGS+FY+P+  LQRA
Sbjct  76    LDEPLLFHWAGVQQRKNSWEDGVAGTNCPIQPGTNYTYHFQVKDQIGSFFYYPSLGLQRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  P +++ V   DW+ K + TL+K+LD G+++ RP  +++N
Sbjct  136   AGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWFTKSHSTLRKLLDGGRSLGRPQAVLLN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             G+N K G+    PLFTM P KTY+YR+CNVGL+ ++NFR Q H M LVE+EGSHTVQN Y
Sbjct  196   GQNAK-GDGTDKPLFTMIPGKTYKYRICNVGLKNTINFRIQNHPMKLVEMEGSHTVQNTY  254

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+H+GQC  VLVTAN+E KDYY+VA++RF K   +   ++R   G   P+      P
Sbjct  255   NSLDVHLGQCFGVLVTANQEPKDYYMVASTRFTKSILTGKGIMRYTTGKAPPSPEIPEAP  314

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG++ ITRT+K +N+ S + GKLR
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQVNITRTVKFINSVSRDSGKLR  369

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSK-VILAPNVKNATFR  577
             YAINGVSH D +TP+KL EYF +    E  FKYD++ D P+ D  K V+L PNV     R
Sbjct  370   YAINGVSHVDGETPIKLAEYFGVP---EKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFEN EK +QSYH+NGY+FFAV IEPG W+PEKRKNYNL+DA++RH + V+P  W
Sbjct  427   TFIEIIFENPEKSVQSYHLNGYAFFAVAIEPGTWTPEKRKNYNLLDAVSRHTMPVFPKSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ + DN G+WN+RSE+ E  YLGQQ Y SVL+PERSLRDEYNIP+  LLCG VKG P
Sbjct  487   AAILLSFDNVGVWNLRSELAENRYLGQQLYISVLTPERSLRDEYNIPEYALLCGVVKGLP  546

Query  216   LPKPY  202
              P+PY
Sbjct  547   KPEPY  551



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 366/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKN W DG  GT CPI PGTN+TYKFQVKDQIGSY Y+P T + +A
Sbjct  75    LDEPFLLTWSGVQHRKNPWQDGVLGTNCPIPPGTNYTYKFQVKDQIGSYMYYPVTGMHKA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
             VGG+G + ++SR LIPVP+  PA+++ +   D++ KG+ TLKKIL++G+ + R DG+ +N
Sbjct  135   VGGFGGLRINSRLLIPVPYADPADDYTIIAGDFFNKGHTTLKKILESGRNLGRCDGVHIN  194

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+    PLFTME  KTY+YR+CN GL+TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  195   GKVAK-GDGSDEPLFTMEAGKTYKYRICNAGLKTSLNVRFQGHNMKLVEMEGSHTVQNDY  253

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC SVLVTA++E  DY++VA++RF KQE +   +IR  NG G P+    PPP
Sbjct  254   ESLDVHVGQCFSVLVTADQEPMDYFVVASTRFTKQEVTATGVIRYTNGKGAPSPKLPPPP  313

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFR+FRWNLTASAARPNPQGSY YG + ITRT+KL NT  +  GKLR
Sbjct  314   V-----GWAWSLNQFRTFRWNLTASAARPNPQGSYKYGSVNITRTIKLANTAQKVDGKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAING S+ +P TPLKL EY+ + D     FKYD +PD P  + +K+ + P V N T RN
Sbjct  369   YAINGASYVEPTTPLKLAEYYGVADK---VFKYDTIPDDPPAEITKITMEPVVLNLTHRN  425

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN E  IQSYH+ GY+FFAV +E G+WSPEKRKNYNL+DA++RH IQV+P  WA
Sbjct  426   FMEIIFENRETAIQSYHLCGYAFFAVAVETGQWSPEKRKNYNLLDAVSRHTIQVFPKSWA  485

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ + DN GMWN+RSE+W+R YLGQQ Y SVLSP +SLRDEYN+P+  L+CG V+  P 
Sbjct  486   AILLSFDNCGMWNIRSEIWDRRYLGQQLYVSVLSPNKSLRDEYNMPEGALVCGVVENMPR  545

Query  213   PKP  205
             P P
Sbjct  546   PPP  548



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 357/486 (73%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+P L +W+GIQQRKNSW DG  GT CPI PG NFTY FQVKDQIGS+FYFP+  + +A
Sbjct  73    LDQPFLLSWNGIQQRKNSWQDGLAGTNCPIQPGKNFTYHFQVKDQIGSFFYFPSLGMHKA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  PDG+++N
Sbjct  133   AGGFGGLRINSRLLIPVPFDPPADDYTVLIGDWYAKDHKALAGILDAGRSIGLPDGVIIN  192

Query  1293  GKNGKVGENK-LNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK GK    K   PLF ME  K YRYR+CN G+R S+NFR QGHSM LVEI+GSHT+QN+
Sbjct  193   GKTGKDRTGKDGKPLFVMESGKVYRYRICNTGIRASLNFRIQGHSMELVEIDGSHTMQNL  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC SVLVTAN+   DYYLVA++RF K+E +   ++R      G   P    
Sbjct  253   YDSLDVHVGQCYSVLVTANQAPGDYYLVASTRFMKKELTATGIVRYA----GSKVPPSAV  308

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
              P   T G AWS NQ+RSFRWNLTASAARPNPQGS+HYG I ITRT+K  N+++  GGK 
Sbjct  309   LPKAPT-GWAWSFNQWRSFRWNLTASAARPNPQGSFHYGSINITRTIKFANSRAVVGGKS  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+A+NGVSH D DTPLK +EYF + D     FKY+L  D+P   +  V LAPNV    FR
Sbjct  368   RFALNGVSHVDVDTPLKHLEYFGVADK---FFKYNLTGDEPREGSGPVNLAPNVITVEFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVE+IFEN EK  Q YH++GYSFFAVG+ PGKW PE RK YNL+DA++RH IQVYP  W
Sbjct  425   TFVEVIFENPEKGPQFYHLDGYSFFAVGMGPGKWKPESRKRYNLLDAVSRHAIQVYPKSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A+M T DNAGMWN+RSE+WER YLGQQ Y SV SP RSLRDEY++PD  LLCGAV   P
Sbjct  485   TAIMLTFDNAGMWNLRSELWERRYLGQQLYISVQSPARSLRDEYSLPDTVLLCGAVASLP  544

Query  216   LPKPYT  199
              P PYT
Sbjct  545   KPPPYT  550



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/483 (60%), Positives = 365/483 (76%), Gaps = 9/483 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKN W DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +A
Sbjct  59    LDEPFLLTWSGVQHRKNPWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYMYYPVTAMHKA  118

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + ++SR LIPVP+  PA+++ +   D++ KGY +LKK+L +G+ + R DG+ +N
Sbjct  119   AGGFGGLRINSRLLIPVPYADPADDYTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHIN  178

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+    PLFTME  KTY+YR+CN G++TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  179   GKVAK-GDGNDEPLFTMEAGKTYKYRICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDY  237

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             +SLD+HVGQC SVLVTAN+E KDY++VA++RF K+E     +IR  NG G P+    PPP
Sbjct  238   ESLDVHVGQCFSVLVTANQEPKDYFVVASTRFTKREVIATGVIRYNNGKGAPSPKLPPPP  297

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                     AWS+NQFR+FRWNLTASAARPNPQGSY YG I ITRT+KL NT  +  GKLR
Sbjct  298   V-----SWAWSLNQFRTFRWNLTASAARPNPQGSYKYGSINITRTIKLANTAHKVDGKLR  352

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVS+ +P TPLKL EY+ + D     FKYD +PD P  + +KV + P V N T RN
Sbjct  353   YALNGVSYVEPTTPLKLAEYYNVADK---VFKYDNIPDDPPAEITKVTMEPIVLNMTHRN  409

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+EIIFEN E  IQSYH++GYSFFAV IE GKWSPEKRKNYNL+DA++RH IQV+P  WA
Sbjct  410   FIEIIFENRETAIQSYHLDGYSFFAVAIETGKWSPEKRKNYNLLDAVSRHTIQVFPKSWA  469

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DN GMWN+RSE+W+R YLGQQ Y SV+SP +SL+DEYN+PD  L+CG V+  P 
Sbjct  470   AILLTFDNCGMWNIRSEVWDRHYLGQQLYASVVSPNKSLKDEYNMPDGALVCGVVESMPR  529

Query  213   PKP  205
             P P
Sbjct  530   PPP  532



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/492 (60%), Positives = 361/492 (73%), Gaps = 12/492 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TW+GIQQRKNSW +G PGT CPI PG NFTY FQVKDQIGS+FYFP
Sbjct  66    VLNVFNNLDEPFLLTWNGIQQRKNSWQEGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYFP  125

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +  + RA G +G + ++SR LIPVPF  PA+++ V +SDWY K +K L  +LD G++I  
Sbjct  126   SMGMHRAAGAFGGLRINSRLLIPVPFADPADDYTVLISDWYTKSHKALAGLLDAGRSIGN  185

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NG  GK  +N   PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GS
Sbjct  186   PAGVLINGLTGK--DNA--PLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGS  241

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN Y+SLD+HVGQCLSVLVTAN+EAKDYY+VA++RF K   S   +IR         
Sbjct  242   HTVQNDYESLDVHVGQCLSVLVTANQEAKDYYMVASTRFTKYSLSATGIIRYAGS-----  296

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P  P    G AWS NQ+RS RWNLTASAARPNPQGSYHYG I ITRT++L ++  
Sbjct  297   VVPPSPELPKAPVGWAWSFNQWRSLRWNLTASAARPNPQGSYHYGGINITRTIRLASSVG  356

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK R+A+NGVSH DP TPLKL EY+ + D     FKYD + D P    + + +APNV
Sbjct  357   LVNGKRRFALNGVSHVDPPTPLKLAEYYGIADK---VFKYDSISDDPPETNAPITVAPNV  413

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              NAT+R+++EII EN E+ IQ YH++GYSFFAVG+  GKW+P  R+ YNL+DA++RH IQ
Sbjct  414   LNATYRDYIEIILENPERSIQCYHLDGYSFFAVGMGHGKWTPASRRTYNLLDAVSRHTIQ  473

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W+A+M T DNAGMW++RSEMWER YLGQQ Y SV+SP RSLRDEYN+PDN LLCG
Sbjct  474   VYPRSWSAIMLTFDNAGMWSLRSEMWERHYLGQQLYVSVVSPARSLRDEYNMPDNALLCG  533

Query  234   AVKGKPLPKPYT  199
              V   P P  Y 
Sbjct  534   DVASLPKPPSYV  545



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 359/491 (73%), Gaps = 10/491 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +VNVFN LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+FY+P
Sbjct  76    LVNVFNMLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYP  135

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T +QRA G YG I+VHSR+LIPVPFD PA++F V + DWY K +  L K LD G+ I R
Sbjct  136   STGMQRAAGAYGLISVHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGR  195

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P GLV+NGKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGS
Sbjct  196   PAGLVINGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGS  253

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN YDSLDLH+GQCLS LVTA+++  DY LVA++RF K++ ST A+IR    +  P 
Sbjct  254   HTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSAPPP  313

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL   + 
Sbjct  314   AKLPE-----GPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRG  368

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK R+  NGVSH DP+TP+KL EYF   D     FKY+L+ D P  +T+   +APNV
Sbjct  369   KVDGKERFGFNGVSHVDPETPVKLAEYFNASD---GVFKYNLIGDVPPSNTAPTKMAPNV  425

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +A FR F+E++FEN EK I + HI+GY+FFAVG+ PGKW+   R  YNL+D ++RH IQ
Sbjct  426   ISAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQ  485

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W AVM T DNAGMW+VRS +WER YLG+Q Y SV+SPERSLRDEYN+P+  L CG
Sbjct  486   VYPRSWTAVMMTFDNAGMWSVRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCG  545

Query  234   AVKGKPLPKPY  202
              V G P+P  Y
Sbjct  546   KVVGLPMPPSY  556



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 359/491 (73%), Gaps = 10/491 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +VNVFN LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+FY+P
Sbjct  76    LVNVFNMLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYP  135

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T +QRA G YG I+VHSR+LIPVPFD PA++F V + DWY K +  L K LD G+ I R
Sbjct  136   STGMQRAAGAYGLISVHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGR  195

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P GLV+NGKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGS
Sbjct  196   PAGLVINGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGS  253

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN YDSLDLH+GQCLS LVTA+++  DY LVA++RF K++ ST A+IR    +  P 
Sbjct  254   HTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSAPPP  313

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                          G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL   + 
Sbjct  314   AKLPE-----GPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRG  368

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK R+  NGVSH DP+TP+KL EYF   D     FKY+L+ D P  +T+   +APNV
Sbjct  369   KVDGKERFGFNGVSHVDPETPVKLAEYFNASD---GVFKYNLIGDVPPSNTAPTKMAPNV  425

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +A FR F+E++FEN EK I + HI+GY+FFAVG+ PGKW+   R  YNL+D ++RH IQ
Sbjct  426   ISAEFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMGPGKWTAASRSTYNLLDTVSRHTIQ  485

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W AVM T DNAGMW+VRS +WER YLG+Q Y SV+SPERSLRDEYN+P+  L CG
Sbjct  486   VYPRSWTAVMMTFDNAGMWSVRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCG  545

Query  234   AVKGKPLPKPY  202
              V G P+P  Y
Sbjct  546   KVVGLPMPPSY  556



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/486 (60%), Positives = 359/486 (74%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP LFTW+GIQQRKNSW +GT G+ CPI PG N+TY FQVKDQIGS+ YFP+  + RA
Sbjct  83    LDEPFLFTWNGIQQRKNSWQEGTAGSNCPIPPGQNYTYHFQVKDQIGSFVYFPSLGMHRA  142

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVPF  PA+++ V + DWY K +K L K+LD+G+TI RP G+++N
Sbjct  143   AGGFGGLRVNSRLLIPVPFADPADDYTVLIGDWYTKSHKILAKLLDSGRTIGRPAGVLIN  202

Query  1293  GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G++GK    K +P LFTME  KTYRYR+CNVG++ ++NFR Q HSM LVE++GSHT+QNV
Sbjct  203   GRSGKDSTGKDDPPLFTMEAGKTYRYRICNVGMKVTLNFRIQSHSMKLVEMDGSHTMQNV  262

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+HVGQCLS LV A +  KDYY+VA+SRF K   +   LIR    N          
Sbjct  263   YESLDIHVGQCLSALVEATQAPKDYYMVASSRFTKYTLTASGLIRYAGSN-----TPPSQ  317

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I+ITRT+KLVN+     GK 
Sbjct  318   DLPAAPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLVNSVGHVNGKR  377

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+N VSH D  TPLKL EYF + D     FKY+++ D P   T+ + +APNV NATFR
Sbjct  378   RYALNAVSHQDTATPLKLAEYFGIADK---VFKYNIIGDDPPASTAPIKIAPNVMNATFR  434

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             NF+EIIFEN E+ +Q+YH++GYSFF VG+  GKW+P+ RK YNL+D ++RH IQVY   W
Sbjct  435   NFIEIIFENPERSMQAYHLDGYSFFPVGMGHGKWTPQSRKTYNLLDTVSRHTIQVYQRSW  494

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A+M T DNAGMWN+RSE+WER YLGQQ Y SVLSP RSLRDEYN+P+  L+CG V   P
Sbjct  495   SAIMLTFDNAGMWNLRSELWERRYLGQQLYISVLSPARSLRDEYNMPEKALICGDVVNLP  554

Query  216   LPKPYT  199
              P  Y 
Sbjct  555   RPPSYV  560



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/487 (59%), Positives = 361/487 (74%), Gaps = 10/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             ++D+PLLFTW GIQQRKNSW DG PG MCPI+PGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  80    QIDKPLLFTWHGIQQRKNSWQDGMPGDMCPIMPGTNFTYKMQFKDQIGTFFYYPSIGMQR  139

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I+VHSR LIPVPFD PA++F+  V DWY K ++ L K LD G+ I RP GL++
Sbjct  140   AAGGYGLISVHSRPLIPVPFDPPADDFSALVGDWYTKDHEVLAKNLDTGKGIGRPAGLLI  199

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++ +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  200   NGKNEKDASNP--PMYNVETGKTYRFRVCNVGIKTTLNVRIQGHVVKLVEMEGSHTVQNE  257

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+H+GQCLS L TAN++  DY+L+A++RF K   +  A++R    N  P+      
Sbjct  258   YDSLDVHIGQCLSFLTTANQKPGDYFLIASTRFIKGVNTITAVMRYKGSNSPPSPKLPEA  317

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  ++ +  GK 
Sbjct  318   -----PAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKE  372

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSH D +TPLKL EYF   +  +  F+Y+L+ D P  + + + LAPNV  A  R
Sbjct  373   RYALNGVSHADAETPLKLAEYF---NATKGVFEYNLITDTPPKEGTPIKLAPNVITAEHR  429

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              ++E++FEN E+ I ++H+NGY+FFA G+ PG W+ E RK YNL+D ++RH IQVYP  W
Sbjct  430   TYIEVVFENPERSIDTFHLNGYAFFAAGMGPGLWTAESRKTYNLLDTVSRHTIQVYPRSW  489

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              AVM T DNAGMWN+RS +WER+YLG+Q Y S  SP RSLRDEYN+PDN L CG V G P
Sbjct  490   TAVMLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMP  549

Query  216   LPKPYTI  196
             LP PYTI
Sbjct  550   LPPPYTI  556



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/485 (59%), Positives = 359/485 (74%), Gaps = 10/485 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD+PLLFTW G+QQRKNSW DG PGT CP+ PGTN+T+K+Q KDQIGS+FYFP+  +QR
Sbjct  63    QLDQPLLFTWHGMQQRKNSWQDGMPGTNCPVAPGTNYTFKWQAKDQIGSFFYFPSVGMQR  122

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I+V SR LIPVPFD PA++  V + DWY K +  + ++LD G++  RP G+++
Sbjct  123   AAGGYGLISVVSRLLIPVPFDPPADDLQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLI  182

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NG+ GK  E    PLFT E  KTYR R+CNVG+++++NFR QGH M LVE++GSHTVQ++
Sbjct  183   NGRGGK--EAADPPLFTFEAGKTYRLRICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDM  240

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVG CLSVLV A+++  DYY+VA++RF   + S  A+IR    N         P
Sbjct  241   YDSLDVHVGHCLSVLVDADQKPGDYYVVASTRFISDKSSVSAVIRYAGSN-----TPPAP  295

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+ T+    GKL
Sbjct  296   NVPEPPAGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHLEGKL  355

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             +Y  NGVSH D DTPLKL+EYF + D     FKY+ M D P      + + PNV  A FR
Sbjct  356   KYGFNGVSHVDADTPLKLLEYFNVTD---PVFKYNQMADVPPAVMGPLQVVPNVITAEFR  412

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E++FEN EK + S HI+GY+FFAVG+ PGKWSPE RK YNL+DA++RH+IQVYP  W
Sbjct  413   TFIEVVFENPEKSMDSVHIDGYAFFAVGMGPGKWSPELRKTYNLLDAVSRHSIQVYPRSW  472

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +AVM T DNAGMWNVRS +WER+Y G+QFY SV SP RSLRDEYN+PD  L CG V G P
Sbjct  473   SAVMLTFDNAGMWNVRSNVWERYYTGEQFYISVTSPARSLRDEYNMPDTSLRCGRVVGLP  532

Query  216   LPKPY  202
             +P  Y
Sbjct  533   MPPSY  537



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/487 (59%), Positives = 361/487 (74%), Gaps = 10/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             ++D+PLLFTW GIQQRK SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  79    QIDQPLLFTWHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A G YG I++HSR LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GL++
Sbjct  139   AAGAYGLISIHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  198

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P+F +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  199   NGKNEKDASNP--PMFNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A++R    N  PA      
Sbjct  257   YDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSNTPPAAKLPDA  316

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL +++ +  GK 
Sbjct  317   -----PDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSSSRGKVDGKE  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSHTDP+TPLKL EYF   +  +  F+Y+L+ D P  + + + +AP+V  A  R
Sbjct  372   RYALNGVSHTDPETPLKLAEYF---NATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              ++EI+FEN EK I ++H+NGY+FFA G+ PG W+ E RK YNL+D ++RH IQVYP  W
Sbjct  429   TYIEIVFENPEKSIDTFHLNGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              AVM T DNAGMWN+RS +WER+YLG+Q Y S  SP RSLRDEYN+PDN L CG V G P
Sbjct  489   TAVMLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMP  548

Query  216   LPKPYTI  196
             LP PYTI
Sbjct  549   LPPPYTI  555



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/484 (59%), Positives = 365/484 (75%), Gaps = 11/484 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP L TWSG+Q RKNSW DG PGT CPI PG NFTY FQ KDQIGSYFY+P+  LQRA 
Sbjct  80    DEPFLLTWSGMQHRKNSWQDGMPGTTCPIPPGQNFTYHFQPKDQIGSYFYYPSLGLQRAA  139

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G + V+SR LIP+P+  P +++ V + DWY K + TLK  LD+G++I RP G+++NG
Sbjct  140   GGFGGLRVNSRPLIPIPYADPEDDYTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLING  199

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K+GK  +    P+FTM+P KTYRYR+CNVG++ ++NFR Q H + LVE+EGSHT+QN+YD
Sbjct  200   KSGK-PDGTGEPIFTMKPGKTYRYRICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYD  258

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLDLHVGQC  VLVTA++E KDYY+VA++RF K   ++ A++R   G G  +        
Sbjct  259   SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKSVLTSTAILRYEGGKGAASPQLPK---  315

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNT-KSEEGGKLR  754
               +  G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+I ITR++KLVNT   ++G KLR
Sbjct  316   --SPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTIGKDDGKKLR  373

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTG-DTSKVILAPNVKNATFR  577
             YA++GVSH + DTP+KL +YF + D     FKYD + D+PT  +TSK+++ PNV N   R
Sbjct  374   YALSGVSHVETDTPVKLAQYFGVADK---VFKYDTIKDEPTAAETSKILVQPNVLNIEHR  430

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              FVEI+FENHEK  QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  431   AFVEIVFENHEKTTQSWHLDGYSFFAVAVEPGNWTPEKRKNYNLLDAVSRHTIQVYPKCW  490

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A++ T DN GMWN+RSE+ E+ YLGQQ Y +V  PE S+RDEY+ P N L CG VK  P
Sbjct  491   GAILLTFDNCGMWNIRSEILEKRYLGQQLYVNVGPPELSMRDEYSFPANGLRCGIVKDLP  550

Query  216   LPKP  205
              P P
Sbjct  551   HPHP  554



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 352/484 (73%), Gaps = 10/484 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+PLLF W GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS++YFP+  +QRA
Sbjct  81    LDQPLLFHWHGIQQRKNSWQDGLPGTMCPIQPNTNFTYHWQPKDQIGSFYYFPSIGMQRA  140

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG I VHSR+LIPVPFD PA++F V VSDWY K +  L K LD+G+ I RP GLV+N
Sbjct  141   AGGYGLITVHSRDLIPVPFDTPADDFPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVIN  200

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K   N   P++ ME  KTYR+RVCN+G++ S N R Q H + LVE+EGSHTVQN Y
Sbjct  201   GKNEKDASNP--PMYNMEAGKTYRFRVCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTY  258

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLH+GQCLS LVTA++   DY LVA++RF K+  +  A+IR    N  P +      
Sbjct  259   DSLDLHIGQCLSFLVTADQAPGDYLLVASTRFIKEVSTITAVIRYKGSNTPPPSQLPEA-  317

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  +K +  GK R
Sbjct  318   ----PSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLATSKGKVDGKER  373

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVSH D +TPLKL EYF   D     F+Y++M D P    + + +APNV +A FR 
Sbjct  374   YALNGVSHVDTETPLKLAEYFNATD---GVFQYNIMGDVPPAAGTPIKMAPNVISAEFRT  430

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+E++FEN EK I ++HINGY+FFA G+ PG WSP  RK YNL+D ++RH IQVYP  W 
Sbjct  431   FIEVVFENPEKSIDTFHINGYAFFAAGMGPGTWSPASRKTYNLLDTVSRHTIQVYPRSWT  490

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVM T DNAGMWN+RS +WER YLG+Q Y SV SP RSLRDEYN+P+  L CG V G P+
Sbjct  491   AVMLTFDNAGMWNIRSNLWERHYLGEQLYVSVTSPARSLRDEYNMPETSLRCGKVVGLPM  550

Query  213   PKPY  202
             P  Y
Sbjct  551   PPSY  554



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 355/486 (73%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+G+Q RKNSW+DGTPGT CPILPG NFT+ FQ KDQIGS+FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGVQHRKNSWMDGTPGTNCPILPGQNFTFHFQPKDQIGSFFYFPSLGMQKA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G + VHSR LIPVPF  PA+EFNV   DW+ K +K L + LD G+ +  P G+++N
Sbjct  134   AGGVGMLRVHSRLLIPVPFAPPAQEFNVLAGDWFTKSHKVLARQLDAGRGLGLPAGVLIN  193

Query  1293  GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G+ GK    +  P +FTM+    YR+R CNVGL+TS+NFR Q HS+ LVE+EGSHTVQN+
Sbjct  194   GRLGKDAAGRDEPPMFTMQAGNVYRFRFCNVGLKTSLNFRLQKHSLKLVEMEGSHTVQNL  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQCLSVLVTA++   DYYLVA++RF K+  +  A++R    N  P+      
Sbjct  254   YDSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKEILAATAVLRYAGSNAPPSPVIPD-  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                    G AWS NQ+R+FRWNLTASAARPNPQGSYHYG+I ITRT+KLVN  S   GK 
Sbjct  313   ----GPSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIKLVNGHSVVDGKR  368

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ ING+SH DPDTPLKL EYF L    + +F+Y+LM D P    + V LAPNV  A FR
Sbjct  369   RHFINGISHVDPDTPLKLAEYFNLS---KPAFEYNLMGDVPPAPDAPVTLAPNVITAEFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFEN E+ IQSYH++GY+FF  G+ PGKWSPE RK YN +D ++RH+IQV+P  W
Sbjct  426   TFIEIIFENTERSIQSYHLDGYAFFPAGMGPGKWSPESRKRYNHLDTVSRHSIQVFPRSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A+M T DNAGMWN+RS  WE  YLGQQ Y SV SP RSLRDEYN+P N L CGAV G P
Sbjct  486   TAIMLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPANALRCGAVVGLP  545

Query  216   LPKPYT  199
             LP  YT
Sbjct  546   LPPSYT  551



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/492 (59%), Positives = 365/492 (74%), Gaps = 10/492 (2%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +VNVFN LD+P L +W+GIQQRKNSW DG PGT CPI PG NFTY FQVKDQIGSYFYFP
Sbjct  65    VVNVFNNLDQPFLLSWNGIQQRKNSWQDGMPGTNCPIPPGQNFTYHFQVKDQIGSYFYFP  124

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +  + +A G +G + ++SR  IPVPFD PA+++ V + DWY   + TL++ LD+G++I +
Sbjct  125   SMYMHKAAGAFGGLRINSRLYIPVPFDDPADDYTVLIGDWYASDHNTLRRRLDSGRSIGQ  184

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG N     NK  PLF MEP KTYRYR+CNVGL+TS+NFR QGH++ LVEIEGS
Sbjct  185   PDGVLINGMNKPNKANK--PLFNMEPGKTYRYRICNVGLKTSLNFRIQGHTLKLVEIEGS  242

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQN+Y+SLD+HVGQC SVLVTANK  +DYY+VA++RF  +   T   + +  G+    
Sbjct  243   HTVQNIYESLDVHVGQCYSVLVTANKVPRDYYIVASTRFTNKYTHTATALIHYTGS----  298

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                 P   P    G+AWS+NQFRSFRWNLTASAARPNPQGS+HYG+I ITRT+KL N+  
Sbjct  299   KKPAPLMLPPAPTGVAWSLNQFRSFRWNLTASAARPNPQGSFHYGQINITRTIKLSNSVG  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                 KLRYA+NGVS+  P TPLKL EY+ +       F    + D P   + ++ LAP V
Sbjct  359   FVKSKLRYAMNGVSYVRPSTPLKLAEYYGVA---ARVFDTKAIADMPPA-SPQIKLAPAV  414

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
                 FR+F+EI+FEN EK IQS+H++GYSFFAVG+  G+W+P  RK YNL+DA+++H IQ
Sbjct  415   VKGNFRDFIEIVFENREKSIQSWHLDGYSFFAVGMSGGQWTPASRKVYNLLDAVSKHTIQ  474

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W AV+ T+DNAGMW++RSE+WER YLGQQ Y SV+SP RSLRDEYN+PDN  LCG
Sbjct  475   VYPNSWTAVLLTIDNAGMWSLRSELWERQYLGQQLYLSVVSPARSLRDEYNMPDNARLCG  534

Query  234   AVKGKPLPKPYT  199
              VK  P P PYT
Sbjct  535   IVKRMPKPAPYT  546



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 365/484 (75%), Gaps = 11/484 (2%)
 Frame = -2

Query  1650  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  1471
             DEP LFTWSG+Q RKNSW DG PGT CPI PG NFTY FQ KDQIGSYFY+P+  LQRA 
Sbjct  75    DEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSYFYYPSLGLQRAA  134

Query  1470  GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  1291
             GG+G + ++SR LIPVP+  P +++ V + DWY K +  LK  LD+G++I RP+G+++NG
Sbjct  135   GGFGGLRINSRALIPVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLING  194

Query  1290  KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  1111
             K GK  +    P+FTM+P KTY+YR+CNVGL+ ++NFR Q H + LVE+EGSHT+QN+YD
Sbjct  195   KAGKP-DGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYD  253

Query  1110  SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  931
             SLDLHVGQC  VLVTA++E KDYY+VA++RF K   ++ AL+R   G G  +     PP 
Sbjct  254   SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKGAASPELPKPPV  313

Query  930   PVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSE-EGGKLR  754
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITR++KLVNT  + EG KLR
Sbjct  314   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLR  368

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTG-DTSKVILAPNVKNATFR  577
             YA++GVSH + +TP+KL +YF + D     FKYD + D+PT  DTS +++ PNV N   R
Sbjct  369   YALSGVSHVETETPIKLAQYFGVADK---VFKYDTIKDEPTKVDTSNILVQPNVLNIEHR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             +FVEI+FEN E+  QS+H++GYSFFAV +EPGKW+P KRKNYNL+DA+ RH IQVYP CW
Sbjct  426   SFVEIVFENQERTTQSWHLDGYSFFAVAVEPGKWTPAKRKNYNLLDAVYRHTIQVYPKCW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A++ T DN GMWN+RSE+ E+ YLGQQ Y +V  PE S RDEY+ P N L CG ++G P
Sbjct  486   GAILLTFDNCGMWNIRSEILEKRYLGQQLYVNVGPPELSQRDEYSFPANGLRCGIIQGLP  545

Query  216   LPKP  205
              P+P
Sbjct  546   DPQP  549



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/487 (59%), Positives = 360/487 (74%), Gaps = 10/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             ++D+PLLFTW GIQQRK SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  79    QIDQPLLFTWHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A G YG I++HSR LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GL++
Sbjct  139   AAGAYGLISIHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  198

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P+F +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  199   NGKNEKDASNP--PMFNVEEGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A++R    N  PA      
Sbjct  257   YDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSNTPPAAKLPDA  316

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  ++ +  GK 
Sbjct  317   -----PDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKE  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSHTDP+TPLKL EYF   +  +  F+Y+L+ D P  + + + +AP+V  A  R
Sbjct  372   RYALNGVSHTDPETPLKLAEYF---NATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              ++EI+FEN EK I ++H++GY+FFA G+ PG W+ E RK YNL+D ++RH IQVYP  W
Sbjct  429   TYIEIVFENPEKSIDTFHLDGYAFFAAGMGPGLWTVESRKTYNLLDTVSRHTIQVYPRSW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              AVM T DNAGMWN+RS +WER+YLG+Q Y S  SP RSLRDEYN+PDN L CG V G P
Sbjct  489   TAVMLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNSLRCGKVVGMP  548

Query  216   LPKPYTI  196
             LP PYTI
Sbjct  549   LPPPYTI  555



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/484 (60%), Positives = 357/484 (74%), Gaps = 10/484 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+PLLFTW GIQQRKNSW DG PGTMCPI PGTNFTY +Q KDQIGS+FYFP+ ++QR+
Sbjct  74    LDQPLLFTWHGIQQRKNSWQDGMPGTMCPIKPGTNFTYHWQPKDQIGSFFYFPSIAMQRS  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG I+VHSR+LIPV FD PA++F V V DWY K +  L K LD G+ I RP GL++N
Sbjct  134   AGGYGLISVHSRDLIPVLFDAPADDFPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIIN  193

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K   +   P++  E  KTYR+RVCNVG++ S+N R  GH++ LVE+EGSHTVQN+Y
Sbjct  194   GKNDKDAASA--PMYNFEAGKTYRFRVCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQCLS LVTA+++  DY+LV ++RF K+  +  ALIR    +         P 
Sbjct  252   DSLDVHVGQCLSFLVTADQKPADYFLVVSTRFIKEVSTITALIRYKGSS-----TPPSPK  306

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  ++ +  GK R
Sbjct  307   LPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKER  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVSH D +TPLKL EYF   D     F+Y+L+ D P    + + LAPNV +A FR 
Sbjct  367   YALNGVSHVDAETPLKLAEYFNATD---GVFQYNLISDVPPKAGTPIKLAPNVLSAEFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+E++FEN EK I S+HI+GY+FF  G+ PG WSP+ RK YNL+D ++RH IQVYP  W 
Sbjct  424   FIEVVFENPEKSIDSFHIDGYAFFTAGMGPGTWSPQSRKTYNLLDTVSRHTIQVYPRSWT  483

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVM T DNAGMWNVRS +WER YLG+Q Y SV+SP RSLRDEYN+P+  L CG V G P+
Sbjct  484   AVMLTFDNAGMWNVRSNLWERQYLGEQMYISVISPARSLRDEYNMPETSLRCGKVVGLPM  543

Query  213   PKPY  202
             P  Y
Sbjct  544   PPSY  547



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/485 (60%), Positives = 352/485 (73%), Gaps = 9/485 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQQRKNSW+DG PGT CPI PG NFTY FQVKDQIGS+FYFP+  + RA
Sbjct  75    LDEPFLLTWNGIQQRKNSWMDGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYFPSMGMHRA  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVPF  P +++ V + DWY K +K L  ILD G  I  P G+++N
Sbjct  135   AGAFGGLRVNSRLLIPVPFADPTDDYTVLIGDWYAKSHKALAAILDAGHGIGNPAGVLIN  194

Query  1293  GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G+ GK    K + PLFTME  KTYRYR+CNVG++ S+NFR Q H M LVE++GSHTVQN 
Sbjct  195   GRTGKDASGKDDTPLFTMEAGKTYRYRICNVGMKVSLNFRMQNHRMKLVEMDGSHTVQND  254

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   +IR    +         P
Sbjct  255   YESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVIRYAGSS-----VPPSP  309

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT+KL ++     GK 
Sbjct  310   ELPAAPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGGINITRTIKLASSVGLVNGKR  369

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+A+NGVSH +  TPLKL EY+ + D     FKYD + D+P   ++ +   PNV NAT+R
Sbjct  370   RFALNGVSHVESPTPLKLAEYYGIADK---VFKYDSINDEPPAASAPITATPNVLNATYR  426

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              ++EII EN E+ IQ YH++GYSFF VG+  GKW+PE RK YNL+DA++RH IQVYP  W
Sbjct  427   TYIEIILENPERSIQCYHLDGYSFFPVGMGHGKWTPESRKTYNLLDAVSRHTIQVYPRSW  486

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A+M T DNAGMWN+RSEMWER YLGQQ Y SV SPERSLRDEYNIPDN LLCG V   P
Sbjct  487   SAIMLTFDNAGMWNLRSEMWERHYLGQQIYISVTSPERSLRDEYNIPDNTLLCGDVADLP  546

Query  216   LPKPY  202
              P  Y
Sbjct  547   KPPSY  551



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 355/486 (73%), Gaps = 11/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLF W GIQQRKNSW+DG PGT CPI PGTN+TYK+Q KDQIG++FYFP+  +QR
Sbjct  72    QLDHPLLFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQR  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K LD G++I RP GLV+
Sbjct  132   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVI  191

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++TME  K YR+RVCNVG++TS+N R QGHS+ LVE+EGSHTVQN 
Sbjct  192   NGKNEKDASNP--PMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNS  249

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HV QC+S LVTA+++  DY LVA++RF K+  +  A++R    N         P
Sbjct  250   YDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASP  304

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  +K +  GK 
Sbjct  305   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKE  364

Query  756   RYAINGVSHTD-PDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
             R+A+NGVSH D   TPLKL EYF   +     F+Y+L+ D P   T    LAPNV +A F
Sbjct  365   RFALNGVSHVDDAQTPLKLAEYF---NASSGVFEYNLIGDVPPATTVPQKLAPNVISAEF  421

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FEN EK I S+HINGY+FFA G+ PG W+PE RK YNL+D ++RH IQVYP  
Sbjct  422   RTFIEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRS  481

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W AVM T DNAGMWN+RS MWER+YLG Q Y SV+SP RSLRDEYN+P+  L CG V G 
Sbjct  482   WTAVMLTFDNAGMWNIRSNMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGL  541

Query  219   PLPKPY  202
             P+P  Y
Sbjct  542   PMPPSY  547



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 355/486 (73%), Gaps = 11/486 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLF W GIQQRKNSW+DG PGT CPI PGTN+TYK+Q KDQIG++FYFP+  +QR
Sbjct  75    QLDHPLLFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQR  134

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K LD G++I RP GLV+
Sbjct  135   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVI  194

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++TME  K YR+RVCNVG++TS+N R QGHS+ LVE+EGSHTVQN 
Sbjct  195   NGKNEKDASNP--PMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNS  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HV QC+S LVTA+++  DY LVA++RF K+  +  A++R    N         P
Sbjct  253   YDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASP  307

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  +K +  GK 
Sbjct  308   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKE  367

Query  756   RYAINGVSHTD-PDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
             R+A+NGVSH D   TPLKL EYF   +     F+Y+L+ D P   T    LAPNV +A F
Sbjct  368   RFALNGVSHVDDAQTPLKLAEYF---NASSGVFEYNLIGDVPPATTVPQKLAPNVISAEF  424

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+E++FEN EK I S+HINGY+FFA G+ PG W+PE RK YNL+D ++RH IQVYP  
Sbjct  425   RTFIEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTPECRKTYNLLDTVSRHTIQVYPRS  484

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W AVM T DNAGMWN+RS MWER+YLG Q Y SV+SP RSLRDEYN+P+  L CG V G 
Sbjct  485   WTAVMLTFDNAGMWNIRSNMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGL  544

Query  219   PLPKPY  202
             P+P  Y
Sbjct  545   PMPPSY  550



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/484 (60%), Positives = 354/484 (73%), Gaps = 10/484 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+ Y+P+T +QRA
Sbjct  82    LDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFVYYPSTGMQRA  141

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G YG I+VHSR+LIPVPFDRPA++F V V DWY K +  L K LD G+ I RP GLV+N
Sbjct  142   AGAYGLISVHSRDLIPVPFDRPADDFPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVIN  201

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K   N   P++ +E  KTYR+R+CNVG++ S+N   Q H M LVE+EGSHT+QN Y
Sbjct  202   GKNEKDAANP--PMYNVEAGKTYRFRICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDY  259

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQCLSVLVTA+++  DY LVA++RF K+  +T A+IR    +  P        
Sbjct  260   DSLDIHVGQCLSVLVTADQKPGDYLLVASTRFIKEVSTTTAVIRYKGASAPPPAKLPE--  317

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                +  G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT++L   + +  GK R
Sbjct  318   ---SPSGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIRLGIGRGKVDGKER  374

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + INGVSH DP+TP+KL EYF   D     F+YDL+ D P   ++   +APNV  A FR 
Sbjct  375   FGINGVSHVDPETPVKLAEYFNATD---GVFQYDLIGDVPPAKSAPTKMAPNVLRAEFRT  431

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+E++FEN EK I ++HI+GY+FFAVG+ PGKW+P  R  YNL+D ++RH +QVYP  W 
Sbjct  432   FIEVVFENPEKSIDTFHIDGYAFFAVGMGPGKWTPACRSTYNLLDTVSRHTVQVYPRSWT  491

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVM T DNAGMW++RS +WER YLG+Q Y SV SPERSLRDEYN+P+  L CG V G PL
Sbjct  492   AVMMTFDNAGMWSIRSNIWERNYLGEQLYISVTSPERSLRDEYNMPETSLRCGKVVGLPL  551

Query  213   PKPY  202
             P  Y
Sbjct  552   PPSY  555



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 350/486 (72%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW+DG PGT CPILPG NFTY FQ KDQIGS+FY P+  +Q+A
Sbjct  74    LDEPFLLTWNGIQHRKNSWMDGAPGTNCPILPGQNFTYHFQPKDQIGSFFYIPSLGMQKA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + VHSR LIPVPFD PAEEFNV   DW+ K +K L   LD G+++  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFDPPAEEFNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLIN  193

Query  1293  GKNGK-VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G+ GK    +   P+FTM+    YR+R CNVGL+TS+NFR Q H + LVE+EGSHTVQN+
Sbjct  194   GRRGKDAAGHDEPPMFTMQAGDVYRFRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNL  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             Y SLD+HVGQCLSVLVTA++   DYYLVA++RF K+  +  A++R    N         P
Sbjct  254   YTSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKKVLTATAVLRYAGSN-----TPPSP  308

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS NQ+R+FRWNLTASAARPNPQGSYHYG+I ITR+++LVN  S   GK 
Sbjct  309   VIPEGPTGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRSIRLVNGHSIVDGKR  368

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R  INGVSH DPDTPLKL EYF L +     FKY LM D P    + V LAPNV    FR
Sbjct  369   RNFINGVSHVDPDTPLKLAEYFNLSN---PVFKYSLMGDAPPAPDTPVTLAPNVIAVEFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFEN EK IQSYH++GY+FF  G+ PGKWSPE RK YNL+D ++RH++ V+P  W
Sbjct  426   TFIEIIFENTEKSIQSYHLDGYAFFPAGMGPGKWSPESRKRYNLLDTVSRHSVHVFPKSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A++ T DNAGMWN+RS  WE  YLGQQ Y SV SPERSLRDEYN+P N L CGAV G P
Sbjct  486   TAILLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPERSLRDEYNMPLNALRCGAVVGLP  545

Query  216   LPKPYT  199
             LP  YT
Sbjct  546   LPPSYT  551



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/487 (58%), Positives = 356/487 (73%), Gaps = 9/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L +W+GIQ RKNSW+DG  GT CPI+PG N+TY FQ KDQIGS+FYFP+ S+ +
Sbjct  72    KLDEPFLLSWNGIQHRKNSWMDGMTGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSISMHK  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
               GG G + VHSR LIPVP+  PA+EFNV   DWY K +K L ++LD G+ I RP G+++
Sbjct  132   VAGGIGMLRVHSRLLIPVPYADPADEFNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLI  191

Query  1296  NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NGK+GK    K  P +FTME  KTYRYRVCNVG++TS+N R Q H + LVE+EGSHT+QN
Sbjct  192   NGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQN  251

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             VYDSLDLH GQC SV VTA+++  DYY+V ++RF K      A+IR    N         
Sbjct  252   VYDSLDLHTGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----MPPS  306

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
             P  P +  G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I ITRT++L  +     GK
Sbjct  307   PDLPPSPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGK  366

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              RYA+NGVSH +P TPLKL EY+ + D +   FKY+++ D+P  D S +++APNV   TF
Sbjct  367   RRYALNGVSHENPATPLKLSEYYSITDKE---FKYNIIGDEPPADKSPIVIAPNVIKCTF  423

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+EII EN E+ I SYH++GYSFF  G+  G+WSPEKR+ YNL+DA++RH +QVYP  
Sbjct  424   RTFIEIILENPERSIHSYHLDGYSFFPAGMGHGEWSPEKRRTYNLLDAVSRHTVQVYPKS  483

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+A+M T DNAGMWN+R+ +W++ YLGQQ Y SV+SPERSLRDEYNIP+N LLCG V   
Sbjct  484   WSAIMLTFDNAGMWNLRTMIWDKQYLGQQLYISVISPERSLRDEYNIPENSLLCGNVVNL  543

Query  219   PLPKPYT  199
             P P PY 
Sbjct  544   PKPPPYA  550



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/486 (59%), Positives = 356/486 (73%), Gaps = 11/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW+DGTPGT CPILPG NFTY FQ KDQIGS+FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGIQHRKNSWMDGTPGTNCPILPGQNFTYHFQPKDQIGSFFYFPSIGMQKA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + VHSR LIPVPF  PAEEFNV   DW+ +G+K L + LD G+ +  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFAPPAEEFNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLIN  193

Query  1293  GKNGK--VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             G++G+   G + L P+FTM+    YR+R CNVGL+ S+NFR Q HS+ LVE+EGSHTVQN
Sbjct  194   GRSGRNAAGHDDL-PMFTMQAGNVYRFRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQN  252

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLD+HVGQC+SVLVTA++   DYYLVA++RF K+  +  A++R    N  P+     
Sbjct  253   LYDSLDVHVGQCMSVLVTADQAPGDYYLVASTRFTKKVHTATAVLRYAGSNSPPSRVIPR  312

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
                     G AWS NQ+R+FRWNLTASAARPNPQGSYHYG+I ITRT++LVN  +   GK
Sbjct  313   -----GPSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIRLVNGHNVVDGK  367

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
             LRY ING+SH + DTPLKL EYF   +     FKY+LM D P    + + L PNV  A F
Sbjct  368   LRYFINGISHVESDTPLKLAEYF---NASSPVFKYNLMGDVPPAPDAPLTLVPNVITAEF  424

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+EIIFEN E+ IQSYH++GY+FF VG+ PGKWSPE RK YNL+D ++RH+I+V+P  
Sbjct  425   RTFIEIIFENTERSIQSYHLDGYAFFPVGMGPGKWSPESRKRYNLLDTVSRHSIEVFPRS  484

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W A++ T DNAGMWN+RS  WE  YLGQQ Y SV SP RSLRDEYN+P N L CG V G 
Sbjct  485   WTAILLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPLNALRCGQVIGL  544

Query  219   PLPKPY  202
             PLP  Y
Sbjct  545   PLPPSY  550



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/485 (60%), Positives = 355/485 (73%), Gaps = 23/485 (5%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY + +  LK  LD+G+TI RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTESHTQLKNFLDSGRTIGRPDGILIN  196

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  255

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC  V++TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  256   DSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  310

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +   KLR
Sbjct  311   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  370

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YA+NGVSH D +TPLKL EYF + D     FKYD + D PT D         +KN     
Sbjct  371   YALNGVSHIDLETPLKLAEYFGVTDK---VFKYDSISDNPTSD--------QIKN-----  414

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
              ++I   NHE+ +QS+H++GYSFFAV +EPG W+PEKRKNYNL+DA++RH IQVYP CWA
Sbjct  415   -IKIEPNNHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTIQVYPKCWA  473

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VK KP 
Sbjct  474   AILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPK  533

Query  213   PKPYT  199
               PY 
Sbjct  534   INPYA  538



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/485 (59%), Positives = 355/485 (73%), Gaps = 10/485 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEPLLFTW+G+Q RKNSW DG  GT CPI PGTN+TYK+Q KDQIGS+FYFP+  + R
Sbjct  79    QLDEPLLFTWNGMQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GGYG I+V SR LIPVPFD PA++  V + DWY K +  + K+LD G++  RP G+V+
Sbjct  139   AAGGYGGISVVSRLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVI  198

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGK+GK   +   P+FT+E  KTYR RVCNVG++ S+NFR QGH M LVE+EGSHTVQ++
Sbjct  199   NGKSGKAAADP--PMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDM  256

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVG CLSVLV A+++  DYY VA++RF  +  S  A+IR    +         P
Sbjct  257   YDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSP  311

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT++L+ ++    GKL
Sbjct  312   AVPEPPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKL  371

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             +Y  NGVSH D +TPLKL EYF + D     F+Y+ M D P      + + PNV  A FR
Sbjct  372   KYGFNGVSHVDAETPLKLAEYFNVTD---GVFRYNQMTDVPPAVNGPLHVVPNVITAEFR  428

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFEN EK + S H++GY+FFAVG+ PGKWS E+RK YNL+D ++RH++QVYP  W
Sbjct  429   TFIEIIFENPEKSMDSVHLDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSW  488

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A+M T DNAGMWNVRS +WER YLG+Q Y SV+SP RSLRDEYN+P+N L CG V G P
Sbjct  489   TAIMLTFDNAGMWNVRSNIWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLP  548

Query  216   LPKPY  202
             LP  Y
Sbjct  549   LPPSY  553



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 358/488 (73%), Gaps = 12/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNF YK+Q KDQIGS++YFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFMYKWQPKDQIGSFYYFPSMGMQR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             AVGGYG I+V+SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  139   AVGGYGGISVYSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  198

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             V+NGK GK  E+   PLFT +  KTYR RVCN G++ S+NFR QGH MTLVE+EGSHT+Q
Sbjct  199   VINGKGGKDLESA--PLFTFDAGKTYRLRVCNTGIKASLNFRIQGHHMTLVELEGSHTLQ  256

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             +VYDSLD+HVG CLSVLVTA+++  DYY+VA++RF     S  A++R    +        
Sbjct  257   DVYDSLDVHVGHCLSVLVTADQKPGDYYMVASTRFIHDAKSARAVVRYAGSS-----APP  311

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
             P   P    G AWSINQ RS RWNLT+SAARPNPQGSYHYG+I ITRT++++ ++    G
Sbjct  312   PAEMPEPPAGWAWSINQARSIRWNLTSSAARPNPQGSYHYGQINITRTIRVMVSRGHIDG  371

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KLRY  NGVSH DP+TP+KL EYF + D     F Y+ M D P      + + PNV  A 
Sbjct  372   KLRYGFNGVSHRDPETPVKLAEYFNVTD---GVFSYNQMGDVPPAVNGPLHVVPNVITAE  428

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EI+FEN EK + S H++GY+FF VG+ PG+WSPE R  YNL+DA++RH IQVYP 
Sbjct  429   FRTFIEIVFENPEKSLDSIHLDGYAFFGVGMGPGQWSPEARVTYNLLDAVSRHTIQVYPR  488

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W A+M T DNAGMW+VRS +WER+YLG+QFY SV+SPE SLRDEYN+PDN L CG V G
Sbjct  489   SWTAIMLTFDNAGMWSVRSNIWERYYLGEQFYISVISPEHSLRDEYNMPDNDLRCGKVVG  548

Query  222   KPLPKPYT  199
              PLP  Y+
Sbjct  549   LPLPPSYS  556



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/486 (61%), Positives = 356/486 (73%), Gaps = 38/486 (8%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQV-KDQIGSYFYFPTTSLQR  1477
             LDEPLLFTW G+Q RKNSW DGT G  CPI PGTN+TY FQV KDQIG+YFY+PTT LQR
Sbjct  67    LDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVVKDQIGTYFYYPTTGLQR  126

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A+GG+G + + SR                         +  LK+ LD+G++I RP G+ +
Sbjct  127   AIGGFGGLRIFSRL------------------------HTALKQKLDSGRSIGRPVGVHI  162

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKNG      L PL+TMEP KTY+YR+CNVGL+ S+NFR QGH + LVE EGSH VQN 
Sbjct  163   NGKNGG-----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNN  217

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQC +VLVTA++E KDY++VA++RF K+  +   +IR  NG G  +    P 
Sbjct  218   YDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVGPASGGLPPA  277

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   +G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT S   GKL
Sbjct  278   -----PQGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKL  332

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RY +NGVSH D  TPLKL EY+ + D     FKY+L+ D P      + +APNV NATFR
Sbjct  333   RYGLNGVSHVDTQTPLKLAEYYGVADK---VFKYNLISDSPDTAFPDLTVAPNVINATFR  389

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
             +F+E+IFEN  KVIQSY+++GYSFFA+ +EPGKW+PEKRKNYNL+DAI+RH IQV+PN W
Sbjct  390   DFIEVIFENPGKVIQSYNLDGYSFFALAVEPGKWTPEKRKNYNLLDAISRHTIQVFPNSW  449

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA+M T DNAGMWN+RSEM E  YLGQQ Y SVLSP RSLRDEYN+P+ QLLCG VK  P
Sbjct  450   AAIMLTFDNAGMWNLRSEMAENRYLGQQLYVSVLSPNRSLRDEYNLPETQLLCGIVKDMP  509

Query  216   LPKPYT  199
              P PY+
Sbjct  510   KPPPYS  515



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/484 (59%), Positives = 348/484 (72%), Gaps = 10/484 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LD+PLLFTW GIQQRKNSW DG  GTMCPI P TNFTY +Q KDQIGS+FY+P+T +QRA
Sbjct  81    LDQPLLFTWHGIQQRKNSWQDGMLGTMCPIQPNTNFTYHWQPKDQIGSFFYYPSTGMQRA  140

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G YG I+VHSR+LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GLV+N
Sbjct  141   AGAYGLISVHSRDLIPVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVIN  200

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGSHT+QN Y
Sbjct  201   GKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDY  258

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLDLH+GQCLS LVTA+++  DY L  ++RF K+  S  A+IR    N  P        
Sbjct  259   DSLDLHIGQCLSFLVTADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSNAPPPAKVPE--  316

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                +  G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL   + +  GK R
Sbjct  317   ---SPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKER  373

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             +  NGVSH DP+TP+KL EYF   D     F+YD++ D P   ++   +APNV  A FR 
Sbjct  374   FGFNGVSHVDPETPVKLAEYFNTTD---GVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRT  430

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             F+E++FEN EK I + HI+GY+FFAVG+ PGKW+P  R  YNL+D ++RH IQVYP  W 
Sbjct  431   FIEVVFENPEKSIDTIHIDGYAFFAVGMGPGKWTPASRSTYNLLDTVSRHTIQVYPRSWT  490

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             AVM T DNAGMW++RS +WER YLG+Q Y SV+SPERSLRDEYN+P+  L CG V G P+
Sbjct  491   AVMMTFDNAGMWSIRSNIWERQYLGEQLYVSVISPERSLRDEYNMPETSLRCGKVVGLPM  550

Query  213   PKPY  202
             P  Y
Sbjct  551   PPSY  554



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 352/488 (72%), Gaps = 10/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLFTW+G+Q RKNSW+DG PGT CPI P TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  77    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIGSFFYFPSIGMQR  136

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  137   AAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  196

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK GK  E    P+ T E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  197   LINGKGGKDLEAAA-PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHDMKLVELEGSHTLQ  255

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             +VYDSLD+HVG CLSVLV A++   DYY+VA++RF     S  A+IR    +G P  P +
Sbjct  256   DVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNM  315

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
               P      G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+K++ ++    G
Sbjct  316   TEP----PAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KLRY  NG+SH D +TPLKL EYF + D     F Y+ M D P      + + PNV  A 
Sbjct  372   KLRYGFNGISHRDTETPLKLAEYFNVTD---GVFSYNQMGDVPPAVNGPLHVIPNVITAE  428

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EI+FEN EK I S H++GY+FF VG+ PG WSPE RK YNL+D ++RH IQVYP 
Sbjct  429   FRTFIEIVFENPEKSIDSLHLDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPR  488

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W A+M T DNAGMW+VRS +WER+YLG+QFY SV+SP RSLRDEYN+PDN L CG V G
Sbjct  489   SWTAIMLTFDNAGMWSVRSNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVG  548

Query  222   KPLPKPYT  199
              PLP  Y 
Sbjct  549   LPLPPSYA  556



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/487 (58%), Positives = 357/487 (73%), Gaps = 9/487 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LDEP L +W+GIQ RKNSW+DG PGT CPI+PG N+TY FQ KDQIGS+FYFP+  +Q+
Sbjct  72    KLDEPFLLSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQK  131

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A GG G I VHSR LIPVP+  PA+EFN+   +WY K +K L + LD+G+ I RP G+++
Sbjct  132   ASGGMGMIRVHSRLLIPVPYTDPADEFNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLI  191

Query  1296  NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  1120
             NGK+GK    K  P +FT+E  KTYR+RVCN+G++ S+NFR Q H++ LVE+EGSH VQN
Sbjct  192   NGKHGKDASGKDEPPMFTVEAGKTYRFRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQN  251

Query  1119  VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  940
             +YDSLDLH+GQC SV VTA+++  DYY++A++RF K +    A+IR    N         
Sbjct  252   MYDSLDLHIGQCFSVFVTADQQPGDYYILASTRFTKYKCDGSAIIRYAGSN-----TPPS  306

Query  939   pppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGK  760
                P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT++L        GK
Sbjct  307   KDLPPGPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLRGGTGLVNGK  366

Query  759   LRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATF  580
              RYAINGVSH +P TP KL EYF + D +   FKY+++ D+P    S + +APNV N TF
Sbjct  367   RRYAINGVSHDNPVTPFKLSEYFGIADKE---FKYNIIGDEPPTGKSPITIAPNVVNCTF  423

Query  579   RNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNC  400
             R F+EII EN E+ I +YHI+GY+FF VG+  G+W PEKR+ YNL+DA +RH +QVYP  
Sbjct  424   RTFIEIILENPERSIHAYHIDGYAFFPVGMGHGEWDPEKRRTYNLLDASSRHTVQVYPKS  483

Query  399   WAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGK  220
             W+A+M T DNAGMWN+R+ +W++ YLGQQ YFSV+SP RSLRDEYNIP+N LLCG V   
Sbjct  484   WSAIMLTFDNAGMWNLRTLVWDKQYLGQQLYFSVVSPARSLRDEYNIPENALLCGNVVKL  543

Query  219   PLPKPYT  199
             P P PYT
Sbjct  544   PQPAPYT  550



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/488 (59%), Positives = 352/488 (72%), Gaps = 10/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLFTW+G+Q RKNSW+DG PGT CPI P TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  77    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIGSFFYFPSIGMQR  136

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  137   AAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  196

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK GK  E    P+ T E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  197   LINGKGGKDLEAAA-PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  255

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             +VYDSLD+HVG CLSVLV A++   DYY+VA++RF     S  A+IR    +G P  P +
Sbjct  256   DVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNM  315

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
               P      G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+K++ ++    G
Sbjct  316   TEP----PAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KLRY  NG+SH D +TPLKL EYF + D     F Y+ M D P      + + PNV  A 
Sbjct  372   KLRYGFNGISHRDTETPLKLAEYFNVTD---GVFSYNQMGDVPPAVNGPLHVIPNVITAE  428

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EI+FEN EK I S H++GY+FF VG+ PG WSPE RK YNL+D ++RH IQVYP 
Sbjct  429   FRTFIEIVFENPEKSIDSLHLDGYAFFGVGMGPGTWSPEMRKTYNLLDTVSRHTIQVYPR  488

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W A+M T DNAGMW+VRS +WER+YLG+QFY SV+SP RSLRDEYN+PDN L CG V G
Sbjct  489   SWTAIMLTFDNAGMWSVRSNVWERYYLGEQFYISVISPARSLRDEYNMPDNALRCGKVVG  548

Query  222   KPLPKPYT  199
              PLP  Y 
Sbjct  549   LPLPPSYA  556



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/497 (59%), Positives = 360/497 (72%), Gaps = 38/497 (8%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN LDEP L TWS +QQRKNSW DG  GT CPI P TN+TY FQVKDQIGSY Y+P
Sbjct  47    VLNVFNNLDEPFLLTWSCVQQRKNSWQDGVLGTNCPIPPRTNYTYHFQVKDQIGSYIYYP  106

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             TT + RA GG+G + V+SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  107   TTGMHRAAGGFGGLRVNSRLLIPVPYVDPEDDYTVILNDWYTSSHSTLRKYLDSGRSLAR  166

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P+G+++NGKN K G+    PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGS
Sbjct  167   PNGVLINGKNAK-GDGNDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGS  225

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H VQNVY+ LD+HVGQC SVL                    +  ++  +IR  NG G  +
Sbjct  226   HVVQNVYEPLDVHVGQCFSVL--------------------EVLTSKGIIRYTNGKGPAS  265

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                   P      G AWS+NQFRSF WNLTASAARPNPQGSYHYG I ITRT+KLVN+ S
Sbjct  266   PELPEAPV-----GWAWSLNQFRSFHWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  320

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGD--TSKVILAP  601
               GGKL YAINGVSH +P+TPLKL EY+ +       FKYD +PD P  +  ++KV+  P
Sbjct  321   RAGGKLCYAINGVSHVNPETPLKLAEYYGI---AHKVFKYDTIPDMPLANIASAKVVTHP  377

Query  600   NVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAV-----GIEPGKWSPEKRKNYNLVDA  436
             NV N TFRNFVEI+FENHEK +QSYH++GYSFFA+      IEP  W+PEKRK+YNL+DA
Sbjct  378   NVINQTFRNFVEIVFENHEKSMQSYHLDGYSFFALYTNIHNIEPDTWTPEKRKSYNLLDA  437

Query  435   INRHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIP  256
             ++R  IQV+P  WAA++ T DNAGMWN+RSEMWER YLGQQ Y SVL P  SL+DEYN+P
Sbjct  438   VSRTTIQVFPKSWAAILLTFDNAGMWNIRSEMWERTYLGQQLYVSVLCPGCSLKDEYNVP  497

Query  255   DNQLLCGAVKGKPLPKP  205
             DN LLCG VK   LPKP
Sbjct  498   DNALLCGQVKD--LPKP  512



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 351/488 (72%), Gaps = 12/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSIGMQR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + +D G+ + RP G+
Sbjct  139   AAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGV  198

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK GK  + +  P FT E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  199   LINGKGGK--DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  256

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             N YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S  A+IR    +  P+    
Sbjct  257   NTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSSAPPSPNMT  316

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
              P       G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+K++ ++    G
Sbjct  317   EP-----PAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KLRY  NG+SH DP+TP+KL EYF   D     F Y+ M D P      + + PNV  A 
Sbjct  372   KLRYGFNGISHRDPETPVKLAEYFNATD---GVFSYNQMGDVPPAVNGPLHVIPNVITAE  428

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EI+FEN EK I S H++GY+FF VG+ PGKWSPE RK YNL+D ++RH IQVYP 
Sbjct  429   FRTFIEIVFENPEKSIDSLHVDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPR  488

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W A+M T DNAGMW+V S +WER+YLG+QFY SV+SP RSLRDEYN+PDN L CG V G
Sbjct  489   SWTAIMLTFDNAGMWSVHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVG  548

Query  222   KPLPKPYT  199
              PLP  Y 
Sbjct  549   LPLPPSYA  556



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/486 (59%), Positives = 351/486 (72%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+G+Q RKNSW+DGTPGT CPI PG NFTY FQ KDQIG++FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGVQNRKNSWMDGTPGTNCPIPPGQNFTYHFQPKDQIGTFFYFPSVGMQKA  133

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + VHSR LIPVPF  PAEEF+V   DW+   +K L + LD G+ +  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFAPPAEEFDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLIN  193

Query  1293  GKNGK-VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             G+ G+ V  +   P+FT++    YR+R CNVGL+TS+NFR Q HS+ LVE+EGSHT+QN+
Sbjct  194   GRPGRPVTGHDDPPMFTVQAGNVYRFRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNL  253

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLD+HVGQCLSVLV A++   DYYLV ++RF K+  +  A++R    N         P
Sbjct  254   YDSLDVHVGQCLSVLVVADQGPGDYYLVVSTRFTKKIHTATAVLRYAGSN-----TPPSP  308

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
               P    G AWS NQ+R+FRWNLTASAARPNPQGSYHYGEI ITRT+KL+N  +   GK 
Sbjct  309   VIPEGPSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGEINITRTIKLLNGHTVVDGKR  368

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             R+ INGVSH DPDTPLKL EYF L +     F Y+LM D P      V LAPNV  A FR
Sbjct  369   RHFINGVSHVDPDTPLKLAEYFNLSN---PVFNYNLMGDVPPALDIPVKLAPNVITAEFR  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+EIIFEN E+ IQSYH++GY+FF VG+ PGKWSPE R+ YNL+D ++RH+I V+P  W
Sbjct  426   TFIEIIFENTERSIQSYHLDGYAFFPVGMGPGKWSPESRRLYNLLDTVSRHSIHVFPKSW  485

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              A+M T DNAGMWN+RS  WE  YLGQQ Y SV SP RSLRDEYN+PDN L CGAV G P
Sbjct  486   TAIMLTFDNAGMWNLRSMNWENKYLGQQLYVSVTSPARSLRDEYNMPDNTLRCGAVVGLP  545

Query  216   LPKPYT  199
             LP  Y 
Sbjct  546   LPPSYV  551



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 350/488 (72%), Gaps = 12/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSIGMQR  138

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + +D G+ + RP G+
Sbjct  139   AAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGV  198

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK GK  + +  P FT E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  199   LINGKGGK--DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  256

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             N YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S  A+IR    +        
Sbjct  257   NTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSS-----VPP  311

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
              P       G AWSINQ RSFRWNLTASAARPNPQGSYHYG+I ITRT+K++ ++    G
Sbjct  312   APNMTEPPAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KLRY  NG+SH DP+TP+KL EYF + D     F Y+ M D P      + + PNV  A 
Sbjct  372   KLRYGFNGISHRDPETPVKLAEYFNVTD---GVFSYNQMGDVPPAVNGPLHVIPNVITAE  428

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EI+FEN EK I S H++GY+FF VG+ PGKWSPE RK YNL+D ++RH IQVYP 
Sbjct  429   FRTFIEIVFENPEKSIDSLHVDGYAFFGVGMGPGKWSPEVRKTYNLLDTVSRHTIQVYPR  488

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W A+M T DNAGMW+V S +WER+YLG+QFY SV+SP RSLRDEYN+PDN L CG V G
Sbjct  489   SWTAIMLTFDNAGMWSVHSNIWERYYLGEQFYISVVSPARSLRDEYNMPDNALRCGKVVG  548

Query  222   KPLPKPYT  199
              PLP  Y 
Sbjct  549   LPLPPSYA  556



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/486 (57%), Positives = 351/486 (72%), Gaps = 9/486 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L +W+GIQ RKNSW+DG PGT CPI+PG N+TY FQ KDQIGS+FYFP+  +Q+A
Sbjct  73    LDEPFLLSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQKA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG G I VHSR LIPVP+  PA+EFN+   DWY K +K L   LD+G++I RP G+++N
Sbjct  133   AGGMGMIRVHSRLLIPVPYADPADEFNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLIN  192

Query  1293  GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             GK+GK    K  P +FTME  KTYR+RVCN+G++ S+NFR Q HS+ LVE+EGSH VQN 
Sbjct  193   GKHGKDASGKDEPPMFTMEAGKTYRFRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNT  252

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDSLDLH+GQC SV VTA+++  DYY++ ++RF K      A++R    N  P+    P 
Sbjct  253   YDSLDLHIGQCFSVFVTADQQPGDYYILMSTRFTKYSCGGSAIVRYAGSNAPPSKDLPPA  312

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL        GK 
Sbjct  313   -----PSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLRGGTGLVNGKR  367

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYAINGVSH +P TPLKL EY+ + D +   FKY ++ D+P    S + +APNV N TFR
Sbjct  368   RYAINGVSHENPVTPLKLSEYYGIADKE---FKYSIIGDEPPNGKSLITIAPNVINCTFR  424

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              F+E+I EN E+ I +YH++GY+FF  G+  G+W+PEKR  YNL+DA +RH +QVYP  W
Sbjct  425   TFIEVILENPERSIHAYHLDGYAFFPAGMGHGEWTPEKRVTYNLLDAASRHTVQVYPKSW  484

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             +A+M T DNAGMWN+R+ +W++ YLGQQ Y SV SP RSLRDEYN+P+N L CG V   P
Sbjct  485   SAIMLTFDNAGMWNLRTLVWDKQYLGQQLYISVASPARSLRDEYNMPENALHCGNVVNLP  544

Query  216   LPKPYT  199
              P PYT
Sbjct  545   KPAPYT  550



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/499 (54%), Positives = 368/499 (74%), Gaps = 14/499 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++NVFN+LDEP L TW GIQ +KNSW DG  GT CPI PG N+TY  QVKDQIGSY Y P
Sbjct  70    VINVFNKLDEPFLLTWPGIQHKKNSWQDGVLGTNCPIPPGKNYTYYLQVKDQIGSYIYHP  129

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEE-FNVFVSDWYKKGYKTLKKILDNGQTIA  1318
             +T   RA GG+G + +HSR ++PVP++R  E+ F + + DWY + +  L K LD+G+ + 
Sbjct  130   STGFHRAAGGFGGLCIHSRSVVPVPYNRFVEDDFTLLIGDWYTRSHVELGKQLDSGKLLG  189

Query  1317  RPDGLVMNGKNGKV-----GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTL  1153
             +PDG+++NGK+G++     G+    PLFTM+  K Y+YR+CNVG++TS+NFR QGH+M L
Sbjct  190   KPDGVLINGKSGRLDYDSDGKGDNEPLFTMKAGKVYKYRICNVGVKTSLNFRIQGHTMKL  249

Query  1152  VEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGN  973
             VE+EGSH VQN Y+SLD+HVGQC +VLVTAN++ KDYYL+A++RF +   +T A++R  +
Sbjct  250   VEMEGSHVVQNEYESLDVHVGQCFTVLVTANQDPKDYYLIASTRFTRTVITTTAIVRYSD  309

Query  972   GNGGpatpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLK  793
               G  +      P      G  WS+NQFRSFRWNLTASAARPNPQGS+HYG I I RT++
Sbjct  310   SKGLASPDLPKAPV-----GWDWSLNQFRSFRWNLTASAARPNPQGSFHYGGIPINRTIR  364

Query  792   LVNTKSEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKV  613
             L NT     GK+R+A+NGVS+ + +TPLK  EY+ +    E  FKY+++ D+P  +   V
Sbjct  365   LANTAHLVNGKVRFAVNGVSYVNSETPLKFAEYYGIP---EEVFKYNVISDKPADEIENV  421

Query  612   ILAPNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAI  433
              L PNV +AT++ F+EI+ EN +  +QS+ ++GY+FFAVG+EPG W+P+KRK+YNL+DA+
Sbjct  422   TLQPNVMDATYKAFMEIVLENRQNTMQSWILDGYAFFAVGMEPGTWNPDKRKSYNLIDAV  481

Query  432   NRHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPD  253
             +R+ IQV+PNCWAA++ ++DNAGMWN+RS +WER YLGQQ Y SV   +RSLRDEYN+PD
Sbjct  482   SRYTIQVFPNCWAAILVSMDNAGMWNLRSNIWERNYLGQQLYLSVRLHKRSLRDEYNMPD  541

Query  252   NQLLCGAVKGKPLPKPYTI  196
             N LLCG V     P PY++
Sbjct  542   NALLCGIVANMSKPTPYSL  560



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/487 (57%), Positives = 352/487 (72%), Gaps = 21/487 (4%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD+PLLFTW GIQQRK+SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  104   QLDQPLLFTWHGIQQRKSSWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  163

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  1297
             A G YG I++HSR LIPVPFD PA++F   V DWY K +  L K LD G+ I RP GL++
Sbjct  164   AAGAYGLISIHSRPLIPVPFDPPADDFGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  223

Query  1296  NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  1117
             NGKN K   N   P++ +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  224   NGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  281

Query  1116  YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  937
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A+IR    N  PA      
Sbjct  282   YDSMDVHIGQCLSFLTTANQKPGDYFFIASTRFIKGVSTITAVIRYKGSNTPPAAKLPDA  341

Query  936   ppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKL  757
                   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL  ++ +  GK 
Sbjct  342   -----PDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKE  396

Query  756   RYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFR  577
             RYA+NGVSHTDP+TPLKL EYF   +  +  F+Y+L+ D P  + + + +AP+V     R
Sbjct  397   RYALNGVSHTDPETPLKLAEYF---NATKGVFEYNLVTDTPPKEGTPIKVAPSVITTEHR  453

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
              ++EI+FEN EK I ++H++GY+FFA G           K YNL+D ++RH IQVYP  W
Sbjct  454   TYIEIVFENPEKSIDTFHLDGYAFFAAG-----------KTYNLLDTVSRHTIQVYPRSW  502

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
              AVM T DNAGMWN+RS +WER+YLG+Q Y S  SP RSLRDEYN+PDN L CG V G P
Sbjct  503   TAVMLTFDNAGMWNLRSNLWERYYLGEQLYVSCTSPARSLRDEYNMPDNALRCGKVVGMP  562

Query  216   LPKPYTI  196
             LP PYTI
Sbjct  563   LPPPYTI  569



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 343/473 (73%), Gaps = 10/473 (2%)
 Frame = -2

Query  1620  IQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINVHS  1441
             +Q RKNSW DG  GT CPI PGTN+TYK+Q KDQIGS+FYFP+  + RA GGYG I+V S
Sbjct  1     MQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHRAAGGYGGISVVS  60

Query  1440  RELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKL  1261
             R LIPVPFD PA++  V + DWY K +  + K+LD G++  RP G+V+NGK+GK   +  
Sbjct  61    RLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAADP-  119

Query  1260  NPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCL  1081
              P+FT+E  KTYR RVCNVG++ S+NFR QGH M LVE+EGSHTVQ++YDSLD+HVG CL
Sbjct  120   -PMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCL  178

Query  1080  SVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPVNTEGIAWS  901
             SVLV A+++  DYY VA++RF  +  S  A+IR    +         P  P    G AWS
Sbjct  179   SVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSPAVPEPPAGWAWS  233

Query  900   INQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLRYAINGVSHTDP  721
             INQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT++L+ ++    GKL+Y  NGVSH D 
Sbjct  234   INQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDA  293

Query  720   DTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRNFVEIIFENHEK  541
             +TPLKL EYF + D     F+Y+ M D P      + + PNV  A FR F+EIIFEN EK
Sbjct  294   ETPLKLAEYFNVTD---GVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEK  350

Query  540   VIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWAAVMTTLDNAGM  361
              + S H++GY+FFAVG+ PGKWS E+RK YNL+D ++RH++QVYP  W A+M T DNAGM
Sbjct  351   SMDSVHLDGYAFFAVGMGPGKWSAEERKTYNLLDGVSRHSVQVYPRSWTAIMLTFDNAGM  410

Query  360   WNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPLPKPY  202
             WNVRS +WER YLG+Q Y SV+SP RSLRDEYN+P+N L CG V G PLP  Y
Sbjct  411   WNVRSNIWERHYLGEQLYISVVSPARSLRDEYNMPENALRCGKVVGLPLPPSY  463



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/488 (58%), Positives = 352/488 (72%), Gaps = 12/488 (2%)
 Frame = -2

Query  1656  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1477
             +LD+PLLF W+GIQ RKNSW+DG  GT CPI P TNFTYK+Q KDQIG++FYFP   +QR
Sbjct  76    QLDQPLLFHWNGIQHRKNSWMDGLLGTNCPIAPNTNFTYKWQPKDQIGTFFYFPIIGMQR  135

Query  1476  AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  1303
             A GGYG I V SR LIPVPFD P  E +  V + DWY K ++ + ++LD G+++ RP+G+
Sbjct  136   AAGGYGAITVVSRLLIPVPFDPPPPESDHVVLIGDWYTKDHEVMARMLDAGRSVGRPEGV  195

Query  1302  VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  1123
             ++NGK G   +    P+FT E  KTYR+RVCN G++ S+NFR QGH M LVE+EGSHTVQ
Sbjct  196   LINGKGGP--DAAAAPMFTFEAGKTYRFRVCNTGIKASLNFRIQGHDMKLVEMEGSHTVQ  253

Query  1122  NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  943
             ++YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S +A+IR    N        
Sbjct  254   DMYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDARSVMAVIRYAGSN-----TPP  308

Query  942   ppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGG  763
              P  P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYG+I ITRT+KL+ ++    G
Sbjct  309   SPNVPEPPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLMVSRGHIDG  368

Query  762   KLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNAT  583
             KL+Y  NGVSH D +TPLKL EYF + D     F Y+ M D P      + + PNV  A 
Sbjct  369   KLKYGFNGVSHRDTETPLKLAEYFNVTD---GVFSYNQMGDVPPAVNGPLSVIPNVITAE  425

Query  582   FRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPN  403
             FR F+EIIFEN EK + S H++GY+FF VG+ PGKWSPE RK YNL+DA++RH IQVYP 
Sbjct  426   FRTFIEIIFENPEKSMDSLHLDGYAFFGVGMGPGKWSPELRKTYNLLDAVSRHTIQVYPR  485

Query  402   CWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKG  223
              W+A+M T DNAGMWN+RS +WER YLG+Q Y SV+SP RSLRDEYN+PDN L CG V G
Sbjct  486   SWSAIMLTFDNAGMWNIRSNIWERHYLGEQLYMSVVSPARSLRDEYNMPDNALRCGKVVG  545

Query  222   KPLPKPYT  199
              P+P  Y 
Sbjct  546   LPMPPSYA  553



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/486 (57%), Positives = 344/486 (71%), Gaps = 51/486 (10%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + V+SR LIPVP+  P +       D+ KK                        
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPED-------DYTKK------------------------  163

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
                         PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  164   ------------PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  211

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA++EAK YY+VA++RF K+E STV ++     N  P+      P
Sbjct  212   DSLDVHVGQCFAVLVTADQEAKSYYMVASTRFLKKEVSTVGVMSYEGSNVQPSNVLPKAP  271

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KL NTK+   GK+R
Sbjct  272   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVR  326

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             + +NGVSH D +TPLKL EYFE+    E  FKY+++ D+P    + + + PNV N TFR 
Sbjct  327   FGLNGVSHVDTETPLKLAEYFEMS---EKVFKYNVIKDEPAAKITTLTVEPNVLNITFRT  383

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCWA  394
             FVEI+FENHE+ +QS+H++GYSFF+V  EPG W+PEKR NYNL+DA++RH +QV+P  W+
Sbjct  384   FVEIVFENHERSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQVFPKSWS  443

Query  393   AVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKPL  214
             A++ T DNAGMWN+RSE WER YLGQQ Y SVLSPE+SLRDEYNIP N  LCG VKG PL
Sbjct  444   AILLTFDNAGMWNIRSENWERRYLGQQMYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPL  503

Query  213   PKPYTI  196
             P PYTI
Sbjct  504   PTPYTI  509



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/486 (58%), Positives = 344/486 (71%), Gaps = 22/486 (5%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  79    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  138

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+TI RPDG+++N
Sbjct  139   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILIN  198

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  199   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  257

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC  V +TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  258   DSLDVHVGQCFGVTLTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  312

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +   KLR
Sbjct  313   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  372

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKNATFR  577
             YA+NGVSH DP+TPLKL EYF + D     FKYD + D PT D  K I + PNV N    
Sbjct  373   YALNGVSHIDPETPLKLAEYFGVTDK---VFKYDSISDNPTSDQIKNIKIEPNVLN----  425

Query  576   NFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVYPNCW  397
                 I     E  + ++   G+    +   PG W+PEKRKNYNL+DA++RH IQVYP CW
Sbjct  426   ----ITQPREECPVLAF---GW-LLLLRYSPGTWTPEKRKNYNLLDAVSRHTIQVYPKCW  477

Query  396   AAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAVKGKP  217
             AA++ T DN GMWN+RSE  ER YLGQQ Y SVLSPE+SLRDEYN+P++ L CG VK KP
Sbjct  478   AAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKP  537

Query  216   LPKPYT  199
                PY 
Sbjct  538   KINPYA  543



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/455 (59%), Positives = 345/455 (76%), Gaps = 9/455 (2%)
 Frame = -2

Query  1563  LPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFV  1384
             + G  F+     +DQIGSYFY+PTTSL R  GG+G + V+SR LIPVP+  P +++ V +
Sbjct  113   IQGKGFSADRLSRDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLL  172

Query  1383  SDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNV  1204
              DWY  G+  LK  LD+G+T+  P+G+++NGK+GKVG  K  PLFTM+P KTY+YR+CNV
Sbjct  173   GDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVG-GKNEPLFTMKPGKTYKYRLCNV  231

Query  1203  GLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATS  1024
             G ++++NFR Q H M LVE+EGSH +QN YDSLD+HVGQC SVLVTAN+ AKDYY+VA++
Sbjct  232   GFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVAST  291

Query  1023  RFFKQEFSTVALIRNGNGNGGpatpelppppPVNTEGIAWSINQFRSFRWNLTASAARPN  844
             RF K+E STV +IR    N   +T     P      G AWS+NQFRSFRWNLT++AARPN
Sbjct  292   RFLKKELSTVGVIRYEGSNVQASTELPKAPV-----GWAWSLNQFRSFRWNLTSNAARPN  346

Query  843   PQGSYHYGEIEITRTLKLVNTKSEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEAS  664
             PQGSYHYG+I ITR++KLVN+KS   GK+R+  NGVSH D +TPLKL EYF++    E  
Sbjct  347   PQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMS---EKV  403

Query  663   FKYDLMPDQPTGDTSKVILAPNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEP  484
             FKY+++ D+P    + + + PNV N TFR FVEIIFENHEK +QS+H++GYSFFAV  EP
Sbjct  404   FKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFHLDGYSFFAVASEP  463

Query  483   GKWSPEKRKNYNLVDAINRHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYF  304
             G+W+PEKR+NYNL+DA++RH +QVYP  W+A++ T DNAGMWN+RSE  ER YLG+Q Y 
Sbjct  464   GRWTPEKRENYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERKYLGEQLYV  523

Query  303   SVLSPERSLRDEYNIPDNQLLCGAVKGKPLPKPYT  199
             SVLSPE+SLRDEYNIP N  LCG VKG PLP  Y+
Sbjct  524   SVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPAHYS  558



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/490 (58%), Positives = 345/490 (70%), Gaps = 21/490 (4%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSV----NFRFQGHSMTLVEIEGSHTV  1126
             GK+GK G+    PLFT++P      R+  +G  T V    +FR Q H M LVE +   T 
Sbjct  196   GKSGK-GDGSDAPLFTLKPE-----RLTGLGSVTWVSDIYHFRIQNHKMKLVEWK-DRTF  248

Query  1125  QNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpe  946
                           L  +VTAN+E KDYY+VA+SRF K   +T  L+R   G G      
Sbjct  249   FKRLRLSRRSRWPVLWHIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----P  303

Query  945   lppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEG  766
                  P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT+KLVNT+ +  
Sbjct  304   ASSQLPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVD  363

Query  765   GKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI-LAPNVKN  589
             GKLR+A+NGVSHT+P+TPLKL EYF + D     FKYD + D PT +  K I + PNV N
Sbjct  364   GKLRFALNGVSHTEPETPLKLAEYFGISDK---VFKYDTITDDPTPEQIKNIKIEPNVLN  420

Query  588   ATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQVY  409
              T R FVE++FENHEK +QS+H++GYSFF+V +EPG W+PEKRKNYNL+DA++RH +QVY
Sbjct  421   ITHRTFVEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVY  480

Query  408   PNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCGAV  229
             P CWAA++ T DN GMWNVRSE  ER YLGQQ Y SVLSPE+SLRDEYN+P+  L CG V
Sbjct  481   PKCWAAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLV  540

Query  228   KGKPLP-KPY  202
             K  P P  PY
Sbjct  541   KNTPKPVNPY  550



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/488 (56%), Positives = 352/488 (72%), Gaps = 17/488 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +VNVFN+LDEP L +W+G+QQRKNSW DG PGT CPI PG N+TY+FQVKDQIG+YFYF 
Sbjct  67    VVNVFNQLDEPFLISWNGVQQRKNSWQDGMPGTNCPIPPGGNYTYQFQVKDQIGTYFYFL  126

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +TS  +A GG+G + V+SR  IPVPFD PAE++ + + DWY K +K L+K LD+ +++ +
Sbjct  127   STSFHKAAGGFGGLRVNSRMYIPVPFDPPAEDYTLLIGDWYTKSHKELRKRLDDSKSLGK  186

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P G+++NG+ GK  E       T+EP KTYR R+ NVG++TS+NFR +GH++ LVEIEGS
Sbjct  187   PCGVLINGRTGKNAET-----LTVEPGKTYRIRISNVGIKTSLNFRIEGHALLLVEIEGS  241

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVY+SLD+HVGQ  SVLVTAN+  KDY +VA++RF K   +  A++       G +
Sbjct  242   HTVQNVYESLDVHVGQSYSVLVTANQAVKDYQIVASTRFTKYILTGTAVLHYSGATEGVS  301

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                L         G+A+S+NQFRSFRWNLTASAARPNPQGSYHYG I I RT+KL ++  
Sbjct  302   DAALS-----GPTGVAFSLNQFRSFRWNLTASAARPNPQGSYHYGSIPIVRTIKLASSIG  356

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GKLRYAINGVS+    TPLKL +Y+E+   KE  +    MPD P  +  K     NV
Sbjct  357   KIEGKLRYAINGVSYKQASTPLKLADYYEM--GKEV-WCDKCMPDSPPEEEMKE--ETNV  411

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +   R+F+EI+FEN EK +Q++H+NGYSFFAVG+  G W+PE R  YNL DAI+R NIQ
Sbjct  412   VDGVHRDFIEIVFENREKTVQTWHLNGYSFFAVGMSRGTWTPESRNVYNLFDAISRSNIQ  471

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W+A++ T DNAGMW++RSE+WER YLGQQ Y  + SP  SLRDEY+IP N   CG
Sbjct  472   VYPKSWSAILLTTDNAGMWSLRSEIWERQYLGQQLYLRIPSPVHSLRDEYDIPLNTPHCG  531

Query  234   AV--KGKP  217
              V  KG+P
Sbjct  532   LVANKGEP  539



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   530 bits (1365),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 260/485 (54%), Positives = 334/485 (69%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NV+N LDEP L +W+G+QQR+NS+ DG  GT CPI PG NFTY  QVKDQIGS+FYFP
Sbjct  74    IINVYNNLDEPFLLSWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFP  133

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GG+G I + SR  IPVPF  PA +F V + DWYK  ++ LK  LD G  +  
Sbjct  134   SLAFHKAAGGFGGIKILSRPRIPVPFPDPAGDFTVLIGDWYKTDHRQLKARLDGGHKLPF  193

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG     G N    +FT+E  KTYR+R+ NVGL+ ++NFR QGHSM LVE+EG+
Sbjct  194   PDGILINGH----GPN--GAIFTVEQGKTYRFRISNVGLQNTLNFRIQGHSMKLVEVEGT  247

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQ +Y+SLD+HVGQ  SVLVT ++ AKD+Y+VA++RF  +  +T A +   N N   +
Sbjct  248   HTVQTIYESLDVHVGQSYSVLVTMDQTAKDFYIVASTRFTDKILTTTASLHYSNSNKAVS  307

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T+ I WS+NQ RS R NLTAS  RPNPQGSYHYG I ITRT+KLV++ +
Sbjct  308   GPIPGGP----TDQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAA  363

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK RYA+N VS    DTPLKL +YF++    +  F+   + D P G   K+ L  +V
Sbjct  364   QVNGKQRYAVNSVSFVPADTPLKLADYFKI----DGVFRVGSISDSPAG--KKMYLDTSV  417

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR FVEI+FENHE ++QS+HINGY+F+ VG++ G W+P+ RK YNL DA++R   Q
Sbjct  418   MGADFRAFVEIVFENHESIVQSWHINGYAFWVVGMDGGLWTPDSRKQYNLRDAVSRSTTQ  477

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWNVR+E W R YLGQQFY  V SP  S+RDEY IP N LLCG
Sbjct  478   VYPRSWTAIYIALDNVGMWNVRTEFWARQYLGQQFYLRVYSPVESVRDEYPIPKNALLCG  537

Query  234   AVKGK  220
                GK
Sbjct  538   RAAGK  542



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/490 (53%), Positives = 335/490 (68%), Gaps = 17/490 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             IVNVFN LD+P L +WSGIQQR+NSW DG  GT CPI PG NFTYKFQVKDQIGSY+YFP
Sbjct  69    IVNVFNSLDQPFLISWSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGSYYYFP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +  + +A GG+G ++V SR LIPVPF  P  +  + + DWYK  +  L++ LD G+++ +
Sbjct  129   SMYMHKAAGGFGGLSVVSRPLIPVPFPAPNGDITLLIGDWYKANHTILRRTLDMGRSLGK  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PD +V+NG+    G        T++  KTYR R+ NVGL +S+NFR QGH + LVE+EGS
Sbjct  189   PDAVVINGRGPASGAT-----ITVDQGKTYRLRISNVGLSSSLNFRIQGHKLKLVEVEGS  243

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVYDSLD+HVGQ  SVLVT ++ ++DYY+VA++RF     + +A     N      
Sbjct  244   HTVQNVYDSLDIHVGQTYSVLVTTDQPSQDYYMVASTRFTSPVLTGLATFHYSNSQ----  299

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P P   TE I WS+NQ RS RWNLTASAARPNPQGSYHYG I ITRT+KL N+  
Sbjct  300   KKVSGPIPGAPTE-IVWSLNQARSVRWNLTASAARPNPQGSYHYGNITITRTIKLANSAP  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+NGVS+    TPL+L +Y+    N    F    +PD P G +  +  A   
Sbjct  359   FINGKQRYAVNGVSYLPSATPLQLADYY----NISGVFTAGGIPDSPRGGSGYLQTA--A  412

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +  +R F+E++F+N+E  IQS+H++GYSFF VG++ G W+P  RK YNL DA++R   Q
Sbjct  413   LSVEYRAFIEVVFQNYESTIQSWHLDGYSFFVVGMDGGDWTPANRKGYNLFDAVSRCTTQ  472

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W AV+ T DNAG+WN+RS+ WER +LGQQ Y  V SP +SLRDEY+IP N LLCG
Sbjct  473   VYPNSWTAVLLTFDNAGLWNLRSQTWERQFLGQQTYVRVKSPVKSLRDEYDIPHNALLCG  532

Query  234   AVKGKP-LPK  208
                G+P LP+
Sbjct  533   KAVGRPRLPQ  542



>ref|XP_009407426.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   523 bits (1348),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/480 (52%), Positives = 334/480 (70%), Gaps = 18/480 (4%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             +++V N+LDEPLL TW+GI+QRKNSW DG  GT CPILP  NFTYKFQ KDQIG + YFP
Sbjct  66    VIDVINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPILPSGNFTYKFQTKDQIGGFTYFP  125

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T +QRA GG+G +NV+ R  IPVP+ +PA++F++ V DWY+  +K L+K LD+G ++  
Sbjct  126   STGMQRAAGGFGSLNVYQRPQIPVPYAKPADDFSLLVGDWYRASHKVLQKALDSGSSLPF  185

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PD L++NG+            F  +  KTY +R+ NVG+ TS+NFR QGH M LVE+EGS
Sbjct  186   PDDLLINGQKYTA--------FAGDQGKTYLFRISNVGMTTSINFRIQGHKMKLVEVEGS  237

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN+YDSLD+HVGQ LSVLVT ++  KDYY+VA++RF ++  +  A++  GN N   +
Sbjct  238   HTLQNIYDSLDIHVGQSLSVLVTLDQAPKDYYIVASTRFTRKVLTATAVLHYGNSNSPVS  297

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P      G+ WS+ Q R+FRWNLTASAARPNPQGSYHYG+I  +R++ L N+ +
Sbjct  298   GPIPGGP----AYGLHWSMKQARTFRWNLTASAARPNPQGSYHYGKITRSRSIMLANSAA  353

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
               GGK RYAINGVS   P TPLKL + F    N    F +D +P  P G +   +L+  V
Sbjct  354   VIGGKQRYAINGVSFVVPGTPLKLADDF----NIAGVFTWDSLPIPPAGGSP--VLSTPV  407

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
                   +FVEIIF+N E  +Q++H++GY F+ VG   GKW+   R+ YNLVDA+ RH +Q
Sbjct  408   VRFNLHDFVEIIFQNTENTMQTWHLDGYDFWVVGYGSGKWTERLRRRYNLVDAVTRHTVQ  467

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W+A++ +LDN GMWN+RS MW R YLGQQFY  V +PE+S  +EY++P N L CG
Sbjct  468   VYPNGWSAILVSLDNQGMWNLRSAMWARQYLGQQFYIRVWTPEKSYANEYDMPANALRCG  527



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   521 bits (1341),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 251/399 (63%), Positives = 307/399 (77%), Gaps = 9/399 (2%)
 Frame = -2

Query  1653  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  1474
             LDEPL FTW G+QQRKNSW DG  GT C ILPGTN+TY FQVKDQIGSYFY+PTT+L RA
Sbjct  73    LDEPLQFTWHGVQQRKNSWQDGVAGTSCHILPGTNYTYHFQVKDQIGSYFYYPTTALHRA  132

Query  1473  VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  1294
              GG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK +LD+G++I RP+G+++N
Sbjct  133   AGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYAKSHKTLKSLLDSGRSIGRPNGVLIN  192

Query  1293  GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  1114
             GK  K G+    PL+TM+P KTY+YR+CNVGL+ S+NFR QGH M LVE EGSH VQN Y
Sbjct  193   GKTAK-GDGSDQPLYTMKPGKTYKYRICNVGLKDSLNFRIQGHPMKLVETEGSHVVQNTY  251

Query  1113  DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  934
             DSLD+HVGQC +VLVTA+K+ KDYYLVA++RF K   +   +IR  NG G  +    P P
Sbjct  252   DSLDVHVGQCYTVLVTADKDPKDYYLVASTRFTKYSLTGKGIIRYTNGVGPASPELPPAP  311

Query  933   pPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKSEEGGKLR  754
                   G AWS+NQFRSFRWNLTASAARPNP+GSYHYG+I ITRT+KLVNT S+  GKLR
Sbjct  312   V-----GWAWSLNQFRSFRWNLTASAARPNPRGSYHYGQINITRTIKLVNTVSKAQGKLR  366

Query  753   YAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNVKNATFRN  574
             YAINGVSH D +TPLKL EYF + D     FKY+++ D+P  D + + LAPNV NATFR 
Sbjct  367   YAINGVSHVDGETPLKLAEYFGVADK---VFKYNIISDEPPADLNTITLAPNVVNATFRT  423

Query  573   FVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRK  457
             F+EIIFEN  K +QSY+++GYSFF V +EPGKW+PEKRK
Sbjct  424   FIEIIFENPGKTVQSYNLDGYSFFLVAVEPGKWTPEKRK  462



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/485 (54%), Positives = 326/485 (67%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             IV+VFN L+EP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGS+FYFP
Sbjct  68    IVSVFNSLNEPFLLSWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFP  127

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + + Q+A GGYG I ++SR +IPVPF  PA E+ +   DW+K+ +  L+ ILD G  +  
Sbjct  128   SLAFQKAAGGYGSIRIYSRSVIPVPFPPPAAEYTILAGDWFKQNHTDLRAILDGGHDLPF  187

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+    G N     FT++  KTYR+R+ NVGL TS+NFR QGH M LVE+EG+
Sbjct  188   PDGILINGR----GSNGYT--FTVDQGKTYRFRISNVGLVTSLNFRIQGHKMLLVEVEGT  241

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN YDS DLH+GQ  SVLVTA++ A+DYY+V ++RF  Q  +  +L+   N     A
Sbjct  242   HTLQNTYDSFDLHLGQSCSVLVTADQPARDYYIVFSTRFTSQVLTATSLLHYSN----SA  297

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                + PPP   T  I WS+NQ RS R NLTAS  RPNPQGSYHYG +  TRT++L N+  
Sbjct  298   VSVVGPPPGGPTTEIDWSLNQARSIRQNLTASGPRPNPQGSYHYGMVNTTRTIRLANSAP  357

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+N VS    DTPLKL +Y+    N +  F    MPD PTG  S   L  +V
Sbjct  358   VINGKKRYAVNSVSFVPADTPLKLADYY----NIQGVFSLGSMPDNPTG--SGGYLQTSV  411

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR F E++FEN E  +QS+HI+G+ FF VG++ G+WSP  R NYNL D I+R  +Q
Sbjct  412   MAADFRAFFEVVFENSEDTVQSWHIDGHIFFVVGMDGGQWSPASRSNYNLRDGISRCTVQ  471

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWNVRSE W R YLGQQFY  V SP  SLRDEY IP N LLCG
Sbjct  472   VYPRSWTALYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSLRDEYPIPKNALLCG  531

Query  234   AVKGK  220
                G+
Sbjct  532   RASGR  536



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   519 bits (1336),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 323/485 (67%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I++VFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSY+YFP
Sbjct  69    IISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYYFP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GGYG I + SR  IPVPFD PA +F +   DW+K+ +  LK ILD G  +  
Sbjct  129   SLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLKAILDGGNNLPF  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDGL++NG+ G  G       FT++  KTYR+R+ NVG+ TS+NFR QGH M LVE+EG 
Sbjct  189   PDGLIINGR-GSNGNT-----FTVDQGKTYRFRISNVGIATSINFRIQGHKMLLVEVEGI  242

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN Y SLD+H+GQ LSVLVTA++  +DYY+V ++RF  Q  S  +++   N  G  +
Sbjct  243   HTLQNTYSSLDIHLGQSLSVLVTADQPPQDYYIVVSTRFTSQVLSATSILHYSNSGGSVS  302

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T  + WS+ Q RSFR NLTAS  RPNPQGSYHYG I  TRT++L N+  
Sbjct  303   GPPPGGP----TTEVDWSLEQARSFRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAP  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYAIN VS   PDTPLK+ +YF++       F    + D PTG      L  +V
Sbjct  359   IINGKQRYAINSVSFLQPDTPLKVADYFKI----SGVFSVGSISDNPTGGGG--YLQTSV  412

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +A FR FVE +FEN E  +QS+H++GYSFF VG++ G+W+P  R  YNL+D ++R  +Q
Sbjct  413   MHADFRAFVEFVFENPENTLQSWHLDGYSFFVVGMDGGQWTPASRLRYNLMDTVSRCTVQ  472

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W A+   LDN GMWNVRSE W R YLGQQFY  V SP  S RDEY IP N LLCG
Sbjct  473   VYPNSWTAIYVPLDNVGMWNVRSENWARQYLGQQFYLRVYSPVNSWRDEYPIPKNALLCG  532

Query  234   AVKGK  220
                G+
Sbjct  533   RASGR  537



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   518 bits (1335),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 324/485 (67%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NVFN LD+P L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  70    IINVFNSLDQPFLISWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFP  129

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +L +A GGYG   + SR +IPVPF  PA ++ +   DWYKK +  LK ILD+G  +  
Sbjct  130   SLALHKAAGGYGGFRILSRSVIPVPFPPPAADYTILAGDWYKKNHTDLKAILDSGSDLPF  189

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDGL++NG+    G N     FT++  KTYR+R+ NVGL TS+NFR QGH + LVE+EG+
Sbjct  190   PDGLLINGR----GANGYT--FTVDQGKTYRFRISNVGLTTSINFRIQGHKLLLVEVEGT  243

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN YDSLD+H+GQ  SVLVTA++ A+DYY+VA++RF  Q  +T A++   N  G  +
Sbjct  244   HTLQNTYDSLDIHLGQSYSVLVTADQPAQDYYIVASTRFTSQVLATTAVLHYSNSAGTVS  303

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T  I WS+ Q RS R NLTAS  RPNPQGSYHYG I  TRT++L ++ S
Sbjct  304   GPLPGGP----TTQIDWSLEQARSIRRNLTASGPRPNPQGSYHYGLINTTRTIRLASSAS  359

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+N VS    DTPLKL +YF    N    F    +P  PTG      L  +V
Sbjct  360   IINGKQRYAVNSVSFIPADTPLKLADYF----NISGVFSLGSIPVGPTG--GGAYLQTSV  413

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR + EI+FEN E  +QS+HI+G++FF VG++ G+W+P  R  YNL D I+R  +Q
Sbjct  414   MAADFRGYTEIVFENPEDTLQSWHIDGHNFFVVGMDGGQWTPASRLTYNLRDTISRCTVQ  473

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W AV   LDN GMWNVRSE W R YLGQQFY  V SP +S RDEY IP N LLCG
Sbjct  474   VYPKSWTAVYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPAKSWRDEYPIPRNALLCG  533

Query  234   AVKGK  220
                G+
Sbjct  534   RAVGQ  538



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   518 bits (1335),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 257/485 (53%), Positives = 320/485 (66%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NVFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  69    IINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +    +A GG+G I + SR +IPVPF  PA +F +   DW+ K +  LK ILD+G  +  
Sbjct  129   SLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPS  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDGL++NG+    G N     FT++  KTYR R+ NVGL TS+NFR QGH M LVE+EG+
Sbjct  189   PDGLLINGR----GSNGFT--FTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGT  242

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H++QN Y SLD+H+GQ  SVLVTA++ A+DYY+V ++RF  Q  ST +++   N  G  +
Sbjct  243   HSLQNTYSSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNSAGSVS  302

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T  I WS+ Q RS R NLTAS  RPNPQGSYHYG I  TRT++L ++  
Sbjct  303   GPPPGGP----TTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAP  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+N VS   PDTPLKL +YF++       F    + D PTG      L  +V
Sbjct  359   IIDGKQRYAVNSVSFIQPDTPLKLADYFKI----SGVFSIGSIQDNPTG--GGAYLQTSV  412

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              NA FR F E++FEN E  +QS+HI+G+SFF VG++ G+W P  R  YNL D I+R  +Q
Sbjct  413   MNADFRGFAELVFENPEDTVQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQ  472

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W A+   LDN GMWNVRSE W R YLGQQFY  V SP  S RDEY IP N LLCG
Sbjct  473   VYPNSWTAIYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  532

Query  234   AVKGK  220
                G+
Sbjct  533   RALGR  537



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   518 bits (1334),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 255/485 (53%), Positives = 332/485 (68%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NV N LDEP L +W+G+QQR+NS+ DG  GT CPI PG NFTY  QVKDQIGS+FYFP
Sbjct  70    IINVQNNLDEPFLLSWNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFP  129

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GG+G I V SR  IPVPF  PA +F + + DW+K  ++ LK +LD G  +  
Sbjct  130   SLAFHKAAGGFGGIRVLSRPRIPVPFTDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPF  189

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG     G N  +  FT+E  KTYR+R+ NVGL+ S+NFR QGH M LVE+EG+
Sbjct  190   PDGILINGH----GPNGAS--FTVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGT  243

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQ +Y+SLD+HVGQ  SVLVT ++ A+D+Y+VA++RF     ST A +   N N   +
Sbjct  244   HTVQTIYESLDVHVGQSYSVLVTMDQAAQDFYIVASTRFTDNILSTTATLHYSNSNKAVS  303

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T+ I WS+NQ RS R NLTAS  RPNPQGS+HYG I ITRT+KLV++ +
Sbjct  304   GPIPAGP----TDQIDWSLNQARSIRTNLTASGPRPNPQGSFHYGLINITRTIKLVSSAA  359

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK RYA+N VS    DTPLKL +YF++       F+   +PD PTG    + L  +V
Sbjct  360   QVNGKQRYAVNSVSFVPTDTPLKLADYFKIG----GVFRVGSIPDNPTG--QNMYLDTSV  413

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A +R FVEI+FENHE ++Q++HI+GY+F+ VG+  G W+P+ R+ YNL DA++R   Q
Sbjct  414   MGADYRAFVEIVFENHENIVQTWHIDGYAFWVVGMNGGVWTPDSREEYNLRDAVSRSTTQ  473

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWNVRSE W R YLGQQFY  V +P  SLRDEY IP N LLCG
Sbjct  474   VYPKSWTAIYMALDNVGMWNVRSEFWARQYLGQQFYLRVYTPVNSLRDEYLIPKNALLCG  533

Query  234   AVKGK  220
               +G+
Sbjct  534   RAQGR  538



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   518 bits (1333),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 249/490 (51%), Positives = 337/490 (69%), Gaps = 27/490 (6%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             ++N+ N+LDEP L TW+GI+QRKNSW DG  GT CP+ P  N+TYKFQ KDQIG+Y YFP
Sbjct  72    VLNLVNKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPVPPNANYTYKFQAKDQIGTYTYFP  131

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +TSL +A GG+G +NV+ R +IPVP+  P  +F + + DWYK  +K+L++ LD+G ++A 
Sbjct  132   STSLHKAAGGFGGLNVYHRSVIPVPYPYPDGDFTLLIGDWYKTNHKSLRESLDSGNSLAF  191

Query  1314  PDGLVMNGK-----NGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLV  1150
             PDGL++NG+     NG  G             KTY +R+ NVG+ TS+NFR QGH++ LV
Sbjct  192   PDGLLINGQAHTTVNGDQG-------------KTYMFRISNVGMSTSINFRIQGHTLKLV  238

Query  1149  EIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNG  970
             EIEGSHT+QNVYD+LD+HVGQ  +VLVT N+  KDYY+VA++RF ++ F+  A++   N 
Sbjct  239   EIEGSHTLQNVYDTLDVHVGQSATVLVTLNQPPKDYYIVASTRFSRKMFTATAVLHYSNS  298

Query  969   NGGpatpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKL  790
             N   + P   PP         WS+ Q R++RWNLTA+AARPNPQGSYHYGEI  T+T+ L
Sbjct  299   NSPASGPLPSPP----IHQYHWSVKQARTYRWNLTANAARPNPQGSYHYGEITPTKTIVL  354

Query  789   VNTKSEEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVI  610
              N+ S   GKLRY +N VS+ +PDTPLKL +YF    N    +  D +   P+ +T   +
Sbjct  355   SNSASLINGKLRYTVNKVSYVNPDTPLKLADYF----NIPGIYSVDSLQSLPSDNTPSSV  410

Query  609   LAPNVKNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAIN  430
              A +V      +F+E++F+N+E   QS+H++GY F+ VG   G+W+P KR+ YNLVDA+ 
Sbjct  411   -ATSVVPTDLHDFIEVVFQNNENTTQSWHLDGYDFWVVGYGFGEWTPAKRRTYNLVDALT  469

Query  429   RHNIQVYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDN  250
             RH  QVYPN W  ++ +LDN GMWN+RS MWER YLGQQ Y  V + ERSL +EY+IPDN
Sbjct  470   RHTAQVYPNAWTGILVSLDNQGMWNLRSAMWERQYLGQQLYLRVWTSERSLANEYDIPDN  529

Query  249   QLLCGAVKGK  220
              LLCG   G+
Sbjct  530   VLLCGKAVGQ  539



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   517 bits (1331),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/484 (51%), Positives = 336/484 (69%), Gaps = 16/484 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+N+ N+LDEP L TW+GI+QRKNSW DG  GT CPI P +N+TYKFQ KDQIG+Y YFP
Sbjct  70    ILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTYSYFP  129

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T L +A GG+G +NV+ R +IP+P+  P  +F + + DWYK  +KTL++ LD+G++I  
Sbjct  130   STQLHKAAGGFGGLNVYHRSVIPIPYQNPDGDFTLLIGDWYKTNHKTLRQTLDSGKSIGL  189

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDGL++NG+            FT    KTY +R+ NVGL TS+NFR QGH++ LVE+EGS
Sbjct  190   PDGLLINGQPHST--------FTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGS  241

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+QN+YDSLD+HVGQ +S+LVT N+  KDYY+VA++RF +   +T A++   N      
Sbjct  242   HTIQNIYDSLDVHVGQSVSLLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYSNSFSS--  299

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  PP PV+     WS+ Q R++RWNLTA+AARPNPQGS+HYG+I  T+ +KL N+  
Sbjct  300   ALGPVPPSPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANSAP  359

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GKLRYA+N VS+ +PDTPLKL +YF    N    F  +L+ + P+     +  A +V
Sbjct  360   SINGKLRYAVNSVSYVNPDTPLKLADYF----NIPGIFSVNLLQNTPSSGPGYI--ATSV  413

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
                +  +F+E+IF+N+E  +QS+H++GY F+ +G   G+WS   RK YNLVDA+ RH  Q
Sbjct  414   LPTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGYGFGQWSDASRKTYNLVDALTRHTAQ  473

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A++ +LDN GMWN+RS +WER YLGQQFY  V + +RSL +EY+IP+N LLCG
Sbjct  474   VYPKSWTAILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQRSLANEYDIPNNVLLCG  533

Query  234   AVKG  223
                G
Sbjct  534   KAVG  537



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   517 bits (1331),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 329/485 (68%), Gaps = 18/485 (4%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NVFN L+EP L +W+GIQQR+NSW DG  GT CPI P  NFTYKFQ KDQIG+YFYFP
Sbjct  69    IINVFNYLNEPFLLSWNGIQQRRNSWQDGVLGTSCPIPPRRNFTYKFQAKDQIGTYFYFP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +T L +A GG+G + + SR +I +P+  PA E+   + DWYK  +  L++ LD+G+ +  
Sbjct  129   STLLHKAAGGFGGLAIASRSVISIPYPTPAGEYTALIGDWYKTNHAVLRRWLDSGRALGM  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             P+G+ +NG+   +        F ++P +TYR R+ NVGL TS+NFR QGH M LVE+EGS
Sbjct  189   PNGVHINGRGKGLST------FKVDPGRTYRLRISNVGLSTSLNFRIQGHKMKLVEVEGS  242

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQNVYDSLDLHVGQ  SVL+TA++  KDYY+VA++RF       VAL+R  N      
Sbjct  243   HTVQNVYDSLDLHVGQSCSVLITADQAPKDYYIVASTRFTNPVLYGVALLRYSNSR----  298

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P   P PP  T  I WS++Q RS RWNLTA+AARPNPQGSYHYG I+  RT+ L N+  
Sbjct  299   QPASGPLPPGPTTQIDWSLSQARSIRWNLTANAARPNPQGSYHYGLIKPARTITLANSAP  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+NGVS   PDTPLKL +YF++    +  F    + D P G    +  A  V
Sbjct  359   IINGKQRYAVNGVSFMPPDTPLKLADYFKI----QGVFNLGTISDYPRGGGGYLQTA--V  412

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              +  FR+F+EI+F+N E  IQS+HI+GYSFF  G++ G+WSP  RK YNL DA++R   Q
Sbjct  413   MSGQFRSFIEIVFQNDENTIQSWHIDGYSFFVAGMDGGQWSPASRKGYNLFDAVSRSTTQ  472

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W AV+  LDNAGMWNVRSE+W R YLGQQFY  V     + +DEY +P N L+CG
Sbjct  473   VYPNSWTAVLLMLDNAGMWNVRSEIWARQYLGQQFYMKVAG--FAGQDEYIVPRNALMCG  530

Query  234   AVKGK  220
               +G+
Sbjct  531   RARGR  535



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 328/485 (68%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NV+N L EP L +W+G+QQR+NS+ DG  GT CPI PG NFTY  QVKDQIGS++Y+P
Sbjct  71    IINVYNSLPEPFLISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYP  130

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GG+G I + SR LIPVPF  PA++F V + DWYK  +K LK ILD G  +  
Sbjct  131   SLAFHKAAGGFGGIRILSRPLIPVPFPEPADDFTVLIGDWYKANHKVLKAILDRGHKLPF  190

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+    G N+    FT +P KTYR R+ NVGL+ S+NFR QGH M LVE+EG+
Sbjct  191   PDGILVNGR----GPNQT--YFTFQPGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGT  244

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HT+Q  + SLD+HVGQ  SVLVTA++ A+DYY+  ++RF  +  +T A++   N     A
Sbjct  245   HTLQTTHSSLDVHVGQSYSVLVTADQTAQDYYIAVSTRFTTKILTTTAILHYSNS----A  300

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P P   T  I WS+NQ RS R NLTAS  RPNPQGSYHYG I +TRT+KL ++ +
Sbjct  301   KKVSGPIPGGPTTEIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINLTRTIKLESSAA  360

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK RYA+N VS    DTPLK+ +YF++       F+   MPD PTG   K+ L  +V
Sbjct  361   QVNGKQRYAVNSVSFVPADTPLKIADYFKIG----GVFRVGSMPDYPTG--KKMYLDTSV  414

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR FVEI+F+NHE ++QS+HINGYSF+ VG++ G W+P  R  YNL DA++R   Q
Sbjct  415   MGADFRAFVEIVFQNHENIVQSWHINGYSFWVVGMDGGVWTPASRNQYNLRDAVSRCTTQ  474

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWN+R+E W R YLGQQFY  V SP  S RDEY IP N LLCG
Sbjct  475   VYPKSWTAIYIALDNVGMWNIRTEFWARQYLGQQFYMRVYSPVESPRDEYPIPKNALLCG  534

Query  234   AVKGK  220
                G+
Sbjct  535   RAIGR  539



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   516 bits (1329),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 330/485 (68%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NV+N LDEP L +W+G+QQR+NS+ DG  GT CPI PG NFTY  Q KDQIG+++YFP
Sbjct  72    IINVYNNLDEPFLLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFP  131

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GG+G I + SR  IPVPF  PA +F V + DW+K  +K L+  LD G  +  
Sbjct  132   SLAFHKAAGGFGGIRILSRPRIPVPFPDPASDFTVLIGDWFKTDHKKLQAKLDRGHKLPF  191

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG     G N     FT+E  KTYR+R+ NVGL+ S+NFR QGH M LVE+EG+
Sbjct  192   PDGILINGH----GPN--GAFFTVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGT  245

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQ +Y+SLD+HVGQ  SVLVT ++ A+D+Y+VA++RF  +  ST A +   N N   +
Sbjct  246   HTVQTMYESLDVHVGQSYSVLVTMDQSAQDFYIVASTRFTDKILSTTATLHYSNSNKAVS  305

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T+ I WS+NQ RS R NLTAS  RPNPQGSYHYG I ITRT+KLV++  
Sbjct  306   GPIPGGP----TDQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAD  361

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK RYA+N VS    DTPLKL +YF++       F+   + D+PTG    + L  +V
Sbjct  362   QVKGKQRYAVNSVSFIPADTPLKLADYFKIG----GVFRVGSISDKPTG--QNMYLDTSV  415

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               + FR FVEI+FENHE ++QS+HI+GY+F+ VG++ G W+P+ RK YNL DA++R   Q
Sbjct  416   MGSDFRAFVEIVFENHESIVQSWHIDGYAFWVVGMDGGLWTPDSRKEYNLRDAVSRSTTQ  475

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWNVR++ W R YLGQQFY  V SP  S RDEY IP N LLCG
Sbjct  476   VYPRSWTAIYMALDNVGMWNVRTQFWARQYLGQQFYLRVYSPVNSPRDEYPIPKNALLCG  535

Query  234   AVKGK  220
               +GK
Sbjct  536   RAQGK  540



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   516 bits (1328),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 324/485 (67%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NV N L EP L +W+G+QQR+NS+ DG  GT CPI PG NFTY  QVKDQIGS+FYFP
Sbjct  71    IINVHNSLPEPFLISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFP  130

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             + +  +A GG+G I + SR LIPVPF  PA +F V + DWYK  +  LK ILD G  +  
Sbjct  131   SLAFHKAAGGFGGIRILSRPLIPVPFPDPAGDFTVLIGDWYKTNHTKLKAILDYGHRLPF  190

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
             PDG+++NG+    G N     FT EP KTYR R+ NVGL+ S+NFR QGH M LVE+EG+
Sbjct  191   PDGILINGR----GPNATT--FTFEPGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGT  244

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             HTVQ  Y SLD+HVGQ  SVLVTA++ A+DYY+  ++RF  +  +T A++   N     A
Sbjct  245   HTVQTTYSSLDVHVGQSYSVLVTADQAAQDYYIAVSTRFTNKVLTTTAILHYSNS----A  300

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
                  P P   T  I WS+NQ RS R NLTAS  RPNPQGSYHYG I I+RT+KL ++ +
Sbjct  301   KKVSGPIPGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAA  360

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
             +  GK RYA+N VS    DTPLKL +YF++       F+   + D PTG   K+ L  +V
Sbjct  361   QVNGKQRYAVNSVSFRPADTPLKLADYFKIG----GVFRVGSISDSPTG--KKMYLDTSV  414

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
               A FR FVEI+F+NHE ++QS+H++GYSF+ VG++ G W+P  R  YNL DA++R   Q
Sbjct  415   MGADFRAFVEIVFQNHENIVQSWHLDGYSFWVVGMDGGVWTPASRDQYNLRDAVSRCTTQ  474

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYP  W A+   LDN GMWN+R+E W R YLGQQFY  V SP  S+RDEY IP N LLCG
Sbjct  475   VYPKSWTAIYVALDNVGMWNLRTEFWARQYLGQQFYLRVYSPVMSIRDEYPIPKNALLCG  534

Query  234   AVKGK  220
                GK
Sbjct  535   RANGK  539



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   516 bits (1328),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 319/485 (66%), Gaps = 16/485 (3%)
 Frame = -2

Query  1674  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1495
             I+NVFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  69    IINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFP  128

Query  1494  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  1315
             +    +A GG+G I + SR +IPVPF  PA +F +   DW+ K +  LK ILD+G  +  
Sbjct  129   SLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPL  188

Query  1314  PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  1135
              DGL++NG+    G N     FT++  KTYR R+ NVGL TS+NFR QGH M LVE+EG+
Sbjct  189   SDGLLINGR----GSNGFT--FTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGT  242

Query  1134  HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  955
             H++QN Y SLD+H+GQ  SVLVTA++ A+DYY+V ++RF  Q  ST +++   N  G  +
Sbjct  243   HSLQNTYSSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNAAGSVS  302

Query  954   tpelppppPVNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGEIEITRTLKLVNTKS  775
              P    P    T  I WS+ Q RS R NLTAS  RPNPQGSYHYG I  TRT++L ++  
Sbjct  303   GPPPGGP----TTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAP  358

Query  774   EEGGKLRYAINGVSHTDPDTPLKLIEYFELKDNKEASFKYDLMPDQPTGDTSKVILAPNV  595
                GK RYA+N VS   PDTPLKL +YF++       F    + D PTG      L  +V
Sbjct  359   IIDGKQRYAVNSVSFIQPDTPLKLADYFKI----SGVFSIGSIQDNPTG--GGAYLQTSV  412

Query  594   KNATFRNFVEIIFENHEKVIQSYHINGYSFFAVGIEPGKWSPEKRKNYNLVDAINRHNIQ  415
              NA FR F E++FEN E  +QS+HI+G+SFF VG++ G+W P  R  YNL D I+R  +Q
Sbjct  413   MNADFRGFAELVFENPEDTVQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQ  472

Query  414   VYPNCWAAVMTTLDNAGMWNVRSEMWERFYLGQQFYFSVLSPERSLRDEYNIPDNQLLCG  235
             VYPN W A+   LDN GMWNVRSE W R YLGQQFY  V SP  S RDEY IP N LLCG
Sbjct  473   VYPNSWTAIYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  532

Query  234   AVKGK  220
                G+
Sbjct  533   RALGR  537



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4855800065831