BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21546_g1_i1 len=1198 path=[490:0-110 4272:111-231 3311:232-234
1802:235-284 3362:285-363 5552:364-383 2185:384-448 2250:449-1197]

Length=1198
                                                                      Score     E

ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             621   0.0      
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             615   0.0      
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             613   0.0      
gb|AAQ90182.1|  ntp101                                                  612   0.0      Nicotiana tabacum [American tobacco]
gb|AAQ90185.1|  ntp805                                                  609   0.0      Nicotiana tabacum [American tobacco]
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             608   0.0      
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             608   0.0      
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             608   0.0      
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             607   0.0      
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           606   0.0      Petunia x hybrida [garden petunia]
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             605   0.0      
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    602   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             601   0.0      
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             601   0.0      
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             602   0.0      
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             600   0.0      
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                592   0.0      
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                591   0.0      
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                588   0.0      
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             581   0.0      
emb|CDP18567.1|  unnamed protein product                                575   0.0      
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             573   0.0      
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             572   0.0      
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             572   0.0      
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             571   0.0      
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             570   0.0      
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             565   0.0      
gb|ABI52585.1|  pollen-specific protein                                 563   0.0      Camellia sinensis [black tea]
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             560   0.0      
gb|EPS72881.1|  pollen-specific protein                                 560   0.0      
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             559   0.0      
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             555   0.0      
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             554   0.0      
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             551   0.0      
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             550   0.0      
emb|CDP04133.1|  unnamed protein product                                550   0.0      
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             549   0.0      
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             549   0.0      
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             548   0.0      
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             547   0.0      
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             547   0.0      
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    546   0.0      
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    546   0.0      
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    546   0.0      
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             546   0.0      
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    545   0.0      
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             544   0.0      
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             543   0.0      
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                543   0.0      
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         543   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             542   0.0      
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
gb|EPS68478.1|  hypothetical protein M569_06286                         540   0.0      
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             541   0.0      
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   539   0.0      
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    540   0.0      
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             540   0.0      
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    537   0.0      
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         537   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    537   0.0      
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             537   0.0      
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             536   0.0      
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             535   0.0      
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             535   0.0      
emb|CDY23596.1|  BnaC05g39980D                                          535   0.0      
gb|AES71848.2|  L-ascorbate oxidase-like protein                        533   0.0      
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   534   0.0      
gb|AFK33666.1|  unknown                                                 531   0.0      
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         534   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   534   0.0      
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   533   0.0      
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             533   0.0      
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             533   0.0      
gb|KHN44494.1|  L-ascorbate oxidase like                                533   0.0      
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             533   0.0      
gb|AFC88081.1|  skewed-like protein                                     532   0.0      
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             532   0.0      
emb|CAN69061.1|  hypothetical protein VITISV_032605                     532   0.0      Vitis vinifera
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    531   0.0      
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    531   0.0      
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   531   0.0      
ref|XP_002523381.1|  multicopper oxidase, putative                      531   0.0      Ricinus communis
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             531   0.0      
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    530   0.0      Brassica napus [oilseed rape]
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             530   0.0      
emb|CAA47177.1|  Bplo                                                   530   0.0      Brassica napus [oilseed rape]
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             530   0.0      
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             530   0.0      
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   530   0.0      
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             530   0.0      
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         529   0.0      
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             529   0.0      
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             529   0.0      
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   528   0.0      
dbj|BAL41449.1|  SKU5 similar 1                                         528   0.0      
ref|NP_187947.1|  protein SKU5-like 11                                  528   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014658.1|  SKU5 similar 13                                    528   0.0      
emb|CDX82541.1|  BnaA03g32800D                                          528   0.0      
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             528   0.0      
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    528   0.0      
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             528   0.0      
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             528   0.0      
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             528   0.0      
emb|CDX75707.1|  BnaC03g37900D                                          527   0.0      
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             527   0.0      
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             527   0.0      
emb|CAA47178.1|  Bplo                                                   526   1e-180   Brassica napus [oilseed rape]
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       523   2e-180   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             525   3e-180   
ref|NP_175953.1|  protein SKU5 similar 12                               526   3e-180   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10549.1|  BnaC03g70650D                                          525   4e-180   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       522   5e-180   
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    525   5e-180   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    525   6e-180   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             525   7e-180   
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    524   7e-180   
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             525   7e-180   
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                525   8e-180   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             524   1e-179   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             524   1e-179   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             523   3e-179   
emb|CDY56013.1|  BnaA08g29220D                                          522   5e-179   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             522   7e-179   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             522   7e-179   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             521   8e-179   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             521   9e-179   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             520   3e-178   
ref|XP_002523382.1|  multicopper oxidase, putative                      520   3e-178   Ricinus communis
ref|NP_564697.1|  SKU5 similar 14                                       520   6e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             520   7e-178   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             519   8e-178   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             518   1e-177   
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             518   1e-177   
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   518   2e-177   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             517   4e-177   
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   516   1e-176   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             521   2e-176   
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             516   2e-176   
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             515   2e-176   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             514   4e-176   
emb|CDX75708.1|  BnaC03g37910D                                          514   8e-176   
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             514   1e-175   
emb|CDX97352.1|  BnaA02g21430D                                          511   1e-175   
emb|CDY43994.1|  BnaA05g25890D                                          513   2e-175   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             513   3e-175   
emb|CDY23597.1|  BnaC05g39970D                                          513   3e-175   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             513   3e-175   
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             512   5e-175   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             512   6e-175   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             511   7e-175   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             511   8e-175   
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             511   1e-174   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             511   1e-174   
emb|CDY43353.1|  BnaA01g29840D                                          511   1e-174   
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    511   1e-174   
emb|CDX82540.1|  BnaA03g32810D                                          511   1e-174   
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   511   2e-174   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             511   2e-174   
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             511   2e-174   
ref|NP_187948.1|  protein SKU5-like 13                                  510   3e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             509   8e-174   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             509   1e-173   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             508   1e-173   
emb|CDY24188.1|  BnaC01g37680D                                          508   1e-173   
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             508   3e-173   
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             508   3e-173   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    506   6e-173   
emb|CAA47176.1|  Bplo                                                   506   8e-173   Brassica napus [oilseed rape]
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      506   1e-172   Zea mays [maize]
gb|ACN34077.1|  unknown                                                 506   1e-172   Zea mays [maize]
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             506   2e-172   
ref|XP_007014661.1|  SKU5 similar 12                                    506   2e-172   
emb|CDY24189.1|  BnaC01g37690D                                          505   2e-172   
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             503   1e-171   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             503   1e-171   
gb|AGW80453.1|  pollen-specific protein                                 503   2e-171   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    503   2e-171   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             501   5e-171   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    502   5e-171   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             504   1e-170   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             501   2e-170   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             500   2e-170   
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             500   2e-170   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             499   5e-170   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             499   8e-170   
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             499   1e-169   
dbj|BAK05994.1|  predicted protein                                      498   2e-169   
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             498   2e-169   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             498   2e-169   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          496   5e-169   
gb|KHG05644.1|  L-ascorbate oxidase                                     496   5e-169   
gb|KHG03555.1|  L-ascorbate oxidase                                     496   1e-168   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          496   1e-168   Sorghum bicolor [broomcorn]
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             495   2e-168   
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             493   1e-167   
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    494   1e-167   
gb|KHG27164.1|  L-ascorbate oxidase                                     489   3e-167   
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             492   3e-167   
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        492   3e-167   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        491   7e-167   
emb|CDM84722.1|  unnamed protein product                                491   1e-166   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             490   2e-166   
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    490   2e-166   
dbj|BAK07214.1|  predicted protein                                      489   5e-166   
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             489   5e-166   
ref|NP_001044620.1|  Os01g0816700                                       488   1e-165   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55579.1|  hypothetical protein OsJ_03867                          488   2e-165   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71702.1|  hypothetical protein OsI_04207                          488   3e-165   Oryza sativa Indica Group [Indian rice]
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             487   3e-165   
gb|AAT01329.1|  putative L-ascorbate oxidase                            486   9e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             484   3e-164   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             483   1e-163   
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             483   1e-163   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             483   2e-163   
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        483   3e-163   
emb|CDY50029.1|  BnaA06g00300D                                          481   5e-163   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          479   4e-162   Sorghum bicolor [broomcorn]
gb|ACF86554.2|  unknown                                                 478   2e-161   Zea mays [maize]
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           477   4e-161   Zea mays [maize]
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             477   4e-161   
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           476   9e-161   Zea mays [maize]
gb|ACN26659.1|  unknown                                                 476   1e-160   Zea mays [maize]
gb|EEE64155.1|  hypothetical protein OsJ_18987                          473   2e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         473   5e-160   
gb|KHN20513.1|  L-ascorbate oxidase like                                472   6e-160   
emb|CDY49392.1|  BnaC09g53590D                                          468   2e-159   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       468   6e-159   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          466   3e-157   
gb|EEC79422.1|  hypothetical protein OsI_20394                          463   4e-157   Oryza sativa Indica Group [Indian rice]
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             459   2e-154   
gb|AAD10639.1|  putative pollen specific protein                        458   8e-154   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54363.1|  BnaC06g07290D                                          452   1e-151   
emb|CDY43352.1|  BnaA01g29830D                                          447   5e-150   
gb|ABV89619.1|  Sku5-like 11                                            447   9e-150   Brassica rapa
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             423   2e-140   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             422   9e-140   
gb|ABK25092.1|  unknown                                                 421   1e-139   Picea sitchensis
ref|XP_002524823.1|  multicopper oxidase, putative                      421   1e-139   Ricinus communis
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             421   2e-139   
gb|AGJ03718.1|  multicopper oxidase                                     421   2e-139   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             421   2e-139   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             421   3e-139   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             420   3e-139   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             420   3e-139   
ref|XP_007041705.1|  SKU5 similar 5                                     420   4e-139   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             419   6e-139   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             419   7e-139   
gb|ABR18324.1|  unknown                                                 419   7e-139   Picea sitchensis
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             419   7e-139   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             419   8e-139   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             419   8e-139   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  417   1e-138   
emb|CDP10787.1|  unnamed protein product                                419   1e-138   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             419   1e-138   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           419   1e-138   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    418   1e-138   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             418   1e-138   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         417   5e-138   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             416   1e-137   
gb|KHN36198.1|  L-ascorbate oxidase like                                416   1e-137   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             416   2e-137   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   416   2e-137   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    416   2e-137   
ref|XP_002528421.1|  multicopper oxidase, putative                      416   2e-137   Ricinus communis
gb|KHN42054.1|  L-ascorbate oxidase like                                415   2e-137   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             415   2e-137   
emb|CDY18626.1|  BnaA09g07690D                                          415   3e-137   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             415   3e-137   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             415   4e-137   
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             415   5e-137   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         414   6e-137   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             414   7e-137   
emb|CDY01453.1|  BnaA07g12260D                                          414   8e-137   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             414   8e-137   
gb|KHG21949.1|  L-ascorbate oxidase                                     414   8e-137   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         414   9e-137   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             414   9e-137   
emb|CDX81353.1|  BnaC09g07640D                                          414   1e-136   
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             413   2e-136   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             413   2e-136   
gb|EPS74059.1|  hypothetical protein M569_00695                         413   3e-136   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         413   3e-136   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             412   3e-136   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             412   3e-136   
emb|CBI18560.3|  unnamed protein product                                412   4e-136   
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           409   4e-136   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             412   4e-136   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             412   4e-136   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             412   7e-136   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          412   7e-136   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             411   8e-136   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          411   9e-136   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             411   9e-136   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-135   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-135   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             411   1e-135   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   411   1e-135   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             410   1e-135   
gb|KHM99211.1|  L-ascorbate oxidase like                                410   2e-135   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-135   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-135   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-135   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-135   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             410   3e-135   
gb|KEH29685.1|  multi-copper oxidase-like protein                       410   4e-135   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-135   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-135   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             410   4e-135   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             409   5e-135   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             410   5e-135   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             409   5e-135   
emb|CDP19581.1|  unnamed protein product                                409   5e-135   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             409   6e-135   
ref|XP_002522337.1|  multicopper oxidase, putative                      409   6e-135   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             409   6e-135   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             409   6e-135   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             409   7e-135   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             409   7e-135   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             409   7e-135   
gb|KHG11003.1|  L-ascorbate oxidase                                     409   7e-135   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    409   7e-135   
gb|KHN33820.1|  L-ascorbate oxidase like                                409   7e-135   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           409   7e-135   
gb|KEH20499.1|  multi-copper oxidase-like protein                       409   9e-135   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           409   9e-135   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               409   1e-134   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             408   1e-134   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             408   2e-134   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             408   2e-134   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             408   2e-134   
gb|KHG03845.1|  L-ascorbate oxidase                                     408   2e-134   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    408   3e-134   
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                407   3e-134   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             407   3e-134   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             407   4e-134   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             407   4e-134   
gb|AGE09595.1|  SKU5-like protein                                       406   4e-134   
gb|KEH36280.1|  multi-copper oxidase-like protein                       407   5e-134   
gb|KHG04142.1|  L-ascorbate oxidase                                     407   5e-134   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    407   5e-134   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             407   5e-134   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   8e-134   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             406   1e-133   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    404   1e-133   
gb|KHN44868.1|  L-ascorbate oxidase like                                404   1e-133   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-133   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-133   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             406   2e-133   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-133   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             405   2e-133   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             405   2e-133   
gb|KEH20500.1|  multi-copper oxidase-like protein                       405   2e-133   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                405   2e-133   
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-133   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-133   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-133   
gb|ACJ85585.1|  unknown                                                 405   3e-133   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             405   3e-133   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-133   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             405   3e-133   
gb|KHG25743.1|  L-ascorbate oxidase                                     405   3e-133   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             404   4e-133   
gb|AFK35121.1|  unknown                                                 405   4e-133   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             404   5e-133   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             404   5e-133   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    404   5e-133   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                405   5e-133   
gb|KEH40258.1|  multi-copper oxidase-like protein                       404   5e-133   
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             404   5e-133   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             404   6e-133   
ref|XP_002518462.1|  multicopper oxidase, putative                      404   6e-133   
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             404   6e-133   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             404   6e-133   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             404   7e-133   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             404   8e-133   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             404   9e-133   
gb|KHG02352.1|  L-ascorbate oxidase                                     404   9e-133   
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                404   1e-132   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             404   1e-132   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             404   1e-132   
emb|CDY43557.1|  BnaC02g16540D                                          403   1e-132   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             403   1e-132   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    403   1e-132   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             403   1e-132   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-132   
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    403   2e-132   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             403   2e-132   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-132   
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    400   2e-132   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         403   2e-132   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-132   
emb|CAA65634.1|  PS60                                                   403   2e-132   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   402   2e-132   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             403   2e-132   
gb|AGT57427.1|  ascorbate oxidase                                       402   2e-132   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             402   2e-132   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                402   2e-132   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             402   3e-132   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             402   3e-132   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             402   3e-132   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     404   3e-132   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             402   4e-132   
ref|XP_002866726.1|  predicted protein                                  402   4e-132   
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   400   4e-132   
dbj|BAK04971.1|  predicted protein                                      402   4e-132   
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     400   4e-132   
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             402   4e-132   
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             399   5e-132   
gb|ABK95805.1|  unknown                                                 402   5e-132   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          402   5e-132   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             402   5e-132   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             402   5e-132   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             402   6e-132   
gb|KHG07318.1|  L-ascorbate oxidase                                     401   6e-132   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             401   7e-132   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    402   7e-132   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             401   7e-132   
emb|CBI18561.3|  unnamed protein product                                403   8e-132   
dbj|BAB08634.1|  pectinesterase like protein                            401   1e-131   
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           399   1e-131   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         401   1e-131   
ref|NP_001147597.1|  LOC100281206 precursor                             401   1e-131   
gb|KHF99506.1|  L-ascorbate oxidase                                     401   1e-131   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             401   1e-131   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     401   1e-131   
ref|NP_569041.1|  protein SKU5 similar 17                               401   1e-131   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             401   1e-131   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          400   2e-131   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             400   2e-131   
ref|NP_001058365.1|  Os06g0678800                                       400   2e-131   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         400   2e-131   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         400   2e-131   
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             400   2e-131   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             400   2e-131   
gb|AAM61328.1|  pectinesterase-like protein                             400   2e-131   
emb|CDP07321.1|  unnamed protein product                                400   3e-131   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             400   3e-131   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             400   3e-131   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             400   4e-131   
ref|NP_001132891.1|  uncharacterized protein LOC100194388               395   4e-131   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             399   6e-131   
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             399   6e-131   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             399   6e-131   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             399   6e-131   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             399   7e-131   
gb|EEC82126.1|  hypothetical protein OsI_26158                          399   7e-131   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             399   7e-131   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             399   7e-131   
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             398   8e-131   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             398   1e-130   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   399   1e-130   
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    398   1e-130   
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           398   1e-130   
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     395   1e-130   
gb|ABK25324.1|  unknown                                                 398   1e-130   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     397   1e-130   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             398   1e-130   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-130   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   398   2e-130   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-130   
ref|NP_173604.1|  SKU5 similar 7 protein                                398   2e-130   
gb|KHN21220.1|  L-ascorbate oxidase like                                398   2e-130   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-130   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             398   2e-130   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             397   2e-130   
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             398   2e-130   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          398   2e-130   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    398   2e-130   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             397   2e-130   
dbj|BAJ91397.1|  predicted protein                                      397   3e-130   
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             397   3e-130   
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             397   3e-130   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        397   3e-130   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             397   3e-130   
gb|KHG21048.1|  L-ascorbate oxidase                                     397   4e-130   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             397   4e-130   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             397   4e-130   
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             397   4e-130   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             397   4e-130   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    397   4e-130   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             397   5e-130   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             396   6e-130   
gb|ACL53812.1|  unknown                                                 397   6e-130   
dbj|BAC83966.1|  putative PS60                                          397   6e-130   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             396   7e-130   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             396   9e-130   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             396   9e-130   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             396   1e-129   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    396   1e-129   
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             395   1e-129   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             395   1e-129   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             395   1e-129   



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/392 (75%), Positives = 341/392 (87%), Gaps = 1/392 (0%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TWSGIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFP+T L RA
Sbjct  77    LDEPLLLTWSGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPSTGLHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G ++VHSR LIP+PFD+PAEE+NVF+ DWY KG++TLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGAVDVHSRNLIPIPFDKPAEEYNVFLGDWYNKGHRTLKKILDGGRTIGRPDGIHIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKATEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQCLSVLVTA++E KDYY+V +SRF KQE S+VA++R  NG  GPA+ ELP P
Sbjct  257   DSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQELSSVAILRYANGK-GPASSELPAP  315

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS++Q  GKLR
Sbjct  316   PPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +A+NG+SH D DTPLKL E+F +P + FKYD+M D PP +L KVT++PNV NATFRNFVE
Sbjct  376   FALNGISHMDTDTPLKLVEFFGVPEKTFKYDLMADEPPSDLSKVTISPNVKNATFRNFVE  435

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQTYHLDG+SFFAVGIEPGKWSP
Sbjct  436   IIFENEEKTIQTYHLDGYSFFAVGIEPGKWSP  467



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/392 (74%), Positives = 339/392 (86%), Gaps = 1/392 (0%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L RA
Sbjct  77    LDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTGLHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+KTLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG  GPA+ ELP P
Sbjct  257   DSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGK-GPASSELPTP  315

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS++Q  GKLR
Sbjct  316   PPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +A+NG+SH D DTPLKL E+F +P + FKYD++ D PP +L KVT++PNV NATFRNFVE
Sbjct  376   FALNGISHMDTDTPLKLVEFFGVPEKTFKYDLIADEPPSDLSKVTISPNVKNATFRNFVE  435

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQTYHLDG+SFFAV IEPGKWSP
Sbjct  436   IIFENQEKTIQTYHLDGYSFFAVSIEPGKWSP  467



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/391 (75%), Positives = 336/391 (86%), Gaps = 2/391 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYGPINVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKK+LD G T+ RPDG+++N
Sbjct  134   AGGYGPINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQE S+VA+IR  NG  GPA+PELP  
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQELSSVAIIRYANGK-GPASPELPAS  311

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K++NS  Q NGKLR
Sbjct  312   PPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIINSMGQVNGKLR  371

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NG+SH+D +TPLKL EYF    + FKYD+M D  P +  K+TVAPNV NAT+RNFVE
Sbjct  372   YGLNGISHSDTETPLKLVEYFGAADKTFKYDLMADEAPADPSKLTVAPNVKNATYRNFVE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             IIFENHEK+I+TYHLDG+SFFAV +EPGKWS
Sbjct  432   IIFENHEKSIRTYHLDGYSFFAVAVEPGKWS  462



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/392 (74%), Positives = 338/392 (86%), Gaps = 1/392 (0%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L RA
Sbjct  77    LDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTGLHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+KTLKKILD G+TI RPDG+ +N
Sbjct  137   AGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+     LFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNVY
Sbjct  197   GKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVY  256

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG  GPA+ ELP P
Sbjct  257   DSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGK-GPASSELPTP  315

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS++Q  GKLR
Sbjct  316   PPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLR  375

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +A+NG+SH D DTPLKL E+F +P + FKYD++ D PP +L KVT++ NV NATFRNFVE
Sbjct  376   FALNGISHMDTDTPLKLVEFFGVPEKTFKYDLIADEPPSDLSKVTISSNVKNATFRNFVE  435

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQTYHLDG+SFFAV IEPGKWSP
Sbjct  436   IIFENQEKTIQTYHLDGYSFFAVSIEPGKWSP  467



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/394 (75%), Positives = 342/394 (87%), Gaps = 4/394 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+    PLFTME  KTYRYRVCN G+RTSVNFR QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  460
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG  GPA+ +LP 
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGK-GPASSDLPA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK+VNS+T+ +GKL
Sbjct  314   PPPENTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKL  373

Query  279   RYAINGVSHTD-PDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRN  106
             R+A+NG+SHT+  +TP KLAEYF +  ++FKYD+M D P  D+L KVTVAPN+ NATFRN
Sbjct  374   RFALNGISHTNAAETPFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRN  433

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             FVEIIFEN EKTIQTYHLDG+SFFAV IEPGKWS
Sbjct  434   FVEIIFENREKTIQTYHLDGYSFFAVAIEPGKWS  467



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/393 (74%), Positives = 337/393 (86%), Gaps = 2/393 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L R
Sbjct  74    QLDEPLLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++
Sbjct  134   AAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIII  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+
Sbjct  194   NGKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNI  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC SVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG  GPA+PELP 
Sbjct  253   YDSLDLHVGQCFSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGK-GPASPELPT  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+ NSK+Q +GKL
Sbjct  312   PPPENTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKL  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RY +NG+SHTD +TPLKL EYF    + FKYD+M D  P +  K+T+  NV NAT+RNFV
Sbjct  372   RYGLNGISHTDGETPLKLVEYFGATDKAFKYDLMADEAPADATKLTITANVKNATYRNFV  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTI+TYHLDG+SFFAV +EPG+WSP
Sbjct  432   EIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSP  464



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/393 (74%), Positives = 340/393 (87%), Gaps = 2/393 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G INVHSR LIPVPFD PA++++VFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+    PL+ ME  KTYRYR CNVG+RTSVN R QGH M LVEIEGSHTVQNVY
Sbjct  195   GKSVKVGDKAAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  460
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ E S+V++IR  NG  GPA+ +LP 
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYTNGK-GPASSDLPA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK+VNS+++ +GKL
Sbjct  314   PPPENTKGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NG+SHTD +TP KLAEYF    ++FKYD+M D P  + +KVTVA N+ NATFRNFV
Sbjct  374   RYALNGISHTDSETPFKLAEYFGATDKVFKYDLMDDEPSTSSDKVTVASNIKNATFRNFV  433

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTIQTYHLDG+SFFAVG+EPGKW+P
Sbjct  434   EIIFENHEKTIQTYHLDGYSFFAVGVEPGKWTP  466



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/394 (75%), Positives = 342/394 (87%), Gaps = 4/394 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+    PLFTME  KTYRYRVCN G+RTSVNFR QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSVKVGDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  460
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG  GPA+ +LP 
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGK-GPASSDLPA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK+VNS+++ +GKL
Sbjct  314   PPPENTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKL  373

Query  279   RYAINGVSHTD-PDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRN  106
             R+A+NG+SHT+  +TP KLAEYF +  ++FKYD+M D P  D+L KVTVAPN+ NATFRN
Sbjct  374   RFALNGISHTNAAETPFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRN  433

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             FVEIIFEN EKTIQTYHLDG+SFFAV IEPGKWS
Sbjct  434   FVEIIFENREKTIQTYHLDGYSFFAVAIEPGKWS  467



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/391 (74%), Positives = 333/391 (85%), Gaps = 2/391 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG INVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKK+LD G T+ RPDG+++N
Sbjct  134   AGGYGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN R QGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNVRLQGHPMKLVELEGSHTVQNIY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQCLSVLVTAN+E KDYYLV +SRF KQE S+VA+IR  NG  GPA+PELP  
Sbjct  253   DSLDIHVGQCLSVLVTANQEPKDYYLVVSSRFLKQELSSVAIIRYANGK-GPASPELPAS  311

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS  Q NGKLR
Sbjct  312   PPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSMGQVNGKLR  371

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NG+SH+D +TPLKL EYF    + FKYD+M D  P +  K+TVAPNV N T+RNFVE
Sbjct  372   YGLNGISHSDTETPLKLVEYFGAADKSFKYDLMADEAPADPSKLTVAPNVKNTTYRNFVE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             IIFENHEK+I+TYHLDG+SFFAV +EPG+WS
Sbjct  432   IIFENHEKSIRTYHLDGYSFFAVAVEPGRWS  462



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/394 (74%), Positives = 336/394 (85%), Gaps = 3/394 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTT L R
Sbjct  76    HLDEPLLITWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTDLHR  135

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+GPINVHSR LIP+PFD PA E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +
Sbjct  136   AAGGFGPINVHSRNLIPIPFDSPAAEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHI  195

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GKVG+N   PLFTME  KTYRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQNV
Sbjct  196   NGKSGKVGDNAAEPLFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNV  255

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelp  463
             Y+SLDLHVGQCLSVLVTA++E K YY+V +SRF KQ E S+VA++R  NG  GPA+ +LP
Sbjct  256   YESLDLHVGQCLSVLVTADQEPKGYYMVVSSRFLKQAELSSVAIVRYANGK-GPASSDLP  314

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
              PPP + EGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+ NS++Q  GK
Sbjct  315   APPPDNTEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIANSRSQVGGK  374

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
             LR+A+NG+SH+  +TP KLAEYF    ++FKYD+M D PP   +KVTV  N+ NAT+RN+
Sbjct  375   LRFALNGISHSPAETPFKLAEYFGATDKVFKYDLMADEPPSG-DKVTVDHNIKNATYRNY  433

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFEN EKTIQTYHLDG+SFFAV IEPGKWSP
Sbjct  434   VEIIFENREKTIQTYHLDGYSFFAVAIEPGKWSP  467



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/393 (74%), Positives = 338/393 (86%), Gaps = 2/393 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G INVHSR LIPVPFD PA++++VFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE    PL+ ME  KTYRYR CNVG+RTSVN R QGH M LVEIEGSHTVQNVY
Sbjct  195   GKSEKVGEKVAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  460
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ E S+V++IR  NG  GPA+ +LP 
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYVNGK-GPASSDLPA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK+VNS+T+ +GKL
Sbjct  314   PPPENTQGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NG+SHTD +TP KLAEYF    ++FKYD+M D P    +KVT+A N+ NATFRNFV
Sbjct  374   RYALNGISHTDSETPFKLAEYFGATDKVFKYDLMPDQPSTPDDKVTIASNIKNATFRNFV  433

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EI+FENHEKTIQTYHLDG+SFFAV +EPGKW+P
Sbjct  434   EIVFENHEKTIQTYHLDGYSFFAVAVEPGKWTP  466



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/392 (74%), Positives = 334/392 (85%), Gaps = 2/392 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYSYFPTTALHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++N
Sbjct  134   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG  GPA+PELP P
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGK-GPASPELPTP  311

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+ NS +Q  GKLR
Sbjct  312   PPENTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLR  371

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NG+SHT+ +TPLKL EYF    + FKYD+M D  P +  K+T+A NV NAT+RNFVE
Sbjct  372   YGLNGISHTNGETPLKLVEYFGATNKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEKTI+TYHLDG+SFFAV +EPG+WSP
Sbjct  432   IIFENHEKTIRTYHLDGYSFFAVAVEPGRWSP  463



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/395 (74%), Positives = 339/395 (86%), Gaps = 4/395 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+PLL TW+G+QQRKNSW DGTPGTMCPI+PGTNFTY+FQVKDQIGS+FYFPTT L RA
Sbjct  75    LDDPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G INVHSR LIPVPFD PA+E+NVFV DWY KGYK+LKKILD G+TI RPDG+ +N
Sbjct  135   AGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+    PLFTME  KTYRYR+CN G+RTSVN R QGH M LVE+EGSHTVQNVY
Sbjct  195   GKSLKVGDKVAEPLFTMEAGKTYRYRMCNAGMRTSVNVRIQGHPMKLVEMEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQ-EFSTVALIRNGNGNGGpatpelpp  460
             +SLDLHVGQCLSVLVTA++E KDYY++ +SRF KQ + S+VA+IR  NG  GPA+ +LP 
Sbjct  255   ESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGK-GPASSDLPA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK+VNS+++ +GKL
Sbjct  314   PPPENTQGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKL  373

Query  279   RYAINGVSHTDP-DTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRN  106
             R+A+NG+SHT   +TP KLAEYF    +LFKYD+M D P  ++L KVTV PN+ NATFRN
Sbjct  374   RFALNGISHTAAGETPFKLAEYFGATDKLFKYDLMADEPQTEDLNKVTVVPNIKNATFRN  433

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             FVEIIFEN EKTIQTYHLDG+SFFAV IEPG+WSP
Sbjct  434   FVEIIFENREKTIQTYHLDGYSFFAVAIEPGRWSP  468



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/392 (74%), Positives = 334/392 (85%), Gaps = 2/392 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+G+Q RKNSW DGT GTMCPI+PG NFTY+FQVKDQIGSY+YFPTT+L RA
Sbjct  74    LDEPFLFTWNGVQHRKNSWQDGTSGTMCPIMPGQNFTYRFQVKDQIGSYYYFPTTALHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI R DG+++N
Sbjct  134   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRADGIIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE K   LFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  194   GKSAKVGEAK-ESLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG G PA+PELP P
Sbjct  253   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTP  311

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+ NSK+Q +GKLR
Sbjct  312   PPENTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLR  371

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NG+SHTD +TPLKL EYF    + FKYD+M D  P +  K+T+A NV NAT+RNFVE
Sbjct  372   YGLNGISHTDSETPLKLVEYFGATDKAFKYDLMADEAPADSTKLTIAANVKNATYRNFVE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEKTI+TYHLDG+SFFAV +EPG+WSP
Sbjct  432   IIFENHEKTIRTYHLDGYSFFAVAVEPGRWSP  463



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/392 (74%), Positives = 334/392 (85%), Gaps = 2/392 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+G+Q RKNSW DGTPGTMCPI+PG NFTY+FQVKDQIGSY YFPTT+L RA
Sbjct  109   LDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYSYFPTTALHRA  168

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG +NVHSR LIPVPFD PA+E+NVFV DWY KG+KTLKKILD G+TI RPDG+++N
Sbjct  169   AGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIIN  228

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVGE K  PLFTME  KTYRYR CN+G+R+SVN RFQGH M LVE+EGSHTVQN+Y
Sbjct  229   GKSAKVGEAK-EPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIY  287

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++E KDYYLV +SRF KQ  S+VA+IR  NG  GPA+PELP P
Sbjct  288   DSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGK-GPASPELPTP  346

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PP + EGIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+ NS +Q  GKLR
Sbjct  347   PPENTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLR  406

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NG+SHT+ +TPLKL EYF    + FKYD+M D  P +  K+T+A NV NAT+RNFVE
Sbjct  407   YGLNGISHTNGETPLKLVEYFGATDKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVE  466

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEKTI+TYHLDG+SFFAV +EPG+WSP
Sbjct  467   IIFENHEKTIRTYHLDGYSFFAVAVEPGRWSP  498



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/400 (71%), Positives = 334/400 (84%), Gaps = 8/400 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLL TW+GIQQRKNSW DGTPGTMCPI+PGTNFTY FQVKDQIGS+FYFPTTSL R
Sbjct  78    KLDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYFPTTSLHR  137

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G ++VHSR LIP+PFD+PA+E+NVF+ DWY KG+K LKK LD G+TI RPDG+ +
Sbjct  138   ASGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKALKKTLDGGRTIGRPDGIHI  197

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+ K+G+ K  PLF+ME  K YRYR+CNVG+RTSVN R QGH+M LVE+EGSHTVQN+
Sbjct  198   NGKSNKLGD-KAEPLFSMEAGKIYRYRMCNVGMRTSVNVRIQGHAMKLVEMEGSHTVQNM  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQCLSVLVTA++E KDYY+V +SRF KQ  S+VA++R  NG G  +T     
Sbjct  257   YDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQAISSVAILRYANGKGVGSTSISDH  316

Query  459   ppPA---HKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQAN  289
              P     + +GIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K+VNS++Q N
Sbjct  317   LPTPPPNNTQGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSRSQVN  376

Query  288   GKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP----DNLEKVTVAPNVVN  121
             GKLR+A+NG+SH D DTPLKL EYF +  + FKYD+M D PP    +N + VT+APNV N
Sbjct  377   GKLRFALNGISHMDSDTPLKLVEYFGVAEKTFKYDVMGDEPPTPSSNNNKVVTIAPNVKN  436

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ATFRNFVEIIFEN EKTIQTYHLDG+SFFAVGIEPGKW P
Sbjct  437   ATFRNFVEIIFENEEKTIQTYHLDGYSFFAVGIEPGKWKP  476



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/392 (72%), Positives = 329/392 (84%), Gaps = 1/392 (0%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW GIQQRKNSW DGTPGTMCPILPGTN+TYKFQVKDQIGSY YFPTT LQRA
Sbjct  75    LDEPLLLTWGGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYFPTTGLQRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G + VHSRELIPVPFD PA+EF V + DWY KG+KTLKKILD+G++I +PDG+ +N
Sbjct  135   SGGMGMLQVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKKILDSGRSIGKPDGIQIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ KVG+    PL  MEP KTYRYRVCNVG++ SVNFRFQGH+M LVE+EGSHTVQNVY
Sbjct  195   GKSSKVGDVAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTAN+  KDYYLV +SRF KQ  S+VA+I+  N NG  A+  +PPP
Sbjct  255   DSLDLHVGQCLSVLVTANQAPKDYYLVVSSRFSKQVMSSVAVIKYKNANGA-ASTVIPPP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             P  ++ GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+ N+    +GKLR
Sbjct  314   PAENRVGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANTHAVVDGKLR  373

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + ING+SH + +TPLKLAEYF +  ++F Y++MKD P +   K+ VAP+VVNATFRNFVE
Sbjct  374   FGINGISHVNTETPLKLAEYFGLGDKVFTYNLMKDEPTEGDNKLVVAPSVVNATFRNFVE  433

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQT+HLDG+SFFAV +EPG+WSP
Sbjct  434   IIFENREKTIQTWHLDGYSFFAVAVEPGRWSP  465



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/392 (71%), Positives = 327/392 (83%), Gaps = 1/392 (0%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+GIQQRKNSW DGTPGTMCPILPGTN+TYKFQVKDQIGSY YFPTT LQRA
Sbjct  75    LDEPLLLTWAGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYFPTTGLQRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G + VHSRELIPVPFD PA+EF V + DWY KG+KTLK+ILD+G++I +PDG+ +N
Sbjct  135   SGGMGMLKVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKRILDSGRSIGKPDGIQIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+  VG+    PL  MEP KTYRYRVCNVG++ SVNFRFQGH+M LVE+EGSHTVQNVY
Sbjct  195   GKSSSVGDAAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLHVGQCLSVLVTA++  KDYYLV +SRF K+  STVA+IR  NGNG  +    PPP
Sbjct  255   DSLDLHVGQCLSVLVTADQAPKDYYLVVSSRFSKKVMSTVAVIRYKNGNGAASLSIPPPP  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                ++ GIAWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+ NS    +GKLR
Sbjct  315   AE-NRAGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIANSHAVVDGKLR  373

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + ING+SH + +TPLKLAEYF +  ++F Y++MKD P +   K+ +AP+VVNATFRNFVE
Sbjct  374   FGINGISHVNTETPLKLAEYFGLGDKVFTYNLMKDEPTEGDNKLALAPSVVNATFRNFVE  433

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQT+HLDG+SFFAV +EPG+W+P
Sbjct  434   IIFENREKTIQTWHLDGYSFFAVAVEPGRWAP  465



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/393 (73%), Positives = 332/393 (84%), Gaps = 1/393 (0%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEPLLFTW+GIQQRKNSW+DGT GTMCPILPG NFTYKFQVKDQIGSYFYFPTT+  R
Sbjct  77    HLDEPLLFTWTGIQQRKNSWMDGTLGTMCPILPGQNFTYKFQVKDQIGSYFYFPTTAFHR  136

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + +HSR+LIPVPFD PA+EF V + DWY KG+KTLKKILD+G TI  P+G+ +
Sbjct  137   AAGGMGMLQIHSRDLIPVPFDTPADEFAVLLGDWYNKGHKTLKKILDSGATIGLPNGIHI  196

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++GKVG   L PL  +EP KTYRYRVCNVGLRTS+NFRFQ H M LVE+EGSHTVQNV
Sbjct  197   NGQSGKVGSAPLTPLAIVEPGKTYRYRVCNVGLRTSINFRFQSHIMKLVEVEGSHTVQNV  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLH GQC+SVLVTA++  KDYYLVA+SRF K+  S+VA+IR  NG G PA+PELPP
Sbjct  257   YDSLDLHAGQCVSVLVTADQAPKDYYLVASSRFSKKPLSSVAIIRYANGKGAPASPELPP  316

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP +  GIAWS+NQFRS+RWNLTASAARPNPQGSYHYG+INITRT K+ NS+ Q NGKL
Sbjct  317   PPPENTAGIAWSVNQFRSYRWNLTASAARPNPQGSYHYGKINITRTIKIANSRYQVNGKL  376

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH + +TPLKLAEYF +  + F YD++KD  P N +KV +AP+VVNATFRNFV
Sbjct  377   RFGINGVSHIESETPLKLAEYFGLADKAFNYDLVKDE-PSNDKKVVLAPSVVNATFRNFV  435

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN+E TIQT+HLDG+SFFAV IE GKW+P
Sbjct  436   EIIFENNENTIQTWHLDGYSFFAVAIEAGKWNP  468



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/393 (71%), Positives = 332/393 (84%), Gaps = 2/393 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+G+QQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT L R
Sbjct  74    QLDEPFLLTWAGVQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTGLHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G I +HSR LIP+PFD+PA+E+ V + DWY KG+K+LK ILD+G++I RPDG+ +
Sbjct  134   ASGGMGMIQIHSRNLIPIPFDKPADEYPVLLGDWYNKGHKSLKNILDSGRSIGRPDGIQI  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E  KTYR+RVCNVGLR SVNFR Q HSMT+VE+EGSHTVQNV
Sbjct  194   NGQSSKVGDANAKPLFTFEAGKTYRFRVCNVGLRLSVNFRIQAHSMTVVEVEGSHTVQNV  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGN GPA+PELPP
Sbjct  254   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGN-GPASPELPP  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP +  GIAWSI+QFRSFRWNLTASAARPNPQGSY YG+INITRT KLVN+++ +NGKL
Sbjct  313   PPPQNTMGIAWSISQFRSFRWNLTASAARPNPQGSYKYGKINITRTIKLVNTRSSSNGKL  372

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +   KV VAPNVVN T+RNFV
Sbjct  373   RFGINGVSHVDTETPLKLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFV  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTIQT+HLDG+SFFAV IEPG+WSP
Sbjct  432   EIIFENHEKTIQTWHLDGYSFFAVAIEPGRWSP  464



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/394 (70%), Positives = 325/394 (82%), Gaps = 3/394 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLL TW+G+QQRKNSW DGT GTMCPILPG N+TY FQVKDQIGSYFY+PT  LQ+
Sbjct  74    QLDEPLLLTWAGVQQRKNSWQDGTLGTMCPILPGQNYTYHFQVKDQIGSYFYYPTVGLQK  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG GP+NVHSR+LIPVPFD PA+E+NV V DWY KG+K LK +LD+G+++ RPDG+ +
Sbjct  134   AAGGMGPLNVHSRDLIPVPFDWPADEYNVLVGDWYTKGHKALKNMLDSGRSLGRPDGIQI  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+ KVG+N + PLFTMEP KTYRYRVCNVGL+TS+NFR QGH + LVEIEGSHTVQ  
Sbjct  194   NGKSAKVGDN-VEPLFTMEPGKTYRYRVCNVGLKTSINFRIQGHPLKLVEIEGSHTVQYD  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             +DSLD+HVGQCLSVLVTA+KE KDYY VA+SRF +   S+V +IR  NG G  +    P 
Sbjct  253   FDSLDVHVGQCLSVLVTADKEPKDYYFVASSRFIQAPLSSVGIIRYTNGKGPASPELPPS  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PP     GIAWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVNS+++  GKL
Sbjct  313   PPVG-SAGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSESRVGGKL  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNF  103
             RYAINGVSH D  TPLK AEYF +  +LF+Y+++KD+    N     +AP+VVNATFRNF
Sbjct  372   RYAINGVSHIDTPTPLKHAEYFGVADKLFQYNLVKDDGSAVNTPAPIIAPSVVNATFRNF  431

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFENHEKTIQTY+LDG+SFFAV +EPG WSP
Sbjct  432   VEIIFENHEKTIQTYNLDGYSFFAVAVEPGTWSP  465



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/393 (69%), Positives = 324/393 (82%), Gaps = 2/393 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWVGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPASPELPPP  314

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PP + K GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+INITRT K+ NS++ +NGKL
Sbjct  315   PPDSTK-GIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +  +KV VAPNVVN T+RNFV
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFV  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTIQT+HLDG SFFAV IEPG+WSP
Sbjct  433   EIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSP  465



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/392 (69%), Positives = 323/392 (82%), Gaps = 2/392 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGAASPELPPP  314

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PP + K GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+INITRT K+ NS++ +NGKL
Sbjct  315   PPDSTK-GIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +   KV VAPNVVN T+RNFV
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFV  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             EIIFENHEKTIQT+HLDG SFFAV IEPG+WS
Sbjct  433   EIIFENHEKTIQTWHLDGFSFFAVAIEPGRWS  464



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/393 (70%), Positives = 329/393 (84%), Gaps = 2/393 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E   TY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGNTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  A+PELPP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPHSTVAVIRYANGNGA-ASPELPP  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+INITRT K+ NS++ +NGKL
Sbjct  314   PPPENTKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +  +KV VAPNVVN T+RNFV
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFV  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTIQT+HLDG SFFAV IEPG+WSP
Sbjct  433   EIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSP  465



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/392 (70%), Positives = 328/392 (84%), Gaps = 2/392 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  74    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  134   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH+M +VE+EGSHTVQN+
Sbjct  194   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNL  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  A+PELPP
Sbjct  254   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGA-ASPELPP  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PPP + +GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+INITRT K+ NS++ +NGKL
Sbjct  313   PPPENTKGIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  372

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +   KV VAPNVVN T+RNFV
Sbjct  373   RFGINGVSHVDAETPLKLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFV  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             EIIFENHEKTIQT+HLDG SFFAV IEPG+WS
Sbjct  432   EIIFENHEKTIQTWHLDGFSFFAVAIEPGRWS  463



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/393 (68%), Positives = 323/393 (82%), Gaps = 2/393 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW DGTPG MCPILPG N+TY+FQVKDQIG+YFYFPTT+L R
Sbjct  75    QLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYFPTTALHR  134

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIP+P+D PAEE+ V + DWY KG+KTLK ILD+G++I RPDG+ +
Sbjct  135   ASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG++ KVG+    PLFT E  KTY+ RVCNVGLR SVNFR QGH++ +VE+EGSH VQN+
Sbjct  195   NGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTLKVVEVEGSHNVQNL  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLHVGQC+SVLVTA++  KDYY VA+SRF +   STVA+IR  NGNG  +    PP
Sbjct  255   YDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYVNGNGAASPELPPP  314

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PP   K GIAWSI+QFRSFRWNLT++AARPNPQGSY YG+INITRT K+ NS++ +NGKL
Sbjct  315   PPENTK-GIAWSISQFRSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKL  373

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH D +TPLKLAEY+ +  ++F Y++MKD P +  +KV VAPNVVN T+RNFV
Sbjct  374   RFGINGVSHVDAETPLKLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFV  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKTIQT+HLDG SFFAV IEPG+WSP
Sbjct  433   EIIFENHEKTIQTWHLDGFSFFAVAIEPGRWSP  465



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/400 (66%), Positives = 330/400 (83%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEPLLFTWSG+QQRKNSW DGT GTMCPI PG N+TY+FQVKDQIGSYFY+P
Sbjct  68    VLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQIGSYFYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ RA GG+G + ++SR LIPVP+  P +++ V + DWY KG+  LKK LD+G+++AR
Sbjct  128   ITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKGHTALKKHLDSGRSMAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  188   PDGVIINGKSAK-GDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K+  +   ++R  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKKVLTGKGIMRYENGNGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS T
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTLKIVNSAT  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEY+ +  ++FKYD ++D+PP  +E KVT+APNVVN
Sbjct  362   KVDGKLRYAINGVSHVDPETPLKLAEYYGVADKVFKYDTIQDDPPATVEDKVTLAPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFRNFVEIIFENHEK+IQ+++LDG+SFFAV IEPG+W+P
Sbjct  422   QTFRNFVEIIFENHEKSIQSWNLDGYSFFAVAIEPGRWAP  461



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/396 (68%), Positives = 323/396 (82%), Gaps = 5/396 (1%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW GIQQRKNSW DGT GTMCPI PGTN+T+KFQVKDQIGSY+YFPTT LQR
Sbjct  78    KLDEPFLLTWYGIQQRKNSWQDGTLGTMCPIQPGTNYTFKFQVKDQIGSYYYFPTTGLQR  137

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIPVPFD PA+E+ V   DWY KG+K+++K LD G+++ RPDG+ +
Sbjct  138   ASGGIGGLQVHSRLLIPVPFDAPADEYFVIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQI  197

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GKVG +   P+F ME  K YRYRVCNVG++TS+NFR QGHS+ LVE+EGSHTVQNV
Sbjct  198   NGKSGKVGGSN-EPMFNMEAGKIYRYRVCNVGMKTSLNFRIQGHSLKLVEMEGSHTVQNV  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+H+GQC SVLV AN+E  DYY+V +SRF KQ  ++VA+IR  NG   P++    P
Sbjct  257   YDSLDVHIGQCFSVLVEANQEPNDYYMVFSSRFTKQPLTSVAVIRYANGKNSPSSELPAP  316

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             PP     GIAWSINQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS+   +GKL
Sbjct  317   PPET-ATGIAWSINQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSRNNVDGKL  375

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP---PDNLEKVTVAPNVVNATFR  109
             RYAINGVSH +P TPLKL EY+ +  ++FKYDI+KD P    ++ EK+ +APNV+NATFR
Sbjct  376   RYAINGVSHVEPTTPLKLVEYYGIQDKVFKYDIIKDEPEAASESNEKIVLAPNVLNATFR  435

Query  108   NFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             NFVEII ENHEKTIQT+HLDG+SFFAV IEPG+W+P
Sbjct  436   NFVEIILENHEKTIQTWHLDGYSFFAVAIEPGRWTP  471



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/400 (66%), Positives = 323/400 (81%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TWSGIQQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ RA GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKK+LD+G+T+ R
Sbjct  128   VTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGKN K G+ K  PLFTM+P KTY+YRVCNVGL+ S+NFR QGH + LVE+EGS
Sbjct  188   PDGILINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENGNGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVN  121
             + NGKLRYAINGVSH + +TPLKLAEYF +  ++FKYD ++D P   +E KVT+APNVVN
Sbjct  362   RVNGKLRYAINGVSHVESETPLKLAEYFGVADKVFKYDTIQDEPRATVEDKVTLAPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFR+FVEIIFENHEK+IQ++HLDG+SFFAV IEPG+W+P
Sbjct  422   QTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTP  461



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 330/426 (77%), Gaps = 29/426 (7%)
 Frame = -2

Query  1194  VNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQV------------  1051
             VNVFNELDEPLLFTW+GIQQRKNSW DG P T CPI PG N+TYKFQV            
Sbjct  69    VNVFNELDEPLLFTWNGIQQRKNSWQDGLPATNCPIPPGKNWTYKFQVCAFHDPWRVGEC  128

Query  1050  ---------------KDQIGSYFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFN  916
                            KDQIGS+FYFPTT LQRA GG G + VHSR+LIPVPFDRPA+EF 
Sbjct  129   KIHGGWVIFGWVSQVKDQIGSFFYFPTTGLQRAGGGMGMMQVHSRDLIPVPFDRPADEFA  188

Query  915   VFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRV  736
             V V DWY KG+KTLK ILD+G++I  PDG+ +NGK GKVG     P+FT+E  KTYRYRV
Sbjct  189   VLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGS-PPMFTVEKGKTYRYRV  247

Query  735   CNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLV  556
             CNVG+R SVNFR QGH + LVE+EGSHTVQNVYDSLDLHVGQC+SVL+TA++   DY+ V
Sbjct  248   CNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLITADQAPADYHFV  307

Query  555   ATSRFFKQEFSTVALIRNGNGNGGpatpelppppPAHKEGIAWSINQFRSFRWNLTASAA  376
              +SRF K+  STVA+IR     G   +  +PPPPP +  GIAWSINQFRSFRWNLTASAA
Sbjct  308   VSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQFRSFRWNLTASAA  367

Query  375   RPNPQGSYHYGQINITRTFKLVNSKTQANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRL  196
             RPNPQGSYHYG+INITRT K+VN++ Q NGKLR+ INGVSH D +TPLKLAEYF +  ++
Sbjct  368   RPNPQGSYHYGKINITRTIKVVNARYQVNGKLRFGINGVSHVDGETPLKLAEYFGVGDKV  427

Query  195   FKYDIMKDNPPDNLE-KVTVAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIE  19
             FKYD+MKD P    E K ++APNVVNATFRNFVEI+FENHE+TIQT+HLDG++FFAV +E
Sbjct  428   FKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTIQTWHLDGYAFFAVAVE  487

Query  18    PGKWSP  1
             PG+WSP
Sbjct  488   PGRWSP  493



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 316/396 (80%), Gaps = 8/396 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTWSGIQQRKNSW DGTPGTMCPI PGTN+TY+FQVKDQIGSYFYFPTT   R
Sbjct  77    QLDEPLLFTWSGIQQRKNSWQDGTPGTMCPIQPGTNYTYRFQVKDQIGSYFYFPTTGFMR  136

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + V+SR LIPVPF  P +++ + V DWYK+ +  L+K L+NG+++ARPD ++M
Sbjct  137   AAGGFGGLRVNSRLLIPVPFADPEDDYTIMVGDWYKESHAVLRKHLENGKSLARPDAVLM  196

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK GKVG+ K  PLFTM+P KTYRYR+CNVG++ S+NFR QGH+M LVE+EGSHTVQN+
Sbjct  197   NGKQGKVGDPKEEPLFTMKPGKTYRYRICNVGMKNSINFRMQGHTMKLVEVEGSHTVQNM  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+H+GQC SVLVTA+KE KDYY+VA++RF K       ++R   G G P+T     
Sbjct  257   YDSLDIHLGQCYSVLVTADKEPKDYYMVASTRFTKYHLQATGIVRYEGGKGAPSTVLPEA  316

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFRS RWNLTASAARPNPQGSYHYGQINITRT KL N+    +GKL
Sbjct  317   PV-----GWAWSLNQFRSLRWNLTASAARPNPQGSYHYGQINITRTIKLANTAGTVDGKL  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE---KVTVAPNVVNATFR  109
             RYAING SHTD DTPLKL EY+++  + FKYD++KD PP N+E   K T  PNV+N TFR
Sbjct  372   RYAINGHSHTDVDTPLKLLEYYQVAQKAFKYDVIKDEPPANVETLDKFTTGPNVLNGTFR  431

Query  108   NFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             NF+EIIFENHEK+IQ++HLDG+SFF V IE G+W+P
Sbjct  432   NFIEIIFENHEKSIQSWHLDGYSFFPVAIEVGQWTP  467



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/400 (64%), Positives = 325/400 (81%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEPLLFTWSG+QQRKNSW DGT GTMCPI PG N+TY+FQVKDQIGSYFY+P
Sbjct  68    VLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQIGSYFYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ RA GG+G + ++SR LIPVP+  P +++ V + DWY K +  LKK LD+G+++ R
Sbjct  128   ITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKHLDSGRSMGR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  188   PDGVIINGKSAK-GDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN Y+SLD+H+GQC SVLVTA+K+  DYY+VA++RF K+  +   ++R  NGNG  +
Sbjct  247   HTMQNTYESLDVHLGQCFSVLVTADKDPMDYYMVASTRFTKKVLTGKGIMRYENGNGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS T
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSAT  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEY+ +  ++FKYD ++D PP  +E KVT+APNVVN
Sbjct  362   KVDGKLRYAINGVSHVDPETPLKLAEYYGVADKVFKYDTIQDEPPATVEDKVTLAPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFRNFVEIIFENHEK+IQ+++LDG+SFF V IEPG+W+P
Sbjct  422   QTFRNFVEIIFENHEKSIQSWNLDGYSFFTVAIEPGRWTP  461



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/400 (64%), Positives = 323/400 (81%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW+G+QQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWNGVQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ +A GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKKILD+G+++ R
Sbjct  128   VTAMHKAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKILDSGRSMGR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NGKN K G+ K  PLFTM+P KTY+YRVCNVGL+ S+NFR QGH + LVE+EGS
Sbjct  188   PAGVLINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NGNG  +
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKEPKDYYMVASTRFTKTVLTGKGIIRYENGNGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVN  121
             + +GKLRYA+NGVSH + +TPLKLAEYF +  ++FKYD ++D PP  +E K+T+APNVVN
Sbjct  362   RVDGKLRYAVNGVSHVESETPLKLAEYFGVADKVFKYDTIEDEPPATVEDKITLAPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFR+FVEIIFENHEK+IQ++HLDG+SFFAV IEPG+W+P
Sbjct  422   QTFRDFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTP  461



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/397 (67%), Positives = 327/397 (82%), Gaps = 10/397 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP LFTW+G+QQRKNSW +GT GT CPI PG+NFTY+FQVKDQIGS++Y+PTT+L R
Sbjct  74    QLDEPFLFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSFYYYPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  823
             A GGYG I+VHSR LIP+PFD  PA+EF V VSDWY K +  L+K+LD+G++  RP+G++
Sbjct  134   AAGGYGGISVHSRALIPIPFDVNPADEFFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVI  193

Query  822   MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             +NGK+GK G+NK  P+FTM P KTYRYR CNVG++ S+N R QGH M LVEIEGSHTVQN
Sbjct  194   INGKSGK-GDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHIMKLVEIEGSHTVQN  252

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLD+H+GQC+SVLVTA+K+ KDY+LVA++RF K+  +  A IR GNG G PA+ ELP
Sbjct  253   MYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYGNGKGAPASLELP  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
               P     G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+    +GK
Sbjct  313   KAPI----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGSVDGK  368

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN----PPDNLEKVTVAPNVVNAT  115
             LRYAINGVSH +P+TP+KLAEY+ +  ++FKYDI+KD+         EK+T+APNVVN T
Sbjct  369   LRYAINGVSHVNPETPIKLAEYYSVADKVFKYDIIKDDYEAPTAKTEEKITLAPNVVNGT  428

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             +RNFVEIIFENHEK++Q++HL G+SFFAV IEPGKW+
Sbjct  429   YRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWT  465



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/392 (67%), Positives = 314/392 (80%), Gaps = 10/392 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTWSGIQQRKNSW DGT GT CPI PG+N+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWSGIQQRKNSWQDGTLGTQCPIAPGSNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G I V+SR LIPVP+  PA+E+ V + DW+ K + TLKK LD+G+++ RPDG+ + 
Sbjct  133   AGGIGGIRVYSRLLIPVPYADPADEYWVLIGDWFGKSHTTLKKFLDSGRSMGRPDGVHIM  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+     N + PL+TME  KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGSHTVQN+Y
Sbjct  193   GKS-----NSVEPLYTMESGKTYKYRICNVGLKDTLNFRIQGHSMKLVEMEGSHTVQNMY  247

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTA+KE KDYYLVA++RF K   +T A+IR  NG G        P 
Sbjct  248   DSLDVHVGQCYSVLVTADKEPKDYYLVASTRFTKNVLTTTAVIRYSNGVG-----PASPI  302

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQ RSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+ ++ NGKLR
Sbjct  303   IPPAPVGWAWSLNQLRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTASRVNGKLR  362

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH D +TPLKLAEY+ +  ++FKYDI+ D+PP  +  +T+APNV+NATFR F+E
Sbjct  363   YAINGVSHVDSETPLKLAEYYGVADKVFKYDIISDDPPTVITDITLAPNVINATFRTFIE  422

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             II EN  KTIQ+Y+LDG+SFFAV +EPGKW+P
Sbjct  423   IILENPTKTIQSYNLDGYSFFAVAVEPGKWTP  454



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 319/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TWSGIQQRKNSW DGT GTMCPI PGTNFTY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIXPGTNFTYRFQVKDQIGSYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ RA GG+G + ++SR LIPVP+  P +E+ V + DWY K +  LKK+LD+G+T+ R
Sbjct  128   VTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PD +++NGKN K G+ K  PLFTM+P KTY+YRVCNVG + S+NFR QGH + LVE+EGS
Sbjct  188   PDXILINGKNAK-GDGKDEPLFTMKPGKTYKYRVCNVGFKNSLNFRIQGHPLKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  N NG  +
Sbjct  247   HTVQNTYESLDVHLGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENXNGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K+VNS +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVN  121
               NGKLRYAINGVS+ + +TPLKLA+YF +  ++FKYD ++D PP  +E KVT+APNVVN
Sbjct  362   XVNGKLRYAINGVSYVESETPLKLAQYFGVADKVFKYDTIQDEPPATVEDKVTLAPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFR FVEIIFENHEK+IQ++HLDG+SFFAV IEPG+W+P
Sbjct  422   QTFRXFVEIIFENHEKSIQSWHLDGYSFFAVAIEPGRWTP  461



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 317/396 (80%), Gaps = 10/396 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+G+QQRKNSW +G  GT CPI PGTN T++FQVKDQIGSY+Y+P+T+L RA
Sbjct  77    LDEPLLFTWNGVQQRKNSWQEGLLGTSCPIPPGTNHTFRFQVKDQIGSYYYYPSTALHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYGP+ V SR+LIPVPFD P  ++ +   DWY K +  L+K+LD+G+T+ RPDG+++N
Sbjct  137   AGGYGPLTVVSRDLIPVPFDAPEADYTIMAGDWYSKSHVALRKLLDSGRTLGRPDGVLIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK  + K  P+FTM P KTYRYRVCNVG++ S+NFRFQGH+M LVE+EGSHT+Q +Y
Sbjct  197   GKSGK-ADGKDEPMFTMIPGKTYRYRVCNVGMKNSLNFRFQGHTMKLVEMEGSHTMQYLY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLH+GQC SVLVTA+KE KDYY VA++RF KQ  S  A IR   G G  +    P P
Sbjct  256   DSLDLHLGQCASVLVTADKEPKDYYFVASTRFTKQILSATATIRYTTGKGPASPELPPAP  315

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT ++VNS  +A+GKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIRIVNSAGEADGKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL----EKVTVAPNVVNATFR  109
             YAINGVSH DP+TPLKLAEYF +  ++FKY+I++D P  +       +T+APNVVNATFR
Sbjct  371   YAINGVSHVDPETPLKLAEYFGVADKVFKYNIIQDEPSADATAKNHAITLAPNVVNATFR  430

Query  108   NFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             NF+EII ENHEKT+Q++HLDG+SFFAV IEPG W+P
Sbjct  431   NFIEIILENHEKTVQSWHLDGYSFFAVAIEPGTWTP  466



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 320/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPILPGTN+TY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  LK++LD+G++IAR
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQLLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKSAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  +G G  +
Sbjct  248   HTVQNDYESLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKGPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  308   PEIPEAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSIS  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D    +    VTVAPNVVN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ATFRNF+EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  423   ATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/398 (66%), Positives = 326/398 (82%), Gaps = 10/398 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP LFTW+G+QQRKNSW +GT GT CPI PG+NFTY+FQVKDQIGS++Y+PTT+L R
Sbjct  74    QLDEPFLFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSFYYYPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  823
             A GGYG I+VHSR LIPVPFD  PA+EF V VSDWY K +  ++K+LD+G+ + RP+G++
Sbjct  134   AAGGYGGISVHSRALIPVPFDVNPADEFFVLVSDWYTKSHSQMRKLLDSGRALGRPNGVI  193

Query  822   MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             +NGK+GK G+NK  P+FTM P KTYRYR CNVG++ S+N R QGH M LVEIEGSHTVQN
Sbjct  194   INGKSGK-GDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHVMKLVEIEGSHTVQN  252

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLD+H+GQC+SVLVTA+K+ KDY+LVA++RF K+  +  A IR  NG G PA+ ELP
Sbjct  253   MYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYANGKGAPASLELP  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
               P     G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQIN TRT KLVN+    +GK
Sbjct  313   KAPI----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINFTRTIKLVNAAGSVDGK  368

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN----PPDNLEKVTVAPNVVNAT  115
             LRYAINGVSH +P+TP+KLAEY+ +  ++FKYD++KD+         EK+T+APNVVN T
Sbjct  369   LRYAINGVSHVNPETPIKLAEYYGVANKVFKYDLIKDDYEAPTAKTEEKITLAPNVVNGT  428

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +RNFVEIIFENHEK++Q++HL G+SFFAV IEPGKW+P
Sbjct  429   YRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTP  466



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/400 (65%), Positives = 316/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G I V+SR LIPVP+  P +++ V + DWY K + TLK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK  K  +    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTSK-DDGIDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  NG G  +
Sbjct  248   HTVQNDYKSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKSALVGKGIVRYTNGKGPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVNS T
Sbjct  308   PEIPNAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D    + +  VTVAPNVVN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFRNF+EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  423   TTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/400 (65%), Positives = 316/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G I V+SR LIPVP+  P +++ V + DWY K + TLK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK  K  +    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTSK-DDGIDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y SLD+HVGQC SVLVTA++E KDYY+VA++RF K       ++R  NG G  +
Sbjct  248   HTVQNDYKSLDVHVGQCFSVLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKGPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVNS T
Sbjct  308   PEIPNAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D    + +  VTVAPNVVN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFRNF+EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  423   TTFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/393 (66%), Positives = 309/393 (79%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  134   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  194   GKSGKVEGDKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  254   DSLDVHVGQCYSVLVTANQTPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVN+    +GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP-DNLEKVTVAPNVVNATFRNFV  100
             YAING+SH D DTPLKLAEYF +  ++FKYD + D P     EK+ + PNV+NATFRNFV
Sbjct  369   YAINGMSHVDKDTPLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII ENHEK+IQ++HLDG+SFFAVGIEPGKW+P
Sbjct  429   EIILENHEKSIQSWHLDGYSFFAVGIEPGKWTP  461



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 317/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPILPGTN+TY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  LK+ LD+G++IAR
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK  K G+    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  189   PDGVLINGKTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  +G G  +
Sbjct  248   HTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKGPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  308   PEIPEAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSIS  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVN  121
             + +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D    +    VTVAPNVVN
Sbjct  363   KVDGKLRYAINGVSHVDPETPLKLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ATFRNF+EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  423   ATFRNFIEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/393 (66%), Positives = 309/393 (79%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  134   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  194   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  254   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVN+    +GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP-DNLEKVTVAPNVVNATFRNFV  100
             YAING+SH D DTPLKLAEYF +  ++FKYD + D P     EK+ + PNV+NATFRNFV
Sbjct  369   YAINGMSHVDKDTPLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII ENHEK+IQ++HLDG+SFFAVGIEPGKW+P
Sbjct  429   EIILENHEKSIQSWHLDGYSFFAVGIEPGKWTP  461



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/393 (66%), Positives = 309/393 (79%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  73    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  133   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  193   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  253   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVN+    +GKLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP-DNLEKVTVAPNVVNATFRNFV  100
             YAING+SH D DTPLKLAEYF +  ++FKYD + D P     EK+ + PNV+NATFRNFV
Sbjct  368   YAINGMSHVDKDTPLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFV  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII ENHEK+IQ++HLDG+SFFAVGIEPGKW+P
Sbjct  428   EIILENHEKSIQSWHLDGYSFFAVGIEPGKWTP  460



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/393 (66%), Positives = 309/393 (79%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG PGT CPI PGTNFTY FQVKDQIGS+FYFPT  + RA
Sbjct  75    LDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFFYFPTIGMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPF  P +++ V + DWY KG+ +LKK+LD G+++ +PDG+++N
Sbjct  135   AGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKV  +K  PLFTM+P K YRYRVCNVGL+ S+NFR QGHS+ LVE+EGSHTVQNVY
Sbjct  195   GKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+  KDYY+VA++RF K   S   +IR  NG G  +      P
Sbjct  255   DSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKGPASPVLPEAP  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVN+    +GKLR
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP-DNLEKVTVAPNVVNATFRNFV  100
             YAING+SH D DTPLKLAEYF +  ++FKYD + D P     EK+ + PNV+NATFRNFV
Sbjct  370   YAINGMSHVDKDTPLKLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII ENHEK+IQ++HLDG+SFFAVGIEPGKW+P
Sbjct  430   EIILENHEKSIQSWHLDGYSFFAVGIEPGKWTP  462



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/393 (67%), Positives = 314/393 (80%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+GIQQRKNSW DGT GT CPI PGTN+TY+FQVKDQIGSY+YFPTT+L RA
Sbjct  76    LDEPLLFTWNGIQQRKNSWQDGTLGTNCPIPPGTNYTYQFQVKDQIGSYYYFPTTALHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYGPINVHSR LIP+PF+ P  EFNV V DWY KG+ TLKK LD+G+++ RPDG+V+N
Sbjct  136   AGGYGPINVHSRNLIPIPFNSPEAEFNVLVGDWYSKGHVTLKKFLDSGRSLGRPDGVVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+G        P + + P KTYRYR+CNVG++ SVN R QGH+M LVEIEGSHTVQNVY
Sbjct  196   GKSGNEA-----PKWNLIPGKTYRYRICNVGMKNSVNVRIQGHTMKLVEIEGSHTVQNVY  250

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC SVLVTA++  KDY  V ++RF K   +T   I     N   +T     P
Sbjct  251   DSLDIHLGQCNSVLVTADQTPKDYAFVVSTRFTKTVLTTTGTIHYEGSNIPASTELPAAP  310

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
               A  EGIAWSINQFRS RWNLTASAARPNPQGSYHYG+INITRT K+VNS ++   KLR
Sbjct  311   GNA-PEGIAWSINQFRSLRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRGEDKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK-VTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD++KD P  + E  +T+APNVVN TFRNF+
Sbjct  370   YAVNGVSHTDPETPLKLAEYFGVSDKVFKYDLIKDEPSADAEDHITIAPNVVNGTFRNFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK+IQ++HLDG+SFFAV IEPG+W+P
Sbjct  430   EIIFENHEKSIQSWHLDGYSFFAVAIEPGRWAP  462



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 316/395 (80%), Gaps = 10/395 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW +GT GT CPILPG NFTY FQVKDQIGSY+Y+PTT+L R
Sbjct  72    QLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGSYYYYPTTALHR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYGPI++HSR LIPVPFD P EEF+VFVSDWY K +KTL+ ILD G++I RP+G+++
Sbjct  132   ATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIII  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKNGK G+ K  P+F+M   KTYRYR CNVG++ S+N RFQGH+M LVE+EGSHTVQN+
Sbjct  192   NGKNGK-GDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNM  250

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+H+GQCLSVLVTA++E KDY+LVA+SRF K+     A IR  N    P  P+   
Sbjct  251   YESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTNDPASPELPKA--  308

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                   EG  WS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT +LV++    +GK 
Sbjct  309   -----PEGWEWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKR  363

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN--PPDNLEKVTVAPNVVNATFRN  106
             RYAINGVSH DP TP+KLAE + +  ++FKYD++KD    P   EK+T+APNVVNAT+RN
Sbjct  364   RYAINGVSHVDPTTPIKLAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRN  423

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             FVEII ENHEK++Q++HL G++FFAV IE G+W P
Sbjct  424   FVEIILENHEKSVQSWHLAGYNFFAVAIEAGRWKP  458



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/402 (62%), Positives = 315/402 (78%), Gaps = 8/402 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN+LDEPLLFTW GIQQRKNSW DGTPGTMCPI PGTN+TY+FQVKDQIGS+FY+P
Sbjct  70    VLNVFNQLDEPLLFTWVGIQQRKNSWQDGTPGTMCPIPPGTNYTYRFQVKDQIGSFFYYP  129

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT   +A GG+G + V+SR LIPVP+  P +++ V + DWYK+ +  L+K+LD+G+++ R
Sbjct  130   TTGFLKAAGGFGGLRVNSRLLIPVPYPDPEDDYTVLIGDWYKQSHTALRKVLDSGKSLGR  189

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG++MNGK GKVG+ K  PLFTM+P KTY+YR+CNVGL+ ++NFR QGH + LVE+EGS
Sbjct  190   PDGVLMNGKQGKVGDAKEEPLFTMKPGKTYKYRICNVGLKNTLNFRIQGHKIKLVEVEGS  249

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H+VQN YDSLD+H+GQC +VLVTA+++ KDYY+VA+ RF K        IR  NG G   
Sbjct  250   HSVQNSYDSLDVHLGQCYAVLVTADQDPKDYYMVASVRFTKYHLQATGKIRYENGKG---  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                     P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KL  +  
Sbjct  307   --PASNILPEAPTGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTVKLATTAN  364

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE---KVTVAPNV  127
               +GKLRYA+NGVSHTDP+TP+KLAEY+E P ++FKYD + D PP N+E   K+T+AP V
Sbjct  365   TVDGKLRYAVNGVSHTDPETPMKLAEYYEAPAKVFKYDPIGDEPPANIEKLDKITIAPIV  424

Query  126   VNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +N   R+F+E+IFENHEK++Q++ L G++FF V IE G WSP
Sbjct  425   LNFKHRDFIEVIFENHEKSVQSFRLAGYAFFPVAIEVGTWSP  466



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/398 (64%), Positives = 318/398 (80%), Gaps = 11/398 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTW+G+QQRKNSW +GT GT CPI PG NFTY+FQVKDQIGSY+Y+PTT+L R
Sbjct  74    QLDEPLLFTWNGVQQRKNSWQEGTHGTNCPIPPGANFTYRFQVKDQIGSYYYYPTTTLHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G I+V SR LIPVPFD P ++F V V+DWY K +  LK +LDNG+ + RP G+++
Sbjct  134   AAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVII  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK G+ K  P++T+ P KTYR+R CNVG++ S+N RFQGH+M LVEIEGSHTVQNV
Sbjct  194   NGKSGK-GDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNV  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+H+GQC+SVL+TA+++ KDY+LVA++RF K+     A IR  NG G  +      
Sbjct  253   YESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYANGKGPASPQLPKA  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV S    +GKL
Sbjct  313   -----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKL  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN--PPDNLE---KVTVAPNVVNAT  115
             RYAINGVSH DP TP+KLAEY+ +  ++FKYD++KD+  P    E   K+T+APNVVNAT
Sbjct  368   RYAINGVSHVDPATPIKLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNAT  427

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +RNFVEIIFENH K++Q++HL GHSFFAVGIEPG+W+P
Sbjct  428   YRNFVEIIFENHGKSVQSWHLSGHSFFAVGIEPGRWTP  465



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/393 (66%), Positives = 309/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+GIQQRKNSW +G  GT CPI PGTNFTYKFQVKDQIGSYFY+PTTSL RA
Sbjct  74    LDEPLLFTWNGIQQRKNSWQEGVLGTNCPIQPGTNFTYKFQVKDQIGSYFYYPTTSLHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYGP+ VHSRELIPVPFD P EE+ V   DWY+K +  LK+ +DNG+TI R DG+++N
Sbjct  134   AGGYGPLTVHSRELIPVPFDWPEEEYIVLTGDWYRKSHTELKRHMDNGKTIGRTDGVIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    P+FTM P KTYRYR CNVG++ S+N R QGH+M LVEIEGSHTVQNVY
Sbjct  194   GKQGK-GDGSDPPMFTMIPGKTYRYRFCNVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC SVLVTA+++ KDYYLV+++RF K    T A IR    N         P 
Sbjct  253   DSLDVHMGQCYSVLVTADQKPKDYYLVSSTRFTKTVLMTTATIRYTGSN-----EPASPV  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K VN+    + KLR
Sbjct  308   LPEAPTGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTAGTVDRKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVNATFRNFV  100
             YAING+SH + DTPLKLAEY+ +  ++FKYDI+ D+PP ++  KVT+APNV+   FRNFV
Sbjct  368   YAINGLSHMNTDTPLKLAEYYGIQDQVFKYDIITDDPPADVGTKVTIAPNVITGIFRNFV  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q++HL G+SFFAV IEPG WSP
Sbjct  428   EIIFENHEKSVQSWHLSGYSFFAVAIEPGTWSP  460



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/399 (63%), Positives = 313/399 (78%), Gaps = 6/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TWSG+QQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT + RA GG+G + ++SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  128   TTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NGKN K G+ K  PLFTM+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGS
Sbjct  188   PTGVLINGKNAK-GDGKDEPLFTMKPGKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQNVY++LD+HVGQC SVLVTAN+  KDYY+V T+RF KQ  +   +IR  NG G  +
Sbjct  247   HVVQNVYEALDVHVGQCFSVLVTANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  307   PELPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
             +  GKLRYA+NGVSH DP+TPLK+AEY+ +  ++FKY+ +KD P   + KV   PNV+N 
Sbjct  362   REGGKLRYALNGVSHVDPETPLKIAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQ  421

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             TFRNFVEIIFENHEK++Q+YHLDG+SFFAV IEPG W+P
Sbjct  422   TFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIEPGTWTP  460



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/402 (64%), Positives = 317/402 (79%), Gaps = 9/402 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN +DEPLLFTW+GIQQRKNSW DG  GT CPI PG NFTY+FQVKDQIGSYFY+P
Sbjct  66    VINVFNNIDEPLLFTWNGIQQRKNSWQDGVLGTNCPIPPGKNFTYRFQVKDQIGSYFYYP  125

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT++ RA GG+G + V+SR LIPVP+  P +++ V + DWY K +  L++ LD G+ +AR
Sbjct  126   TTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTVLRQKLDAGRPLAR  185

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NG+ GK     + PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGS
Sbjct  186   PDGVLINGQTGKGKGKDVKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGS  245

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDSLD+HVGQC SVL+TA+K+ +DYY+VA++RF K   +   +IR  NGNG PA
Sbjct  246   HTVQNTYDSLDVHVGQCFSVLITADKDPRDYYMVASTRFTKSVLTATGIIRYTNGNGAPA  305

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
             +  LP       EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV+S +
Sbjct  306   SSILPKA----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVSSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK---VTVAPNV  127
              A GKLRY INGVSH +P TPLKLAEY+ +  ++FKYD + D P   LEK   VT APNV
Sbjct  362   SAGGKLRYGINGVSHVNPPTPLKLAEYYGVADKVFKYDTIPDEP--LLEKATPVTPAPNV  419

Query  126   VNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +N TFR FVEII ENHEK++Q++HLDG+SFF V IEPG+W+P
Sbjct  420   MNITFRTFVEIILENHEKSVQSWHLDGYSFFGVAIEPGRWTP  461



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/400 (65%), Positives = 314/400 (79%), Gaps = 11/400 (3%)
 Frame = -2

Query  1185  FNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSL  1006
             FN+LDEPLLFTWSGIQQRKNSW +GT G  CPI PGTNFTY+FQVKDQIGSY+Y+PTTS+
Sbjct  73    FNQLDEPLLFTWSGIQQRKNSWQEGTLGNNCPIPPGTNFTYRFQVKDQIGSYYYYPTTSM  132

Query  1005  QRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
              RA GG+G I+V SR LIPVPF+ P  +  V V DWY K +  LK++LD+G+ + RP G+
Sbjct  133   HRAAGGFGGISVLSRALIPVPFETPEADHMVLVGDWYTKSHTELKRLLDSGRALGRPQGV  192

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             V+NGK+GK G+ K  P+FT+ P KTYR+R+CNVGL+ S+N R QGH++ LVEIEGSHTVQ
Sbjct  193   VINGKSGK-GDGKDEPMFTVTPGKTYRFRICNVGLKDSINVRMQGHTLKLVEIEGSHTVQ  251

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             NVY+SLD+H+GQC SVLVTAN+E KDY+LVA++RF K        IR  NG G       
Sbjct  252   NVYESLDIHLGQCFSVLVTANQEPKDYFLVASTRFTKDSHVATTTIRYANGKG-----PA  306

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
              P  P   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV S  Q +G
Sbjct  307   SPELPKAPEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDG  366

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN---PPDNL--EKVTVAPNVVN  121
             KLRYA+NGVSH DP TP+KLAEY+    ++FKYD++KD     P     +K+TVAPNVVN
Sbjct  367   KLRYALNGVSHVDPTTPIKLAEYYGAGDKVFKYDLIKDEYEPSPGQAGQDKITVAPNVVN  426

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             AT+RNFVEI+ ENH K++Q++HL GHSFFAVGIEPG+W+P
Sbjct  427   ATYRNFVEIVIENHGKSVQSWHLSGHSFFAVGIEPGRWTP  466



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 309/393 (79%), Gaps = 10/393 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEPLLFTW G+QQRKNSW +GTPGT CPILPGTN+TY FQVKDQIGSYFY+PTT LQR
Sbjct  72    HLDEPLLFTWHGVQQRKNSWQEGTPGTACPILPGTNYTYHFQVKDQIGSYFYYPTTGLQR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + + SR LIPVP+  P +E+ V + DWY KG+KTLK +LD+G++I RPDG++M
Sbjct  132   AAGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYNKGHKTLKMMLDSGRSIGRPDGVIM  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK          PL+TM+P KTY+YR+CNVGL+ ++NFRFQGH+M LVE EGSH VQ+ 
Sbjct  192   NGK-----ATNEEPLYTMKPGKTYKYRICNVGLKDALNFRFQGHAMKLVETEGSHVVQSF  246

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC +VLVTA+K+ KDYY+VA++RF K   +   +IR  NG G         
Sbjct  247   YDSLDVHVGQCYTVLVTADKDPKDYYMVASTRFTKYTHTATGIIRYTNGAG-----PASN  301

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVNS  + +GKL
Sbjct  302   VLPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSVAKVDGKL  361

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYAINGVSH D +TPLKLAEY+ +  ++FKY+I+ D PP +L  +T+APNV+NATFR F+
Sbjct  362   RYAINGVSHVDGETPLKLAEYYGVADKVFKYNIIGDEPPADLTAITIAPNVINATFRTFI  421

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+I EN  K+IQ+Y+LDG+SFFAV  EPGKWSP
Sbjct  422   EVILENSGKSIQSYNLDGYSFFAVACEPGKWSP  454



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/398 (64%), Positives = 319/398 (80%), Gaps = 11/398 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTW+G+QQRKNSW +GTPGT CPI PG N TY+FQVKDQIGSY+Y+P+T+L R
Sbjct  74    QLDEPLLFTWNGVQQRKNSWQEGTPGTNCPIPPGANITYRFQVKDQIGSYYYYPSTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G I+V SR LIPVPFD P ++F V V+DWY K +  LK +LDNG+ + RP G+++
Sbjct  134   AAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVII  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK G+ K  P++T+ P KTYR+R CNVG++ S+N RFQGH+M LVEIEGSHTVQNV
Sbjct  194   NGKSGK-GDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNV  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+H+GQC+SVL+TA+++ KDY+LVA++RF K+     A IR  NG G        P
Sbjct  253   YESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYANGKG-----PASP  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV S    +GKL
Sbjct  308   ELPKAPEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKL  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN--PPDNLE---KVTVAPNVVNAT  115
             RYAINGVSH DP TP+KLAEY+ +  ++FKYD++KD+  P    E   K+T+APNVVNAT
Sbjct  368   RYAINGVSHVDPATPIKLAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNAT  427

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +RNFVEIIFENH K++Q++HL G+SFFAVGIEPG+W+P
Sbjct  428   YRNFVEIIFENHGKSVQSWHLSGYSFFAVGIEPGRWTP  465



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/394 (66%), Positives = 314/394 (80%), Gaps = 13/394 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+GIQQRKNSW +GT  T CPI PGTN+TYKFQVKDQIG+YFY+PTTS  RA
Sbjct  60    LDEPLLFTWNGIQQRKNSWQEGTLATNCPIPPGTNYTYKFQVKDQIGTYFYYPTTSTHRA  119

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYGP+++HSR+LIPVPF  P  E+NV V DWYKKG  +LKK+LD G+T+ RPDG+++N
Sbjct  120   AGGYGPLSIHSRDLIPVPFPWPHAEYNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIIN  179

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+     +   P+F+ E  KT+R+RVCNVGL+ S+NFR Q H++TLVEIEGSHTVQNVY
Sbjct  180   GKH-----DSNEPMFSFEAGKTHRFRVCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVY  234

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIR-NGNGNGGpatpelpp  460
             DSLDLH+GQC SVLVTA++  KDYY VA++RF K   +T A+IR NG+           P
Sbjct  235   DSLDLHLGQCASVLVTADQTPKDYYFVASTRFTKTVLTTKAIIRYNGSSTPASPELPEAP  294

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K VN+    +GKL
Sbjct  295   V------GWAWSVNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNAPGTVDGKL  348

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPP-DNLEKVTVAPNVVNATFRNF  103
             RY++NGVSHTDP TPLKLAEYF +  +LFKYDI+KD+P  D   K+T+AP V+NATFRNF
Sbjct  349   RYSVNGVSHTDPATPLKLAEYFGVGDKLFKYDIIKDDPSVDANSKITIAPIVLNATFRNF  408

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFEN EK++Q++HL G+SFFAV I+PGKW+P
Sbjct  409   VEIIFENQEKSVQSWHLSGYSFFAVAIQPGKWTP  442



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 315/393 (80%), Gaps = 10/393 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+GIQQRKNSW DG PGT CPI PGTNFTY+FQVKDQIG+YFYFP+  +QRA
Sbjct  76    LDEPLLFTWNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGTYFYFPSLGMQRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G + V+SR LIPVPFD P +++ V + DWYKK +  LKK LD+G +I RPDG+ +N
Sbjct  136   AGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+    E+K  PLFTM+P  TYRYR+CNVG+++S+NFR QGH+M LVE+EGSHTVQNVY
Sbjct  196   GKS----EDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC SVLVTAN++ KDYY+VA++RF KQ ++   +IR  NG G        P 
Sbjct  252   DSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG-----PASPE  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G  WS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT K+VNS +  +GKLR
Sbjct  307   LPEPPSGWIWSLNQFRSFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNFV  100
             YAINGVSHTDP TP KLAEYF +  ++FKY+ M D+ PP++ EK+ + PNV+N TFR FV
Sbjct  367   YAINGVSHTDPTTPPKLAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFV  426

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK+IQ++HL+G+SFFAV +EPG+W+P
Sbjct  427   EIIFENHEKSIQSWHLNGYSFFAVAMEPGRWNP  459



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/399 (63%), Positives = 313/399 (78%), Gaps = 6/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TWSG+QQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT + RA GG+G + ++SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  128   TTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NGKN K G+ K  PLF M+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGS
Sbjct  188   PTGVLINGKNAK-GDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQNVY+SLD+HVGQC SVLVTAN+  KDYY+VA++RF KQ  +   +IR  NG G  +
Sbjct  247   HVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  307   PEFPEAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
             +  GKLRY++NGVSH DP+TPLK+AEY+ +  ++FKY+ +KD P   + KV   PNV+N 
Sbjct  362   REGGKLRYSLNGVSHVDPETPLKIAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQ  421

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             TFRNFVEIIFENHEK++Q+YHLDG+SFFAV IEPG W+P
Sbjct  422   TFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIEPGTWTP  460



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/400 (64%), Positives = 319/400 (80%), Gaps = 6/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN +DEP+LFTW GIQQRKNSW DG  GT CPILPGTNFTY+FQVKDQIGSYFY+P
Sbjct  50    VLNVFNNIDEPILFTWLGIQQRKNSWQDGVLGTNCPILPGTNFTYRFQVKDQIGSYFYYP  109

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT++ RA GG+G + V+SR LIPVP+  P +++ + + DWY + + TL+K LD G+++ R
Sbjct  110   TTAIHRAAGGFGGLRVNSRLLIPVPYADPEDDYTILIGDWYTESHSTLRKFLDIGRSLGR  169

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K  +    PLFTM+P K Y+YR+CNVGL+ S+NFR QGH + LVE+EGS
Sbjct  170   PDGVLINGKSAK-SDGSDEPLFTMKPGKIYKYRICNVGLKNSLNFRIQGHPLKLVEMEGS  228

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC +VLVTA+K  KDY +VA++RF K   +   +IR  N    P 
Sbjct  229   HTVQNTYESLDVHVGQCFAVLVTADKAPKDYLVVASTRFTKNVLTGKGIIRYTNAKPAPP  288

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
             +P++   P     G AWS+NQFRSFRWNLT+SAARPNPQGSYHYG+INITRT KLVNS  
Sbjct  289   SPDVVEAPV----GWAWSLNQFRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNSAV  344

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVN  121
             +  GKLRYAINGVSH DP TPLKLAEY+++  ++FKYDI+ D PP N  +K+TVA NVVN
Sbjct  345   RVQGKLRYAINGVSHVDPYTPLKLAEYYQVADKVFKYDIISDEPPANAGDKITVATNVVN  404

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              TFRNFVEIIFENHEK++QT+HLDG+SFFAV IEPG+WSP
Sbjct  405   QTFRNFVEIIFENHEKSLQTWHLDGYSFFAVAIEPGRWSP  444



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/394 (65%), Positives = 311/394 (79%), Gaps = 7/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP L TWSG+Q RKNSW DGT GT CPILPG NFTY FQVKDQIGSYFY+PTTS  R
Sbjct  74    HLDEPFLLTWSGVQHRKNSWQDGTLGTNCPILPGQNFTYHFQVKDQIGSYFYYPTTSTHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + V+SR LIPVP+  P +++ V + DWY K +K LK  LD+G+++ARPDG+V+
Sbjct  134   AAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKTHKQLKTFLDSGRSLARPDGVVI  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK G     P+FTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSH VQNV
Sbjct  194   NGKSGK-GPGGDKPVFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHVVQNV  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+HVGQC SVLVTA++E +DYY+VA++RF K+  +   ++R  NG G  +T     
Sbjct  253   YESLDVHVGQCFSVLVTADQEPRDYYMVASTRFTKEVITATRILRYTNGKGPASTVLPKA  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVNS ++A GKL
Sbjct  313   -----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASRAGGKL  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK-VTVAPNVVNATFRNF  103
             RYAINGVSH +P TPLK AEYF    ++FKYD++ D+PP+   K VT+ PNV N TFR F
Sbjct  368   RYAINGVSHVNPTTPLKFAEYFGTADKVFKYDVIPDSPPEQEPKLVTLEPNVGNITFRTF  427

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFENHEK+IQ++HLDG+SFFAV +EPG+W+P
Sbjct  428   VEIIFENHEKSIQSWHLDGYSFFAVAVEPGRWTP  461



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/394 (65%), Positives = 312/394 (79%), Gaps = 8/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             L+EP L  WSGIQ RKNSW DG  GT CPILPGTNFTY FQVKDQIGS+FY+P  ++ RA
Sbjct  75    LNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQIGSFFYYPPIAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVM  820
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN 
Sbjct  195   NGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQND  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      
Sbjct  254   YQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KL NS T+ +GKL
Sbjct  314   PM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKL  368

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNF  103
             RYAINGVSH DP+TPLKLAEYFE+  ++FKYD++ D  P +    VT+APNVVNATFRNF
Sbjct  369   RYAINGVSHVDPETPLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNF  428

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  429   IEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/403 (64%), Positives = 315/403 (78%), Gaps = 13/403 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ +AVG +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHKAVGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NG+  K G+    PLFTM+P KTY+YR+CNVGL+TS+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVY SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K       +IR  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKAPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                          G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT K+VNS T
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK----VTVAPN  130
               +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D   + L K    VTVAPN
Sbjct  363   NVDGKLRYAINGVSHVDPETPLKLAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPN  419

Query  129   VVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             V+NATFRNFVEI+FEN EK++Q++HLDG+SFFAV +EPG+WSP
Sbjct  420   VLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAVEPGRWSP  462



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/400 (64%), Positives = 316/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP LFTW+GIQ RKNSW DG  GT CPI PGTNFTY+ QVKDQIGSYFY+P
Sbjct  69    VINVFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIGSYFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G + V+SR LIPVP+  P +E+ V + DWY K +  L+K+LD+G+++ R
Sbjct  129   STAMHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P+G+++NGK  K G+ K  PLFTM+P+KTY+YR+CNVGL+ S+N+R QGHSM LVE+EGS
Sbjct  189   PEGVLINGKTAK-GDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQN+YDSLD+HVG+C SVLVTA+KE KDYY+VA++RF K       +IR  NG G   
Sbjct  248   HVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG---  304

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  P  P    G AWS+NQF +FRWNLTASAARPNPQGSY YGQINITRT KLVNS +
Sbjct  305   --PASPDIPPAPVGWAWSLNQFHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVS  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVN  121
             ++NGKLRYA+NGVSH DP+TPLKLAEYF +  ++FKYD + DNP  N+   VTV PNV+N
Sbjct  363   KSNGKLRYALNGVSHVDPETPLKLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T RNF+EIIFEN EKTIQ+YHLDG+SFF +GIEPG W+P
Sbjct  423   ITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGIEPGTWTP  462



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/403 (64%), Positives = 315/403 (78%), Gaps = 13/403 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ +AVG +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHKAVGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NG+  K G+    PLFTM+P KTY+YR+CNVGL+TS+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVY SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K       +IR  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKAPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                          G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT K+VNS T
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK----VTVAPN  130
               +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D   + L K    VTVAPN
Sbjct  363   NVDGKLRYAINGVSHVDPETPLKLAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPN  419

Query  129   VVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             V+NATFRNFVEI+FEN EK++Q++HLDG+SFFAV +EPG+WSP
Sbjct  420   VLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVAVEPGRWSP  462



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 312/393 (79%), Gaps = 8/393 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  60    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  119

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  120   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  179

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY+
Sbjct  180   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYE  238

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+  KDYY++A++RF KQ  + + +IR  NG G  +      P 
Sbjct  239   SLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQVLTYMGIIRYTNGKGPASPEFPEAPV  298

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++  GKLRY
Sbjct  299   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  353

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNFV  100
             A+NGVSH DP+TPLK+AEY+ +  +LFKYD M+D+P  N+   K+   PNV+N TFRNFV
Sbjct  354   ALNGVSHVDPETPLKIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFV  413

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q+YHLDG+SFFAV +EPG W+P
Sbjct  414   EIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTP  446



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 312/394 (79%), Gaps = 8/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQQRKNSW DG  GT CPILPGTN+TY FQVKDQIGSY Y+PTT + RA
Sbjct  75    LDEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNYTYHFQVKDQIGSYIYYPTTGMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+T+ARPDG+++N
Sbjct  135   TGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY
Sbjct  195   GKNAK-GDGKDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC SVLVTAN++ KDYY+VA++RF KQ  +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGKGPASPELPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KL+NS +Q  GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLINSASQEGGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNF  103
             YA+NGVSH +P+TPLKLAEY+ +  ++FKYD + D+P  N+   K+   PNV+N TFRNF
Sbjct  369   YALNGVSHVNPETPLKLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNF  428

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFENHEK++Q+YHLDG+SFFAV +EPG W+P
Sbjct  429   VEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTP  462



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 311/393 (79%), Gaps = 8/393 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  135

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  136   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  195

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGSH VQNVY+
Sbjct  196   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYE  254

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+  KDYY++A++RF KQ  +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQVLTAKGIIRYTNGKGPASPEFPEAPV  314

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++  GKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  369

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNFV  100
             A+NGVSH DP+TPLK+AEY+ +  +LFKYD M+D+P  N+   K+   PNV+N TFRNFV
Sbjct  370   ALNGVSHVDPETPLKIAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q+YHLDG+SFFAV +EPG W+P
Sbjct  430   EIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTP  462



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/400 (62%), Positives = 318/400 (80%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF     +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS +
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN-LEKVTVAPNVVN  121
             + +GKLRYAING+SH DP+TPLKLA+Y+++  ++FK+D MKD PP    +K+T+ PNVVN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T R+FVEIIFEN EK++QT+HLDG+SFF+VG EPG W+P
Sbjct  422   ITIRDFVEIIFENPEKSLQTWHLDGYSFFSVGSEPGTWTP  461



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/400 (64%), Positives = 310/400 (78%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA G +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHRAGGAFGGLRVNSRLLIPVPYVDPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK  K G+    PLFTM P KTY+YR+CNVGL+ S+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGKIAK-GDGTDEPLFTMNPGKTYKYRICNVGLKISLNFRIQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVY SLD+HVGQC SVLVTA+++ +DYY+VA+SRF K       ++R  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADQDPRDYYMVASSRFTKNILVGKGIVRYTNGKAPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                          G AWS+NQFR+FRWNLTA+AARPNPQGSYHYG INITRT K+VNS T
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTANAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVN  121
               +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D         VT+APNVVN
Sbjct  363   NIDGKLRYAINGVSHIDPETPLKLAEYFEVADKVFKYDTISDEGSAKTANTVTIAPNVVN  422

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ATFRNFVEIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  423   ATFRNFVEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  462



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/400 (62%), Positives = 317/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS +
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN-LEKVTVAPNVVN  121
             + +GKLRYAING+SH DP+TPLKLA+Y+++  ++FK+D MKD PP    +K+T+ PNVVN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T R+FVEIIFEN EK+ QT+HLDG+SFF+V  EPG W+P
Sbjct  422   ITIRDFVEIIFENPEKSPQTWHLDGYSFFSVASEPGTWTP  461



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/394 (63%), Positives = 312/394 (79%), Gaps = 8/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQQRKNSW DG  GT CPILPGTN+TY FQVKDQIGSY Y+PTT + RA
Sbjct  75    LDEPFLLTWSGIQQRKNSWQDGMLGTNCPILPGTNYTYHFQVKDQIGSYIYYPTTGMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+T+ARPDG+++N
Sbjct  135   TGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+ K  PLF M+P KTY+YR+CN G++ ++NFR QGH+M LVE+EGSH VQNVY
Sbjct  195   GKNAK-GDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC SVLVTAN++ KDYY+VA++RF KQ  +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPASPELPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++A GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNF  103
             YA+NGVSH +P+TPLKLAEY+ +  ++FKYD + D+P  N+   K+   PNV+N TFRNF
Sbjct  369   YALNGVSHVNPETPLKLAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNF  428

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEIIFENHEK++Q+YHLDG+SFFAV +EPG W+P
Sbjct  429   VEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTP  462



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 308/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             +A+NGVSHTDP+TPLKLAEYF +  ++FKYD + D+P P+ ++ + + PNV+N T RNF+
Sbjct  370   FALNGVSHTDPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRNFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFF+V +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTP  462



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 306/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGTPG  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  37    LDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  96

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  97    VGGFGGLRIFSRLLIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIIN  156

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  157   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  215

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G        P 
Sbjct  216   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-----PASPV  270

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKL 
Sbjct  271   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  330

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L+ +T+APNV+  TFR F+E
Sbjct  331   YAINGVSHVDPETPVKLAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIE  390

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK +Q+Y+L G+SFFAV  EPG W+P
Sbjct  391   IIFENPEKVLQSYNLGGYSFFAVAGEPGTWTP  422



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 306/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G        P 
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-----PASPV  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKLR
Sbjct  307   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L+ +T+APNV+  TFR F+E
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK +Q+Y+L G+SFFAV  EPG W+P
Sbjct  427   IIFENPEKVLQSYNLGGYSFFAVAGEPGTWTP  458



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 308/392 (79%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPL FTW G+QQRKNSW DG  GT C ILPGTN+TY FQVKDQIGSYFY+PTT+L RA
Sbjct  73    LDEPLQFTWHGVQQRKNSWQDGVAGTSCHILPGTNYTYHFQVKDQIGSYFYYPTTALHRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK +LD+G++I RP+G+++N
Sbjct  133   AGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYAKSHKTLKSLLDSGRSIGRPNGVLIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+    PL+TM+P KTY+YR+CNVGL+ S+NFR QGH M LVE EGSH VQN Y
Sbjct  193   GKTAK-GDGSDQPLYTMKPGKTYKYRICNVGLKDSLNFRIQGHPMKLVETEGSHVVQNTY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+K+ KDYYLVA++RF K   +   +IR  NG G        P 
Sbjct  252   DSLDVHVGQCYTVLVTADKDPKDYYLVASTRFTKYSLTGKGIIRYTNGVG-----PASPE  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNP+GSYHYGQINITRT KLVN+ ++A GKLR
Sbjct  307   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPRGSYHYGQINITRTIKLVNTVSKAQGKLR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH D +TPLKLAEYF +  ++FKY+I+ D PP +L  +T+APNVVNATFR F+E
Sbjct  367   YAINGVSHVDGETPLKLAEYFGVADKVFKYNIISDEPPADLNTITLAPNVVNATFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  KT+Q+Y+LDG+SFF V +EPGKW+P
Sbjct  427   IIFENPGKTVQSYNLDGYSFFLVAVEPGKWTP  458



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/393 (63%), Positives = 310/393 (79%), Gaps = 8/393 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSGIQQRKNSW DG  GT CPILPGTNFTY FQVKDQIGSY Y+PTT + RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAA  135

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + ++SR LIPVP+  P +++ V ++DWY K +  L+K+LD+G+++ARPDG+++NG
Sbjct  136   GGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLING  195

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             KN  +G+ K  PLFTM+P KTY+YR+CN GL+ ++NFR Q H+M LVE+EGSH VQNVY+
Sbjct  196   KNA-MGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQDHTMKLVEMEGSHVVQNVYE  254

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+  KDYY+VA++RF KQ  +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPASPELPEAPV  314

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++  GKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRY  369

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNFV  100
             A+NGVSH DP+TPLK+AEY+ +  +LFKYD M+D+P  ++   K+   PNV+N TFRNFV
Sbjct  370   ALNGVSHVDPETPLKIAEYYGVADKLFKYDTMQDSPQADIAHAKIVSQPNVLNLTFRNFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q+YHLDG+SFFAV +EPG W+P
Sbjct  430   EIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTP  462



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 307/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGTPG  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  78    LDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  137

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  138   VGGFGGLRIFSRLLIPVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIIN  197

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  198   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  256

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       +IR  NG G  +    P P
Sbjct  257   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKGPASPVLPPAP  316

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKL 
Sbjct  317   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  371

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L+ +T+APNV+  TFR F+E
Sbjct  372   YAINGVSHVDPETPVKLAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK +Q+Y+L G+SFFAV  EPG W+P
Sbjct  432   IIFENPEKVLQSYNLGGYSFFAVAGEPGTWTP  463



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/392 (64%), Positives = 306/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+ +  PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGRDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G        P 
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-----PASPV  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKLR
Sbjct  307   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L  +T+APNV+  TFR F+E
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK +Q+Y+L G+SFFAV  EPG W+P
Sbjct  427   IIFENPEKVLQSYNLGGYSFFAVAGEPGTWTP  458



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/392 (64%), Positives = 309/392 (79%), Gaps = 10/392 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW+GIQ RKNSW DGT GT CPI PGTN+TY FQVKDQIGSYFY+PT  +QRA
Sbjct  75    LDEPLLFTWNGIQHRKNSWQDGTLGTQCPIQPGTNYTYHFQVKDQIGSYFYYPTIGMQRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + ++SR LIPVP+  PA+EF V + DW+ K ++TLK+ LD+G++I RP G+ +N
Sbjct  135   VGGFGGLRIYSRLLIPVPYADPADEFWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKNG      L P +TMEP KTY+YR+CNVGL+ S+NFR QGHS+ LVE+EGSH VQN Y
Sbjct  195   GKNGG-----LEPAYTMEPGKTYKYRICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQY  249

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTA++E KDYY+VA++RF K+      +IR  NG G        P 
Sbjct  250   DSLDVHVGQCFSVLVTADQEPKDYYMVASTRFAKKTLGATRIIRYSNGVG-----PASPE  304

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P   EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+ ++  GKLR
Sbjct  305   LPPAPEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTLSRTGGKLR  364

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NGVSH DP+TPLKLAEY+ +  ++FKY+I+ D+P   +  +  APNV+NATFR+F+E
Sbjct  365   YGLNGVSHVDPETPLKLAEYYGVSDQVFKYNIISDDPASPIGDLACAPNVINATFRDFIE  424

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  K  Q+Y+LDG+SFFAVG+EPGKWSP
Sbjct  425   IIFENPTKVPQSYNLDGYSFFAVGMEPGKWSP  456



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 316/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW G+QQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIG+Y Y+P
Sbjct  68    VLNVFNNLDEPFLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT++ +A G +G + V+SR LIPVP+  P +E+ V + DW+ K +  LKK+LD G+++AR
Sbjct  128   TTAMHKAAGAFGGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ ++NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF     +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS +
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN-LEKVTVAPNVVN  121
             + +GKLRYAING+SH DP+TPLKLA+Y+++  ++FK+D MKD PP    +K+T+ PNVVN
Sbjct  362   KVDGKLRYAINGISHVDPETPLKLADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T R+FVEIIFEN E ++QT+HLDG+SFF+V  EPG W+P
Sbjct  422   ITIRDFVEIIFENPENSLQTWHLDGYSFFSVASEPGTWTP  461



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/400 (64%), Positives = 315/400 (79%), Gaps = 8/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP LFTW+GIQ RKNSW DG  GT CPI PGTNFTY+ QVKDQIG YFY+P
Sbjct  69    VINVFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIG-YFYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ RA GG+G + V+SR LIPVP+  P +E+ V + DWY K +  L+K+LD+G+++ R
Sbjct  128   STAMHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P+G+++NGK  K G+ K  PLFTM+P+KTY+YR+CNVGL+ S+N+R QGHSM LVE+EGS
Sbjct  188   PEGVLINGKTAK-GDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQN+YDSLD+HVG+C SVLVTA+KE KDYY+VA++RF K       +IR  NG G   
Sbjct  247   HVVQNMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG---  303

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  P  P    G AWS+NQF +FRWNLTASAARPNPQGSY YGQINITRT KLVNS +
Sbjct  304   --PASPDIPPAPVGWAWSLNQFHTFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVN  121
             ++NGKLRYA+NGVSH DP+TPLKLAEYF +  ++FKYD + DNP  N+   VTV PNV+N
Sbjct  362   KSNGKLRYALNGVSHVDPETPLKLAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T RNF+EIIFEN EKTIQ+YHLDG+SFF +GIEPG W+P
Sbjct  422   ITHRNFIEIIFENPEKTIQSYHLDGYSFFVLGIEPGTWTP  461



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 309/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTNFTYKFQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLITWNGIQHRKNCWQDGTPGTMCPIMPGTNFTYKFQPKDQIGSYFYYPSTALHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLF ++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFNLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   ++TAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD + DNP P+  + + + PNV+N T RNF+
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADKVFKYDTITDNPTPEQTKNIKIEPNVLNITHRNFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             +A+NGVSHT+P+TPLKLAEYF +  ++FKYD + D+P P+ ++ + + PNV+N T R FV
Sbjct  370   FALNGVSHTEPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFF+V +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTP  462



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/395 (63%), Positives = 308/395 (78%), Gaps = 7/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW GIQQRKNSW DGT GT CPI PG NFTY FQVKDQIGSY+Y PTT+L R
Sbjct  72    QLDEPFLITWKGIQQRKNSWQDGTLGTNCPIPPGKNFTYHFQVKDQIGSYYYHPTTALHR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             AVGGYGPI ++SR LIPVPFD PA++F V VSDWY   +K+LK +LD G+++ RPDG+V+
Sbjct  132   AVGGYGPITIYSRALIPVPFDTPADDFTVLVSDWYTNSHKSLKGLLDTGRSLGRPDGIVI  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK G+ K  P+FTM   KTYR+R CNVG++ ++N R QGH+M LVE+EGSHTVQN+
Sbjct  192   NGKSGK-GDGKDEPMFTMVKGKTYRFRFCNVGMKDTINVRIQGHTMKLVEMEGSHTVQNL  250

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+ LD+H+GQCLSVL+TA++  KDY++VATSRF K+     A IR  NG G  +  E   
Sbjct  251   YELLDIHLGQCLSVLITADQNPKDYFIVATSRFTKESRVATATIRYANGKGPASPLEKKE  310

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                   EG  WS+NQF SFRWNLTAS+ARPNPQGSYHYGQINITRT +LV++    NGK 
Sbjct  311   A----PEGWEWSLNQFNSFRWNLTASSARPNPQGSYHYGQINITRTIRLVSTAGVVNGKH  366

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN--PPDNLEKVTVAPNVVNATFRN  106
             RYAINGVSHTDP+TP+KLA+Y+ +  ++FKY + KD   PP   E +T+APNVVN T+RN
Sbjct  367   RYAINGVSHTDPETPIKLAQYYGVADKVFKYGLCKDEYIPPSGNEVITIAPNVVNVTYRN  426

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             FVEII ENHEK++Q++HLDG +FFAV I PG+W P
Sbjct  427   FVEIILENHEKSVQSWHLDGFNFFAVAIAPGRWKP  461



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/405 (63%), Positives = 315/405 (78%), Gaps = 22/405 (5%)
 Frame = -2

Query  1176  LDEPLLFTW------------SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGS  1033
             LDEPLLFTW            +GIQQRKNSW DG PGT CPI PGTNFTY+FQVKDQIG+
Sbjct  76    LDEPLLFTWYCIFHVLVRXGRNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGT  135

Query  1032  YFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG  853
             YFYFP+  +QRA GG G + V+SR LIPVPFD P +++ V + DWYKK +  LKK LD+G
Sbjct  136   YFYFPSLGMQRAAGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSG  195

Query  852   QTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLV  673
              +I RPDG+ +NGK+    E+K  PLFTM+P  TYRYR+CNVG+++S+NFR QGH+M LV
Sbjct  196   HSIGRPDGVQINGKS----EDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLV  251

Query  672   EIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNG  493
             E+EGSHTVQNVYDSLD+H+GQC SVLVTAN++ KDYY+VA++RF KQ ++   +IR  NG
Sbjct  252   ELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNG  311

Query  492   NGGpatpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKL  313
              G        P  P    G  WS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT K+
Sbjct  312   KG-----PASPELPEPPSGWIWSLNQFRSFRWNLTASAARPNPQGSYHYGFINITRTIKI  366

Query  312   VNSKTQANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVA  136
             VNS +  +GKLRYAINGVSHTDP TP KLAEYF +  ++FKY+ M D+ PP++ EK+ + 
Sbjct  367   VNSASTVDGKLRYAINGVSHTDPTTPPKLAEYFGVVDKVFKYNTMVDDPPPESAEKIVIT  426

Query  135   PNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             PNV+N TFR FVEIIFENHEK+IQ++HL+G+SFFAV +EPG+W+P
Sbjct  427   PNVLNITFRTFVEIIFENHEKSIQSWHLNGYSFFAVAMEPGRWNP  471



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/392 (65%), Positives = 308/392 (79%), Gaps = 8/392 (2%)
 Frame = -2

Query  1170  EPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVG  991
             EP L  WSGIQ RKNSW DG  GT CPI PG NFTY FQVKDQIGS+FY+P+ ++ RA G
Sbjct  78    EPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQIGSFFYYPSIAMHRAAG  137

Query  990   GYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVMNG  814
             G+G + ++SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++NG
Sbjct  138   GFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLING  197

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN Y 
Sbjct  198   KTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQ  256

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      P 
Sbjct  257   SLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM  316

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KL NS T+ +GKLRY
Sbjct  317   -----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRY  371

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNFVE  97
             AINGVSH DP+TPLKLAEYF +  ++FKYDI+ D  P +    VT+APNVVNATFRNF+E
Sbjct  372   AINGVSHIDPETPLKLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  432   IIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  463



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/392 (65%), Positives = 308/392 (79%), Gaps = 8/392 (2%)
 Frame = -2

Query  1170  EPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVG  991
             EP L  WSGIQ RKNSW DG  GT CPI PG NFTY FQVKDQIGS+FY+P+ ++ RA G
Sbjct  78    EPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQIGSFFYYPSIAMHRAAG  137

Query  990   GYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVMNG  814
             G+G + ++SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++NG
Sbjct  138   GFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLING  197

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN Y 
Sbjct  198   KTAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQ  256

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      P 
Sbjct  257   SLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKGPASPEIPKAPM  316

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KL NS T+ +GKLRY
Sbjct  317   -----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRY  371

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNFVE  97
             AINGVSH DP+TPLKLAEYF +  ++FKYDI+ D  P +    VT+APNVVNATFRNF+E
Sbjct  372   AINGVSHIDPETPLKLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIE  431

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  432   IIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  463



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 305/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G        P 
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLVGKGIVRYTNGKG-----PASPL  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P+   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKLR
Sbjct  307   LPSAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L  +T+APNV+  TFR F+E
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  K +Q+Y+L G+SFFAV  EPG W+P
Sbjct  427   IIFENPGKVLQSYNLGGYSFFAVAGEPGTWTP  458



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/391 (63%), Positives = 310/391 (79%), Gaps = 6/391 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSGIQQRKNSW +G PGT CPI PG+N+TY FQVKDQIGS+ Y+P+T+L RA 
Sbjct  76    DEPFLLTWSGIQQRKNSWQEGVPGTNCPIPPGSNYTYHFQVKDQIGSFIYYPSTALHRAS  135

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             G +G ++++SR LIPVP+  P +++ V ++DWY K +K+L+  LD+G+++ RPDG+++NG
Sbjct  136   GAFGGLHINSRLLIPVPYPDPEDDYTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLING  195

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             KN K G+ K  PLFTM+P KTY+YRVCN G++TS+NFR QGH M LVE+EGSH VQNVY+
Sbjct  196   KNAK-GDGKDEPLFTMKPDKTYKYRVCNAGIKTSLNFRIQGHEMKLVEMEGSHVVQNVYE  254

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQCLSVLV AN+  KDYY+VA++RF K   +   +IR  NG G  +      P 
Sbjct  255   SLDVHVGQCLSVLVRANQAPKDYYMVASTRFMKTVQTAKGIIRYTNGKGPASPELPEAPV  314

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++A GKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRY  369

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVEI  94
             AINGVSHTD +TPLKLAEY+ +  ++FKYD +KD+PP  + +V   PNV+N TFRNFVEI
Sbjct  370   AINGVSHTDTETPLKLAEYYGIADKVFKYDTIKDDPPPKITEVVTQPNVLNMTFRNFVEI  429

Query  93    IFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IFEN EK+IQ++HLDG+SFFAV +EPG W+P
Sbjct  430   IFENPEKSIQSWHLDGYSFFAVAVEPGTWTP  460



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/392 (63%), Positives = 306/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPRKTYKYRLCNVGFKSTLNFRIQNHMMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+K+  +GKLR
Sbjct  308   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH DP+TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGLNGVSHVDPETPLKLAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  EPGKW+P
Sbjct  428   IIFENHEKSMQSFHLDGYSFFAVASEPGKWTP  459



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             +A+NGVSHT+P+TPLKLAEYF +  ++FKYD + D+P P+ ++ + + PNV+N T R FV
Sbjct  370   FALNGVSHTEPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFF+V +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTP  462



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 306/397 (77%), Gaps = 8/397 (2%)
 Frame = -2

Query  1185  FNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSL  1006
             FN+LDEPLL TWSGIQQRKNSW +GT G  CPI PG NFTY+FQVKDQIGSY+Y+PTTS 
Sbjct  73    FNQLDEPLLLTWSGIQQRKNSWQEGTLGNNCPIPPGANFTYRFQVKDQIGSYYYYPTTST  132

Query  1005  QRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
              RA GGYG I+V SR LIPVPF+ P  +  V   DWY K +  LK++LD+G+ + RP G+
Sbjct  133   HRAAGGYGGISVLSRALIPVPFETPEADHMVLAGDWYTKSHVELKRMLDSGRALGRPTGV  192

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK+GK G+ K  P+FT+   KTYR+R CNVG++ S+N R QGH+M LVEIEGSHTVQ
Sbjct  193   LINGKSGK-GDGKDEPMFTVIAGKTYRFRFCNVGMKDSINVRMQGHTMKLVEIEGSHTVQ  251

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             NVY+S+D+H+GQC SVLVTAN+E KDYYLV ++RF K      A IR  NG G  +    
Sbjct  252   NVYESIDIHLGQCFSVLVTANQEPKDYYLVVSTRFTKDSHVATATIRYANGKGPASPELP  311

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
                     EG AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV S  Q +G
Sbjct  312   KA-----PEGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDG  366

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKD--NPPDNLEKVTVAPNVVNATF  112
             KLRYA+NGVSH D  TP+KLAEY+    ++FKY+++KD   P    +K+TVAPNVVNAT+
Sbjct  367   KLRYALNGVSHVDTATPIKLAEYYGAGDKVFKYNLIKDEYEPNPGQDKITVAPNVVNATY  426

Query  111   RNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             RN+VEI+ ENH KT+Q++HL GHSFFAVGIEPG+W+P
Sbjct  427   RNYVEIVIENHGKTVQSWHLSGHSFFAVGIEPGRWAP  463



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 308/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVTANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYDI+ DNP P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 312/394 (79%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTAN+EAKDYY+VA++RF K+  +T  L+R   G G         
Sbjct  255   YDSLDVHVGQCFGVIVTANQEAKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKY+I+ DNP P+ ++ + + PNV+N T R F
Sbjct  370   RYAMSGVSHTDPETPLKLAEYFGVADKVFKYNIITDNPNPEQIKTIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  463



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 309/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   ++TA++EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R F+
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 305/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  73    LDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  133   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  193   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE +DYY++A++R  K       ++R  NG G        P 
Sbjct  252   DSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-----PASPV  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKL 
Sbjct  307   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLC  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L+ +T+APNV+  TFR F+E
Sbjct  367   YAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK +Q+Y+L G+SFFAV  EPG W+P
Sbjct  427   IIFENPEKVLQSYNLGGYSFFAVAGEPGTWTP  458



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/393 (61%), Positives = 309/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   ++TA++EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R F+
Sbjct  370   YALNGVSHTDPETPLKLAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/392 (62%), Positives = 307/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             +DEP L TWSGIQQRKNSW +G  GT CPI PGTN TY FQVKDQIGS+ Y+P+T++ RA
Sbjct  75    IDEPFLLTWSGIQQRKNSWQEGMLGTNCPIQPGTNHTYHFQVKDQIGSFIYYPSTAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + ++SR LIPVP+  P +++ V ++DWY K +K L+  LD G+ + RPDG+++N
Sbjct  135   SGAFGGLRINSRLLIPVPYAPPEDDYTVIINDWYTKDHKALRSFLDEGRVLGRPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+ K  PLF M+P K Y+YR+CN GL+ S+NFR QGH+M LVE+EGSHTVQNVY
Sbjct  195   GKNAK-GDGKDEPLFEMKPEKVYKYRICNAGLKASLNFRIQGHTMMLVEMEGSHTVQNVY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC SVLVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   ESLDVHVGQCFSVLVTADKEPKDYYMVASTRFLKTVLTAKGIIRYTNGKGPASPELPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGS+HYG INITRT K ++  T+A GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSFHYGSINITRTIKFISQATKAGGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYD +KD+PP  +E+ T+APNV+N TFR+FVE
Sbjct  369   YAVNGVSHTNPETPLKLAEYFGIADKVFKYDTIKDDPPAKVEEATLAPNVMNMTFRDFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EKTIQ++HLDG+SFFAV +EPG W+P
Sbjct  429   IIFENPEKTIQSWHLDGYSFFAVAVEPGTWTP  460



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P KTYR RVCNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRVCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +++AN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILSANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + NGKLR
Sbjct  310   LPPGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVNGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R F+
Sbjct  370   YALNGVSHTDPETPLKLAEYFGVADKVFKYDSITDNPTPEQIKSIKIEPNVLNITHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 306/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQQRKNSW DGT GT CPI PG N+TY FQVKDQIGSY Y+P T++ RA
Sbjct  74    LDEPFLLTWNGIQQRKNSWQDGTLGTSCPIPPGQNYTYHFQVKDQIGSYIYYPITAMHRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TL K LD+G+ + RPDG+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K  + K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHT+QN Y
Sbjct  194   GKSSK-SKGKEEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE KDYY+VA++R+ K   +T A+I   NG G  +      P
Sbjct  253   DSLDVHVGQCFAVLVTADKEPKDYYMVASTRYTKTVLTTTAVISYTNGKGPASPVLPEAP  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AW++NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVNS ++  GKLR
Sbjct  313   V-----GWAWTLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASREGGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVNATFRNFV  100
             YAING+SH +P TPLKLAEY+ +  ++FKYD M D+ P    +K+TV PNV N T+R FV
Sbjct  368   YAINGISHANPATPLKLAEYYGVADKIFKYDTMSDDAPATASDKITVEPNVANITYRTFV  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+IFENHEK+IQ++HLDG+SFFAV +EPG+W+P
Sbjct  428   EVIFENHEKSIQSWHLDGYSFFAVAVEPGRWTP  460



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPILPGTN+TYKFQVKDQIGSYFY+PTT LQRA
Sbjct  74    LDEPLLFTWHGVQQRKNSWQDGTLGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  P +E+ V + DWY K +KTLK  LD+G++I RP G+++N
Sbjct  134   VGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+    PL+TM+P KTY+YR+CN GL+ ++NFRFQGH M LVE EGSH VQNVY
Sbjct  194   GKNAK-GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+KE KDYY+VA++R  K       +IR  NG G        P 
Sbjct  253   DSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRYTNGKG-----PASPM  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS +  NGKLR
Sbjct  308   LPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TP+KLAEY+ +  ++FKY+I+ D PP +L  +T+APNV+  TFR F+E
Sbjct  368   YAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPIDLRAITIAPNVMQTTFRTFIE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  K +Q+Y+L G+SFF V  EPG W+P
Sbjct  428   IIFENPGKVLQSYNLGGYSFFVVAGEPGTWTP  459



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 311/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQQRKNSW DG PGT CPI PGTN+TY FQVKDQIGS+ YFP+T++ ++
Sbjct  75    LDEPFLVTWSGIQQRKNSWQDGMPGTQCPIPPGTNYTYHFQVKDQIGSFMYFPSTAMHKS  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G I+++SR LIPVP+  P  ++ V ++DW+ K +  L+ +LD+G+T+ARP+G+++N
Sbjct  135   AGGFGGIHINSRLLIPVPYADPEADYTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K G+ K  PLFTM+  KTY+YR+CN GL+TS+NFR QGH+M LVE+EGSH VQN+Y
Sbjct  195   GKNAK-GDGKDEPLFTMKAGKTYKYRICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVG C++VLVTA+++ KDYY++A++RF K   +   +IR   G G          
Sbjct  254   DSLDVHVGGCMAVLVTADQDPKDYYMIASTRFTKTVTTGKGIIRYEGGKG-----PADTE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT +L N+  ++NGKLR
Sbjct  309   IPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTLRLANTAGRSNGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVNATFRNFV  100
             YA NG+SH DP TPLKLAEY+ +  ++FKYD MKD PP + +  + + PNV+N TFRNFV
Sbjct  369   YAFNGISHVDPPTPLKLAEYYGVADKVFKYDTMKDTPPSSDKVDIVMQPNVMNFTFRNFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK+IQ+YHLDG++FFAVGIEPG WSP
Sbjct  429   EIIFENHEKSIQSYHLDGYAFFAVGIEPGIWSP  461



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/393 (61%), Positives = 309/393 (79%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T++ R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTAMHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   ++TAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPPGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTDP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R F+
Sbjct  370   YALNGVSHTDPETPLKLAEYFGVADKVFKYDSITDNPTPEQIKSIKIVPNVLNITHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 309/392 (79%), Gaps = 5/392 (1%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG  GT CPI PG N+TY FQVKDQIGSY Y+P+T++ RA
Sbjct  76    LDEPFLLTWSGIQHRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIGSYIYYPSTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P  ++ V + DWY K +  LKK LD+G+++ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYSDPEADYTVLIGDWYTKSHTMLKKFLDSGRSLGRPDGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G  K  PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQNVY
Sbjct  196   GKVAK-GNGKDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHRMKLVEMEGSHTVQNVY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC +VLVTA++  KDY++VA++RF K   +   +IR  NG G  A+P+LPP 
Sbjct  255   ESLDVHVGQCFAVLVTADQGPKDYFMVASTRFTKNVLTATGIIRYTNGKGAAASPKLPPA  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             P     G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVN+ ++A GKLR
Sbjct  315   PV----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTASRAGGKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y INGVSH +P TPLKLAEY+ +  ++FKYD++ D PP  +  VTV PNV+N TFRNFVE
Sbjct  371   YGINGVSHINPPTPLKLAEYYNVANKVFKYDVIGDEPPAKITGVTVQPNVLNMTFRNFVE  430

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             II ENHEK+IQ+YHLDG+SFFAV IEPG+W+P
Sbjct  431   IILENHEKSIQSYHLDGYSFFAVAIEPGRWTP  462



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +V AN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYDI+ DNP P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +V AN+E KDYY+VA++RF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYDI+ DNP P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 304/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALKSLLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASAE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+K+  +GKLR
Sbjct  308   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMADKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  EPGKW+P
Sbjct  428   IIFENHEKSMQSFHLDGYSFFAVASEPGKWTP  459



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/398 (64%), Positives = 314/398 (79%), Gaps = 11/398 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP LFTW+GIQQRKNSW +GT GT CPI PG+NFTY FQVKDQIGS+FY+PTT+L R
Sbjct  74    QLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGSNFTYHFQVKDQIGSFFYYPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  823
             A GGYG I+VHSR LIP+PFD  PA+EF V VSDWY K +  L+K LD+G+++ RPDG++
Sbjct  134   AAGGYGGISVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGII  193

Query  822   MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             +N   G  G+ K  PLF+M P KTYRYR CN G++ S+N R QGH+M LVE+EGSH VQN
Sbjct  194   IN-GKGGKGDGKDEPLFSMTPGKTYRYRFCNAGMKDSINVRIQGHTMKLVEMEGSHVVQN  252

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLD+H+GQC+SVLVTA+K+ KDY LVA++RF K+  +  ++IR  NGNG  +     
Sbjct  253   MYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGNGPASPELPK  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
              P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+    +GK
Sbjct  313   API-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGK  367

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKD--NPPDNL--EKVTVAPNVVNAT  115
             LRYAINGVSH +P TP+KL EY+ +  ++FKYD+MKD   PP     EK+T+APNVV  T
Sbjct  368   LRYAINGVSHVNPTTPIKLVEYYGVEDKIFKYDLMKDEYEPPAGKAEEKITLAPNVVKVT  427

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +RNFVEIIFENHEK++Q++HL G+SFFAV IEPGKW+P
Sbjct  428   YRNFVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTP  465



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 316/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW+GIQQRKNSW DGT GTMCPI PGTN+TY+FQVKDQIGSY Y+P
Sbjct  68    VLNVFNNLDEPFLVTWNGIQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGSYMYYP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
              T++ +A G +G + V+SR LIPVP+  P +++ V + DWY K +  LKK+LD+G+++AR
Sbjct  128   ITAMHKAGGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKLLDSGRSMAR  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+ K  PLF M+P KTY+YR+CNVGL+ S+NFR QGHSM LVE+EGS
Sbjct  188   PDGVLINGKSSK-GDGKDEPLFVMKPGKTYKYRICNVGLKNSLNFRIQGHSMKLVELEGS  246

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDS+D+H+GQC SVLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +
Sbjct  247   HTVQNTYDSMDVHLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKGPAS  306

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INI+RT KLVNS +
Sbjct  307   PELPKAPV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINISRTIKLVNSAS  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN-LEKVTVAPNVVN  121
             + +GKLRYAING+SH D +TPLKLA+Y+++  ++FK D MKD PP    +K+T+  NVVN
Sbjct  362   KVDGKLRYAINGISHVDSETPLKLADYYKVWDKVFKPDTMKDTPPATAADKITMVTNVVN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T ++FVEIIFEN EK++QT+HLDG+SFF+V  EPG W+P
Sbjct  422   ITIKDFVEIIFENPEKSLQTWHLDGYSFFSVASEPGTWTP  461



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/394 (62%), Positives = 309/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G         
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP PD ++ + + PNV+N T R F
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  463



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 308/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  +KK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +V+AN+E KDYY+VA+SRF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYDI+ D+P P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 309/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLITWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTA++E KDYY+VA++RF K+  +T  L+R   G G         
Sbjct  255   YDSLDVHVGQCFGVIVTADQELKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP PD ++ + + PNV+N T R F
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHE+++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTP  463



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 313/393 (80%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPL+FTW+GIQQRKNSW DGTPGTMCPI PG N+TY FQVKDQIGSYFY+P T++ RA
Sbjct  76    LDEPLMFTWNGIQQRKNSWQDGTPGTMCPIPPGKNYTYHFQVKDQIGSYFYYPITAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V + DWY K + +L+K LD G+++ RP+G+++N
Sbjct  136   GGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHNSLRKQLDMGRSLGRPEGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN + G+    PLFTM+P KTY++RVCNVGL+ S+NFR QGH+M LVE+EGSH VQN Y
Sbjct  196   GKNAR-GDGTDEPLFTMKPGKTYKFRVCNVGLKNSLNFRIQGHTMKLVEMEGSHVVQNTY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+H+GQC S LVTA+KE KDY++VA +RF K   + + LIR  NGNG        P 
Sbjct  255   ESLDVHLGQCFSALVTADKEPKDYWMVADTRFTKTMLTGLGLIRYTNGNG-----PANPE  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P   EG+AWS+NQ RSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++ +GKLR
Sbjct  310   LPLPPEGLAWSLNQARSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNSASKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSH D +TPLK AEYF +  ++FKYDI+KD+P P+   K+T+APNVVN T+R+FV
Sbjct  370   YAVNGVSHIDTETPLKYAEYFGVADKVFKYDIIKDDPSPEAEAKITLAPNVVNQTYRDFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENH K+IQ++HLDG++FF V IE G+W+P
Sbjct  430   EIIFENHGKSIQSWHLDGYAFFPVAIEFGRWAP  462



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   526 bits (1356),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 307/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DW+ K +  +KK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +V+AN+E KDYY+VA+SRF K+  +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHT+P+TPLKLAEYF +  ++FKYDI+ D+P P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGVSHTEPETPLKLAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>gb|KGN63948.1| hypothetical protein Csa_1G031720 [Cucumis sativus]
Length=480

 Score =   523 bits (1347),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 308/397 (78%), Gaps = 13/397 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPI PGTNFTY FQVKDQIGS+FY+P
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T++ +AVG +G + V+SR LIPVP+  P +++ V + DWY K + TLKK LD+G++IAR
Sbjct  129   STAMHKAVGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIAR  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NG+  K G+    PLFTM+P KTY+YR+CNVGL+TS+NFR QGH+M LVE+EGS
Sbjct  189   PDGVLINGRIAK-GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGS  247

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVY SLD+HVGQC SVLVTA+K+ KDYY+VA++RF K       +IR  NG    +
Sbjct  248   HTVQNVYQSLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKAPAS  307

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                          G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT K+VNS T
Sbjct  308   PEIPEA-----PRGWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSAT  362

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK----VTVAPN  130
               +GKLRYAINGVSH DP+TPLKLAEYFE+  ++FKYD + D   + L K    VTVAPN
Sbjct  363   NVDGKLRYAINGVSHVDPETPLKLAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPN  419

Query  129   VVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIE  19
             V+NATFRNFVEI+FEN EK++Q++HLDG+SFFAV  E
Sbjct  420   VLNATFRNFVEIVFENQEKSLQSWHLDGYSFFAVADE  456



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   525 bits (1353),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKNSW DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +E+ V + DWY  G+  LK +LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYAAPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E  TV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELGTVGVIRYEGSN-----VQASTK  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+K+  +GKLR
Sbjct  308   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  EPGKW+P
Sbjct  428   IIFENHEKSMQSFHLDGYSFFAVASEPGKWTP  459



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   526 bits (1354),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 239/394 (61%), Positives = 309/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLITWAGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ + ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTA++E KDYY++A++RF K+  +T  L+R   G G         
Sbjct  255   YDSLDVHVGQCFGVIVTADQEPKDYYMIASTRFLKKPLTTTGLLRYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP PD ++ + + PNV+N T R F
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHE+++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTP  463



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   525 bits (1352),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASTE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+K   +GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y  NGVSH D +TPLKLAEYF+M  ++FKYD++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK+++++HLDG+SFFAV  EPG+W+P
Sbjct  428   IIFENHEKSMESFHLDGYSFFAVASEPGRWTP  459



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   522 bits (1345),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 252/388 (65%), Positives = 305/388 (79%), Gaps = 8/388 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             L+EP L  WSGIQ RKNSW DG  GT CPILPGTNFTY FQVKDQIGS+FY+P  ++ RA
Sbjct  75    LNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQIGSFFYYPPIAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVM  820
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN 
Sbjct  195   NGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQND  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      
Sbjct  254   YQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KL NS T+ +GKL
Sbjct  314   PM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKL  368

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNF  103
             RYAINGVSH DP+TPLKLAEYFE+  ++FKYD++ D  P +    VT+APNVVNATFRNF
Sbjct  369   RYAINGVSHVDPETPLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNF  428

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIE  19
             +EIIFENHEK++Q++HLDG+SFFAV  E
Sbjct  429   IEIIFENHEKSLQSWHLDGYSFFAVADE  456



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   525 bits (1352),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 305/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT + RA
Sbjct  77    LDEPFLLTWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTGMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  137   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++  KTYR R+CNVGL++S+NFR Q H M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKSSLNFRIQNHKMRLVEMEGSHVLQNDY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC  V+VTA++E KDYY+ A++RF K   ST  L+R   G G          
Sbjct  256   DSLDVHVGQCYGVIVTADQEPKDYYMAASTRFLKNALSTTGLLRYEGGKG-----PASSQ  310

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  311   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSHTD +TPLKLAEYF +  ++FKYDI+ DNP P+ ++K+ + PNV+N T R F+
Sbjct  371   YALNGVSHTDSETPLKLAEYFGVADKVFKYDIISDNPTPEQIKKIKMEPNVLNITHRTFI  430

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+IFENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  431   EVIFENHEKSVQSWHLDGYSFFAVAVEPGVWTP  463



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   525 bits (1351),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 238/393 (61%), Positives = 308/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTNFTY FQ KDQIGSYFY+P+T++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNFTYHFQPKDQIGSYFYYPSTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H + LVE+EGSH +QN Y
Sbjct  196   GKSGK-GDGSDAPLFTLKPGKTYRLRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +++A+++AKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTILSADQQAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRS+RWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPPGPVGWAWSLNQFRSYRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NG+SHTDP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R FV
Sbjct  370   YALNGISHTDPETPLKLAEYFGIGDKVFKYDSITDNPTPEQIKSIKILPNVLNITHRTFV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 308/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G         
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP  D ++ + + PNV+N T R F
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDKVFKYDSISDNPNADQIKTIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  463



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   524 bits (1350),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 301/393 (77%), Gaps = 6/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP L TWSG+Q RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGLQHRKNCWQDGVAGTTCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK +LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVILGDWYTSGHTALKNLLDSGRTLGLPNGVLI  192

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GKVG N   PLFTM P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVGGNN-EPLFTMNPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQND  251

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC +VLVTAN+ AKDYY+VA++RF K+E STV +IR    N      +   
Sbjct  252   YDSLDVHVGQCFAVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASS  306

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVNSK+  NGK 
Sbjct  307   ELPKTPIGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGRINITRSIKLVNSKSSVNGKT  366

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+  NGVSH D DTPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FV
Sbjct  367   RFGFNGVSHVDTDTPLKLAEYFQMSEKVFKYNVIKDEPASKITTLTVQPNVLNITFRTFV  426

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  427   EIIFENHEKSMQSFHLDGYSFFAVASEPGRWTP  459



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 308/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+T+ RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILIN  196

Query  816   GKNGKV-GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK  G +K  PLFT++P KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN 
Sbjct  197   GKSGKTDGSDK--PLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  V+VTAN+E KDYY+VA++RF K+  +T  L+    G G         
Sbjct  255   YDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLLLYEGGKG-----PASS  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKL
Sbjct  310   QLPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKL  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNF  103
             RYA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP PD ++ + + PNV+N T R F
Sbjct  370   RYALSGVSHTDPETPLKLAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTF  429

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   IEVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  463



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   525 bits (1352),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 251/399 (63%), Positives = 313/399 (78%), Gaps = 12/399 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLL TW+G+QQRKNSW +GT GT CPILPGTN+TYKFQVKDQIGSY+Y+PTT L RA
Sbjct  80    LDEPLLLTWNGVQQRKNSWQEGTLGTNCPILPGTNYTYKFQVKDQIGSYYYYPTTPLHRA  139

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             +GGYGP+ VHSR+LIPVPFD P +++ VFV DWYKKG+ +L+K+LD G+++ RPDG+++N
Sbjct  140   MGGYGPLAVHSRDLIPVPFDLPEDDYFVFVGDWYKKGHASLRKLLDGGRSLGRPDGVIIN  199

Query  816   GKNGKVGENKL----NPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTV  649
             GK      NK     +P+FTM   KTYRYR CNVG++ SVN R QGH+M +VEIEGSHTV
Sbjct  200   GKGSFGTGNKTGGEDSPMFTMIAKKTYRYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTV  259

Query  648   QNVYDSLDLHVGQCLSVLVTAN-KEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatp  472
             QNVYDSLD+H+GQC SVLVTA+ K   DYYLVA++RF K+  ++ A+IR   G       
Sbjct  260   QNVYDSLDVHLGQCYSVLVTADQKPESDYYLVASTRFSKKALTSTAIIRYVGGG----QV  315

Query  471   elppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSK-TQ  295
                P  P    G+ WSINQFRSFRWNLTASAARPNPQGSYHYG+I+ITRT K V    ++
Sbjct  316   PPSPELPPAPVGLPWSINQFRSFRWNLTASAARPNPQGSYHYGKIDITRTIKFVLKPFSK  375

Query  294   ANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN--LEKVTVAPNVVN  121
               GK RY+INGVSH DP+TPLKLAEY+ +  ++FKYD++KD P D+    +V VAPNV+N
Sbjct  376   VGGKRRYSINGVSHVDPETPLKLAEYYGVADKVFKYDMIKDQPSDSDLAAEVIVAPNVIN  435

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
              TFRNFVEII ENH+K++QT+H+ G+SFFAV +EPG+W+
Sbjct  436   GTFRNFVEIILENHDKSVQTFHVSGYSFFAVAVEPGRWT  474



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 305/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  75    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGKNFTYHFQPKDQIGSYFYYPTTAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ + ++DWY K +  LKK LD+G+TI RPDG+++N
Sbjct  135   AGAFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  195   GKAGK-GDGSDQPLFTLKQGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC  VLVTAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  254   DSLDVHVGQCFGVLVTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKG-----PASSQ  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  309   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA++GVSHTDP+TPLKLAEYF +  ++FKYD + DNP  D ++ + + PNV+N T RNF+
Sbjct  369   YALSGVSHTDPETPLKLAEYFGVVDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFI  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EI+FENHE+++Q++HLDG+SFFAV +EPG W+P
Sbjct  429   EIVFENHERSVQSWHLDGYSFFAVAVEPGTWTP  461



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 239/392 (61%), Positives = 309/392 (79%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW G+QQRKN W DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LDEPFLITWVGVQQRKNPWQDGVXGTMCPIPPGTNYTYKFQVKDQIGSFMYYPATAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + ++SR LIPVP+  P +++ V + DWY K +  L+K LD+G+++ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGXGPVSPEVPKAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL+NS ++A+GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAING+SH DP+TPLKLA+Y+ +  ++FK+D MK +P    EK+T+ PNV+N T ++FVE
Sbjct  369   YAINGISHVDPETPLKLADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK++QT+HL+G++FFAV +EPGKW+P
Sbjct  429   IIFENPEKSLQTWHLNGYAFFAVAVEPGKWTP  460



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   523 bits (1346),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 242/400 (61%), Positives = 314/400 (79%), Gaps = 7/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             + N+FN LDEPLLFTW+G+Q RKNSW DG PGT CPI PGTN+TY+ QVKDQIGS+FY+P
Sbjct  66    VFNIFNNLDEPLLFTWNGVQHRKNSWQDGVPGTNCPITPGTNYTYRLQVKDQIGSFFYYP  125

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T+L RA GG+G + ++SR LIPVP+  P +++ V +SDWY K + TLKK LD+G++I R
Sbjct  126   STALHRAAGGFGGLRINSRLLIPVPYHDPEDDYTVLISDWYTKSHTTLKKFLDSGRSIGR  185

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P+G+++NGK  K G+    P+FTM+P KTY+YR+CNVG++ S+N RFQGH M LVE+EGS
Sbjct  186   PEGVLINGKTAK-GDGSDKPMFTMKPGKTYKYRICNVGMKNSLNLRFQGHLMKLVEMEGS  244

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQN YDSLD+HVG C SVL+TA+K+ KDYY+VA++RF K   +  A++R  NG G P+
Sbjct  245   HVVQNNYDSLDVHVGGCFSVLITADKDPKDYYIVASTRFSKTVLTGKAIMRYTNGKGAPS  304

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQF++FRWNL+ASAARPNPQGSY Y +I+ITRT KLVNS +
Sbjct  305   PDIPESPL-----GWAWSLNQFKTFRWNLSASAARPNPQGSYKYSKIDITRTIKLVNSVS  359

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVN  121
             + NGKLRYA+NGVSH DP+TPLKLAEYF +  ++FKY+ ++D PP +L   V + PNV+N
Sbjct  360   RENGKLRYALNGVSHVDPETPLKLAEYFGVSDKVFKYNTIQDEPPADLGASVKIQPNVLN  419

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              T R F+EIIFEN EK+IQ+YHLDG++FF VGIEPG W+P
Sbjct  420   VTHRKFIEIIFENPEKSIQSYHLDGYAFFVVGIEPGTWTP  459



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   522 bits (1345),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 242/392 (62%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITR+ KLVN+K   +GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y  NGVSH D +TPLKLAEYF+M  ++FKYD++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK+++++HLDG+SFFAV  EPG+W+P
Sbjct  428   IIFENHEKSMESFHLDGYSFFAVASEPGRWTP  459



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   522 bits (1344),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 239/393 (61%), Positives = 304/393 (77%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+P+T+L R+
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRS  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+T+ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCYGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INI+RT  L N++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINISRTIVLKNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSH DP+TPLKLAEYF +  ++FKYD + DNP P+ ++ + + PNV+N T R F+
Sbjct  370   YALNGVSHIDPETPLKLAEYFGIADKVFKYDSITDNPTPEQIKTIKIEPNVLNITHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHEK++Q++HLDG+SFFAV +EPG W+P
Sbjct  430   EVVFENHEKSVQSWHLDGYSFFAVAVEPGTWTP  462



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   522 bits (1344),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 308/393 (78%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW G+QQRKNSW DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LDEPFLITWVGVQQRKNSWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPVTAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + ++SR LIPVP+  P +++ V + DWY K +  LKK LD+G+ +ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC +VLVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFAVLVTADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKGPASPEVPKAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL+NS ++A+GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDN-LEKVTVAPNVVNATFRNFV  100
             YAING+SH DP+TPLKLA+Y+ +  ++FK+D MK +P     EK+T+ PNV+N T ++FV
Sbjct  369   YAINGISHVDPETPLKLADYYGIREKVFKFDTMKVDPQSTPAEKITMEPNVLNITIKDFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN EK++QT+HL+G++FFAV +EPGKW+P
Sbjct  429   EIIFENPEKSLQTWHLNGYAFFAVAVEPGKWTP  461



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   521 bits (1343),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 242/392 (62%), Positives = 304/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+EAKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITR+ KLVN+K+  +GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKSFVDGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y  NGVSH D +TPLKLAEYF+M  ++FKYD++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   YGFNGVSHVDTETPLKLAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK+++++HLDG+SFFAV  EPG+W+P
Sbjct  428   IIFENHEKSMESFHLDGYSFFAVASEPGRWTP  459



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   521 bits (1343),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 246/393 (63%), Positives = 300/393 (76%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+GIQQRKNSW DGT G+ CPILPG NFTY FQVKDQIGS+ YFPT  +QRA
Sbjct  73    LDEPFLFTWNGIQQRKNSWQDGTAGSNCPILPGKNFTYHFQVKDQIGSFVYFPTLGMQRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + V+SR LIPVPFD PA+++ V + DWY K +K L+KILD G+ + RP GL++N
Sbjct  133   VGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLIN  192

Query  816   GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G +GK G  K  P LFTME  KTYRYR+CN+G++ ++NFR Q HSMTLVE++GSHTVQN 
Sbjct  193   GHSGKNGAGKDEPPLFTMEAKKTYRYRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNN  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQCLSVLVTAN+  +DYY+VA+SRF K   +   ++R               
Sbjct  253   YDSLDIHVGQCLSVLVTANQSPRDYYMVASSRFTKYMLTVTGIVRYAGSQ-----TPPSQ  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT +LVN+    +GK 
Sbjct  308   DLPEAPAGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLVNTIGNVDGKR  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSH D DTPLKLAEY+ +  ++FKYDI+ D PP +  ++ +APNVVN TFR FV
Sbjct  368   RYALNGVSHQDTDTPLKLAEYYGIADKVFKYDIISDEPPADGAQIKLAPNVVNTTFRTFV  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN E+++Q YHLDG+SFF VG+  GKW+P
Sbjct  428   EIIFENPERSMQAYHLDGYSFFPVGMGHGKWTP  460



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   520 bits (1340),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 306/392 (78%), Gaps = 7/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW GIQ RKNSW +GTPGT+CPI PGTN+TY FQVKDQIGS+FY+P+T LQRA
Sbjct  74    LDEPFLMTWHGIQHRKNSWQEGTPGTLCPIAPGTNYTYHFQVKDQIGSFFYYPSTGLQRA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + + SR LIPVP+  P +E+ V + DWY K + +L+K+LD+G++I RP+G+++N
Sbjct  134   AGGFGGLRIFSRLLIPVPYADPEDEYWVIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+    PL+TM P KTY+YR+CNVGL+ ++NFR QGHS+ LVE EGSH VQNVY
Sbjct  194   GKTAK-GDGSDQPLYTMIPGKTYKYRLCNVGLKDALNFRIQGHSLKLVETEGSHVVQNVY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA+K+ KDYY+VA++RF K + S  A+I   N           P 
Sbjct  253   DSLDVHVGQCFTVLVTADKDPKDYYMVASTRFTKYDLSAKAIIHYTNS-----AAPASPE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K  NS ++  G LR
Sbjct  308   LPPSPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKFANSVSRGQG-LR  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAINGVSH DP+TPLKLAEY+ +  ++FKY+ + D PP +L  +T APNV+NATFR+F+E
Sbjct  367   YAINGVSHVDPETPLKLAEYYGVADKVFKYNTISDEPPVDLSSITKAPNVINATFRDFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  KT+Q+Y+LDG+SFFAV +EPGKWSP
Sbjct  427   IIFENDGKTVQSYNLDGYSFFAVAMEPGKWSP  458



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   520 bits (1340),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 241/391 (62%), Positives = 301/391 (77%), Gaps = 6/391 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSG+QQRKNSW +G  GT CPI PGTN TY FQVKDQIGS+ Y+P+T++ RA 
Sbjct  76    DEPFLLTWSGVQQRKNSWQEGVLGTNCPIPPGTNHTYHFQVKDQIGSFIYYPSTAMHRAA  135

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G ++++SR LIPVP+  P +++ V V+DWY K + +L+K LD+G +I RP+G+++NG
Sbjct  136   GGFGGLHINSRLLIPVPYPDPEDDYTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLING  195

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K  K G  K  PLFTM+P KTY+YR+CN GL+TS+NFR QGH+M LVE+EGSH VQN+Y+
Sbjct  196   KTAK-GNGKDKPLFTMKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEMEGSHVVQNIYE  254

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTAN+  KDYY+VA++RF K       ++R  NG G  +      P 
Sbjct  255   SLDVHVGQCFSVLVTANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKGQASPVLPKAPV  314

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS +   GKLRY
Sbjct  315   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRY  369

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVEI  94
             AIN VSH +P+TPLKLAEYF +  ++FKYD  +DNPP  + K+   PNV+N TFRNFVEI
Sbjct  370   AINSVSHVEPETPLKLAEYFGVANKVFKYDTFQDNPPAKIGKIVSQPNVLNMTFRNFVEI  429

Query  93    IFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IFEN EK+IQ++HLDG+SFF V +EPG W+P
Sbjct  430   IFENPEKSIQSWHLDGYSFFVVAVEPGTWTP  460



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   520 bits (1338),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 302/393 (77%), Gaps = 6/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLI  192

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQND  251

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC SVLVTAN+ AKDYY+VA++RF K+E STV +IR    N      +   
Sbjct  252   YDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQAST  306

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITR+ KLVNSK+  +GK+
Sbjct  307   ELPKAPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKV  366

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FV
Sbjct  367   RFGFNGVSHVDTETPLKLAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFV  426

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEKT+Q++HLDG+SFFAV  EPG+W+P
Sbjct  427   EIIFENHEKTMQSFHLDGYSFFAVASEPGRWTP  459



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   520 bits (1338),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 305/392 (78%), Gaps = 10/392 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+Q RKNSW DGT G  CPI PGTN+TY FQVKDQIG+YFY+PTT LQRA
Sbjct  85    LDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVKDQIGTYFYYPTTGLQRA  144

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             +GG+G + + SR LIPVP+  PA+E+ V + DW+ K +  LK+ LD+G++I RP G+ +N
Sbjct  145   IGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQKLDSGRSIGRPVGVHIN  204

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKNG      L PL+TMEP KTY+YR+CNVGL+ S+NFR QGH + LVE EGSH VQN Y
Sbjct  205   GKNGG-----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNNY  259

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++E KDY++VA++RF K+  +   +IR  NG G          
Sbjct  260   DSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG-----PASGG  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P   +G AWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+ ++ANGKLR
Sbjct  315   LPPAPQGWAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKLR  374

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NGVSH D  TPLKLAEY+ +  ++FKY+++ D+P      +TVAPNV+NATFR+F+E
Sbjct  375   YGLNGVSHVDTQTPLKLAEYYGVADKVFKYNLISDSPDTAFPDLTVAPNVINATFRDFIE  434

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +IFEN  K IQ+Y+LDG+SFFA+ +EPGKW+P
Sbjct  435   VIFENPGKVIQSYNLDGYSFFALAVEPGKWTP  466



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   519 bits (1337),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 243/392 (62%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LKK+LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTTGHTALKKLLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVNSK+  +GK+R
Sbjct  308   LPKTPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGFNGVSHVDTETPLKLAEYFQMAEKVFKYNVIKDEPEAKITALTVQPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  E GKW+P
Sbjct  428   IIFENHEKSMQSFHLDGYSFFAVASEAGKWTP  459



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   518 bits (1335),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 241/392 (61%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R 
Sbjct  74    LDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTSGHTALKNFLDSGRTLGLPNGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGNN-EPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N      +    
Sbjct  253   DSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAE  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLV+SK   NGK+R
Sbjct  308   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVSSKNMVNGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  N VSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGFNSVSHVDTETPLKLAEYFQMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  428   IIFENHEKSMQSFHLDGYSFFAVASEPGRWTP  459



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   518 bits (1335),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 302/393 (77%), Gaps = 6/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP L TWSGIQ RKN W DG  GT CPI  G NFTY FQ KDQIGSYFY+PTTSL R
Sbjct  73    HLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQPKDQIGSYFYYPTTSLHR  132

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
               GG+G + V+SR LIPVP+  P +++ V + DWY  G+  LK  LD+G+T+  P+G+++
Sbjct  133   FAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLI  192

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GKVG  K  PLFTM+P KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN 
Sbjct  193   NGKSGKVG-GKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQND  251

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC SVLVTA++ AKDYY+VA++RF K+E STV +IR    N      +   
Sbjct  252   YDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASA  306

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVNSK+  +GK+
Sbjct  307   ELPKAPIGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKV  366

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FV
Sbjct  367   RFGFNGVSHVDTETPLKLAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFV  426

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  427   EIIFENHEKSMQSFHLDGYSFFAVASEPGRWTP  459



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 247/392 (63%), Positives = 306/392 (78%), Gaps = 8/392 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TW+G+Q RKNSW DG  GT CPI PG NFTY FQVKDQIGSY Y+PTT++ RA 
Sbjct  75    DEPFLLTWTGVQHRKNSWQDGVVGTNCPIPPGKNFTYHFQVKDQIGSYIYYPTTAVHRAA  134

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             G +G + V+SR LIPVP+  P +++ V + DWY K +KTLK  LD+G+++ RPDG+++NG
Sbjct  135   GAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYVKSHKTLKNFLDSGRSLGRPDGVLING  194

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K+G    N   PLFTM+P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQN Y+
Sbjct  195   KSG----NDKKPLFTMKPGKTYKYRICNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNTYE  250

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLD+HVGQC SVLVTA+K  K+YY+VA++RF K   +  A+IR  NG  G A+ +  P  
Sbjct  251   SLDVHVGQCFSVLVTADKAPKEYYMVASTRFTKTVLTGKAIIRYTNGRKGSASLKNIPEA  310

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRY  274
             P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+I ITRT K+VNS ++  GKLRY
Sbjct  311   PV---GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKIPITRTIKIVNSASRVKGKLRY  367

Query  273   AINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVNATFRNFVE  97
              INGVSH +P TPLKLAEY+ +  ++FKYD++KD PP  L  +VT+APNVVN TFRNFVE
Sbjct  368   GINGVSHVNPVTPLKLAEYYGVADKVFKYDLIKDEPPKKLSGEVTLAPNVVNQTFRNFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HL G+SFFAV IEPG+W P
Sbjct  428   IIFENHEKSLQSWHLAGYSFFAVSIEPGRWRP  459



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   517 bits (1332),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 241/392 (61%), Positives = 302/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPIL GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPILAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   TGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVGE K   LFTM+P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGE-KNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      E    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL NSK   NGK+R
Sbjct  309   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDGHSFFAV  EPG+W+P
Sbjct  429   IIFENHEKSMQSFHLDGHSFFAVASEPGRWTP  460



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   516 bits (1328),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/392 (64%), Positives = 298/392 (76%), Gaps = 10/392 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTWSGIQQRKNSW DGT G  CPI PGTN+TYKFQVKDQIGSYFY+PTT L RA
Sbjct  73    LDEPLLFTWSGIQQRKNSWADGTSGVQCPIAPGTNYTYKFQVKDQIGSYFYYPTTGLMRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G I V+SR LIPVP+  PA+E+ V + DWY K +  L+K LD+G+++ RPDG+ + 
Sbjct  133   AGGIGGIRVYSRLLIPVPYADPADEYWVLMGDWYGKSHTQLQKFLDSGRSMGRPDGVHIM  192

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+     N   PL+ MEP KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQNVY
Sbjct  193   GKS-----NSAEPLYKMEPGKTYKYRLCNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNVY  247

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTA+KE K Y +VA++RF K   +T A+I   NGNG        P 
Sbjct  248   DSLDVHVGQCFSVLVTADKEPKQYKMVASTRFTKTVLTTTAVISYTNGNG-----PASPV  302

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQ RSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+    +GKLR
Sbjct  303   LPPAPVGWAWSLNQVRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNNPFNIDGKLR  362

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             Y +NGVSH D +TPLKLAEY+ +  ++F+YD+  DNPP  +  + V  NV+N TFR FVE
Sbjct  363   YTLNGVSHEDDETPLKLAEYYGVANKVFQYDLTSDNPPAVIGNLRVEANVLNVTFRTFVE  422

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN  K IQ+Y+LDG+SFFAV +EPGKW+P
Sbjct  423   IIFENPTKVIQSYNLDGYSFFAVAVEPGKWTP  454



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 238/392 (61%), Positives = 309/392 (79%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             L+EP L TW G+QQRKN W DG  GTMCPI PGTN+TYKFQVKDQIGS+ Y+P T++ RA
Sbjct  75    LEEPFLITWVGVQQRKNPWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPATAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + ++SR LIPVP+  P +++ V + DWY K +  L+K LD+G+++ARPDG+++N
Sbjct  135   AGAFGGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K G+ K  PLFTM+  KTY+YR+CNVGL+ S+NFR QGH M LVE+EGSHTVQN Y
Sbjct  195   GKSAK-GDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC S+LVTA+KE KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGKGPVSPEVPKAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL+NS ++A+GKLR
Sbjct  314   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAING+SH DP+TPLKLA+Y+ +  ++FK+D MK +P    EK+T+ PNV+N T ++FVE
Sbjct  369   YAINGISHVDPETPLKLADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN EK++QT+HL+G++FFAV +EPGKW+P
Sbjct  429   IIFENPEKSLQTWHLNGYAFFAVAVEPGKWTP  460



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/392 (62%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GKVGE K   LFTM+P KTY+YR+CNVG ++S+NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKFGKVGE-KNEALFTMKPGKTYKYRICNVGFKSSLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      E    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL NSK   NGK+R
Sbjct  309   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDGHSFFAV  EPG+W+P
Sbjct  429   IIFENHEKSMQSFHLDGHSFFAVASEPGRWTP  460



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   515 bits (1327),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 307/394 (78%), Gaps = 11/394 (3%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLFTW G+QQRKNSW DGT G  CPI PGTN+TY+FQVKDQIG+YFY+PTT LQRA
Sbjct  75    LDEPLLFTWHGVQQRKNSWQDGTLGAQCPIAPGTNYTYRFQVKDQIGTYFYYPTTGLQRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + + SR LIPVP+  PA+E+ V + DW+ K +  LK+ LD+G++I RP G+ +N
Sbjct  135   VGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQTLDSGRSIGRPSGVHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKNG      L  L+TMEP KTY+YR+CNVGL+ ++NFR QGH M LVE EGSH VQN Y
Sbjct  195   GKNG-----GLEALYTMEPGKTYKYRICNVGLKEALNFRIQGHPMKLVETEGSHVVQNTY  249

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++E +DY++VA++RF K+  +   +IR  NG G    P  P  
Sbjct  250   DSLDVHVGQCFTVLVTADQEPRDYFMVASTRFTKKVITATRVIRYSNGVG----PASPLL  305

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             PPA  +G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLV ++++  GKLR
Sbjct  306   PPAPHQGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVGTRSKIGGKLR  365

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVVNATFRNF  103
             YA+NGVSH DP+TPLKLAEY+ +  ++FKY+++ D P   +      +APNV+NATFRNF
Sbjct  366   YALNGVSHVDPETPLKLAEYYGVADKVFKYNLISDAPDAAIASRDPIIAPNVINATFRNF  425

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E+I EN  K  Q+Y+LDG+SFFAV +EPG+WSP
Sbjct  426   IEVILENPTKVTQSYNLDGYSFFAVAVEPGQWSP  459



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   514 bits (1325),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 307/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L  WSGIQ RKN W DG PGT CPI+PG NFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  74    LDEPFLLHWSGIQHRKNCWQDGLPGTTCPIMPGQNFTYHFQPKDQIGSYFYYPSTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K + ++K +LD+G+ +  PDG+++N
Sbjct  134   AGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTSIKNLLDSGRALGSPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K+ + K  PLFTM+P KTY++R+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSAKM-DGKDQPLFTMKPGKTYKFRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AKDYY+VA++RF K+E ++  ++R   G+   +T     P
Sbjct  253   DSLDVHVGQCFAVLVTADQAAKDYYMVASTRFLKKEMTSTGVLRYVGGSAQASTVLPKAP  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS+   NGKL+
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQQVVNGKLK  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   ++++TV PNV+N TFR FVE
Sbjct  368   FGLNGVSHIDTETPLKLAEYFQMAEKVFKYNVIKDEPGAMIKQLTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +IFEN EK++Q+YHLDG+SFFAV  EPG+W+P
Sbjct  428   VIFENREKSMQSYHLDGYSFFAVATEPGRWTP  459



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   514 bits (1324),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSSE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K+  NGK+R
Sbjct  309   LPKAPVGWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYFEM  ++FKY++++D P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMSEKVFKYNVIEDEPAAKVTTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFFAV  EPGKW+P
Sbjct  429   IVFENHEKSMQSFHLDGYSFFAVASEPGKWTP  460



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   514 bits (1323),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 310/398 (78%), Gaps = 11/398 (3%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP LFTW+GIQQRKNSW +GT GT CPI PG NFTY FQVKDQIG++FY+PTT+L R
Sbjct  74    QLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGGNFTYHFQVKDQIGTFFYYPTTALHR  133

Query  999   AVGGYGPINVHSRELIPVPFD-RPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLV  823
             A GGYG ++VHSR LIP+PFD  PA+EF V VSDWY K +  L+K LD+G+++ RPDG++
Sbjct  134   AAGGYGGLSVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGVI  193

Query  822   MNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             +N   G  G+ K  P+F+M P KTYRYR CN G + S+N R QGH+M LVEIEGSH VQN
Sbjct  194   IN-GKGGNGDGKDEPMFSMTPGKTYRYRFCNAGNKDSINVRIQGHTMKLVEIEGSHVVQN  252

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLD+H+GQC+SVLVTA+K+ KDY LVA++RF K+  +  ++IR  NG G  +     
Sbjct  253   MYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGKGPASPELPK  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
              P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+    +GK
Sbjct  313   API-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGK  367

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKD--NPPDNL--EKVTVAPNVVNAT  115
             LRYA NG+SH +P TP+KLAEY+ +  ++FKYD+MKD   PP     EK+T+APNVV   
Sbjct  368   LRYAFNGISHVNPTTPIKLAEYYGVEDKVFKYDLMKDEYEPPAGKAEEKITLAPNVVKVI  427

Query  114   FRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +RN+VEIIFENHEK++Q++HL G+SFFAV IEPGKW+P
Sbjct  428   YRNYVEIIFENHEKSVQSFHLAGYSFFAVAIEPGKWTP  465



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   511 bits (1316),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 237/384 (62%), Positives = 301/384 (78%), Gaps = 7/384 (2%)
 Frame = -2

Query  1149  SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINV  970
             +GIQ RKNSW DGT GTMCPI PG NFTY FQ KDQIGSYFY+PTT++ RA G +G + V
Sbjct  19    NGIQHRKNSWQDGTAGTMCPIPPGKNFTYHFQPKDQIGSYFYYPTTAMHRAAGAFGGLRV  78

Query  969   HSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGEN  790
             +SR LIPVP+  P +++ V ++DWY K +  LKK LD+G+TI RPDG+++NGK GK G+ 
Sbjct  79    NSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGK-GDG  137

Query  789   KLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQ  610
                PLFT++  KTYR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN YDSLD+HVGQ
Sbjct  138   SDQPLFTLKQGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  197

Query  609   CLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPAHKEGIA  430
             C  V+VTAN+E KDYY+VA++RF K+  +T  L+R   G G        P  PA   G A
Sbjct  198   CFGVIVTANQEPKDYYMVASTRFLKKALATTGLLRYEGGKG-----LASPQLPAAPVGWA  252

Query  429   WSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRYAINGVSHT  250
             WS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +GKLRYA++GVSHT
Sbjct  253   WSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHT  312

Query  249   DPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFVEIIFENHEK  73
             DP+TPLKLAEYF +  ++FKYDI+ DNP  D ++ + + PNV+N T R F+E++FENHEK
Sbjct  313   DPETPLKLAEYFGVADKVFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEK  372

Query  72    TIQTYHLDGHSFFAVGIEPGKWSP  1
             ++Q++HLDG+SFFAV +EPG W+P
Sbjct  373   SVQSWHLDGYSFFAVAVEPGTWTP  396



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   513 bits (1321),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  255   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSE  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  310   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFF+V  EPG W+P
Sbjct  430   IVFENHEKSMQSFHLDGYSFFSVASEPGTWTP  461



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   513 bits (1321),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTTCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  255   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSE  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  310   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFF+V  EPG W+P
Sbjct  430   IVFENHEKSMQSFHLDGYSFFSVASEPGTWTP  461



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   513 bits (1320),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  76    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  136   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG   + PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  196   GKSGKVGGPNV-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  255   DSLDVHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSE  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  310   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  370   FGLNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFF+V  EPG W+P
Sbjct  430   IVFENHEKSMQSFHLDGYSFFSVASEPGTWTP  461



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   513 bits (1320),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 244/400 (61%), Positives = 302/400 (76%), Gaps = 6/400 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP LFTW+GIQQRKNSW DG PGT CPI PGTN+TY FQVKDQIGS+FYFP
Sbjct  67    VLNVFNNLDEPFLFTWNGIQQRKNSWQDGMPGTNCPIPPGTNYTYHFQVKDQIGSFFYFP  126

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +  + RA GG+G + ++SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  
Sbjct  127   SLGMHRAAGGFGGLRINSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAGILDAGRSIGN  186

Query  837   PDGLVMNGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEG  661
             P G++MNG +GK    K +P LFTME  KTYRYR+CNVGL+ S+NFR QGH M LVE++G
Sbjct  187   PAGVLMNGLSGKDATGKDDPPLFTMEAGKTYRYRICNVGLKLSLNFRIQGHLMKLVEMDG  246

Query  660   SHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGp  481
             SHTVQN Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   ++R        
Sbjct  247   SHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVVRYAGSK---  303

Query  480   atpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSK  301
                   P  PA   G AWS+NQ+RS RWNLTASAARPNPQGSYHYG INITRT KL +S 
Sbjct  304   --VPPSPELPAGPVGWAWSLNQWRSLRWNLTASAARPNPQGSYHYGSINITRTIKLASSV  361

Query  300   TQANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVN  121
                NGK R+ +NGVSH D  TPLKLAEY+ +  ++FKYD + D PP +   +TVAPNV+N
Sbjct  362   GLVNGKRRFGLNGVSHVDSPTPLKLAEYYGISDKVFKYDSIGDEPPASGASITVAPNVLN  421

Query  120   ATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             AT+R+++EII EN E++IQ YHLDG+SFFA G+  GKW+P
Sbjct  422   ATYRDYIEIILENPERSIQCYHLDGYSFFAAGMGHGKWTP  461



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   512 bits (1318),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 248/394 (63%), Positives = 303/394 (77%), Gaps = 15/394 (4%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             L+EP L  WSGIQ RKNSW DG  GT CPILPGTNFTY FQVKDQIGS+FY+P  ++ RA
Sbjct  75    LNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQIGSFFYYPPIAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNG-QTIARPDGLVM  820
              GG+G + V+SR LIPVP+  P +++ V + DWY K + TLK+ILDNG ++IARP+G+++
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK  K G+    PLFTM+P KTY+YRVCNVGL+TS+NFRFQGH+M LVE+EGSHTVQN 
Sbjct  195   NGKTAK-GDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQND  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       +IR  NG G  +      
Sbjct  254   YQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKGPASPEIPKA  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFR+F       +  PNPQGSYHYG INITRT KL NS T+ +GKL
Sbjct  314   PM-----GWAWSLNQFRTF-------SLEPNPQGSYHYGSINITRTIKLFNSATKVDGKL  361

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN-PPDNLEKVTVAPNVVNATFRNF  103
             RYAINGVSH DP+TPLKLAEYFE+  ++FKYD++ D  P +    VT+APNVVNATFRNF
Sbjct  362   RYAINGVSHVDPETPLKLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNF  421

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EIIFENHEK++Q++HLDG+SFFAV IEPG+WSP
Sbjct  422   IEIIFENHEKSLQSWHLDGYSFFAVAIEPGRWSP  455



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   512 bits (1318),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++       G         
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVM----SYEGSTVQPSSEL  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             P A   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K+  NGK+R
Sbjct  310   PKA-PVGWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKVTTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  429   IVFENHEKSMQSFHLDGYSFFAVASEPGRWTP  460



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   511 bits (1317),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 240/394 (61%), Positives = 302/394 (77%), Gaps = 7/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP L TW+G+QQRKNSW DG  GT CP+ PG N+TY FQVKDQIGSYFY+P+T++ R
Sbjct  73    HLDEPFLITWNGVQQRKNSWQDGVLGTNCPVPPGKNYTYHFQVKDQIGSYFYYPSTAMHR  132

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + ++SR LIPVP+  P +++ V + DWY K +  LK  LD+G+ + RPDG+++
Sbjct  133   AAGGFGGLRINSRLLIPVPYADPKDDYTVMIGDWYTKSHTQLKSFLDSGRALGRPDGVLI  192

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+ K    K  PLFTM+P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQN 
Sbjct  193   NGKSNK-SRGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQDHPMKLVEMEGSHTVQNN  251

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+HVGQC  VLVTA+K+ KDY +VA++RF K   +T A++   NG G  +      
Sbjct  252   YESLDVHVGQCFGVLVTADKKPKDYLMVASTRFTKTVLTTTAVVSYTNGKGQASPEIPKA  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYG INITRT KLVNS ++ N KL
Sbjct  312   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGHINITRTIKLVNSASKVNDKL  366

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVNATFRNF  103
             RYAINGVSH +P TPLKLAEY+ +  ++FKY+ ++D+PP  + +KVTV PNV N TFR F
Sbjct  367   RYAINGVSHEEPKTPLKLAEYYNVVDKVFKYNAIQDDPPATVGDKVTVEPNVANITFRTF  426

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             VEII ENHE +IQ++HLDG+SFFAV IEPG+W+P
Sbjct  427   VEIILENHENSIQSWHLDGYSFFAVAIEPGRWTP  460



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   511 bits (1317),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 239/392 (61%), Positives = 301/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVGE K   LFTM+P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGE-KNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      E    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL NSK   NGK+R
Sbjct  309   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  429   IIFENHEKSMQSFHLDGYSFFAVASEPGRWTP  460



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   511 bits (1316),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 299/392 (76%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L  WSGIQ RKN W DG P T CPI+PG NFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  74    LDEPFLLHWSGIQHRKNCWQDGLPATTCPIMPGQNFTYHFQPKDQIGSYFYYPSTSLHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V +SDWY K + +LK +LD+G+ +  PDG+++N
Sbjct  134   SGGFGGLRVNSRLLIPVPYPDPEDDYTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K+ + K  PLFTM+  KTY+YR+CNVG ++++NFR Q H M LVE+EGSH +QN Y
Sbjct  194   GKSAKM-DGKDQPLFTMKLGKTYKYRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ A DYY+VA+SRF K++ S   LIR   G G  +      P
Sbjct  253   DSLDVHVGQCFAVLVTADQTATDYYMVASSRFLKKQLSGTGLIRYEGGQGQASPVLPKAP  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVNS+   + KLR
Sbjct  313   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQKVVDRKLR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF+M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGFNGVSHIDTETPLKLAEYFQMAEKVFKYNVIKDEPAGKITGLTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +IFENHEK++Q+YHLDG+SFFAV  EPG+WSP
Sbjct  428   VIFENHEKSMQSYHLDGYSFFAVATEPGRWSP  459



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   511 bits (1317),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 302/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGNN-EPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVIQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASNE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  309   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH DP+TPLKLAEYF +  ++FKY+++KD P   +  + V PNV+N TFR FVE
Sbjct  369   FGLNGVSHVDPETPLKLAEYFGLAEKVFKYNVIKDEPAAKITTLVVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q+++LDG+SFF V  EPG+W+P
Sbjct  429   IVFENHEKSMQSFNLDGYSFFNVASEPGRWTP  460



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   511 bits (1317),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 304/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+EAKDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NG+SHTD +TPLKLAEYF +  ++FKY+ + +  P+  + + + P+V+N T RNF+E
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FENHEK++Q++HL+G+SFFAV +EPG W+P
Sbjct  430   VVFENHEKSVQSWHLNGYSFFAVAVEPGTWTP  461



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   511 bits (1316),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+PTT+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYYPTTALHRY  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P E+  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEEDHTILINDWYTKSHTALKNFLDSGRTLGLPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG  K  PLFT++P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVG-GKNEPLFTLKPGKTYKFRICNVGFKSTLNFRVQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E ST+ ++       G         
Sbjct  254   DSLDIHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTIGVM----SYAGSKVEASAVI  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             P A   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   +GK+R
Sbjct  310   PKA-PVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNMVDGKIR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMAEKIFKYNVIKDEPAAKITTLTVEPNVLNVTFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++ ++HLDGHSFFAV  EPG+W+P
Sbjct  429   IIFENHEKSMASFHLDGHSFFAVASEPGRWTP  460



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   511 bits (1315),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 302/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++       G         
Sbjct  254   DSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVM----SYEGSTVQPSSEL  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
             P A   G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K+  NGK+R
Sbjct  310   PKA-PVGWAWSLNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYFEM  ++FKY+++KD P      +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKATTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  429   IVFENHEKSMQSFHLDGYSFFAVASEPGRWTP  460



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   511 bits (1315),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 236/393 (60%), Positives = 300/393 (76%), Gaps = 6/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             ELDEPLLFTW+G+QQRKN W DG PGT CPI PGTN+TY+FQVKDQIGSYFY+P+  + R
Sbjct  74    ELDEPLLFTWAGVQQRKNCWQDGVPGTNCPIAPGTNYTYRFQVKDQIGSYFYYPSLGMHR  133

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + ++SR LIPVP+  P +++ V + DW+ K + TL K+LD+G+ + RP  +++
Sbjct  134   AAGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWFTKSHSTLSKLLDSGRALGRPQAVLV  193

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG+N K G+    PLFTM+P KTY+YR+CNVGL+ S+NF  Q H M LVE EGSHTVQN 
Sbjct  194   NGQNAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFGIQNHPMKLVEFEGSHTVQNS  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC  VLVTA+KE KDYY+VA++RF K   +   ++R  NG G  +      
Sbjct  253   YDSLDVHVGQCFGVLVTADKEPKDYYMVASTRFTKTVITGKGIMRYANGKGPASPELPEA  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
             P      G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KL+N+ ++  GKL
Sbjct  313   PV-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTVKLINTVSREGGKL  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSH D +TPLKLAEY+ +  ++FKYD + D P +    VT+APNV+    R F+
Sbjct  368   RYALNGVSHVDTETPLKLAEYYNVAEKVFKYDTIPDMPENLGTSVTLAPNVLKFKHRTFI  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EI+FENHEK++Q+Y+LDG+SFFAV IEPG W+P
Sbjct  428   EIVFENHEKSVQSYNLDGYSFFAVAIEPGLWTP  460



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   511 bits (1315),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 236/393 (60%), Positives = 300/393 (76%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+TI RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLKNFLDSGRTIGRPDGILIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q   M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNLKMKLVEMEGSHVLQNDY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC  V++TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  256   DSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  310

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + + KLR
Sbjct  311   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSH D +TPLKLAEYF +  ++FKYD + DNP  D ++ + + PNV+N T RNF+
Sbjct  371   YALNGVSHIDTETPLKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFI  430

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FENHE+++Q++HLDG+SFFAV +EPG W+P
Sbjct  431   EVVFENHERSVQSWHLDGYSFFAVAVEPGTWTP  463



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   511 bits (1315),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 299/393 (76%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LF W+GIQQRKNSW DG  GT CPILPGTNFTY +QVKDQIGSYFY+P+  + RA
Sbjct  77    LDEPFLFHWAGIQQRKNSWQDGVAGTNCPILPGTNFTYHYQVKDQIGSYFYYPSLGMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  P +++ V   DWY K + TL K+LD+G+ + RP  L++N
Sbjct  137   AGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWYTKSHSTLAKLLDSGRALGRPQALLVN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             G+N K G+    PLFTM P KTY+YR+CNVGL+ S+NFR Q H M LVE+EGSHTVQNVY
Sbjct  197   GQNAK-GDGTDKPLFTMLPGKTYKYRLCNVGLKNSINFRIQNHQMKLVEMEGSHTVQNVY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC  VLVTA++EAKDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  256   DSLDVHLGQCFGVLVTADQEAKDYYIVASTRFTKTVLTGKGIIRYANGKGPASPEIPEAP  315

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT K VNS ++ NGKLR
Sbjct  316   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTLKFVNSVSRDNGKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVNATFRNFV  100
             YAINGVSH D DTPLKL++Y+ +  + FK D + D P  +L   VT+APNV+   +R F+
Sbjct  371   YAINGVSHVDGDTPLKLSDYYGIGSKFFKNDTIPDQPAADLGSAVTLAPNVMKFEYRTFI  430

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFENHEK++Q+Y+L+G+SFFAV IEPG W+P
Sbjct  431   EIIFENHEKSVQSYNLNGYSFFAVAIEPGTWTP  463



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   510 bits (1314),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 301/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYAKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK+G N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKLGGNNA-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSD  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  309   IPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  429   VVFENHEKSMQSFHLDGYSFFAVASEPGRWTP  460



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   509 bits (1311),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NG+SHTD +TPLKLAEYF +  ++FKY+ + +  P+  + + + P+V+N T RNF+E
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FENHEK++Q++HL+G+SFFAV +EPG W+P
Sbjct  430   VVFENHEKSVQSWHLNGYSFFAVAVEPGTWTP  461



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   509 bits (1310),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW G+Q RKNSW DG  GT CPI  GTNFTY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWIGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK+G N   PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKIGGNNA-PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASNE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  309   IPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKLAEYF M  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +IFENHEK++Q++HLDG+SFFAV  EPG+W+P
Sbjct  429   VIFENHEKSMQSFHLDGYSFFAVASEPGRWTP  460



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   508 bits (1309),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 303/399 (76%), Gaps = 9/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TW+GIQQRKNSW +G PGT CPI PG NFTY FQVKDQIGS+FYFP
Sbjct  66    VLNVFNNLDEPFLLTWNGIQQRKNSWQEGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYFP  125

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +  + RA G +G + ++SR LIPVPF  PA+++ V +SDWY K +K L  +LD G++I  
Sbjct  126   SMGMHRAAGAFGGLRINSRLLIPVPFADPADDYTVLISDWYTKSHKALAGLLDAGRSIGN  185

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NG  GK  +N   PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GS
Sbjct  186   PAGVLINGLTGK--DNA--PLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGS  241

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQCLSVLVTAN+EAKDYY+VA++RF K   S   +IR      G  
Sbjct  242   HTVQNDYESLDVHVGQCLSVLVTANQEAKDYYMVASTRFTKYSLSATGIIRYA----GSV  297

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
              P  P  P A   G AWS NQ+RS RWNLTASAARPNPQGSYHYG INITRT +L +S  
Sbjct  298   VPPSPELPKA-PVGWAWSFNQWRSLRWNLTASAARPNPQGSYHYGGINITRTIRLASSVG  356

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK R+A+NGVSH DP TPLKLAEY+ +  ++FKYD + D+PP+    +TVAPNV+NA
Sbjct  357   LVNGKRRFALNGVSHVDPPTPLKLAEYYGIADKVFKYDSISDDPPETNAPITVAPNVLNA  416

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             T+R+++EII EN E++IQ YHLDG+SFFAVG+  GKW+P
Sbjct  417   TYRDYIEIILENPERSIQCYHLDGYSFFAVGMGHGKWTP  455



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   508 bits (1309),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 301/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  74    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P ++  + ++DWY K +  LK  LD+G+T+  PDG+++N
Sbjct  134   SGGFGGLRVNSRLLIPVPYADPEDDHTILINDWYTKSHTALKNFLDSGRTLGSPDGVLIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG     PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  194   GKSGKVGGQD-KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  252

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      +    
Sbjct  253   DSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSNV  307

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   +GK+R
Sbjct  308   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVR  367

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  368   FGLNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  427

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDG+SFF+V  EPG W+P
Sbjct  428   IVFENHEKSMQSFHLDGYSFFSVASEPGTWTP  459



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   508 bits (1307),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 299/392 (76%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+TSL R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVSGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTSLHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P E+  + ++DW+ K +  LK  LD+G+T+  PDG+++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEEDNTILINDWFTKSHTALKNFLDSGRTLGSPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GKVG +K  PLFTM P KTY++R+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  195   GKSGKVG-HKNEPLFTMNPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++ AK+YY+VA++RF K+E STV ++     N      E    
Sbjct  254   DSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEPSTE  308

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   NGK+R
Sbjct  309   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNVVNGKVR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH D +TPLKL EYF    ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  369   FGFNGVSHVDTETPLKLVEYFGFADKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHEK++Q++HLDGHSFFAV  EPG+W+P
Sbjct  429   IVFENHEKSMQSFHLDGHSFFAVASEPGRWTP  460



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   508 bits (1307),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 235/393 (60%), Positives = 304/393 (77%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW DGT GTMCPI PG+NFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGSNFTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  LKK LD+G+++ RPDG+++N
Sbjct  136   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+GK       PLFTM+P KTYR R+CNVG++TS+NFR Q H M LVE+EGSH +QN Y
Sbjct  196   GKSGKGSSGSDAPLFTMKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTA+++ KDY +VA+SRF K   ST  ++R   G G          
Sbjct  256   DSLDVHVGQCYGTIVTADQDPKDYLMVASSRFLKSVISTTGVLRYDGGKG-----PASSE  310

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT K VN++ +A+GKLR
Sbjct  311   IPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTQGKADGKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA++GVSHTDP+TP+KLAEYF M  ++FKY+I+ D+P  D  + + + PN++N T R FV
Sbjct  371   YALSGVSHTDPETPVKLAEYFGMADKVFKYNIISDSPTSDQTKTIKIEPNILNVTHRTFV  430

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+IFENHE+++Q++H+DG++FFAV +EPG W+P
Sbjct  431   EVIFENHERSVQSWHIDGYAFFAVAVEPGTWTP  463



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   506 bits (1302),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 297/395 (75%), Gaps = 39/395 (10%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L TW+GIQQRKNSW +GT GT CPILPG NFTY FQVKDQIGSY+Y+PTT+L R
Sbjct  72    QLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGSYYYYPTTALHR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYGPI++HSR LIPVPFD P EEF+VFVSDWY K +KTL+ ILD G++I RP+G+++
Sbjct  132   ATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIII  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKNGK G+ K  P+F+M   KTYRYR CNVG++ S+N RFQGH+M LVE+EGSHTVQN+
Sbjct  192   NGKNGK-GDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNM  250

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+H+GQCLSVLVTA++E KDY+LVA+SRF K+     A IR  N            
Sbjct  251   YESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTN------------  298

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                                     ASAARPNPQGSYHYGQINITRT +LV++    +GK 
Sbjct  299   ------------------------ASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKR  334

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDN--PPDNLEKVTVAPNVVNATFRN  106
             RYAINGVSH DP TP+KLAE + +  ++FKYD++KD    P   EK+T+APNVVNAT+RN
Sbjct  335   RYAINGVSHVDPTTPIKLAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRN  394

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             FVEII ENHEK++Q++HL G++FFAV IE G+W P
Sbjct  395   FVEIILENHEKSVQSWHLAGYNFFAVAIEAGRWKP  429



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   506 bits (1304),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 302/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P K+YR R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NG+SHTD +TPLKLAEYF +  ++FKY+ + +   +  + + + P+V+N T RNF+E
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADKVFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FENHEK++Q++HL+G+SFFAV +EPG W+P
Sbjct  430   VVFENHEKSVQSWHLNGYSFFAVAVEPGSWTP  461



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   506 bits (1304),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/398 (61%), Positives = 297/398 (75%), Gaps = 7/398 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             +VNVFN LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+FY+P
Sbjct  76    LVNVFNMLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYP  135

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T +QRA G YG I+VHSR+LIPVPFD PA++F V + DWY K +  L K LD G+ I R
Sbjct  136   STGMQRAAGAYGLISVHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGR  195

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P GLV+NGKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGS
Sbjct  196   PAGLVINGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGS  253

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN YDSLDLH+GQCLS LVTA+++  DY LVA++RF K++ ST A+IR    +    
Sbjct  254   HTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA---  310

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                 P   P    G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT KL   + 
Sbjct  311   --PPPAKLPEGPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRG  368

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
             + +GK R+  NGVSH DP+TP+KLAEYF     +FKY+++ D PP N     +APNV++A
Sbjct  369   KVDGKERFGFNGVSHVDPETPVKLAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISA  428

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
              FR F+E++FEN EK+I T H+DG++FFAVG+ PGKW+
Sbjct  429   EFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMGPGKWT  466



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   506 bits (1304),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/398 (61%), Positives = 297/398 (75%), Gaps = 7/398 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             +VNVFN LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+FY+P
Sbjct  76    LVNVFNMLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYP  135

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T +QRA G YG I+VHSR+LIPVPFD PA++F V + DWY K +  L K LD G+ I R
Sbjct  136   STGMQRAAGAYGLISVHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGR  195

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P GLV+NGKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGS
Sbjct  196   PAGLVINGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGS  253

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN YDSLDLH+GQCLS LVTA+++  DY LVA++RF K++ ST A+IR    +    
Sbjct  254   HTMQNDYDSLDLHIGQCLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA---  310

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                 P   P    G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT KL   + 
Sbjct  311   --PPPAKLPEGPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRG  368

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
             + +GK R+  NGVSH DP+TP+KLAEYF     +FKY+++ D PP N     +APNV++A
Sbjct  369   KVDGKERFGFNGVSHVDPETPVKLAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISA  428

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
              FR F+E++FEN EK+I T H+DG++FFAVG+ PGKW+
Sbjct  429   EFRTFIEVVFENPEKSIDTIHIDGYAFFAVGMGPGKWT  466



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   506 bits (1303),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/393 (61%), Positives = 297/393 (76%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+GIQQRKNSW +GT G+ CPI PG N+TY FQVKDQIGS+ YFP+  + RA
Sbjct  83    LDEPFLFTWNGIQQRKNSWQEGTAGSNCPIPPGQNYTYHFQVKDQIGSFVYFPSLGMHRA  142

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPF  PA+++ V + DWY K +K L K+LD+G+TI RP G+++N
Sbjct  143   AGGFGGLRVNSRLLIPVPFADPADDYTVLIGDWYTKSHKILAKLLDSGRTIGRPAGVLIN  202

Query  816   GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G++GK    K +P LFTME  KTYRYR+CNVG++ ++NFR Q HSM LVE++GSHT+QNV
Sbjct  203   GRSGKDSTGKDDPPLFTMEAGKTYRYRICNVGMKVTLNFRIQSHSMKLVEMDGSHTMQNV  262

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+HVGQCLS LV A +  KDYY+VA+SRF K   +   LIR    N          
Sbjct  263   YESLDIHVGQCLSALVEATQAPKDYYMVASSRFTKYTLTASGLIRYAGSN-----TPPSQ  317

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS NQ+RSFRWNLTASAARPNPQGSYHYG I+ITRT KLVNS    NGK 
Sbjct  318   DLPAAPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLVNSVGHVNGKR  377

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+N VSH D  TPLKLAEYF +  ++FKY+I+ D+PP +   + +APNV+NATFRNF+
Sbjct  378   RYALNAVSHQDTATPLKLAEYFGIADKVFKYNIIGDDPPASTAPIKIAPNVMNATFRNFI  437

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN E+++Q YHLDG+SFF VG+  GKW+P
Sbjct  438   EIIFENPERSMQAYHLDGYSFFPVGMGHGKWTP  470



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   506 bits (1302),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/393 (60%), Positives = 302/393 (77%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+G+QQRKNSW DG  GT CPI PG N+TY FQVKDQIGSY Y+P+T++ +A
Sbjct  75    LDEPFLLTWTGVQQRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIGSYMYYPSTAMHKA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  P +++ +   DW+ KG+ TLKK+LD+G+ + R DG+ +N
Sbjct  135   AGGFGGLRINSRLLIPVPYPDPEDDYTILAGDWFSKGHTTLKKMLDSGRNLGRCDGVHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+ K  PLFTMEP KTY+YR+CNVG++TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  195   GKVAK-GDGKDEPLFTMEPGKTYKYRICNVGIKTSLNVRFQGHNMKLVEMEGSHTVQNTY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC  VLVTA++E +DYY+VA++RF K+  +   +IR  NG G  +    P P
Sbjct  254   ESLDVHVGQCFGVLVTADQEPRDYYVVASTRFTKRVITATGIIRYTNGKGPASPELPPAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFR+FRWNLTASAARPNPQGSYHYG I+ITRT KL N+  +  GKLR
Sbjct  314   I-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGAIDITRTIKLANTAGKVGGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL-EKVTVAPNVVNATFRNFV  100
             YAING+SH DP TPLKLAEY+ +  + FKYDI++D+PP  + E++TV P VVN T+R FV
Sbjct  369   YAINGISHVDPPTPLKLAEYYNVADKSFKYDILRDDPPAKISEEITVQPIVVNLTYRTFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN E  IQ++HL G+SFFAV +E G W+P
Sbjct  429   EIIFENRETAIQSWHLSGYSFFAVAVETGTWTP  461



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   505 bits (1301),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 302/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI  GTN+TY FQ KDQIGSYFY+PTT++ RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIPVGTNYTYHFQPKDQIGSYFYYPTTAMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIP+P+D P +++ V + DWY K +  LKK LD G+T+ RP+G+++N
Sbjct  136   AGGFGGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++P K++R R+CNVGL+TS+NFR Q H M LVE+EGSH +QN +
Sbjct  196   GKAGK-GDGSDAPLFTLKPGKSHRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDF  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC   +VTAN+E KDYY+VA+SRF K   +T  L+R   G G          
Sbjct  255   DSLDVHVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQ  309

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLT+SAARPNPQGSYHYG+INITRT KLVN++ + +GKLR
Sbjct  310   LPAGPVGWAWSLNQFRSFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NG+SHTD +TPLKLAEYF +  ++FKY+ + +   +  + + + P+V+N T RNF+E
Sbjct  370   YALNGISHTDLETPLKLAEYFGIADKVFKYNSVDNPTAEQTKSIKIEPHVLNITHRNFIE  429

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FENHEK++Q++HL+G+SFFAV +EPG W+P
Sbjct  430   VVFENHEKSVQSWHLNGYSFFAVAVEPGTWTP  461



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   503 bits (1296),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 239/393 (61%), Positives = 294/393 (75%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+GIQQRKNSW DG  GT CPI PGTN+TY FQVKDQIGS+FYFP+  + RA
Sbjct  73    LDEPFLFTWNGIQQRKNSWQDGMLGTNCPIPPGTNYTYHFQVKDQIGSFFYFPSVGMHRA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  P G++MN
Sbjct  133   AGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKALAGILDAGRSIGNPTGILMN  192

Query  816   GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G  GK    K + PLF ME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN 
Sbjct  193   GSPGKNAAGKDDAPLFAMEAGKTYRYRICNVGLKVSLNFRIQNHLMKLVEMDGSHTVQND  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   ++R    N          
Sbjct  253   YESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMLTATGIVRYAGSN-----VPPSS  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT KL +S    NGK 
Sbjct  308   ELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKR  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+A+NGVSH + +TPLKLAEY+ +  ++FKYD + D PP     +T APNV+NATFR+++
Sbjct  368   RFALNGVSHVETETPLKLAEYYGIADKVFKYDSISDEPPAASATITAAPNVLNATFRDYI  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII EN E++IQ++HLDG+SFFAVG+  GKW+P
Sbjct  428   EIILENPERSIQSFHLDGYSFFAVGMGHGKWTP  460



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   503 bits (1296),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP LF+W+GIQQRKNSW DG  GT CPI PG NFTY FQVKDQIGS++Y+P
Sbjct  69    VINVFNNLDEPFLFSWNGIQQRKNSWQDGVSGTSCPIAPGQNFTYHFQVKDQIGSFYYYP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             + ++ +A GG+G + ++SR LIPVPFD PA+++ V + DWY K +KTL +ILD G++I  
Sbjct  129   SLAMHKAAGGFGGLRINSRLLIPVPFDPPADDYTVMIGDWYTKDHKTLARILDTGRSIGL  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NGK GK  E    PLF ME  K YRYRVCN+G +TS+NFR QGHSM LVE++GS
Sbjct  189   PAGVLINGKAGKDDE----PLFVMEAGKVYRYRVCNIGTKTSLNFRIQGHSMLLVEMDGS  244

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN Y+SLD+HVGQC SVLVTAN+   DYY+VA++RF ++E +   +IR    +    
Sbjct  245   HTMQNTYESLDIHVGQCFSVLVTANQAPGDYYMVASTRFLRKELTATGVIRYSGSH----  300

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  P  P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYG I+ITRT KL +S+ 
Sbjct  301   -TLPSPVLPKAPSGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLASSRA  359

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
                GK RY +NGVSH + DTPLKLAEYF + G+ FKY++  D PP       +A NV+  
Sbjct  360   IIAGKNRYTLNGVSHVEADTPLKLAEYFGIGGKSFKYNLTSDEPPSGGAPAILATNVITI  419

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR FVEIIFEN EK +Q+YHL+G+SFF VG+ PGKW+P
Sbjct  420   EFRTFVEIIFENPEKNVQSYHLNGYSFFLVGMGPGKWTP  458



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   503 bits (1294),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/392 (61%), Positives = 306/392 (78%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+G+Q RKNSW DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +A
Sbjct  75    LDEPFLVTWNGVQHRKNSWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYIYYPVTAMHKA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + V+SR LIPVP+  PA+++ + V D++ KG+ +LKKILD+G+ + R DG+ +N
Sbjct  135   VGGFGGLRVNSRLLIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+ K  PLFTME  KTY+YR+CN G++TS+N RFQGH+M LVE+EGSHT+QN Y
Sbjct  195   GKVAK-GDRKDEPLFTMEAGKTYKYRICNTGIKTSLNVRFQGHTMKLVEMEGSHTMQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC SVLVTAN+E +DYY+VA++RF ++E +   +IR  NG G  ++   PPP
Sbjct  254   DSLDVHVGQCFSVLVTANQEPRDYYVVASTRFTRREVTATGIIRYKNGKGAASSELPPPP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFR+FRWNLT++AARPNPQGSY YG INITRT KL N+  + +GKLR
Sbjct  314   V-----GWAWSLNQFRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQKVDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NGVS+ +P TPLKLAEY+ +  ++FKYD + D P  +  KVT+AP V+N T RNFVE
Sbjct  369   YALNGVSYVEPTTPLKLAEYYGVADKVFKYDTIPDEPQSDNTKVTLAPIVLNMTHRNFVE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHE  IQ+YHL G+SFFAVG++ GKWSP
Sbjct  429   IIFENHESAIQSYHLSGYSFFAVGMDVGKWSP  460



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   503 bits (1294),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/394 (61%), Positives = 295/394 (75%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP LFTW+GIQ RKNSW DG PGT CPI  GTN+TY FQVKDQIGSYFYFP+  + R
Sbjct  72    HLDEPFLFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L ++LD G++I  P G+++
Sbjct  132   AAGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVII  191

Query  819   NGKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NG  GK    K + PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN
Sbjct  192   NGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQN  251

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
              Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K   +   +IR    +         
Sbjct  252   DYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPS  306

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
             P  PA   G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT KL +S    NGK
Sbjct  307   PELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGK  366

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              R+A+NG SH +  TPLKLAEY+ +  ++FKYD + D PP++   +TVAPNV+NATFR++
Sbjct  367   RRFALNGASHVESPTPLKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDY  426

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EII EN E++IQ+YHLDG+SFFAVG+  GKW+P
Sbjct  427   IEIILENPERSIQSYHLDGYSFFAVGMGHGKWTP  460



>ref|XP_004296148.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   501 bits (1289),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 302/385 (78%), Gaps = 7/385 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSGIQQRKNSW DGT GTMCPI  GTNFTY FQVKDQIGS+ Y+PTT++ RA
Sbjct  75    LDEPFLLTWSGIQQRKNSWQDGTLGTMCPIPAGTNFTYHFQVKDQIGSFIYYPTTAMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+D P E++ V + DWYKK +  LK+ LD+G+T+ARPDG+++N
Sbjct  135   GGAFGGLRVNSRPLIPVPYDTPEEDYTVLIGDWYKKSHIALKQQLDSGRTLARPDGVLIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK+ K G+ K  PLFTM+  KTY++R+CN+G+++S+NFR Q H M LVE+EGSHTVQN Y
Sbjct  195   GKDAK-GDGKDEPLFTMKAGKTYKFRICNIGVKSSLNFRIQEHWMMLVEMEGSHTVQNTY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
              SLD+H+GQC++VLVTA++  KDYY+VA++RF K   +   ++R  NG G   +      
Sbjct  254   QSLDVHLGQCMAVLVTADQTPKDYYMVASTRFTKTVLTGKGILRYENGKGPADSELPEA-  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                  EG AWS+NQFRSFRWNL++SAARPNPQGSYHYG+INITRT KLVN+ TQ +GKLR
Sbjct  313   ----PEGWAWSLNQFRSFRWNLSSSAARPNPQGSYHYGRINITRTMKLVNAATQVDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLE-KVTVAPNVVNATFRNFV  100
             Y+INGVSH DP+TPLKLAEYF +  ++FK   +KD+PP +++ K  + PNVV+ T R+FV
Sbjct  369   YSINGVSHVDPETPLKLAEYFGVGDKVFKTGSIKDDPPADVDTKAVILPNVVDQTHRDFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVG  25
             EIIFENHEK++QT+H+ G++ FAV 
Sbjct  429   EIIFENHEKSLQTWHVSGYAVFAVA  453



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   502 bits (1293),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 239/394 (61%), Positives = 295/394 (75%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP LFTW+GIQ RKNSW DG PGT CPI  GTN+TY FQVKDQIGSYFYFP+  + R
Sbjct  78    HLDEPFLFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHR  137

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + V+SR LIPVPFD PA+++ V + DWY K +K L ++LD G++I  P G+++
Sbjct  138   AAGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVII  197

Query  819   NGKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NG  GK    K + PLFTME  KTYRYR+CNVGL+ S+NFR Q H M LVE++GSHTVQN
Sbjct  198   NGSPGKDAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQN  257

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
              Y SLD+HVGQC SVLVTAN+E KDYY+VA++RF K   +   +IR    +         
Sbjct  258   DYKSLDIHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPS  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
             P  PA   G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT KL +S    NGK
Sbjct  313   PELPAGPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGK  372

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              R+A+NG SH +  TPLKLAEY+ +  ++FKYD + D PP++   +TVAPNV+NATFR++
Sbjct  373   RRFALNGASHVESPTPLKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDY  432

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EII EN E++IQ+YHLDG+SFFAVG+  GKW+P
Sbjct  433   IEIILENPERSIQSYHLDGYSFFAVGMGHGKWTP  466



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   504 bits (1298),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/394 (61%), Positives = 295/394 (75%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
              LDEP LFTW+GIQQRKNSWVDGT GT CPI PG NFTY FQVKDQIGS+ YFP   + R
Sbjct  161   HLDEPFLFTWNGIQQRKNSWVDGTAGTNCPIPPGQNFTYHFQVKDQIGSFVYFPALDMHR  220

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG+G + V+SR LIPVPF  PA+++ V V DWY K +K L ++LD G+TI RP G+++
Sbjct  221   AAGGFGGLRVNSRLLIPVPFADPADDYTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILI  280

Query  819   NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NG+ GK    K +P LFTM+  KTYRYRVCNVG++ S+NFR Q H+M LVE++GSHTVQN
Sbjct  281   NGRPGKDSTGKDDPPLFTMKSGKTYRYRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQN  340

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             VYDSLD+HVGQCLSVLVTA++E +DYY+VA+SRF K   S   +IR    N         
Sbjct  341   VYDSLDVHVGQCLSVLVTAHQEHRDYYMVASSRFTKYALSATGVIRYAGSN-----TPPS  395

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
             P  PA   G AWS NQ+RSFR NLTASAARPNPQGSYHYG INITRT KLVNS    +GK
Sbjct  396   PDLPAAPSGWAWSFNQWRSFRLNLTASAARPNPQGSYHYGSINITRTIKLVNSVGLVDGK  455

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              RYA+N VSH+D  TPLKLAEY+ +  ++FKYD + D P  +   + + PNVVNAT+R F
Sbjct  456   RRYALNAVSHSDAATPLKLAEYYGIADKVFKYDTIADEPAASDAPIKIVPNVVNATYRTF  515

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EI+FEN ++++Q YHLDG+SFFA G+  GKW+P
Sbjct  516   IEIVFENPDRSMQAYHLDGYSFFAAGMGHGKWTP  549



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   501 bits (1289),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/393 (60%), Positives = 297/393 (76%), Gaps = 7/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             ++D+P LFTW GIQQRKNSW DG PGT CPI+PGTNFTYK Q KDQIG++FYFP+  +QR
Sbjct  80    QIDKPFLFTWHGIQQRKNSWQDGMPGTQCPIMPGTNFTYKMQSKDQIGTFFYFPSIGMQR  139

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG ++VHSR LIPVPFD PA++F+V V DWY K +  L+K +D G++I RP GL++
Sbjct  140   AAGGYGLMSVHSRPLIPVPFDPPADDFSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLI  199

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++ +E  KTYR+RVCNVG+++S+N R QGH + LVE+EGSHTVQN 
Sbjct  200   NGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNE  257

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQCLS LVTAN++  DY LVA++RF K+  +  A+IR    +         P
Sbjct  258   YDSLDVHVGQCLSFLVTANQKPGDYLLVASTRFIKEVSTITAIIRYKGSS-----VPASP  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  S+ + +GK 
Sbjct  313   KLPEAPNGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRAKVDGKE  372

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSH DPDTP KLAEYF     +F+Y+++ D PP     + VAPN++ A FR F+
Sbjct  373   RYALNGVSHVDPDTPPKLAEYFNATTGVFEYNLIGDTPPKEGTPIKVAPNILTAEFRTFI  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FEN EK+I ++HL+G++FFA G+ PG W+P
Sbjct  433   EVVFENPEKSIDSFHLNGYAFFAAGMGPGLWTP  465



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   500 bits (1288),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 236/394 (60%), Positives = 295/394 (75%), Gaps = 8/394 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW+DGTPGT CPILPG NFTY FQ KDQIGS+FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGIQHRKNSWMDGTPGTNCPILPGQNFTYHFQPKDQIGSFFYFPSIGMQKA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + VHSR LIPVPF  PAEEFNV   DW+ +G+K L + LD G+ +  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFAPPAEEFNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLIN  193

Query  816   GKNGK--VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             G++G+   G + L P+FTM+    YR+R CNVGL+ S+NFR Q HS+ LVE+EGSHTVQN
Sbjct  194   GRSGRNAAGHDDL-PMFTMQAGNVYRFRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQN  252

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLD+HVGQC+SVLVTA++   DYYLVA++RF K+  +  A++R    N  P+     
Sbjct  253   LYDSLDVHVGQCMSVLVTADQAPGDYYLVASTRFTKKVHTATAVLRYAGSNSPPSRVIPR  312

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
                     G AWS NQ+R+FRWNLTASAARPNPQGSYHYGQINITRT +LVN     +GK
Sbjct  313   G-----PSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIRLVNGHNVVDGK  367

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
             LRY ING+SH + DTPLKLAEYF     +FKY++M D PP     +T+ PNV+ A FR F
Sbjct  368   LRYFINGISHVESDTPLKLAEYFNASSPVFKYNLMGDVPPAPDAPLTLVPNVITAEFRTF  427

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EIIFEN E++IQ+YHLDG++FF VG+ PGKWSP
Sbjct  428   IEIIFENTERSIQSYHLDGYAFFPVGMGPGKWSP  461



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   500 bits (1288),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 295/394 (75%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP+LF+W+GIQ RKNSW+DGTPGT CPI+PGTN+TY FQ KDQIGSYFYFP+  +Q+
Sbjct  72    KLDEPILFSWNGIQHRKNSWMDGTPGTNCPIMPGTNWTYHFQPKDQIGSYFYFPSIGMQK  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G + VHSR LIPVP+  PAEEFNV   DWY K +K L ++LD+G+ + RP G+++
Sbjct  132   AAGGIGMLRVHSRLLIPVPYADPAEEFNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLI  191

Query  819   NGKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NGK+GK    K   P+FTME  KTYRYRVCNVG++TS++FR Q H++ LVE+EGSHT+QN
Sbjct  192   NGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQN  251

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             VYDSLD+H+GQC SV VTA+++  DYY+V ++RF K      A+IR    N         
Sbjct  252   VYDSLDIHIGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----TPPS  306

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
             P  P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT +L  S    NGK
Sbjct  307   PDLPPAPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGK  366

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              RYA+NGVSH +P TPLKL+EY+ +  + FKY+I+ D PP +   + ++PNVVN TFR F
Sbjct  367   RRYALNGVSHENPATPLKLSEYYGIAEKEFKYNIIGDEPPADKSTIVISPNVVNCTFRTF  426

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EII EN E++I  YHLDG+SFF VG+  G+W+P
Sbjct  427   IEIILENPERSIHAYHLDGYSFFPVGMGHGEWTP  460



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   499 bits (1286),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 233/393 (59%), Positives = 300/393 (76%), Gaps = 7/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEPLLF W+G+QQRKNSW DG  GT CPI PGTN+TY FQVKDQIGS+FY+P+  LQRA
Sbjct  76    LDEPLLFHWAGVQQRKNSWEDGVAGTNCPIQPGTNYTYHFQVKDQIGSFFYYPSLGLQRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  P +++ V   DW+ K + TL+K+LD G+++ RP  +++N
Sbjct  136   AGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWFTKSHSTLRKLLDGGRSLGRPQAVLLN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             G+N K G+    PLFTM P KTY+YR+CNVGL+ ++NFR Q H M LVE+EGSHTVQN Y
Sbjct  196   GQNAK-GDGTDKPLFTMIPGKTYKYRICNVGLKNTINFRIQNHPMKLVEMEGSHTVQNTY  254

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+H+GQC  VLVTAN+E KDYY+VA++RF K   +   ++R   G   P+      P
Sbjct  255   NSLDVHLGQCFGVLVTANQEPKDYYMVASTRFTKSILTGKGIMRYTTGKAPPSPEIPEAP  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQ+NITRT K +NS ++ +GKLR
Sbjct  315   V-----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQVNITRTVKFINSVSRDSGKLR  369

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEK-VTVAPNVVNATFRNFV  100
             YAINGVSH D +TP+KLAEYF +P ++FKYDI+ DNP  ++ K V + PNV+    R F+
Sbjct  370   YAINGVSHVDGETPIKLAEYFGVPEKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN EK++Q+YHL+G++FFAV IEPG W+P
Sbjct  430   EIIFENPEKSVQSYHLNGYAFFAVAIEPGTWTP  462



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   499 bits (1284),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 235/393 (60%), Positives = 292/393 (74%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+G+Q RKNSW+DGTPGT CPILPG NFT+ FQ KDQIGS+FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGVQHRKNSWMDGTPGTNCPILPGQNFTFHFQPKDQIGSFFYFPSLGMQKA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G + VHSR LIPVPF  PA+EFNV   DW+ K +K L + LD G+ +  P G+++N
Sbjct  134   AGGVGMLRVHSRLLIPVPFAPPAQEFNVLAGDWFTKSHKVLARQLDAGRGLGLPAGVLIN  193

Query  816   GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G+ GK    +  P +FTM+    YR+R CNVGL+TS+NFR Q HS+ LVE+EGSHTVQN+
Sbjct  194   GRLGKDAAGRDEPPMFTMQAGNVYRFRFCNVGLKTSLNFRLQKHSLKLVEMEGSHTVQNL  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQCLSVLVTA++   DYYLVA++RF K+  +  A++R    N  P+      
Sbjct  254   YDSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKEILAATAVLRYAGSNAPPSPVIPDG  313

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
                    G AWS NQ+R+FRWNLTASAARPNPQGSYHYGQINITRT KLVN  +  +GK 
Sbjct  314   -----PSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRTIKLVNGHSVVDGKR  368

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ ING+SH DPDTPLKLAEYF +    F+Y++M D PP     VT+APNV+ A FR F+
Sbjct  369   RHFINGISHVDPDTPLKLAEYFNLSKPAFEYNLMGDVPPAPDAPVTLAPNVITAEFRTFI  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN E++IQ+YHLDG++FF  G+ PGKWSP
Sbjct  429   EIIFENTERSIQSYHLDGYAFFPAGMGPGKWSP  461



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   499 bits (1284),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 240/392 (61%), Positives = 291/392 (74%), Gaps = 7/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+PLLF W GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS++YFP+  +QRA
Sbjct  81    LDQPLLFHWHGIQQRKNSWQDGLPGTMCPIQPNTNFTYHWQPKDQIGSFYYFPSIGMQRA  140

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG I VHSR+LIPVPFD PA++F V VSDWY K +  L K LD+G+ I RP GLV+N
Sbjct  141   AGGYGLITVHSRDLIPVPFDTPADDFPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVIN  200

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K   N   P++ ME  KTYR+RVCN+G++ S N R Q H + LVE+EGSHTVQN Y
Sbjct  201   GKNEKDASNP--PMYNMEAGKTYRFRVCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTY  258

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLH+GQCLS LVTA++   DY LVA++RF K+  +  A+IR    N        P  
Sbjct  259   DSLDLHIGQCLSFLVTADQAPGDYLLVASTRFIKEVSTITAVIRYKGSN-----TPPPSQ  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  SK + +GK R
Sbjct  314   LPEAPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLATSKGKVDGKER  373

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NGVSH D +TPLKLAEYF     +F+Y+IM D PP     + +APNV++A FR F+E
Sbjct  374   YALNGVSHVDTETPLKLAEYFNATDGVFQYNIMGDVPPAAGTPIKMAPNVISAEFRTFIE  433

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FEN EK+I T+H++G++FFA G+ PG WSP
Sbjct  434   VVFENPEKSIDTFHINGYAFFAAGMGPGTWSP  465



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   498 bits (1283),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 299/399 (75%), Gaps = 7/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             +VNVFN+LD+PLLFTW+GIQ RKNSW DG PGT CP+ PGTN+TY +Q KDQIG++FYFP
Sbjct  77    MVNVFNQLDQPLLFTWNGIQHRKNSWQDGVPGTNCPVAPGTNYTYHWQPKDQIGTFFYFP  136

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +  +QRAVGG+G I+V SR LIPVPFD PA++  V + DW+ K +  +  +LD G++  R
Sbjct  137   SIGMQRAVGGFGLISVVSRLLIPVPFDPPADDLQVVIGDWFTKDHAVMASLLDAGRSFGR  196

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NGK GK   N   P+FT E +KTYR R+CNVG+++S+NFR QGH M LVEI+GS
Sbjct  197   PAGVLINGKGGKEATNP--PMFTWEAAKTYRLRICNVGIKSSLNFRIQGHDMKLVEIDGS  254

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+Q+ YDSLD+HVGQCLSVLV A+++  DY +VA++RF     S  A++R    N    
Sbjct  255   HTLQDSYDSLDVHVGQCLSVLVDADQKPADYLMVASTRFMADASSVSAVVRYAGSN----  310

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  P  P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL+ ++ 
Sbjct  311   -TPPAPNVPEPPAGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRG  369

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               +GKL+Y  NGVSH D DTPLKLAEYF +  ++FKY+ M D PP     + VAPNV+ A
Sbjct  370   HIDGKLKYGFNGVSHVDADTPLKLAEYFNISDQVFKYNQMADTPPAVNGPMHVAPNVITA  429

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR F+E++FEN EK++ + H+DG++FFAVG+ PGKW+P
Sbjct  430   EFRTFIEVVFENPEKSMDSVHIDGYAFFAVGMGPGKWTP  468



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   498 bits (1282),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 295/392 (75%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LFTW+GIQQRKNSW DG  GT CPI  G+NFTY FQVKDQIGSYFY+P+  + RA
Sbjct  75    LDEPFLFTWAGIQQRKNSWQDGVAGTNCPIPVGSNFTYHFQVKDQIGSYFYYPSLGMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +++ V + DWY K +  L K+LD+G+++ RP  +++N
Sbjct  135   AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             G+  K G+    PLFTM+P KTY+YR+CNVGL+ S+NFR QGH M LVE EGSHTVQN Y
Sbjct  195   GQVAK-GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+H+GQC  VLVTA+K+ KDYY+VA++RF K   +   +IR  NG G  +      P
Sbjct  254   DSLDVHLGQCFGVLVTADKDPKDYYMVASTRFTKSIVTGKGIIRYTNGKGPASPELPEAP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFRSF WNLTASAARPNPQGSYHYGQINITRT KL+NS ++ N KLR
Sbjct  314   V-----GWAWSLNQFRSFHWNLTASAARPNPQGSYHYGQINITRTVKLINSVSRDNSKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NG+SH DP+TPLKLAEYF +  ++FKYD + D P      VT+ PNV+N   R F+E
Sbjct  369   YALNGISHVDPETPLKLAEYFGIAEKVFKYDSIPDMPQSVPSSVTLQPNVLNFKHRTFIE  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFENHEK++Q+++L+G+SFF V IEPG W+P
Sbjct  429   IIFENHEKSVQSFNLNGYSFFKVAIEPGTWTP  460



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   498 bits (1282),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 294/393 (75%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP LF+W+GIQQRKNSW DG PGT CPI PG NFTY FQVKDQIGS++YFP+ ++ +A
Sbjct  75    LDEPFLFSWNGIQQRKNSWQDGVPGTNCPIQPGKNFTYHFQVKDQIGSFYYFPSLAMHKA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + ++SR LIPVPFD PA+++ V V DWY K +K L K LD G++I  P G+++N
Sbjct  135   VGGFGGLRINSRLLIPVPFDPPADDYTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLIN  194

Query  816   GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK G  K + PLF ME  K YRYR+CN G++ S+NFR QGH+M LVE++GSHT+QN+
Sbjct  195   GKSGKHGSGKDDKPLFVMEAGKVYRYRICNTGIKASINFRIQGHTMELVEMDGSHTMQNM  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC SVLVTA++  KDYYLVA++RF ++E +  A++R    N          
Sbjct  255   YDSLDIHVGQCFSVLVTADRAPKDYYLVASTRFLRKEITATAVVRYAGSN-----TPPSA  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G  WS+NQ+RSFRWNLTASAARPNPQGSYHYG INITRT KL +S+    GK+
Sbjct  310   VLPKGPTGWGWSLNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLSSSRVVDGGKI  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ +NG+SH D DTPLK  EYF +  + FKY+++ D PP +    T+APNV+   FR +V
Sbjct  370   RFTLNGLSHVDTDTPLKHGEYFGVGDKFFKYNLIGDVPPASKAPFTLAPNVITIEFRTYV  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII EN E+ +Q+YHLDG+SFF VG+ PGKW+P
Sbjct  430   EIILENPERNLQSYHLDGYSFFPVGMGPGKWTP  462



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   496 bits (1278),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 299/399 (75%), Gaps = 7/399 (2%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             +VNVFN LD+P L +W+GIQQRKNSW DG PGT CPI PG NFTY FQVKDQIGSYFYFP
Sbjct  65    VVNVFNNLDQPFLLSWNGIQQRKNSWQDGMPGTNCPIPPGQNFTYHFQVKDQIGSYFYFP  124

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +  + +A G +G + ++SR  IPVPFD PA+++ V + DWY   + TL++ LD+G++I +
Sbjct  125   SMYMHKAAGAFGGLRINSRLYIPVPFDDPADDYTVLIGDWYASDHNTLRRRLDSGRSIGQ  184

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NG N     NK  PLF MEP KTYRYR+CNVGL+TS+NFR QGH++ LVEIEGS
Sbjct  185   PDGVLINGMNKPNKANK--PLFNMEPGKTYRYRICNVGLKTSLNFRIQGHTLKLVEIEGS  242

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN+Y+SLD+HVGQC SVLVTANK  +DYY+VA++RF  +   T   + +  G+    
Sbjct  243   HTVQNIYESLDVHVGQCYSVLVTANKVPRDYYIVASTRFTNKYTHTATALIHYTGS----  298

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                 P   P    G+AWS+NQFRSFRWNLTASAARPNPQGS+HYGQINITRT KL NS  
Sbjct  299   KKPAPLMLPPAPTGVAWSLNQFRSFRWNLTASAARPNPQGSFHYGQINITRTIKLSNSVG  358

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
                 KLRYA+NGVS+  P TPLKLAEY+ +  R+F    + D PP +  ++ +AP VV  
Sbjct  359   FVKSKLRYAMNGVSYVRPSTPLKLAEYYGVAARVFDTKAIADMPPAS-PQIKLAPAVVKG  417

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR+F+EI+FEN EK+IQ++HLDG+SFFAVG+  G+W+P
Sbjct  418   NFRDFIEIVFENREKSIQSWHLDGYSFFAVGMSGGQWTP  456



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   496 bits (1277),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 299/392 (76%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKN W DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +A
Sbjct  59    LDEPFLLTWSGVQHRKNPWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYMYYPVTAMHKA  118

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVP+  PA+++ +   D++ KGY +LKK+L +G+ + R DG+ +N
Sbjct  119   AGGFGGLRINSRLLIPVPYADPADDYTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHIN  178

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+    PLFTME  KTY+YR+CN G++TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  179   GKVAK-GDGNDEPLFTMEAGKTYKYRICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDY  237

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC SVLVTAN+E KDY++VA++RF K+E     +IR  NG G P+    PPP
Sbjct  238   ESLDVHVGQCFSVLVTANQEPKDYFVVASTRFTKREVIATGVIRYNNGKGAPSPKLPPPP  297

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                     AWS+NQFR+FRWNLTASAARPNPQGSY YG INITRT KL N+  + +GKLR
Sbjct  298   V-----SWAWSLNQFRTFRWNLTASAARPNPQGSYKYGSINITRTIKLANTAHKVDGKLR  352

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NGVS+ +P TPLKLAEY+ +  ++FKYD + D+PP  + KVT+ P V+N T RNF+E
Sbjct  353   YALNGVSYVEPTTPLKLAEYYNVADKVFKYDNIPDDPPAEITKVTMEPIVLNMTHRNFIE  412

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN E  IQ+YHLDG+SFFAV IE GKWSP
Sbjct  413   IIFENRETAIQSYHLDGYSFFAVAIETGKWSP  444



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   496 bits (1276),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 300/392 (77%), Gaps = 6/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKN W DG  GT CPI PGTN+TYKFQVKDQIGSY Y+P T + +A
Sbjct  75    LDEPFLLTWSGVQHRKNPWQDGVLGTNCPIPPGTNYTYKFQVKDQIGSYMYYPVTGMHKA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
             VGG+G + ++SR LIPVP+  PA+++ +   D++ KG+ TLKKIL++G+ + R DG+ +N
Sbjct  135   VGGFGGLRINSRLLIPVPYADPADDYTIIAGDFFNKGHTTLKKILESGRNLGRCDGVHIN  194

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK  K G+    PLFTME  KTY+YR+CN GL+TS+N RFQGH+M LVE+EGSHTVQN Y
Sbjct  195   GKVAK-GDGSDEPLFTMEAGKTYKYRICNAGLKTSLNVRFQGHNMKLVEMEGSHTVQNDY  253

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             +SLD+HVGQC SVLVTA++E  DY++VA++RF KQE +   +IR  NG G P+    PPP
Sbjct  254   ESLDVHVGQCFSVLVTADQEPMDYFVVASTRFTKQEVTATGVIRYTNGKGAPSPKLPPPP  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
                   G AWS+NQFR+FRWNLTASAARPNPQGSY YG +NITRT KL N+  + +GKLR
Sbjct  314   V-----GWAWSLNQFRTFRWNLTASAARPNPQGSYKYGSVNITRTIKLANTAQKVDGKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YAING S+ +P TPLKLAEY+ +  ++FKYD + D+PP  + K+T+ P V+N T RNF+E
Sbjct  369   YAINGASYVEPTTPLKLAEYYGVADKVFKYDTIPDDPPAEITKITMEPVVLNLTHRNFME  428

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             IIFEN E  IQ+YHL G++FFAV +E G+WSP
Sbjct  429   IIFENRETAIQSYHLCGYAFFAVAVETGQWSP  460



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   496 bits (1276),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 292/392 (74%), Gaps = 7/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+PLLFTW GIQQRKNSW DG PGTMCPI P TNFTY +Q KDQIGS+ Y+P+T +QRA
Sbjct  82    LDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFVYYPSTGMQRA  141

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G YG I+VHSR+LIPVPFDRPA++F V V DWY K +  L K LD G+ I RP GLV+N
Sbjct  142   AGAYGLISVHSRDLIPVPFDRPADDFPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVIN  201

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K   N   P++ +E  KTYR+R+CNVG++ S+N   Q H M LVE+EGSHT+QN Y
Sbjct  202   GKNEKDAANP--PMYNVEAGKTYRFRICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDY  259

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQCLSVLVTA+++  DY LVA++RF K+  +T A+IR    +        P  
Sbjct  260   DSLDIHVGQCLSVLVTADQKPGDYLLVASTRFIKEVSTTTAVIRYKGASA-----PPPAK  314

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT +L   + + +GK R
Sbjct  315   LPESPSGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIRLGIGRGKVDGKER  374

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + INGVSH DP+TP+KLAEYF     +F+YD++ D PP       +APNV+ A FR F+E
Sbjct  375   FGINGVSHVDPETPVKLAEYFNATDGVFQYDLIGDVPPAKSAPTKMAPNVLRAEFRTFIE  434

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FEN EK+I T+H+DG++FFAVG+ PGKW+P
Sbjct  435   VVFENPEKSIDTFHIDGYAFFAVGMGPGKWTP  466



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 236/393 (60%), Positives = 288/393 (73%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW+DG PGT CPILPG NFTY FQ KDQIGS+FY P+  +Q+A
Sbjct  74    LDEPFLLTWNGIQHRKNSWMDGAPGTNCPILPGQNFTYHFQPKDQIGSFFYIPSLGMQKA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + VHSR LIPVPFD PAEEFNV   DW+ K +K L   LD G+++  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFDPPAEEFNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLIN  193

Query  816   GKNGK-VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G+ GK    +   P+FTM+    YR+R CNVGL+TS+NFR Q H + LVE+EGSHTVQN+
Sbjct  194   GRRGKDAAGHDEPPMFTMQAGDVYRFRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNL  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y SLD+HVGQCLSVLVTA++   DYYLVA++RF K+  +  A++R    N         P
Sbjct  254   YTSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKKVLTATAVLRYAGSN-----TPPSP  308

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS NQ+R+FRWNLTASAARPNPQGSYHYGQINITR+ +LVN  +  +GK 
Sbjct  309   VIPEGPTGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGQINITRSIRLVNGHSIVDGKR  368

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R  INGVSH DPDTPLKLAEYF +   +FKY +M D PP     VT+APNV+   FR F+
Sbjct  369   RNFINGVSHVDPDTPLKLAEYFNLSNPVFKYSLMGDAPPAPDTPVTLAPNVIAVEFRTFI  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN EK+IQ+YHLDG++FF  G+ PGKWSP
Sbjct  429   EIIFENTEKSIQSYHLDGYAFFPAGMGPGKWSP  461



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   493 bits (1270),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 232/393 (59%), Positives = 299/393 (76%), Gaps = 8/393 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP LFTWSG+Q RKNSW DG PGT CPI PG NFTY FQ KDQIGSYFY+P+  LQRA 
Sbjct  75    DEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSYFYYPSLGLQRAA  134

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + ++SR LIPVP+  P +++ V + DWY K +  LK  LD+G++I RP+G+++NG
Sbjct  135   GGFGGLRINSRALIPVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLING  194

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K GK  +    P+FTM+P KTY+YR+CNVGL+ ++NFR Q H + LVE+EGSHT+QN+YD
Sbjct  195   KAGK-PDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYD  253

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLDLHVGQC  VLVTA++E KDYY+VA++RF K   ++ AL+R   G G  +     PP 
Sbjct  254   SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKGAASPELPKPPV  313

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG-KLR  277
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+  +  G KLR
Sbjct  314   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPD-NLEKVTVAPNVVNATFRNFV  100
             YA++GVSH + +TP+KLA+YF +  ++FKYD +KD P   +   + V PNV+N   R+FV
Sbjct  369   YALSGVSHVETETPIKLAQYFGVADKVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFV  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EI+FEN E+T Q++HLDG+SFFAV +EPGKW+P
Sbjct  429   EIVFENQERTTQSWHLDGYSFFAVAVEPGKWTP  461



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   494 bits (1271),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 231/393 (59%), Positives = 298/393 (76%), Gaps = 8/393 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP L TWSG+Q RKNSW DG PGT CPI PG NFTY FQ KDQIGSYFY+P+  LQRA 
Sbjct  80    DEPFLLTWSGMQHRKNSWQDGMPGTTCPIPPGQNFTYHFQPKDQIGSYFYYPSLGLQRAA  139

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + V+SR LIP+P+  P +++ V + DWY K + TLK  LD+G++I RP G+++NG
Sbjct  140   GGFGGLRVNSRPLIPIPYADPEDDYTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLING  199

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K+GK  +    P+FTM+P KTYRYR+CNVG++ ++NFR Q H + LVE+EGSHT+QN+YD
Sbjct  200   KSGK-PDGTGEPIFTMKPGKTYRYRICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYD  258

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLDLHVGQC  VLVTA++E KDYY+VA++RF K   ++ A++R   G G  +      P 
Sbjct  259   SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKSVLTSTAILRYEGGKGAASPQLPKSPV  318

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG-KLR  277
                  G AWS+NQFRSFRWNLT++AARPNPQGSYHYG+INITR+ KLVN+  + +G KLR
Sbjct  319   -----GWAWSLNQFRSFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTIGKDDGKKLR  373

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA++GVSH + DTP+KLA+YF +  ++FKYD +KD P      K+ V PNV+N   R FV
Sbjct  374   YALSGVSHVETDTPVKLAQYFGVADKVFKYDTIKDEPTAAETSKILVQPNVLNIEHRAFV  433

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EI+FENHEKT Q++HLDG+SFFAV +EPG W+P
Sbjct  434   EIVFENHEKTTQSWHLDGYSFFAVAVEPGNWTP  466



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   489 bits (1260),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 298/383 (78%), Gaps = 6/383 (2%)
 Frame = -2

Query  1149  SGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINV  970
             +GIQ RKNSW DG  GT CPI PG N+TYKFQVKDQIGSY Y+P T++ +AVGG+G + V
Sbjct  8     NGIQHRKNSWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYIYYPVTAMHKAVGGFGGLRV  67

Query  969   HSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGEN  790
             +SR LIPVP+  PA+++ + V D++ KG+ +LKKILD+G+ + R DG+ +NGK  K G+ 
Sbjct  68    NSRLLIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAK-GDG  126

Query  789   KLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQ  610
             K  PLFTME  KTY+YR+CN G +TS+N RFQGH+M LVE+EGSHT+QN YDSLD+HVGQ
Sbjct  127   KDEPLFTMEAGKTYKYRICNTGTKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQ  186

Query  609   CLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPAHKEGIA  430
             C SVLVTAN+E +DYY+VA++RF K+E +   +IR  NG G  ++   PPP      G A
Sbjct  187   CFSVLVTANQEPRDYYVVASTRFTKREVTATGIIRYKNGKGAASSELPPPPV-----GWA  241

Query  429   WSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRYAINGVSHT  250
             WS+NQFR+FRWNLT++AARPNPQGSY YG INITRT KL N+    +GKLRYA+NGVS+ 
Sbjct  242   WSLNQFRTFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQIVDGKLRYALNGVSYV  301

Query  249   DPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVEIIFENHEKT  70
             +P TPLKLAEY+ +  ++FKYD + D PP +  KVT+AP V+N T RNFVEIIFENHE  
Sbjct  302   EPTTPLKLAEYYGVADKVFKYDTIPDEPPSDNTKVTLAPIVLNMTHRNFVEIIFENHETA  361

Query  69    IQTYHLDGHSFFAVGIEPGKWSP  1
             IQ+YHL G+SFFAVG++ GKWSP
Sbjct  362   IQSYHLSGYSFFAVGMDIGKWSP  384



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 234/393 (60%), Positives = 288/393 (73%), Gaps = 7/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD+PLLFTW GIQQRKNSW DG PGTMCPI PGTNFTY +Q KDQIGS+FYFP+  +QR
Sbjct  78    QLDQPLLFTWHGIQQRKNSWQDGMPGTMCPIQPGTNFTYHWQPKDQIGSFFYFPSIGMQR  137

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K L+ G++I RP GLV+
Sbjct  138   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVI  197

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++TME  K YRYRVCNVG++TS+N R Q H + LVE+EGSHTVQN 
Sbjct  198   NGKNEKDASNP--PMYTMEAGKVYRYRVCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNT  255

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HV QC+S LV A+++  DY LVA++RF K+  S  A+IR    N         P
Sbjct  256   YDSLDVHVAQCVSFLVAADQKPGDYLLVASTRFMKETSSITAIIRYNGSN-----TPASP  310

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT +L   + +  GK 
Sbjct  311   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLSAGRAKVGGKE  370

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+AINGVSH D +TPLKLAEYF     +F+Y+++ D PP     V +APNV+   FR F+
Sbjct  371   RFAINGVSHVDAETPLKLAEYFNATAGVFEYNLIGDVPPAAGAAVKLAPNVIQTEFRTFI  430

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FEN EK+I ++H++G++FFA G+ PG W+P
Sbjct  431   EVVFENPEKSIDSFHINGYAFFAAGMGPGTWTP  463



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 294/392 (75%), Gaps = 7/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+PLLFTW GIQQRKNSW DG PGTMCPI PGTNFTY +Q KDQIGS+FYFP+ ++QR+
Sbjct  74    LDQPLLFTWHGIQQRKNSWQDGMPGTMCPIKPGTNFTYHWQPKDQIGSFFYFPSIAMQRS  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG I+VHSR+LIPV FD PA++F V V DWY K +  L K LD G+ I RP GL++N
Sbjct  134   AGGYGLISVHSRDLIPVLFDAPADDFPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIIN  193

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K   +   P++  E  KTYR+RVCNVG++ S+N R  GH++ LVE+EGSHTVQN+Y
Sbjct  194   GKNDKDAASA--PMYNFEAGKTYRFRVCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMY  251

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQCLS LVTA+++  DY+LV ++RF K+  +  ALIR    +         P 
Sbjct  252   DSLDVHVGQCLSFLVTADQKPADYFLVVSTRFIKEVSTITALIRYKGSS-----TPPSPK  306

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  S+ + +GK R
Sbjct  307   LPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKER  366

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             YA+NGVSH D +TPLKLAEYF     +F+Y+++ D PP     + +APNV++A FR F+E
Sbjct  367   YALNGVSHVDAETPLKLAEYFNATDGVFQYNLISDVPPKAGTPIKLAPNVLSAEFRTFIE  426

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FEN EK+I ++H+DG++FF  G+ PG WSP
Sbjct  427   VVFENPEKSIDSFHIDGYAFFTAGMGPGTWSP  458



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   491 bits (1265),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 291/392 (74%), Gaps = 7/392 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             ++D+PLLFTW GIQQRK SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  79    QIDQPLLFTWHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A G YG I++HSR LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GL++
Sbjct  139   AAGAYGLISIHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  198

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P+F +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  199   NGKNEKDASNP--PMFNVEEGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A++R    N          
Sbjct  257   YDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN-----TPPAA  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  S+ + +GK 
Sbjct  312   KLPDAPDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKE  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSHTDP+TPLKLAEYF     +F+Y+++ D PP     + VAP+V+ A  R ++
Sbjct  372   RYALNGVSHTDPETPLKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYI  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             EI+FEN EK+I T+HLDG++FFA G+ PG W+
Sbjct  432   EIVFENPEKSIDTFHLDGYAFFAAGMGPGLWT  463



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   491 bits (1263),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/392 (58%), Positives = 292/392 (74%), Gaps = 7/392 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             ++D+PLLFTW GIQQRK SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  79    QIDQPLLFTWHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A G YG I++HSR LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GL++
Sbjct  139   AAGAYGLISIHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  198

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P+F +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  199   NGKNEKDASNP--PMFNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A++R    N          
Sbjct  257   YDSMDVHIGQCLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN-----TPPAA  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL +S+ + +GK 
Sbjct  312   KLPDAPDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSSSRGKVDGKE  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSHTDP+TPLKLAEYF     +F+Y+++ D PP     + VAP+V+ A  R ++
Sbjct  372   RYALNGVSHTDPETPLKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYI  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             EI+FEN EK+I T+HL+G++FFA G+ PG W+
Sbjct  432   EIVFENPEKSIDTFHLNGYAFFAAGMGPGLWT  463



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   490 bits (1261),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 227/393 (58%), Positives = 292/393 (74%), Gaps = 7/393 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD+PLLFTW G+QQRKNSW DG PGT CP+ PGTN+T+K+Q KDQIGS+FYFP+  +QR
Sbjct  63    QLDQPLLFTWHGMQQRKNSWQDGMPGTNCPVAPGTNYTFKWQAKDQIGSFFYFPSVGMQR  122

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I+V SR LIPVPFD PA++  V + DWY K +  + ++LD G++  RP G+++
Sbjct  123   AAGGYGLISVVSRLLIPVPFDPPADDLQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLI  182

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NG+ GK  E    PLFT E  KTYR R+CNVG+++++NFR QGH M LVE++GSHTVQ++
Sbjct  183   NGRGGK--EAADPPLFTFEAGKTYRLRICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDM  240

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVG CLSVLV A+++  DYY+VA++RF   + S  A+IR    N         P
Sbjct  241   YDSLDVHVGHCLSVLVDADQKPGDYYVVASTRFISDKSSVSAVIRYAGSN-----TPPAP  295

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS+NQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL+ ++    GKL
Sbjct  296   NVPEPPAGWAWSLNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHLEGKL  355

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             +Y  NGVSH D DTPLKL EYF +   +FKY+ M D PP  +  + V PNV+ A FR F+
Sbjct  356   KYGFNGVSHVDADTPLKLLEYFNVTDPVFKYNQMADVPPAVMGPLQVVPNVITAEFRTFI  415

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E++FEN EK++ + H+DG++FFAVG+ PGKWSP
Sbjct  416   EVVFENPEKSMDSVHIDGYAFFAVGMGPGKWSP  448



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   490 bits (1262),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 285/392 (73%), Gaps = 7/392 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+PLLFTW GIQQRKNSW DG  GTMCPI P TNFTY +Q KDQIGS+FY+P+T +QRA
Sbjct  81    LDQPLLFTWHGIQQRKNSWQDGMLGTMCPIQPNTNFTYHWQPKDQIGSFFYYPSTGMQRA  140

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G YG I+VHSR+LIPVPFD PA++F V V DWY K +  L K LD G+ I RP GLV+N
Sbjct  141   AGAYGLISVHSRDLIPVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVIN  200

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GKN K   N   P++ +E  KTYR+RVCNVG++ S N R Q H M LVE+EGSHT+QN Y
Sbjct  201   GKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDY  258

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLDLH+GQCLS LVTA+++  DY L  ++RF K+  S  A+IR    N        P  
Sbjct  259   DSLDLHIGQCLSFLVTADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSNA-----PPPAK  313

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT KL   + + +GK R
Sbjct  314   VPESPSGWAWSINQCRSFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKER  373

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             +  NGVSH DP+TP+KLAEYF     +F+YDI+ D PP       +APNV+ A FR F+E
Sbjct  374   FGFNGVSHVDPETPVKLAEYFNTTDGVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIE  433

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             ++FEN EK+I T H+DG++FFAVG+ PGKW+P
Sbjct  434   VVFENPEKSIDTIHIDGYAFFAVGMGPGKWTP  465



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   489 bits (1259),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 293/392 (75%), Gaps = 7/392 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             ++D+PLLFTW GIQQRKNSW DG PG MCPI+PGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  80    QIDKPLLFTWHGIQQRKNSWQDGMPGDMCPIMPGTNFTYKMQFKDQIGTFFYYPSIGMQR  139

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I+VHSR LIPVPFD PA++F+  V DWY K ++ L K LD G+ I RP GL++
Sbjct  140   AAGGYGLISVHSRPLIPVPFDPPADDFSALVGDWYTKDHEVLAKNLDTGKGIGRPAGLLI  199

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++ +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  200   NGKNEKDASNP--PMYNVETGKTYRFRVCNVGIKTTLNVRIQGHVVKLVEMEGSHTVQNE  257

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+H+GQCLS L TAN++  DY+L+A++RF K   +  A++R    N         P
Sbjct  258   YDSLDVHIGQCLSFLTTANQKPGDYFLIASTRFIKGVNTITAVMRYKGSNS-----PPSP  312

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  S+ + +GK 
Sbjct  313   KLPEAPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKE  372

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSH D +TPLKLAEYF     +F+Y+++ D PP     + +APNV+ A  R ++
Sbjct  373   RYALNGVSHADAETPLKLAEYFNATKGVFEYNLITDTPPKEGTPIKLAPNVITAEHRTYI  432

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             E++FEN E++I T+HL+G++FFA G+ PG W+
Sbjct  433   EVVFENPERSIDTFHLNGYAFFAAGMGPGLWT  464



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   489 bits (1259),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 234/393 (60%), Positives = 287/393 (73%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQQRKNSW+DG PGT CPI PG NFTY FQVKDQIGS+FYFP+  + RA
Sbjct  75    LDEPFLLTWNGIQQRKNSWMDGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYFPSMGMHRA  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVPF  P +++ V + DWY K +K L  ILD G  I  P G+++N
Sbjct  135   AGAFGGLRVNSRLLIPVPFADPTDDYTVLIGDWYAKSHKALAAILDAGHGIGNPAGVLIN  194

Query  816   GKNGKVGENKLN-PLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G+ GK    K + PLFTME  KTYRYR+CNVG++ S+NFR Q H M LVE++GSHTVQN 
Sbjct  195   GRTGKDASGKDDTPLFTMEAGKTYRYRICNVGMKVSLNFRMQNHRMKLVEMDGSHTVQND  254

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             Y+SLD+HVGQCLSVLVTAN+E KDYY+VA++RF K   +   +IR    +         P
Sbjct  255   YESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVIRYAGSS-----VPPSP  309

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               PA   G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT KL +S    NGK 
Sbjct  310   ELPAAPVGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGGINITRTIKLASSVGLVNGKR  369

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+A+NGVSH +  TPLKLAEY+ +  ++FKYD + D PP     +T  PNV+NAT+R ++
Sbjct  370   RFALNGVSHVESPTPLKLAEYYGIADKVFKYDSINDEPPAASAPITATPNVLNATYRTYI  429

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EII EN E++IQ YHLDG+SFF VG+  GKW+P
Sbjct  430   EIILENPERSIQCYHLDGYSFFPVGMGHGKWTP  462



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   488 bits (1256),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 292/394 (74%), Gaps = 8/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLF W GIQQRKNSW+DG PGT CPI PGTN+TYK+Q KDQIG++FYFP+  +QR
Sbjct  75    QLDHPLLFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQR  134

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K LD G++I RP GLV+
Sbjct  135   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVI  194

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++TME  K YR+RVCNVG++TS+N R QGHS+ LVE+EGSHTVQN 
Sbjct  195   NGKNEKDASNP--PMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNS  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HV QC+S LVTA+++  DY LVA++RF K+  +  A++R    N         P
Sbjct  253   YDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASP  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  SK + +GK 
Sbjct  308   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKE  367

Query  279   RYAINGVSHT-DPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
             R+A+NGVSH  D  TPLKLAEYF     +F+Y+++ D PP       +APNV++A FR F
Sbjct  368   RFALNGVSHVDDAQTPLKLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTF  427

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FEN EK+I ++H++G++FFA G+ PG W+P
Sbjct  428   IEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTP  461



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   488 bits (1255),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 292/394 (74%), Gaps = 8/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLF W GIQQRKNSW+DG PGT CPI PGTN+TYK+Q KDQIG++FYFP+  +QR
Sbjct  72    QLDHPLLFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K LD G++I RP GLV+
Sbjct  132   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVI  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++TME  K YR+RVCNVG++TS+N R QGHS+ LVE+EGSHTVQN 
Sbjct  192   NGKNEKDASNP--PMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNS  249

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HV QC+S LVTA+++  DY LVA++RF K+  +  A++R    N         P
Sbjct  250   YDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASP  304

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  SK + +GK 
Sbjct  305   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKE  364

Query  279   RYAINGVSHT-DPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
             R+A+NGVSH  D  TPLKLAEYF     +F+Y+++ D PP       +APNV++A FR F
Sbjct  365   RFALNGVSHVDDAQTPLKLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTF  424

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FEN EK+I ++H++G++FFA G+ PG W+P
Sbjct  425   IEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTP  458



>gb|EEC71702.1| hypothetical protein OsI_04207 [Oryza sativa Indica Group]
Length=565

 Score =   488 bits (1255),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 292/394 (74%), Gaps = 8/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLF W GIQQRKNSW+DG PGT CPI PGTN+TYK+Q KDQIG++FYFP+  +QR
Sbjct  72    QLDHPLLFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQR  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I VHSR LIPVPFD PA ++ V V DWY K +  L K LD G++I RP GLV+
Sbjct  132   AAGGYGIITVHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVI  191

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++TME  K YR+RVCNVG++TS+N R QGHS+ LVE+EGSHTVQN 
Sbjct  192   NGKNEKDASNP--PMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNS  249

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HV QC+S LVTA+++  DY LVA++RF K+  +  A++R    N         P
Sbjct  250   YDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASP  304

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  SK + +GK 
Sbjct  305   KLPEGPSGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKE  364

Query  279   RYAINGVSHT-DPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
             R+A+NGVSH  D  TPLKLAEYF     +F+Y+++ D PP       +APNV++A FR F
Sbjct  365   RFALNGVSHVDDAQTPLKLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTF  424

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +E++FEN EK+I ++H++G++FFA G+ PG W+P
Sbjct  425   IEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTP  458



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   487 bits (1253),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 231/393 (59%), Positives = 281/393 (72%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LD+P L +W+GIQQRKNSW DG  GT CPI PG NFTY FQVKDQIGS+FYFP+  + +A
Sbjct  73    LDQPFLLSWNGIQQRKNSWQDGLAGTNCPIQPGKNFTYHFQVKDQIGSFFYFPSLGMHKA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + ++SR LIPVPFD PA+++ V + DWY K +K L  ILD G++I  PDG+++N
Sbjct  133   AGGFGGLRINSRLLIPVPFDPPADDYTVLIGDWYAKDHKALAGILDAGRSIGLPDGVIIN  192

Query  816   GKNGKVGENK-LNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK GK    K   PLF ME  K YRYR+CN G+R S+NFR QGHSM LVEI+GSHT+QN+
Sbjct  193   GKTGKDRTGKDGKPLFVMESGKVYRYRICNTGIRASLNFRIQGHSMELVEIDGSHTMQNL  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC SVLVTAN+   DYYLVA++RF K+E +   ++R               
Sbjct  253   YDSLDVHVGQCYSVLVTANQAPGDYYLVASTRFMKKELTATGIVRYAGSK-----VPPSA  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS NQ+RSFRWNLTASAARPNPQGS+HYG INITRT K  NS+    GK 
Sbjct  308   VLPKAPTGWAWSFNQWRSFRWNLTASAARPNPQGSFHYGSINITRTIKFANSRAVVGGKS  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+A+NGVSH D DTPLK  EYF +  + FKY++  D P +    V +APNV+   FR FV
Sbjct  368   RFALNGVSHVDVDTPLKHLEYFGVADKFFKYNLTGDEPREGSGPVNLAPNVITVEFRTFV  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+IFEN EK  Q YHLDG+SFFAVG+ PGKW P
Sbjct  428   EVIFENPEKGPQFYHLDGYSFFAVGMGPGKWKP  460



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   486 bits (1251),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 290/392 (74%), Gaps = 7/392 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTW+G+Q RKNSW DG  GT CPI PGTN+TYK+Q KDQIGS+FYFP+  + R
Sbjct  79    QLDEPLLFTWNGMQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I+V SR LIPVPFD PA++  V + DWY K +  + K+LD G++  RP G+V+
Sbjct  139   AAGGYGGISVVSRLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVI  198

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK   +   P+FT+E  KTYR RVCNVG++ S+NFR QGH M LVE+EGSHTVQ++
Sbjct  199   NGKSGKAAADP--PMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDM  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVG CLSVLV A+++  DYY VA++RF  +  S  A+IR    +         P
Sbjct  257   YDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSP  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT +L+ S+   +GKL
Sbjct  312   AVPEPPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKL  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             +Y  NGVSH D +TPLKLAEYF +   +F+Y+ M D PP     + V PNV+ A FR F+
Sbjct  372   KYGFNGVSHVDAETPLKLAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFI  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             EIIFEN EK++ + HLDG++FFAVG+ PGKWS
Sbjct  432   EIIFENPEKSMDSVHLDGYAFFAVGMGPGKWS  463



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   484 bits (1247),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 284/393 (72%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L +W+GIQ RKNSW+DG PGT CPI+PG N+TY FQ KDQIGS+FYFP+  +Q+A
Sbjct  73    LDEPFLLSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQKA  132

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG G I VHSR LIPVP+  PA+EFN+   DWY K +K L   LD+G++I RP G+++N
Sbjct  133   AGGMGMIRVHSRLLIPVPYADPADEFNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLIN  192

Query  816   GKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             GK+GK    K  P +FTME  KTYR+RVCN+G++ S+NFR Q HS+ LVE+EGSH VQN 
Sbjct  193   GKHGKDASGKDEPPMFTMEAGKTYRFRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNT  252

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLDLH+GQC SV VTA+++  DYY++ ++RF K      A++R    N          
Sbjct  253   YDSLDLHIGQCFSVFVTADQQPGDYYILMSTRFTKYSCGGSAIVRYAGSNA-----PPSK  307

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL       NGK 
Sbjct  308   DLPPAPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLRGGTGLVNGKR  367

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYAINGVSH +P TPLKL+EY+ +  + FKY I+ D PP+    +T+APNV+N TFR F+
Sbjct  368   RYAINGVSHENPVTPLKLSEYYGIADKEFKYSIIGDEPPNGKSLITIAPNVINCTFRTFI  427

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+I EN E++I  YHLDG++FF  G+  G+W+P
Sbjct  428   EVILENPERSIHAYHLDGYAFFPAGMGHGEWTP  460



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 230/393 (59%), Positives = 290/393 (74%), Gaps = 6/393 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+G+Q RKNSW+DGTPGT CPI PG NFTY FQ KDQIG++FYFP+  +Q+A
Sbjct  74    LDEPFLLTWNGVQNRKNSWMDGTPGTNCPIPPGQNFTYHFQPKDQIGTFFYFPSVGMQKA  133

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + VHSR LIPVPF  PAEEF+V   DW+   +K L + LD G+ +  P G+++N
Sbjct  134   AGGFGMLRVHSRLLIPVPFAPPAEEFDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLIN  193

Query  816   GKNGK-VGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             G+ G+ V  +   P+FT++    YR+R CNVGL+TS+NFR Q HS+ LVE+EGSHT+QN+
Sbjct  194   GRPGRPVTGHDDPPMFTVQAGNVYRFRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNL  253

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQCLSVLV A++   DYYLV ++RF K+  +  A++R    N         P
Sbjct  254   YDSLDVHVGQCLSVLVVADQGPGDYYLVVSTRFTKKIHTATAVLRYAGSN-----TPPSP  308

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWS NQ+R+FRWNLTASAARPNPQGSYHYG+INITRT KL+N  T  +GK 
Sbjct  309   VIPEGPSGWAWSFNQWRTFRWNLTASAARPNPQGSYHYGEINITRTIKLLNGHTVVDGKR  368

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             R+ INGVSH DPDTPLKLAEYF +   +F Y++M D PP     V +APNV+ A FR F+
Sbjct  369   RHFINGVSHVDPDTPLKLAEYFNLSNPVFNYNLMGDVPPALDIPVKLAPNVITAEFRTFI  428

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             EIIFEN E++IQ+YHLDG++FF VG+ PGKWSP
Sbjct  429   EIIFENTERSIQSYHLDGYAFFPVGMGPGKWSP  461



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   483 bits (1243),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/394 (58%), Positives = 284/394 (72%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L +W+GIQ RKNSW+DG  GT CPI+PG N+TY FQ KDQIGS+FYFP+ S+ +
Sbjct  72    KLDEPFLLSWNGIQHRKNSWMDGMTGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSISMHK  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
               GG G + VHSR LIPVP+  PA+EFNV   DWY K +K L ++LD G+ I RP G+++
Sbjct  132   VAGGIGMLRVHSRLLIPVPYADPADEFNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLI  191

Query  819   NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NGK+GK    K  P +FTME  KTYRYRVCNVG++TS+N R Q H + LVE+EGSHT+QN
Sbjct  192   NGKHGKDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQN  251

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             VYDSLDLH GQC SV VTA+++  DYY+V ++RF K      A+IR    N         
Sbjct  252   VYDSLDLHTGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----MPPS  306

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
             P  P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYG INITRT +L  S    NGK
Sbjct  307   PDLPPSPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGK  366

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              RYA+NGVSH +P TPLKL+EY+ +  + FKY+I+ D PP +   + +APNV+  TFR F
Sbjct  367   RRYALNGVSHENPATPLKLSEYYSITDKEFKYNIIGDEPPADKSPIVIAPNVIKCTFRTF  426

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EII EN E++I +YHLDG+SFF  G+  G+WSP
Sbjct  427   IEIILENPERSIHSYHLDGYSFFPAGMGHGEWSP  460



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 226/394 (57%), Positives = 287/394 (73%), Gaps = 6/394 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEP L +W+GIQ RKNSW+DG PGT CPI+PG N+TY FQ KDQIGS+FYFP+  +Q+
Sbjct  72    KLDEPFLLSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQK  131

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GG G I VHSR LIPVP+  PA+EFN+   +WY K +K L + LD+G+ I RP G+++
Sbjct  132   ASGGMGMIRVHSRLLIPVPYTDPADEFNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLI  191

Query  819   NGKNGKVGENKLNP-LFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQN  643
             NGK+GK    K  P +FT+E  KTYR+RVCN+G++ S+NFR Q H++ LVE+EGSH VQN
Sbjct  192   NGKHGKDASGKDEPPMFTVEAGKTYRFRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQN  251

Query  642   VYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelp  463
             +YDSLDLH+GQC SV VTA+++  DYY++A++RF K +    A+IR    N         
Sbjct  252   MYDSLDLHIGQCFSVFVTADQQPGDYYILASTRFTKYKCDGSAIIRYAGSN-----TPPS  306

Query  462   pppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGK  283
                P    G AWS NQ+RSFRWNLTASAARPNPQGSYHYGQINITRT +L       NGK
Sbjct  307   KDLPPGPSGWAWSFNQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLRGGTGLVNGK  366

Query  282   LRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNF  103
              RYAINGVSH +P TP KL+EYF +  + FKY+I+ D PP     +T+APNVVN TFR F
Sbjct  367   RRYAINGVSHDNPVTPFKLSEYFGIADKEFKYNIIGDEPPTGKSPITIAPNVVNCTFRTF  426

Query  102   VEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             +EII EN E++I  YH+DG++FF VG+  G+W P
Sbjct  427   IEIILENPERSIHAYHIDGYAFFPVGMGHGEWDP  460



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   483 bits (1243),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 285/385 (74%), Gaps = 7/385 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD+PLLFTW GIQQRK+SW DG PG MCPILPGTNFTYK Q KDQIG++FY+P+  +QR
Sbjct  104   QLDQPLLFTWHGIQQRKSSWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQR  163

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A G YG I++HSR LIPVPFD PA++F   V DWY K +  L K LD G+ I RP GL++
Sbjct  164   AAGAYGLISIHSRPLIPVPFDPPADDFGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLI  223

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKN K   N   P++ +E  KTYR+RVCNVG++T++N R QGH + LVE+EGSHTVQN 
Sbjct  224   NGKNEKDASNP--PMYNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNE  281

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDS+D+H+GQCLS L TAN++  DY+ +A++RF K   +  A+IR    N          
Sbjct  282   YDSMDVHIGQCLSFLTTANQKPGDYFFIASTRFIKGVSTITAVIRYKGSN-----TPPAA  336

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P   +G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL  S+ + +GK 
Sbjct  337   KLPDAPDGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKE  396

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RYA+NGVSHTDP+TPLKLAEYF     +F+Y+++ D PP     + VAP+V+    R ++
Sbjct  397   RYALNGVSHTDPETPLKLAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITTEHRTYI  456

Query  99    EIIFENHEKTIQTYHLDGHSFFAVG  25
             EI+FEN EK+I T+HLDG++FFA G
Sbjct  457   EIVFENPEKSIDTFHLDGYAFFAAG  481



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   481 bits (1238),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 227/393 (58%), Positives = 288/393 (73%), Gaps = 22/393 (6%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  77    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  136

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY + +  LK  LD+G+TI RPDG+++N
Sbjct  137   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTESHTQLKNFLDSGRTIGRPDGILIN  196

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  197   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  255

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC  V++TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  256   DSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  310

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + + KLR
Sbjct  311   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  370

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATFRNFV  100
             YA+NGVSH D +TPLKLAEYF +  ++FKYD + DNP  D ++ + + PN          
Sbjct  371   YALNGVSHIDLETPLKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPN----------  420

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
                  NHE+++Q++HLDG+SFFAV +EPG W+P
Sbjct  421   -----NHERSVQSWHLDGYSFFAVAVEPGTWTP  448



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   479 bits (1234),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/395 (58%), Positives = 292/395 (74%), Gaps = 9/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNF YK+Q KDQIGS++YFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFMYKWQPKDQIGSFYYFPSMGMQR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             AVGGYG I+V+SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  139   AVGGYGGISVYSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  198

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             V+NGK GK  E+   PLFT +  KTYR RVCN G++ S+NFR QGH MTLVE+EGSHT+Q
Sbjct  199   VINGKGGKDLESA--PLFTFDAGKTYRLRVCNTGIKASLNFRIQGHHMTLVELEGSHTLQ  256

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             +VYDSLD+HVG CLSVLVTA+++  DYY+VA++RF     S  A++R    +        
Sbjct  257   DVYDSLDVHVGHCLSVLVTADQKPGDYYMVASTRFIHDAKSARAVVRYAGSS-----APP  311

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
             P   P    G AWSINQ RS RWNLT+SAARPNPQGSYHYGQINITRT +++ S+   +G
Sbjct  312   PAEMPEPPAGWAWSINQARSIRWNLTSSAARPNPQGSYHYGQINITRTIRVMVSRGHIDG  371

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KLRY  NGVSH DP+TP+KLAEYF +   +F Y+ M D PP     + V PNV+ A FR 
Sbjct  372   KLRYGFNGVSHRDPETPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVVPNVITAEFRT  431

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EI+FEN EK++ + HLDG++FF VG+ PG+WSP
Sbjct  432   FIEIVFENPEKSLDSIHLDGYAFFGVGMGPGQWSP  466



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   478 bits (1229),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 287/395 (73%), Gaps = 7/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLFTW+G+Q RKNSW+DG PGT CPI P TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  77    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIGSFFYFPSIGMQR  136

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  137   AAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  196

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK GK  E    P+ T E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  197   LINGKGGKDLEAAA-PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHDMKLVELEGSHTLQ  255

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             +VYDSLD+HVG CLSVLV A++   DYY+VA++RF     S  A+IR    +G P  P +
Sbjct  256   DVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNM  315

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
               P      G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT K++ S+   +G
Sbjct  316   TEP----PAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KLRY  NG+SH D +TPLKLAEYF +   +F Y+ M D PP     + V PNV+ A FR 
Sbjct  372   KLRYGFNGISHRDTETPLKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRT  431

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EI+FEN EK+I + HLDG++FF VG+ PG WSP
Sbjct  432   FIEIVFENPEKSIDSLHLDGYAFFGVGMGPGTWSP  466



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   477 bits (1227),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 287/395 (73%), Gaps = 7/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLFTW+G+Q RKNSW+DG PGT CPI P TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  77    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIGSFFYFPSIGMQR  136

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + LD G+++ RP G+
Sbjct  137   AAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGV  196

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK GK  E    P+ T E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  197   LINGKGGKDLEAAA-PMLTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  255

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             +VYDSLD+HVG CLSVLV A++   DYY+VA++RF     S  A+IR    +G P  P +
Sbjct  256   DVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGAPPAPNM  315

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
               P      G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT K++ S+   +G
Sbjct  316   TEP----PAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KLRY  NG+SH D +TPLKLAEYF +   +F Y+ M D PP     + V PNV+ A FR 
Sbjct  372   KLRYGFNGISHRDTETPLKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRT  431

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EI+FEN EK+I + HLDG++FF VG+ PG WSP
Sbjct  432   FIEIVFENPEKSIDSLHLDGYAFFGVGMGPGTWSP  466



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   477 bits (1227),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 218/405 (54%), Positives = 300/405 (74%), Gaps = 11/405 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN+LDEP L TW GIQ +KNSW DG  GT CPI PG N+TY  QVKDQIGSY Y P
Sbjct  70    VINVFNKLDEPFLLTWPGIQHKKNSWQDGVLGTNCPIPPGKNYTYYLQVKDQIGSYIYHP  129

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEE-FNVFVSDWYKKGYKTLKKILDNGQTIA  841
             +T   RA GG+G + +HSR ++PVP++R  E+ F + + DWY + +  L K LD+G+ + 
Sbjct  130   STGFHRAAGGFGGLCIHSRSVVPVPYNRFVEDDFTLLIGDWYTRSHVELGKQLDSGKLLG  189

Query  840   RPDGLVMNGKNGKV-----GENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTL  676
             +PDG+++NGK+G++     G+    PLFTM+  K Y+YR+CNVG++TS+NFR QGH+M L
Sbjct  190   KPDGVLINGKSGRLDYDSDGKGDNEPLFTMKAGKVYKYRICNVGVKTSLNFRIQGHTMKL  249

Query  675   VEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGN  496
             VE+EGSH VQN Y+SLD+HVGQC +VLVTAN++ KDYYL+A++RF +   +T A++R  +
Sbjct  250   VEMEGSHVVQNEYESLDVHVGQCFTVLVTANQDPKDYYLIASTRFTRTVITTTAIVRYSD  309

Query  495   GNGGpatpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFK  316
               G        P  P    G  WS+NQFRSFRWNLTASAARPNPQGS+HYG I I RT +
Sbjct  310   SKG-----LASPDLPKAPVGWDWSLNQFRSFRWNLTASAARPNPQGSFHYGGIPINRTIR  364

Query  315   LVNSKTQANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVA  136
             L N+    NGK+R+A+NGVS+ + +TPLK AEY+ +P  +FKY+++ D P D +E VT+ 
Sbjct  365   LANTAHLVNGKVRFAVNGVSYVNSETPLKFAEYYGIPEEVFKYNVISDKPADEIENVTLQ  424

Query  135   PNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             PNV++AT++ F+EI+ EN + T+Q++ LDG++FFAVG+EPG W+P
Sbjct  425   PNVMDATYKAFMEIVLENRQNTMQSWILDGYAFFAVGMEPGTWNP  469



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   476 bits (1225),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 229/395 (58%), Positives = 286/395 (72%), Gaps = 9/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSIGMQR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + +D G+ + RP G+
Sbjct  139   AAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGV  198

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK GK  + +  P FT E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  199   LINGKGGK--DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  256

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             N YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S  A+IR    +        
Sbjct  257   NTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSS-----VPP  311

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
              P       G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT K++ S+   +G
Sbjct  312   APNMTEPPAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KLRY  NG+SH DP+TP+KLAEYF +   +F Y+ M D PP     + V PNV+ A FR 
Sbjct  372   KLRYGFNGISHRDPETPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRT  431

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EI+FEN EK+I + H+DG++FF VG+ PGKWSP
Sbjct  432   FIEIVFENPEKSIDSLHVDGYAFFGVGMGPGKWSP  466



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   476 bits (1224),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 229/395 (58%), Positives = 285/395 (72%), Gaps = 9/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD PLLFTW+G+Q RKNSW+DG PGT CPILP TNFTYK+Q KDQIGS+FYFP+  +QR
Sbjct  79    QLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSIGMQR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             A GGYG I+V SR LIPVPFD+P  E +  V + DWY K ++ L + +D G+ + RP G+
Sbjct  139   AAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGV  198

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK GK  + +  P FT E  KTYR RVCN G++ S+NFR QGH M LVE+EGSHT+Q
Sbjct  199   LINGKGGK--DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQ  256

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             N YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S  A+IR    +        
Sbjct  257   NTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSSA-----PP  311

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
              P       G AWSINQ RSFRWNLTASAARPNPQGSYHYGQINITRT K++ S+   +G
Sbjct  312   SPNMTEPPAGWAWSINQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDG  371

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KLRY  NG+SH DP+TP+KLAEYF     +F Y+ M D PP     + V PNV+ A FR 
Sbjct  372   KLRYGFNGISHRDPETPVKLAEYFNATDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRT  431

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EI+FEN EK+I + H+DG++FF VG+ PGKWSP
Sbjct  432   FIEIVFENPEKSIDSLHVDGYAFFGVGMGPGKWSP  466



>gb|EEE64155.1| hypothetical protein OsJ_18987 [Oryza sativa Japonica Group]
Length=513

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/385 (59%), Positives = 284/385 (74%), Gaps = 7/385 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LDEPLLFTW+G+Q RKNSW DG  GT CPI PGTN+TYK+Q KDQIGS+FYFP+  + R
Sbjct  79    QLDEPLLFTWNGMQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHR  138

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A GGYG I+V SR LIPVPFD PA++  V + DWY K +  + K+LD G++  RP G+V+
Sbjct  139   AAGGYGGISVVSRLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVI  198

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGK+GK   +   P+FT+E  KTYR RVCNVG++ S+NFR QGH M LVE+EGSHTVQ++
Sbjct  199   NGKSGKAAADP--PMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDM  256

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVG CLSVLV A+++  DYY VA++RF  +  S  A+IR    +         P
Sbjct  257   YDSLDVHVGHCLSVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSP  311

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT +L+ S+   +GKL
Sbjct  312   AVPEPPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKL  371

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             +Y  NGVSH D +TPLKLAEYF +   +F+Y+ M D PP     + V PNV+ A FR F+
Sbjct  372   KYGFNGVSHVDAETPLKLAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFI  431

Query  99    EIIFENHEKTIQTYHLDGHSFFAVG  25
             EIIFEN EK++ + HLDG++FFAVG
Sbjct  432   EIIFENPEKSMDSVHLDGYAFFAVG  456



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   473 bits (1218),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 292/406 (72%), Gaps = 33/406 (8%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L TWS +QQRKNSW DG  GT CPI P TN+TY FQVKDQIGSY Y+P
Sbjct  47    VLNVFNNLDEPFLLTWSCVQQRKNSWQDGVLGTNCPIPPRTNYTYHFQVKDQIGSYIYYP  106

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             TT + RA GG+G + V+SR LIPVP+  P +++ V ++DWY   + TL+K LD+G+++AR
Sbjct  107   TTGMHRAAGGFGGLRVNSRLLIPVPYVDPEDDYTVILNDWYTSSHSTLRKYLDSGRSLAR  166

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P+G+++NGKN K G+    PLFTM+P KTY+YR+CN GL+ ++NFR QGH+M LVE+EGS
Sbjct  167   PNGVLINGKNAK-GDGNDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGS  225

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H VQNVY+ LD+HVGQC SVL                    +  ++  +IR  NG G  +
Sbjct  226   HVVQNVYEPLDVHVGQCFSVL--------------------EVLTSKGIIRYTNGKGPAS  265

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFRSF WNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  266   PELPEAPV-----GWAWSLNQFRSFHWNLTASAARPNPQGSYHYGSINITRTIKLVNSAS  320

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNL--EKVTVAPNVV  124
             +A GKL YAINGVSH +P+TPLKLAEY+ +  ++FKYD + D P  N+   KV   PNV+
Sbjct  321   RAGGKLCYAINGVSHVNPETPLKLAEYYGIAHKVFKYDTIPDMPLANIASAKVVTHPNVI  380

Query  123   NATFRNFVEIIFENHEKTIQTYHLDGHSFFAV-----GIEPGKWSP  1
             N TFRNFVEI+FENHEK++Q+YHLDG+SFFA+      IEP  W+P
Sbjct  381   NQTFRNFVEIVFENHEKSMQSYHLDGYSFFALYTNIHNIEPDTWTP  426



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   472 bits (1215),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 231/393 (59%), Positives = 288/393 (73%), Gaps = 35/393 (9%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQV-KDQIGSYFYFPTTSLQR  1000
             LDEPLLFTW G+Q RKNSW DGT G  CPI PGTN+TY FQV KDQIG+YFY+PTT LQR
Sbjct  67    LDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVVKDQIGTYFYYPTTGLQR  126

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVM  820
             A+GG+G + + SR                         +  LK+ LD+G++I RP G+ +
Sbjct  127   AIGGFGGLRIFSRL------------------------HTALKQKLDSGRSIGRPVGVHI  162

Query  819   NGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNV  640
             NGKNG      L PL+TMEP KTY+YR+CNVGL+ S+NFR QGH + LVE EGSH VQN 
Sbjct  163   NGKNGG-----LEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNN  217

Query  639   YDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpp  460
             YDSLD+HVGQC +VLVTA++E KDY++VA++RF K+  +   +IR  NG G         
Sbjct  218   YDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG-----PASG  272

Query  459   ppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKL  280
               P   +G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQINITRT KLVN+ ++ANGKL
Sbjct  273   GLPPAPQGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKL  332

Query  279   RYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFV  100
             RY +NGVSH D  TPLKLAEY+ +  ++FKY+++ D+P      +TVAPNV+NATFR+F+
Sbjct  333   RYGLNGVSHVDTQTPLKLAEYYGVADKVFKYNLISDSPDTAFPDLTVAPNVINATFRDFI  392

Query  99    EIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             E+IFEN  K IQ+Y+LDG+SFFA+ +EPGKW+P
Sbjct  393   EVIFENPGKVIQSYNLDGYSFFALAVEPGKWTP  425



>emb|CDY49392.1| BnaC09g53590D [Brassica napus]
Length=446

 Score =   468 bits (1205),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/378 (58%), Positives = 285/378 (75%), Gaps = 8/378 (2%)
 Frame = -2

Query  1173  DEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAV  994
             DEP LFTWSG+Q RKNSW DG PGT CPI PG NFTY FQ KDQIGSYFY+P+  LQRA 
Sbjct  75    DEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSYFYYPSLGLQRAA  134

Query  993   GGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNG  814
             GG+G + ++SR LIPVP+  P +++ V + DWY K +  LK  LD+G++I RP+G+++NG
Sbjct  135   GGFGGLRINSRALIPVPYADPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLING  194

Query  813   KNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYD  634
             K GK  +    P+FTM+P KTY+YR+CNVGL+ ++NFR Q H + LVE+EGSHT+QN+YD
Sbjct  195   KAGKP-DGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYD  253

Query  633   SLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelpppp  454
             SLDLHVGQC  VLVTA++E KDYY+VA++RF K   ++ AL+R   G G  +     PP 
Sbjct  254   SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKGAASPELPKPPV  313

Query  453   PAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG-KLR  277
                  G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITR+ KLVN+  +  G KLR
Sbjct  314   -----GWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLR  368

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPD-NLEKVTVAPNVVNATFRNFV  100
             YA++GVSH + +TP+KLA+YF +  ++FKYD +KD P   +   + V PNV+N   R+FV
Sbjct  369   YALSGVSHVETETPIKLAQYFGVADKVFKYDTIKDEPTKVDTSDILVQPNVLNIEHRSFV  428

Query  99    EIIFENHEKTIQTYHLDG  46
             EI+FEN E+T Q++HLDG
Sbjct  429   EIVFENQERTTQSWHLDG  446



>gb|KGN54013.1| hypothetical protein Csa_4G267480 [Cucumis sativus]
Length=476

 Score =   468 bits (1205),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 237/414 (57%), Positives = 291/414 (70%), Gaps = 51/414 (12%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             ++NVFN LDEP L  WSGIQ RKNSW DG  GT CPILPGTN+TY FQ     GS     
Sbjct  69    VINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQ-----GS-----  118

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
                            V+SR LIPVP+  P +++ V + DWY K +  LK+ LD+G++IAR
Sbjct  119   --------------RVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIAR  164

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDG+++NGK+ K G+    PLFTM+P KTY+YRVCNVGL++S+NFRFQGH+M LVE+EGS
Sbjct  165   PDGVLINGKSAK-GDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGS  223

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN Y+SLD+HVGQC SVLVTAN+E KDYY+VA++RF K       ++R  +G G  +
Sbjct  224   HTVQNDYESLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKSILVGKGIVRYTDGKGPAS  283

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                   P      G AWS+NQFR+FRWNLTASAARPNPQGSYHYG INITRT KLVNS +
Sbjct  284   PEIPEAPM-----GWAWSLNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSIS  338

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPG--------------------RLFKYDIM  178
             + +GKLRYAINGVSH DP+TPLKLAEYFE+                      ++FKYD +
Sbjct  339   KVDGKLRYAINGVSHVDPETPLKLAEYFEIAATALKYDNPTIMLAEYFEVADKVFKYDTI  398

Query  177   KDNP-PDNLEKVTVAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIE  19
              D    +    VTVAPNVVNATFRNF+EI+FENHEK++Q++HLDG+SFFAV  E
Sbjct  399   SDEGLAEGATTVTVAPNVVNATFRNFIEIVFENHEKSLQSWHLDGYSFFAVADE  452



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   466 bits (1200),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 222/399 (56%), Positives = 293/399 (73%), Gaps = 12/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             +VNVFN+LDEP L +W+G+QQRKNSW DG PGT CPI PG N+TY+FQVKDQIG+YFYF 
Sbjct  67    VVNVFNQLDEPFLISWNGVQQRKNSWQDGMPGTNCPIPPGGNYTYQFQVKDQIGTYFYFL  126

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +TS  +A GG+G + V+SR  IPVPFD PAE++ + + DWY K +K L+K LD+ +++ +
Sbjct  127   STSFHKAAGGFGGLRVNSRMYIPVPFDPPAEDYTLLIGDWYTKSHKELRKRLDDSKSLGK  186

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P G+++NG+ GK  E       T+EP KTYR R+ NVG++TS+NFR +GH++ LVEIEGS
Sbjct  187   PCGVLINGRTGKNAET-----LTVEPGKTYRIRISNVGIKTSLNFRIEGHALLLVEIEGS  241

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVY+SLD+HVGQ  SVLVTAN+  KDY +VA++RF K   +  A++       G  
Sbjct  242   HTVQNVYESLDVHVGQSYSVLVTANQAVKDYQIVASTRFTKYILTGTAVLHYSGATEG--  299

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                +     +   G+A+S+NQFRSFRWNLTASAARPNPQGSYHYG I I RT KL +S  
Sbjct  300   ---VSDAALSGPTGVAFSLNQFRSFRWNLTASAARPNPQGSYHYGSIPIVRTIKLASSIG  356

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
             +  GKLRYAINGVS+    TPLKLA+Y+EM   ++    M D+PP+  E++    NVV+ 
Sbjct  357   KIEGKLRYAINGVSYKQASTPLKLADYYEMGKEVWCDKCMPDSPPE--EEMKEETNVVDG  414

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
               R+F+EI+FEN EKT+QT+HL+G+SFFAVG+  G W+P
Sbjct  415   VHRDFIEIVFENREKTVQTWHLNGYSFFAVGMSRGTWTP  453



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   463 bits (1192),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 278/380 (73%), Gaps = 7/380 (2%)
 Frame = -2

Query  1143  IQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINVHS  964
             +Q RKNSW DG  GT CPI PGTN+TYK+Q KDQIGS+FYFP+  + RA GGYG I+V S
Sbjct  1     MQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHRAAGGYGGISVVS  60

Query  963   RELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKL  784
             R LIPVPFD PA++  V + DWY K +  + K+LD G++  RP G+V+NGK+GK   +  
Sbjct  61    RLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAADP-  119

Query  783   NPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCL  604
              P+FT+E  KTYR RVCNVG++ S+NFR QGH M LVE+EGSHTVQ++YDSLD+HVG CL
Sbjct  120   -PMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCL  178

Query  603   SVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppppPAHKEGIAWS  424
             SVLV A+++  DYY VA++RF  +  S  A+IR    +         P  P    G AWS
Sbjct  179   SVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSPAVPEPPAGWAWS  233

Query  423   INQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLRYAINGVSHTDP  244
             INQ+RSFRWNLTASAARPNPQGSYHYGQINITRT +L+ S+   +GKL+Y  NGVSH D 
Sbjct  234   INQWRSFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDA  293

Query  243   DTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVEIIFENHEKTIQ  64
             +TPLKLAEYF +   +F+Y+ M D PP     + V PNV+ A FR F+EIIFEN EK++ 
Sbjct  294   ETPLKLAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMD  353

Query  63    TYHLDGHSFFAVGIEPGKWS  4
             + HLDG++FFAVG+ PGKWS
Sbjct  354   SVHLDGYAFFAVGMGPGKWS  373



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   459 bits (1182),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/395 (58%), Positives = 288/395 (73%), Gaps = 9/395 (2%)
 Frame = -2

Query  1179  ELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQR  1000
             +LD+PLLF W+GIQ RKNSW+DG  GT CPI P TNFTYK+Q KDQIG++FYFP   +QR
Sbjct  76    QLDQPLLFHWNGIQHRKNSWMDGLLGTNCPIAPNTNFTYKWQPKDQIGTFFYFPIIGMQR  135

Query  999   AVGGYGPINVHSRELIPVPFDRPAEEFN--VFVSDWYKKGYKTLKKILDNGQTIARPDGL  826
             A GGYG I V SR LIPVPFD P  E +  V + DWY K ++ + ++LD G+++ RP+G+
Sbjct  136   AAGGYGAITVVSRLLIPVPFDPPPPESDHVVLIGDWYTKDHEVMARMLDAGRSVGRPEGV  195

Query  825   VMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQ  646
             ++NGK G   +    P+FT E  KTYR+RVCN G++ S+NFR QGH M LVE+EGSHTVQ
Sbjct  196   LINGKGGP--DAAAAPMFTFEAGKTYRFRVCNTGIKASLNFRIQGHDMKLVEMEGSHTVQ  253

Query  645   NVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpel  466
             ++YDSLD+HVG CLSVLV A+++  DYY+VA++RF     S +A+IR    N        
Sbjct  254   DMYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDARSVMAVIRYAGSN-----TPP  308

Query  465   ppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANG  286
              P  P    G AWSINQ+RSFRWNLTASAARPNPQGSYHYGQINITRT KL+ S+   +G
Sbjct  309   SPNVPEPPAGWAWSINQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLMVSRGHIDG  368

Query  285   KLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRN  106
             KL+Y  NGVSH D +TPLKLAEYF +   +F Y+ M D PP     ++V PNV+ A FR 
Sbjct  369   KLKYGFNGVSHRDTETPLKLAEYFNVTDGVFSYNQMGDVPPAVNGPLSVIPNVITAEFRT  428

Query  105   FVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             F+EIIFEN EK++ + HLDG++FF VG+ PGKWSP
Sbjct  429   FIEIIFENPEKSMDSLHLDGYAFFGVGMGPGKWSP  463



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   458 bits (1179),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 277/362 (77%), Gaps = 6/362 (2%)
 Frame = -2

Query  1086  LPGTNFTYKFQVKDQIGSYFYFPTTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFV  907
             + G  F+     +DQIGSYFY+PTTSL R  GG+G + V+SR LIPVP+  P +++ V +
Sbjct  113   IQGKGFSADRLSRDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLL  172

Query  906   SDWYKKGYKTLKKILDNGQTIARPDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNV  727
              DWY  G+  LK  LD+G+T+  P+G+++NGK+GKVG  K  PLFTM+P KTY+YR+CNV
Sbjct  173   GDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVG-GKNEPLFTMKPGKTYKYRLCNV  231

Query  726   GLRTSVNFRFQGHSMTLVEIEGSHTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATS  547
             G ++++NFR Q H M LVE+EGSH +QN YDSLD+HVGQC SVLVTAN+ AKDYY+VA++
Sbjct  232   GFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVAST  291

Query  546   RFFKQEFSTVALIRNGNGNGGpatpelppppPAHKEGIAWSINQFRSFRWNLTASAARPN  367
             RF K+E STV +IR    N      +     P    G AWS+NQFRSFRWNLT++AARPN
Sbjct  292   RFLKKELSTVGVIRYEGSN-----VQASTELPKAPVGWAWSLNQFRSFRWNLTSNAARPN  346

Query  366   PQGSYHYGQINITRTFKLVNSKTQANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKY  187
             PQGSYHYG+INITR+ KLVNSK+  +GK+R+  NGVSH D +TPLKLAEYF+M  ++FKY
Sbjct  347   PQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLKLAEYFQMSEKVFKY  406

Query  186   DIMKDNPPDNLEKVTVAPNVVNATFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKW  7
             +++KD P   +  +TV PNV+N TFR FVEIIFENHEKT+Q++HLDG+SFFAV  EPG+W
Sbjct  407   NVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTMQSFHLDGYSFFAVASEPGRW  466

Query  6     SP  1
             +P
Sbjct  467   TP  468



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   452 bits (1162),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/355 (60%), Positives = 266/355 (75%), Gaps = 7/355 (2%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKNSW  GT GTMCPI PGTNFTY FQ KDQIGSYFY+PTT++ RA
Sbjct  79    LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  138

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              G +G + V+SR LIPVP+  P +++ V ++DWY K +  LK  LD+G+TI RPDG+++N
Sbjct  139   AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILIN  198

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
             GK GK G+    PLFT++  KTYR R+CNVGL+ S+NFR Q H M LVE+EGSH +QN Y
Sbjct  199   GKAGK-GDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDY  257

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC  V +TAN+E KDYY+VA++RF K   +T  L+R   G G          
Sbjct  258   DSLDVHVGQCFGVTLTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKG-----LASSQ  312

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + + KLR
Sbjct  313   LPAAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLR  372

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNAT  115
             YA+NGVSH DP+TPLKLAEYF +  ++FKYD + DNP  D ++ + + PNV+N T
Sbjct  373   YALNGVSHIDPETPLKLAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNIT  427



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   447 bits (1149),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 273/392 (70%), Gaps = 48/392 (12%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TWSG+Q RKNSW DG  GT CPI  GTN+TY FQ KDQIGSYFY+P+T+L R 
Sbjct  75    LDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRF  134

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GG+G + V+SR LIPVP+  P +       D+ KK                        
Sbjct  135   SGGFGGLRVNSRLLIPVPYADPED-------DYTKK------------------------  163

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGSHTVQNVY  637
                         PLFTM+P KTY+YR+CNVG ++++NFR QGH M LVE+EGSH +QN Y
Sbjct  164   ------------PLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDY  211

Query  636   DSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpelppp  457
             DSLD+HVGQC +VLVTA++EAK YY+VA++RF K+E STV ++     N      +    
Sbjct  212   DSLDVHVGQCFAVLVTADQEAKSYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSNV  266

Query  456   pPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQANGKLR  277
              P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KL N+K   +GK+R
Sbjct  267   LPKAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVR  326

Query  276   YAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNATFRNFVE  97
             + +NGVSH D +TPLKLAEYFEM  ++FKY+++KD P   +  +TV PNV+N TFR FVE
Sbjct  327   FGLNGVSHVDTETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVE  386

Query  96    IIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             I+FENHE+++Q++HLDG+SFF+V  EPG W+P
Sbjct  387   IVFENHERSMQSFHLDGYSFFSVASEPGTWTP  418



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   447 bits (1151),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 282/397 (71%), Gaps = 17/397 (4%)
 Frame = -2

Query  1176  LDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFPTTSLQRA  997
             LDEP L TW+GIQ RKN W DGTPGTMCPI+PGTN+TY FQ KDQIGSYFY+PTT + RA
Sbjct  76    LDEPFLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRA  135

Query  996   VGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIARPDGLVMN  817
              GGYG + V+SR LIPVP+  P +++ V + DWY K +  LKK LD G+TI RPDG+V+N
Sbjct  136   AGGYGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVIN  195

Query  816   GKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSV----NFRFQGHSMTLVEIEGSHTV  649
             GK+GK G+    PLFT++P      R+  +G  T V    +FR Q H M LVE +   T 
Sbjct  196   GKSGK-GDGSDAPLFTLKPE-----RLTGLGSVTWVSDIYHFRIQNHKMKLVEWK-DRTF  248

Query  648   QNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpatpe  469
                           L  +VTAN+E KDYY+VA+SRF K   +T  L+R   G G      
Sbjct  249   FKRLRLSRRSRWPVLWHIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----P  303

Query  468   lppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKTQAN  289
                  PA   G AWS+NQFRSFRWNLTASAARPNPQGSYHYG+INITRT KLVN++ + +
Sbjct  304   ASSQLPAGPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVD  363

Query  288   GKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNP-PDNLEKVTVAPNVVNATF  112
             GKLR+A+NGVSHT+P+TPLKLAEYF +  ++FKYD + D+P P+ ++ + + PNV+N T 
Sbjct  364   GKLRFALNGVSHTEPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITH  423

Query  111   RNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
             R FVE++FENHEK++Q++HLDG+SFF+V +EPG W+P
Sbjct  424   RTFVEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTP  460



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   423 bits (1088),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 271/399 (68%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I+NVFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  69    IINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +    +A GG+G I + SR +IPVPF  PA +F +   DW+ K +  LK ILD+G  +  
Sbjct  129   SLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDSGNNLPS  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGL++NG+    G N     FT++  KTYR R+ NVGL TS+NFR QGH M LVE+EG+
Sbjct  189   PDGLLINGR----GSNGFT--FTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGT  242

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             H++QN Y SLD+H+GQ  SVLVTA++ A+DYY+V ++RF  Q  ST +++   N  G   
Sbjct  243   HSLQNTYSSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNSAG---  299

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  PPP      I WS+ Q RS R NLTAS  RPNPQGSYHYG IN TRT +L +S  
Sbjct  300   -SVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAP  358

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               +GK RYA+N VS   PDTPLKLA+YF++ G +F    ++DNP        +  +V+NA
Sbjct  359   IIDGKQRYAVNSVSFIQPDTPLKLADYFKISG-VFSIGSIQDNPTGG--GAYLQTSVMNA  415

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR F E++FEN E T+Q++H+DGHSFF VG++ G+W P
Sbjct  416   DFRGFAELVFENPEDTVQSWHIDGHSFFVVGMDGGQWEP  454



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 269/399 (67%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I++VFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  68    IISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             + +  +A GGYG I + SR LIPVPFD PA +F +   DWYKK +  LK ILD+G  +  
Sbjct  128   SLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPF  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGLV+NG+            FT++  KTYR+R+ NVG+ TS+NFR QGH M LVE+EG+
Sbjct  188   PDGLVINGRGSNANT------FTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGT  241

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN YDSLD+H+GQ  SVLV A++  + YY+V ++RF  Q  S  +++   N  G   
Sbjct  242   HTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAG---  298

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  PPP      I WS+ Q RS R NLTAS  RPNPQGSYHYG IN T T +L N+  
Sbjct  299   -SVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTAP  357

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYA+N VS    DTPLKLA+YF++PG +F    + DNP      +  +  V+ A
Sbjct  358   TINGKQRYAVNSVSFIPADTPLKLADYFKIPG-VFSVGSIPDNPTGGGAYLQTS--VMAA  414

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR F E++FEN E T+Q++H+DGH+FFAVG++ G+W+P
Sbjct  415   DFRGFAEVVFENPEDTLQSWHIDGHNFFAVGMDGGEWTP  453



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 273/399 (68%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I+NVFN L+EP L +W+GIQQR+NSW DG  GT CPI P  NFTYKFQ KDQIG+YFYFP
Sbjct  69    IINVFNYLNEPFLLSWNGIQQRRNSWQDGVLGTSCPIPPRRNFTYKFQAKDQIGTYFYFP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T L +A GG+G + + SR +I +P+  PA E+   + DWYK  +  L++ LD+G+ +  
Sbjct  129   STLLHKAAGGFGGLAIASRSVISIPYPTPAGEYTALIGDWYKTNHAVLRRWLDSGRALGM  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             P+G+ +NG+   +        F ++P +TYR R+ NVGL TS+NFR QGH M LVE+EGS
Sbjct  189   PNGVHINGRGKGLST------FKVDPGRTYRLRISNVGLSTSLNFRIQGHKMKLVEVEGS  242

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQNVYDSLDLHVGQ  SVL+TA++  KDYY+VA++RF       VAL+R  N      
Sbjct  243   HTVQNVYDSLDLHVGQSCSVLITADQAPKDYYIVASTRFTNPVLYGVALLRYSNSR----  298

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
              P   P PP     I WS++Q RS RWNLTA+AARPNPQGSYHYG I   RT  L NS  
Sbjct  299   QPASGPLPPGPTTQIDWSLSQARSIRWNLTANAARPNPQGSYHYGLIKPARTITLANSAP  358

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYA+NGVS   PDTPLKLA+YF++ G +F    + D P      +  A  V++ 
Sbjct  359   IINGKQRYAVNGVSFMPPDTPLKLADYFKIQG-VFNLGTISDYPRGGGGYLQTA--VMSG  415

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR+F+EI+F+N E TIQ++H+DG+SFF  G++ G+WSP
Sbjct  416   QFRSFIEIVFQNDENTIQSWHIDGYSFFVAGMDGGQWSP  454



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/399 (52%), Positives = 273/399 (68%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I+NVFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  70    IINVFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFP  129

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +  + +A GGYG   + SR +IPVPF  PA +F V   DW++  +  LK ILD G  +  
Sbjct  130   SLGMHKAAGGYGGFKIASRSVIPVPFPPPAGDFTVLAGDWFRMNHTDLKAILDGGSDLPF  189

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGL++NG+    G N     F+++  KTYR+R+ NVGL TS+NFR QGH M LVE+EG+
Sbjct  190   PDGLLINGR----GSNGYT--FSVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGT  243

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN YDSLD+H+GQ  SVLVTA++ A+DYY+V ++RF  Q F+T +++   N  G  +
Sbjct  244   HTLQNTYDSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVFTTTSILHYSNSAGSVS  303

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
              P    P       I WS+ Q RS R NL+AS  RPNPQGSYHYG +N TRT +L NS +
Sbjct  304   GPPPGGPTIQ----IDWSLEQARSIRRNLSASGPRPNPQGSYHYGLVNTTRTIRLQNSAS  359

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYA+N VS T  DTPLKLA++F +PG +F    + DNP      +  +  V+ A
Sbjct  360   MINGKQRYAVNSVSFTPADTPLKLADHFNIPG-VFSLGSIPDNPTGGGAYLQTS--VMAA  416

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR + E++F+N E T+Q++H+DGH+FF VG++ G+WSP
Sbjct  417   DFRGYAEVVFDNPEDTLQSWHIDGHNFFVVGMDGGQWSP  455



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 273/399 (68%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I+NVFN LDEP L +W+G++QR+NSW DG  GT CPI PG NFTY  QVKDQIGS++YFP
Sbjct  72    IINVFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFYYFP  131

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             + +  +A GG+G IN+ SR +IPVPF  PA EF++   DW+K+ +  LK ILD G  +  
Sbjct  132   SLAFHKAAGGFGSINIASRSVIPVPFPSPAGEFSILTGDWFKQNHSDLKAILDGGHDLPF  191

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGL++NG     G N     FT++  KTYR+R+ NVGL TSVNFR QGH MT+VE+EG+
Sbjct  192   PDGLLINGH----GSNGYT--FTVDQGKTYRFRISNVGLTTSVNFRIQGHKMTVVEVEGT  245

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HTVQN YDSLD+H+GQ  SVL+TA++ A+DYY+V ++RF  Q  +  + +R  N  G  +
Sbjct  246   HTVQNAYDSLDIHLGQSYSVLLTADQPAQDYYIVVSTRFTSQVLTATSTLRYSNSAGSVS  305

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
              P    P       I WS NQ RS R NLTAS  RPNPQGSYHYG IN TRT +L NS  
Sbjct  306   GPPPGGPTIE----IDWSFNQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLANSAP  361

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYAIN VS    DTPLKLA++F +PG +F    + D+P  +   +  +  V++A
Sbjct  362   IINGKQRYAINSVSFIPADTPLKLADHFNIPG-VFTLGSIPDSPTGSGAYLQTS--VMSA  418

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR + E++FEN E ++Q+YH+DGH FF VG+  G+W+P
Sbjct  419   DFRAYTEVVFENLEDSVQSYHIDGHHFFVVGMGRGEWTP  457



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 269/399 (67%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I++VFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSYFYFP
Sbjct  68    IISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYFP  127

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             + +  +A GGYG I + SR LIPVPFD PA +F +   DWYKK +  LK ILD+G  +  
Sbjct  128   SLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLPF  187

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGLV+NG+            FT++  KTYR+R+ NVG+ TS+NFR QGH M LVE+EG+
Sbjct  188   PDGLVINGRGSNANT------FTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGT  241

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN YDSLD+H+GQ  SVLV A++  + YY+V ++RF  Q  S  +++   N  G   
Sbjct  242   HTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAG---  298

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  PPP      I WS+ Q RS R NLTAS  RPNPQGSYHYG IN T T +L N+  
Sbjct  299   -SVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTGP  357

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYA+N VS    DTPLKLA+YF++PG +F    + DNP      +  +  V+ A
Sbjct  358   TINGKQRYAVNSVSFIPADTPLKLADYFKIPG-VFSVGNIPDNPTGGGAYLQTS--VMAA  414

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR F E++FEN E T+Q++H+DGH+FFAVG++ G+W+P
Sbjct  415   DFRGFAEVVFENPEDTLQSWHIDGHNFFAVGMDGGEWTP  453



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 281/398 (71%), Gaps = 13/398 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I+N+ N+LDEP L TW+GI+QRKNSW DG  GT CPI P +N+TYKFQ KDQIG+Y YFP
Sbjct  70    ILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTYSYFP  129

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             +T L +A GG+G +NV+ R +IP+P+  P  +F + + DWYK  +KTL++ LD+G++I  
Sbjct  130   STQLHKAAGGFGGLNVYHRSVIPIPYQNPDGDFTLLIGDWYKTNHKTLRQTLDSGKSIGL  189

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGL++NG+            FT    KTY +R+ NVGL TS+NFR QGH++ LVE+EGS
Sbjct  190   PDGLLINGQPHST--------FTGNQGKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGS  241

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN+YDSLD+HVGQ +S+LVT N+  KDYY+VA++RF +   +T A++   N      
Sbjct  242   HTIQNIYDSLDVHVGQSVSLLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYSNSFSS--  299

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  PP P  K    WS+ Q R++RWNLTA+AARPNPQGS+HYG+I  T+  KL NS  
Sbjct  300   ALGPVPPSPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIKLANSAP  359

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGKLRYA+N VS+ +PDTPLKLA+YF +PG +F  +++++ P        +A +V+  
Sbjct  360   SINGKLRYAVNSVSYVNPDTPLKLADYFNIPG-IFSVNLLQNTPSSG--PGYIATSVLPT  416

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWS  4
             +  +F+E+IF+N+E T+Q++HLDG+ F+ +G   G+WS
Sbjct  417   SLHDFIEVIFQNNENTMQSWHLDGYDFWVIGYGFGQWS  454



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/399 (53%), Positives = 272/399 (68%), Gaps = 13/399 (3%)
 Frame = -2

Query  1197  IVNVFNELDEPLLFTWSGIQQRKNSWVDGTPGTMCPILPGTNFTYKFQVKDQIGSYFYFP  1018
             I++VFN LDEP L +W+G+QQR+NSW DG  GT CPI PG NFTY  QVKDQIGSY+YFP
Sbjct  69    IISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYYFP  128

Query  1017  TTSLQRAVGGYGPINVHSRELIPVPFDRPAEEFNVFVSDWYKKGYKTLKKILDNGQTIAR  838
             + +  +A GGYG I + SR  IPVPFD PA +F +   DW+K+ +  LK ILD G  +  
Sbjct  129   SLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLKAILDGGNNLPF  188

Query  837   PDGLVMNGKNGKVGENKLNPLFTMEPSKTYRYRVCNVGLRTSVNFRFQGHSMTLVEIEGS  658
             PDGL++NG+ G  G       FT++  KTYR+R+ NVG+ TS+NFR QGH M LVE+EG 
Sbjct  189   PDGLIINGR-GSNGNT-----FTVDQGKTYRFRISNVGIATSINFRIQGHKMLLVEVEGI  242

Query  657   HTVQNVYDSLDLHVGQCLSVLVTANKEAKDYYLVATSRFFKQEFSTVALIRNGNGNGGpa  478
             HT+QN Y SLD+H+GQ LSVLVTA++  +DYY+V ++RF  Q  S  +++   N  G   
Sbjct  243   HTLQNTYSSLDIHLGQSLSVLVTADQPPQDYYIVVSTRFTSQVLSATSILHYSNSGG---  299

Query  477   tpelppppPAHKEGIAWSINQFRSFRWNLTASAARPNPQGSYHYGQINITRTFKLVNSKT  298
                  PPP      + WS+ Q RSFR NLTAS  RPNPQGSYHYG IN TRT +L NS  
Sbjct  300   -SVSGPPPGGPTTEVDWSLEQARSFRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAP  358

Query  297   QANGKLRYAINGVSHTDPDTPLKLAEYFEMPGRLFKYDIMKDNPPDNLEKVTVAPNVVNA  118
               NGK RYAIN VS   PDTPLK+A+YF++ G +F    + DNP      +  +  V++A
Sbjct  359   IINGKQRYAINSVSFLQPDTPLKVADYFKISG-VFSVGSISDNPTGGGGYLQTS--VMHA  415

Query  117   TFRNFVEIIFENHEKTIQTYHLDGHSFFAVGIEPGKWSP  1
              FR FVE +FEN E T+Q++HLDG+SFF VG++ G+W+P
Sbjct  416   DFRAFVEFVFENPENTLQSWHLDGYSFFVVGMDGGQWTP  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2977115735632