BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21543_g1_i3 len=2768 path=[201:0-1892 2287:1893-1971 3024:1972-2164
3327:2165-2224 121:2225-2303 200:2304-2767]

Length=2768
                                                                      Score     E

emb|CDP02242.1|  unnamed protein product                                457   6e-147   
ref|XP_010088142.1|  Dof zinc finger protein                            451   3e-144   
gb|KDO72593.1|  hypothetical protein CISIN_1g011016mg                   447   4e-143   
ref|XP_007032561.1|  Dof zinc finger protein DOF5.2                     447   6e-143   
ref|XP_006482609.1|  PREDICTED: cyclic dof factor 2-like                446   8e-143   
ref|XP_006431167.1|  hypothetical protein CICLE_v10011556mg             444   3e-142   
gb|ACU80551.1|  Dof3 protein                                            444   1e-141   
ref|XP_006363404.1|  PREDICTED: cyclic dof factor 2-like                439   9e-141   
ref|XP_002531852.1|  zinc finger protein, putative                      437   2e-139   Ricinus communis
ref|XP_002283706.1|  PREDICTED: cyclic dof factor 2                     434   6e-138   Vitis vinifera
ref|XP_008230778.1|  PREDICTED: cyclic dof factor 2                     432   2e-137   
ref|XP_007215254.1|  hypothetical protein PRUPE_ppa004451mg             432   4e-137   
ref|XP_004233366.1|  PREDICTED: cyclic dof factor 2                     428   3e-136   
ref|XP_011098639.1|  PREDICTED: cyclic dof factor 2-like                429   6e-136   
ref|XP_009774295.1|  PREDICTED: cyclic dof factor 3-like                426   2e-135   
ref|XP_009598842.1|  PREDICTED: cyclic dof factor 3-like                424   1e-134   
ref|XP_009376278.1|  PREDICTED: cyclic dof factor 2-like                424   4e-134   
ref|XP_009792864.1|  PREDICTED: cyclic dof factor 3-like                411   6e-130   
gb|KHG00596.1|  Dof zinc finger DOF5.2 -like protein                    410   1e-128   
ref|XP_002323863.1|  hypothetical protein POPTR_0017s12080g             405   4e-127   Populus trichocarpa [western balsam poplar]
ref|XP_007139523.1|  hypothetical protein PHAVU_008G037000g             400   5e-125   
ref|XP_009621216.1|  PREDICTED: cyclic dof factor 3-like isoform X2     392   8e-123   
ref|XP_004304291.1|  PREDICTED: cyclic dof factor 2-like                394   1e-122   
ref|XP_002306032.1|  ascorbate oxidase promoter-binding family pr...    394   1e-122   Populus trichocarpa [western balsam poplar]
ref|XP_010257754.1|  PREDICTED: cyclic dof factor 1-like                391   1e-121   
ref|XP_011035770.1|  PREDICTED: cyclic dof factor 2                     390   2e-121   
ref|XP_008379360.1|  PREDICTED: cyclic dof factor 2                     390   2e-121   
ref|XP_008365508.1|  PREDICTED: cyclic dof factor 2-like                390   3e-121   
ref|XP_009621215.1|  PREDICTED: cyclic dof factor 3-like isoform X1     386   2e-120   
ref|XP_011008971.1|  PREDICTED: cyclic dof factor 3-like                387   2e-120   
ref|XP_010029305.1|  PREDICTED: cyclic dof factor 2                     386   1e-119   
ref|XP_011085751.1|  PREDICTED: cyclic dof factor 2-like                384   5e-119   
gb|KHN11617.1|  Dof zinc finger protein DOF5.2                          383   1e-118   
ref|XP_006338444.1|  PREDICTED: cyclic dof factor 2-like                380   4e-118   
ref|XP_003551736.1|  PREDICTED: cyclic dof factor 2-like                381   6e-118   
ref|XP_010258324.1|  PREDICTED: cyclic dof factor 2-like                380   2e-117   
ref|XP_003533537.1|  PREDICTED: cyclic dof factor 2-like                380   2e-117   
ref|XP_008443398.1|  PREDICTED: cyclic dof factor 2                     377   3e-116   
ref|XP_004168502.1|  PREDICTED: dof zinc finger protein DOF5.2-like     375   1e-115   
ref|XP_004147502.1|  PREDICTED: dof zinc finger protein DOF5.2-like     374   4e-115   
ref|XP_009360614.1|  PREDICTED: cyclic dof factor 1-like isoform X2     374   9e-115   
ref|XP_004232217.1|  PREDICTED: cyclic dof factor 3-like                369   8e-114   
ref|XP_009360613.1|  PREDICTED: cyclic dof factor 3-like isoform X1     368   2e-112   
ref|XP_004491816.1|  PREDICTED: cyclic dof factor 2-like                363   3e-111   
ref|XP_006477464.1|  PREDICTED: cyclic dof factor 3-like                358   2e-109   
ref|XP_006440609.1|  hypothetical protein CICLE_v10019949mg             358   2e-109   
ref|XP_003618507.1|  Dof zinc finger protein                            355   2e-108   
gb|AEM97871.1|  DOF domain class transcription factor                   351   7e-107   
ref|XP_004297294.1|  PREDICTED: cyclic dof factor 2-like                352   1e-106   
ref|XP_002281994.1|  PREDICTED: cyclic dof factor 3                     350   2e-106   Vitis vinifera
emb|CAN79859.1|  hypothetical protein VITISV_035904                     350   2e-106   Vitis vinifera
ref|XP_008361785.1|  PREDICTED: cyclic dof factor 2-like                351   3e-106   
ref|XP_008339890.1|  PREDICTED: cyclic dof factor 2-like                349   1e-105   
emb|CDP12294.1|  unnamed protein product                                347   6e-105   
ref|XP_008221604.1|  PREDICTED: cyclic dof factor 1-like                346   1e-104   
ref|XP_008341584.1|  PREDICTED: cyclic dof factor 2-like isoform X2     346   1e-104   
ref|XP_009360328.1|  PREDICTED: cyclic dof factor 2-like                345   3e-104   
ref|XP_009339156.1|  PREDICTED: cyclic dof factor 3-like                343   4e-104   
ref|XP_002269461.2|  PREDICTED: cyclic dof factor 2                     342   2e-103   Vitis vinifera
ref|XP_009587736.1|  PREDICTED: cyclic dof factor 3                     342   4e-103   
ref|XP_008350923.1|  PREDICTED: cyclic dof factor 2-like                342   5e-103   
ref|XP_007209109.1|  hypothetical protein PRUPE_ppa005339mg             340   7e-103   
ref|XP_008239933.1|  PREDICTED: cyclic dof factor 3                     339   2e-102   
ref|XP_008341583.1|  PREDICTED: cyclic dof factor 1-like isoform X1     340   5e-102   
ref|XP_010108679.1|  Dof zinc finger protein                            338   7e-102   
ref|XP_007223292.1|  hypothetical protein PRUPE_ppa005580mg             336   2e-101   
ref|XP_004489399.1|  PREDICTED: cyclic dof factor 2-like                337   3e-101   
emb|CAN60326.1|  hypothetical protein VITISV_028596                     333   3e-100   Vitis vinifera
ref|XP_011017304.1|  PREDICTED: cyclic dof factor 2-like                331   4e-99    
ref|XP_010693252.1|  PREDICTED: cyclic dof factor 2 isoform X1          330   4e-99    
ref|XP_011087240.1|  PREDICTED: cyclic dof factor 1                     331   5e-99    
ref|XP_003621247.1|  Dof zinc finger protein                            330   8e-99    
ref|XP_006379668.1|  hypothetical protein POPTR_0008s08740g             330   9e-99    
ref|XP_009369285.1|  PREDICTED: cyclic dof factor 3-like                328   2e-98    
gb|ACU80550.1|  Dof1 protein                                            327   6e-98    
gb|KDP31262.1|  hypothetical protein JCGZ_11638                         327   6e-98    
ref|XP_008360848.1|  PREDICTED: cyclic dof factor 3-like                326   1e-97    
ref|XP_009619973.1|  PREDICTED: cyclic dof factor 1-like                327   1e-97    
ref|XP_008367550.1|  PREDICTED: cyclic dof factor 3-like                326   2e-97    
ref|XP_006364590.1|  PREDICTED: cyclic dof factor 3-like                327   2e-97    
ref|XP_006373325.1|  hypothetical protein POPTR_0017s12080g             324   3e-97    
ref|XP_004235992.1|  PREDICTED: cyclic dof factor 1-like                325   7e-97    
ref|XP_008356629.1|  PREDICTED: cyclic dof factor 3-like                323   2e-96    
ref|XP_010693253.1|  PREDICTED: cyclic dof factor 2 isoform X2          322   3e-96    
ref|XP_011071702.1|  PREDICTED: cyclic dof factor 3-like                320   7e-95    
ref|XP_009628724.1|  PREDICTED: cyclic dof factor 1-like                317   3e-94    
dbj|BAH58100.1|  Dof zinc finger protein                                318   4e-94    Ipomoea batatas [batate]
ref|XP_003549682.1|  PREDICTED: cyclic dof factor 3                     317   5e-94    
ref|XP_010917059.1|  PREDICTED: cyclic dof factor 2                     316   5e-94    
gb|ACU18293.1|  unknown                                                 315   1e-93    Glycine max [soybeans]
ref|XP_009771503.1|  PREDICTED: cyclic dof factor 1-like                315   2e-93    
gb|KHN13218.1|  Dof zinc finger protein DOF5.2                          315   4e-93    
ref|XP_010939813.1|  PREDICTED: cyclic dof factor 3-like                313   2e-92    
ref|XP_003524761.1|  PREDICTED: cyclic dof factor 3-like                311   5e-92    
ref|XP_008802580.1|  PREDICTED: cyclic dof factor 3-like                311   6e-92    
ref|XP_011013327.1|  PREDICTED: cyclic dof factor 2-like                310   2e-91    
emb|CDP00347.1|  unnamed protein product                                307   1e-90    
ref|XP_007155301.1|  hypothetical protein PHAVU_003G1893001g            305   3e-90    
ref|XP_010029927.1|  PREDICTED: cyclic dof factor 3                     306   3e-90    
gb|KHN01870.1|  Dof zinc finger protein DOF3.3                          306   4e-90    
ref|XP_004299352.1|  PREDICTED: cyclic dof factor 3-like                304   2e-89    
ref|XP_006578570.1|  PREDICTED: cyclic dof factor 3-like                301   3e-88    
ref|XP_010089911.1|  Dof zinc finger protein                            299   3e-87    
emb|CBI22234.3|  unnamed protein product                                296   3e-87    
ref|XP_004508727.1|  PREDICTED: cyclic dof factor 3-like                296   6e-87    
ref|XP_010937173.1|  PREDICTED: cyclic dof factor 3-like                296   2e-86    
ref|XP_007138175.1|  hypothetical protein PHAVU_009G186600g             296   3e-86    
ref|XP_010552851.1|  PREDICTED: cyclic dof factor 2-like                295   7e-86    
ref|XP_003527086.1|  PREDICTED: cyclic dof factor 3-like                294   8e-86    
gb|KEH33316.1|  DOF-type zinc finger DNA-binding family protein         294   1e-85    
ref|XP_004154970.1|  PREDICTED: dof zinc finger protein DOF3.3-like     293   2e-85    
ref|XP_009788566.1|  PREDICTED: cyclic dof factor 1-like                293   2e-85    
ref|XP_006438711.1|  hypothetical protein CICLE_v10031433mg             293   2e-85    
ref|XP_006483138.1|  PREDICTED: cyclic dof factor 3-like                293   4e-85    
gb|ACJ85660.1|  unknown                                                 292   4e-85    Medicago truncatula
ref|XP_004514828.1|  PREDICTED: cyclic dof factor 3-like                293   5e-85    
gb|KDO82954.1|  hypothetical protein CISIN_1g038013mg                   293   7e-85    
ref|XP_008806017.1|  PREDICTED: cyclic dof factor 2                     290   2e-84    
gb|AFK34595.1|  unknown                                                 290   3e-84    
ref|XP_004138169.1|  PREDICTED: dof zinc finger protein DOF3.3-like     285   3e-83    
ref|XP_009761438.1|  PREDICTED: cyclic dof factor 3-like                286   1e-82    
ref|XP_002514746.1|  zinc finger protein, putative                      286   2e-82    Ricinus communis
ref|XP_008453209.1|  PREDICTED: cyclic dof factor 3                     285   2e-82    
ref|XP_010528346.1|  PREDICTED: cyclic dof factor 2 isoform X1          285   2e-82    
ref|XP_009587069.1|  PREDICTED: cyclic dof factor 3-like                285   4e-82    
ref|XP_009591911.1|  PREDICTED: cyclic dof factor 1-like                280   4e-81    
ref|XP_010037173.1|  PREDICTED: cyclic dof factor 3-like isoform X1     282   4e-81    
ref|XP_010037174.1|  PREDICTED: cyclic dof factor 3-like isoform X2     281   7e-81    
ref|XP_004137585.1|  PREDICTED: dof zinc finger protein DOF3.3-like     279   1e-80    
ref|XP_007157611.1|  hypothetical protein PHAVU_002G084000g             280   2e-80    
ref|XP_004505416.1|  PREDICTED: cyclic dof factor 2-like                279   3e-80    
ref|XP_010528347.1|  PREDICTED: cyclic dof factor 2 isoform X2          279   3e-80    
gb|ADO60984.1|  cycling DOF factor-like 1                               276   3e-79    
gb|ADO60985.1|  cycling DOF factor-like 1                               275   6e-79    
ref|XP_004173656.1|  PREDICTED: dof zinc finger protein DOF3.3-like     271   3e-78    
ref|XP_009758869.1|  PREDICTED: cyclic dof factor 1-like                270   4e-78    
ref|XP_003607748.1|  Dof zinc finger protein DOF1.10                    273   6e-78    
ref|XP_006573116.1|  PREDICTED: cyclic dof factor 3-like                273   1e-77    
dbj|BAA08094.1|  AOBP (ascorbate oxidase promoter-binding protein)      269   2e-77    Cucurbita maxima [Boston marrow]
gb|AAL10495.1|  AT5g39660/MIJ24_130                                     270   5e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355111.1|  PREDICTED: cyclic dof factor 2-like                269   6e-77    
ref|NP_568567.1|  cycling DOF factor 2                                  270   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006829835.1|  hypothetical protein AMTR_s00119p00099150          271   1e-76    
emb|CBI31946.3|  unnamed protein product                                265   2e-76    
ref|XP_006827283.1|  hypothetical protein AMTR_s00010p00264070          268   3e-76    
ref|XP_004238821.1|  PREDICTED: cyclic dof factor 1                     267   5e-76    
gb|KFK26911.1|  hypothetical protein AALP_AA8G309800                    265   2e-75    
ref|XP_003520081.1|  PREDICTED: cyclic dof factor 2-like                266   2e-75    
gb|KHN12198.1|  Dof zinc finger protein DOF5.2                          264   2e-74    
ref|XP_011075514.1|  PREDICTED: cyclic dof factor 1                     261   5e-74    
ref|XP_010678507.1|  PREDICTED: cyclic dof factor 3 isoform X3          259   6e-74    
emb|CDX67434.1|  BnaA07g14740D                                          260   9e-74    
ref|XP_010678506.1|  PREDICTED: cyclic dof factor 3 isoform X2          259   2e-73    
ref|XP_006405606.1|  hypothetical protein EUTSA_v10027747mg             260   2e-73    
ref|XP_010678503.1|  PREDICTED: cyclic dof factor 1 isoform X1          259   2e-73    
gb|AFO84079.1|  Dof zinc finger protein                                 258   4e-73    
ref|XP_002316165.2|  hypothetical protein POPTR_0010s17480g             254   7e-73    Populus trichocarpa [western balsam poplar]
ref|XP_010435867.1|  PREDICTED: cyclic dof factor 2-like                257   2e-72    
gb|AFH68179.1|  CDF3 Dof zinc finger protein 3.3                        253   2e-72    
ref|XP_009390304.1|  PREDICTED: cyclic dof factor 2-like                253   8e-72    
dbj|BAB08898.1|  unnamed protein product                                256   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556733.1|  PREDICTED: cyclic dof factor 2-like                254   6e-71    
ref|XP_007158648.1|  hypothetical protein PHAVU_002G170600g             252   2e-70    
ref|XP_008442918.1|  PREDICTED: cyclic dof factor 3-like                251   2e-70    
ref|XP_008793337.1|  PREDICTED: cyclic dof factor 3-like                253   3e-70    
gb|KHN45505.1|  Dof zinc finger protein DOF5.2                          248   6e-70    
ref|XP_010441080.1|  PREDICTED: cyclic dof factor 2-like                250   7e-70    
ref|XP_010550597.1|  PREDICTED: cyclic dof factor 3                     249   1e-69    
gb|AGR67388.1|  ascorbate oxidase                                       241   2e-69    
ref|XP_010451812.1|  PREDICTED: cyclic dof factor 2-like                248   5e-69    
ref|XP_003528583.1|  PREDICTED: cyclic dof factor 2-like isoform X1     248   1e-68    
ref|XP_007046067.1|  F-box family protein, putative                     247   2e-68    
ref|XP_010266732.1|  PREDICTED: cyclic dof factor 3-like                248   2e-68    
gb|ACJ13916.1|  cycling DOF factor 2                                    241   3e-68    Helianthus annuus
ref|XP_006354775.1|  PREDICTED: cyclic dof factor 3-like                246   7e-68    
gb|ACJ13941.1|  cycling DOF factor 2                                    240   1e-67    Helianthus petiolaris
ref|XP_006283563.1|  hypothetical protein CARUB_v10004614mg             246   1e-67    
gb|ACJ13919.1|  cycling DOF factor 2                                    239   2e-67    Helianthus annuus
gb|ACJ13923.1|  cycling DOF factor 2                                    239   3e-67    Helianthus annuus
gb|ACJ13913.1|  cycling DOF factor 2                                    238   4e-67    Helianthus annuus
gb|ACJ13926.1|  cycling DOF factor 2                                    238   4e-67    Helianthus annuus
gb|ACJ13910.1|  cycling DOF factor 2                                    238   4e-67    Helianthus annuus
gb|KDP41212.1|  hypothetical protein JCGZ_15619                         243   4e-67    
gb|ACJ13927.1|  cycling DOF factor 2                                    238   5e-67    Helianthus annuus
ref|XP_010938141.1|  PREDICTED: cyclic dof factor 3-like                244   5e-67    
emb|CDY47405.1|  BnaCnng15140D                                          240   2e-66    
gb|KFK34049.1|  h-protein promoter binding factor-2a                    239   3e-66    
gb|ACJ13911.1|  cycling DOF factor 2                                    236   3e-66    Helianthus annuus
ref|XP_004241585.1|  PREDICTED: cyclic dof factor 1                     241   3e-66    
tpg|DAA34018.1|  TPA: Dof-type zinc finger protein 15                   242   4e-66    
gb|ACJ13922.1|  cycling DOF factor 2                                    235   5e-66    Helianthus annuus
ref|XP_006291025.1|  hypothetical protein CARUB_v10017140mg             239   9e-66    
gb|ADD25169.1|  putative dof zinc finger protein                        235   6e-65    Brassica napus [oilseed rape]
ref|XP_009149907.1|  PREDICTED: cyclic dof factor 3                     235   7e-65    
ref|XP_010922885.1|  PREDICTED: cyclic dof factor 1-like                236   2e-64    
ref|XP_004985552.1|  PREDICTED: cyclic dof factor 3-like                234   2e-64    
gb|ACJ13914.1|  cycling DOF factor 2                                    229   7e-64    Helianthus annuus
gb|ACJ13912.1|  cycling DOF factor 2                                    229   7e-64    Helianthus annuus
gb|ACJ13920.1|  cycling DOF factor 2                                    229   7e-64    Helianthus annuus
gb|ACJ13933.1|  cycling DOF factor 2                                    229   7e-64    Helianthus annuus
gb|AGF33077.1|  chromosome 5 cycling DOF factor-like protein            229   3e-63    
ref|NP_001236866.1|  Dof27                                              226   4e-63    
ref|XP_008781227.1|  PREDICTED: cyclic dof factor 3-like                232   8e-63    
ref|XP_006583963.1|  PREDICTED: cyclic dof factor 2-like isoform X2     228   2e-62    
ref|XP_002457611.1|  hypothetical protein SORBIDRAFT_03g010280          231   3e-62    Sorghum bicolor [broomcorn]
ref|XP_008446369.1|  PREDICTED: cyclic dof factor 1                     227   4e-62    
ref|XP_002468428.1|  hypothetical protein SORBIDRAFT_01g045840          226   7e-62    Sorghum bicolor [broomcorn]
ref|XP_003565622.2|  PREDICTED: cyclic dof factor 2-like                229   1e-61    
ref|XP_002877565.1|  predicted protein                                  226   1e-61    
ref|XP_008792513.1|  PREDICTED: cyclic dof factor 2-like                228   2e-61    
ref|XP_006404373.1|  hypothetical protein EUTSA_v10010412mg             225   2e-61    
ref|XP_010546061.1|  PREDICTED: cyclic dof factor 3-like                225   2e-61    
ref|XP_009383868.1|  PREDICTED: cyclic dof factor 3-like                228   3e-61    
gb|AGV07544.1|  Dof10                                                   227   6e-61    
gb|KGN51929.1|  hypothetical protein Csa_5G605720                       223   8e-61    
ref|XP_009399927.1|  PREDICTED: cyclic dof factor 2-like                225   1e-60    
gb|AAM61191.1|  H-protein promoter binding factor-2a                    223   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921318.1|  PREDICTED: cyclic dof factor 2-like                225   2e-60    
ref|NP_190334.1|  cyclic DOF factor 3                                   222   3e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658977.1|  PREDICTED: cyclic dof factor 1-like                223   5e-60    
ref|XP_009416342.1|  PREDICTED: cyclic dof factor 3-like                223   7e-60    
ref|XP_004967772.1|  PREDICTED: cyclic dof factor 2-like isoform X2     224   9e-60    
ref|XP_004967771.1|  PREDICTED: cyclic dof factor 2-like isoform X1     224   1e-59    
gb|EEC82706.1|  hypothetical protein OsI_27376                          221   2e-59    Oryza sativa Indica Group [Indian rice]
ref|NP_001060673.1|  Os07g0685000                                       221   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010503351.1|  PREDICTED: cyclic dof factor 3-like                219   4e-59    
ref|XP_002275127.1|  PREDICTED: cyclic dof factor 3-like                220   6e-59    Vitis vinifera
ref|XP_009406839.1|  PREDICTED: cyclic dof factor 1-like                219   8e-59    
ref|XP_011047035.1|  PREDICTED: cyclic dof factor 3-like                218   2e-58    
ref|NP_001143209.1|  uncharacterized protein LOC100275712               219   3e-58    Zea mays [maize]
ref|XP_010515057.1|  PREDICTED: cyclic dof factor 3-like                216   6e-58    
ref|XP_003558722.1|  PREDICTED: cyclic dof factor 1-like                214   2e-57    
ref|XP_009404080.1|  PREDICTED: cyclic dof factor 1-like                211   4e-57    
ref|XP_010426193.1|  PREDICTED: cyclic dof factor 3-like                213   5e-57    
ref|XP_002525674.1|  conserved hypothetical protein                     214   5e-57    Ricinus communis
ref|XP_006644026.1|  PREDICTED: cyclic dof factor 2-like                214   7e-57    
ref|NP_001049101.1|  Os03g0169600                                       211   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010086689.1|  Dof zinc finger protein                            211   2e-56    
ref|XP_002319195.2|  hypothetical protein POPTR_0013s06290g             214   2e-56    Populus trichocarpa [western balsam poplar]
ref|XP_006651081.1|  PREDICTED: cyclic dof factor 2-like                211   3e-56    
ref|XP_008787992.1|  PREDICTED: cyclic dof factor 2-like                212   3e-56    
ref|XP_009380153.1|  PREDICTED: cyclic dof factor 1-like                204   1e-54    
ref|XP_002522451.1|  conserved hypothetical protein                     204   1e-54    Ricinus communis
ref|XP_009384962.1|  PREDICTED: cyclic dof factor 3-like                207   2e-54    
ref|XP_007029942.1|  Cycling DOF factor 2, putative isoform 1           206   4e-54    
ref|XP_007029943.1|  Cycling DOF factor 2, putative isoform 2           205   4e-54    
ref|XP_002325441.1|  hypothetical protein POPTR_0019s05720g             206   4e-54    Populus trichocarpa [western balsam poplar]
gb|KDP39636.1|  hypothetical protein JCGZ_02656                         204   1e-53    
ref|XP_006280864.1|  hypothetical protein CARUB_v10026854mg             199   2e-53    
ref|XP_010483955.1|  PREDICTED: cyclic dof factor 1-like                196   2e-52    
gb|EYU24366.1|  hypothetical protein MIMGU_mgv1a012923mg                192   4e-52    
ref|XP_003554055.1|  PREDICTED: cyclic dof factor 3-like                199   8e-52    
gb|ACU18311.1|  unknown                                                 198   2e-51    Glycine max [soybeans]
ref|XP_010458917.1|  PREDICTED: cyclic dof factor 1                     193   2e-51    
gb|KHN34636.1|  Dof zinc finger protein DOF5.2                          197   3e-51    
emb|CDY37010.1|  BnaC06g12530D                                          195   4e-51    
gb|ACF80167.1|  unknown                                                 196   6e-51    Zea mays [maize]
ref|XP_010683163.1|  PREDICTED: cyclic dof factor 1-like                195   8e-51    
dbj|BAJ90016.1|  predicted protein                                      196   1e-50    
ref|XP_004490083.1|  PREDICTED: cyclic dof factor 3-like                192   2e-50    
ref|NP_001131653.1|  uncharacterized protein LOC100193013               193   3e-50    Zea mays [maize]
gb|KHN42188.1|  Dof zinc finger protein DOF5.2                          194   3e-50    
gb|KFK27970.1|  dof zinc finger protein                                 189   7e-50    
gb|ABI16021.1|  Dof20                                                   188   1e-49    Glycine max [soybeans]
ref|XP_010233788.1|  PREDICTED: cyclic dof factor 1-like                191   4e-49    
gb|EMS51340.1|  Dof zinc finger protein DOF5.2                          192   4e-49    
ref|XP_006598005.1|  PREDICTED: cyclic dof factor 3-like isoform X2     190   5e-49    
ref|XP_006585698.1|  PREDICTED: cyclic dof factor 3-like isoform X1     189   9e-49    
ref|XP_006394394.1|  hypothetical protein EUTSA_v10004655mg             186   1e-48    
gb|KHN38134.1|  Dof zinc finger protein DOF5.2                          189   1e-48    
ref|XP_003573898.1|  PREDICTED: cyclic dof factor 3-like                188   3e-48    
ref|XP_009391156.1|  PREDICTED: cyclic dof factor 1-like                186   3e-48    
ref|XP_006598004.1|  PREDICTED: cyclic dof factor 3-like isoform X1     189   3e-48    
ref|XP_010444091.1|  PREDICTED: cyclic dof factor 1-like                183   7e-48    
ref|XP_004983151.1|  PREDICTED: cyclic dof factor 3-like                186   1e-47    
gb|AAY28423.1|  Dof domain zinc finger DNA-binding protein              187   2e-47    Picea abies
ref|XP_003565663.1|  PREDICTED: cyclic dof factor 2-like                184   2e-46    
ref|XP_003628145.1|  Dof zinc finger protein                            183   2e-46    
gb|AFT82640.1|  DOF40 C2C2-DOF type transcription factor                180   2e-45    
ref|NP_001143091.1|  uncharacterized protein LOC100275567               180   3e-45    
gb|ACU17838.1|  unknown                                                 173   2e-43    
gb|AFK42609.1|  unknown                                                 173   1e-42    
emb|CBI15214.3|  unnamed protein product                                166   2e-41    
gb|ADO61266.1|  cycling DOF factor-like 1                               159   7e-40    
ref|XP_010089192.1|  Dof zinc finger protein                            164   1e-39    
ref|XP_007161893.1|  hypothetical protein PHAVU_001G106400g             163   3e-39    
ref|XP_010550549.1|  PREDICTED: cyclic dof factor 3-like                161   3e-39    
gb|ADO61278.1|  cycling DOF factor-like 1                               157   5e-39    
gb|ADO61205.1|  cycling DOF factor-like 1                               155   1e-38    
gb|ADO61260.1|  cycling DOF factor-like 1                               155   2e-38    
gb|ADO61239.1|  cycling DOF factor-like 1                               155   2e-38    
ref|XP_007203463.1|  hypothetical protein PRUPE_ppa023023mg             159   5e-38    
gb|ADO61248.1|  cycling DOF factor-like 1                               154   6e-38    
gb|ADO61186.1|  cycling DOF factor-like 1                               153   9e-38    
gb|ADO61228.1|  cycling DOF factor-like 1                               153   1e-37    
gb|ADO61148.1|  cycling DOF factor-like 1                               153   1e-37    
gb|ADO61210.1|  cycling DOF factor-like 1                               152   1e-37    
gb|ADO61150.1|  cycling DOF factor-like 1                               152   1e-37    
emb|CDX74440.1|  BnaA04g09490D                                          157   2e-37    
gb|ADO61247.1|  cycling DOF factor-like 1                               152   2e-37    
gb|ADO61261.1|  cycling DOF factor-like 1                               152   2e-37    
gb|ADO61238.1|  cycling DOF factor-like 1                               152   2e-37    
gb|ABN08462.1|  Zinc finger, Dof-type                                   155   4e-37    
gb|ADO61267.1|  cycling DOF factor-like 1                               151   6e-37    
gb|ADO61259.1|  cycling DOF factor-like 1                               150   6e-37    
emb|CDY30261.1|  BnaC04g31720D                                          155   8e-37    
ref|XP_003624725.1|  Dof zinc finger protein                            155   2e-36    
ref|XP_002870770.1|  hypothetical protein ARALYDRAFT_916337             154   3e-36    
ref|XP_009125111.1|  PREDICTED: cyclic dof factor 2-like                152   3e-36    
gb|ADO61252.1|  cycling DOF factor-like 1                               148   5e-36    
ref|XP_006390998.1|  hypothetical protein EUTSA_v10018679mg             152   6e-36    
gb|AFK42521.1|  unknown                                                 145   8e-36    
ref|XP_010066902.1|  PREDICTED: cyclic dof factor 2-like                147   1e-35    
ref|XP_009139911.1|  PREDICTED: cyclic dof factor 2-like                151   1e-35    
gb|ADO61237.1|  cycling DOF factor-like 1                               146   2e-35    
ref|XP_007037382.1|  Cycling DOF factor 2, putative                     145   3e-35    
gb|ACT37358.1|  Dof-type zinc finger protein                            142   3e-35    
gb|EMS54019.1|  Dof zinc finger protein DOF5.2                          150   4e-35    
emb|CAC85949.1|  dof zinc finger protein                                145   6e-35    
ref|XP_003521879.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic dof f...    150   7e-35    
gb|EMT08945.1|  Dof zinc finger protein                                 151   8e-35    
gb|EMT22446.1|  Dof zinc finger protein                                 147   8e-35    
gb|EMS66999.1|  Dof zinc finger protein DOF5.5                          145   2e-34    
gb|ADO61218.1|  cycling DOF factor-like 1                               143   2e-34    
gb|ADO61160.1|  cycling DOF factor-like 1                               143   3e-34    
gb|EYU34655.1|  hypothetical protein MIMGU_mgv1a008126mg                145   5e-34    
emb|CDM82672.1|  unnamed protein product                                147   6e-34    
ref|NP_001172270.1|  Os01g0263900                                       147   9e-34    
gb|EEC70357.1|  hypothetical protein OsI_01281                          146   1e-33    
ref|NP_177116.1|  Dof zinc finger protein DOF1.10                       143   4e-33    
ref|XP_008240581.1|  PREDICTED: cyclic dof factor 2-like isoform X2     144   4e-33    
gb|ACY35973.1|  Dof-type zinc finger protein                            135   4e-33    
ref|XP_008240580.1|  PREDICTED: cyclic dof factor 2-like isoform X1     144   4e-33    
gb|AAC28391.1|  H-protein promoter binding factor-2b                    143   5e-33    
gb|EAY88711.1|  hypothetical protein OsI_10186                          142   5e-33    
ref|XP_004136781.1|  PREDICTED: dof zinc finger protein DOF5.2-like     143   1e-32    
ref|XP_002455459.1|  hypothetical protein SORBIDRAFT_03g011160          143   2e-32    
emb|CBI31212.3|  unnamed protein product                                142   3e-32    
ref|NP_201049.3|  cycling DOF factor 1                                  139   3e-32    
emb|CDY67869.1|  BnaC06g43390D                                          140   3e-32    
ref|XP_004493227.1|  PREDICTED: cyclic dof factor 3-like                140   4e-32    
ref|XP_004958725.1|  PREDICTED: cyclic dof factor 2-like                141   5e-32    
ref|XP_010695534.1|  PREDICTED: cyclic dof factor 2-like                139   9e-32    
emb|CDY69244.1|  BnaAnng29770D                                          136   1e-31    
ref|XP_008443297.1|  PREDICTED: cyclic dof factor 3-like                140   1e-31    
ref|XP_004173529.1|  PREDICTED: dof zinc finger protein DOF5.2-like     140   1e-31    
dbj|BAL46029.1|  Dof transcription factor                               140   3e-31    
gb|KDO66028.1|  hypothetical protein CISIN_1g011169mg                   139   4e-31    
ref|XP_008673918.1|  PREDICTED: cyclic dof factor 2-like                139   4e-31    
gb|EYU28770.1|  hypothetical protein MIMGU_mgv1a020300mg                131   5e-31    
gb|ACO53855.1|  Dof-type zinc finger protein                            127   5e-31    
ref|XP_006443525.1|  hypothetical protein CICLE_v10019872mg             138   6e-31    
gb|AEN25820.1|  Dof                                                     137   6e-31    
emb|CDY69084.1|  BnaCnng61810D                                          134   8e-31    
gb|AGL40015.1|  dof8 protein                                            137   1e-30    
ref|XP_010036266.1|  PREDICTED: cyclic dof factor 3-like isoform X1     137   1e-30    
tpg|DAA34011.1|  TPA: Dof-type zinc finger protein 8                    137   1e-30    
ref|XP_003613823.1|  Dof zinc finger protein                            135   1e-30    
gb|AGV07541.1|  Dof7                                                    136   2e-30    
tpg|DAA54180.1|  TPA: hypothetical protein ZEAMMB73_596816              138   2e-30    
gb|KHG19365.1|  Dof zinc finger DOF5.2 -like protein                    136   2e-30    
ref|XP_007151521.1|  hypothetical protein PHAVU_004G054000g             136   2e-30    
emb|CDY67518.1|  BnaAnng24480D                                          133   2e-30    
ref|XP_010553790.1|  PREDICTED: cyclic dof factor 2-like                135   3e-30    
ref|XP_002463406.1|  hypothetical protein SORBIDRAFT_02g043310          136   3e-30    
gb|EEC66917.1|  hypothetical protein OsI_33516                          135   3e-30    
gb|EEE50932.1|  hypothetical protein OsJ_31467                          135   3e-30    
ref|XP_009130214.1|  PREDICTED: cyclic dof factor 1-like                132   3e-30    
gb|ABB47574.1|  Dof domain, zinc finger family protein, expressed       135   3e-30    
dbj|BAL46030.1|  Dof transcription factor                               133   4e-30    
dbj|BAL46028.1|  Dof transcription factor                               136   4e-30    
gb|ACO53856.1|  Dof-type zinc finger protein                            125   5e-30    
gb|AAK98677.1|AC021893_11  Putative H-protein promoter binding fa...    135   5e-30    
gb|AGL40009.1|  dof2 protein                                            135   6e-30    
ref|XP_010036267.1|  PREDICTED: cyclic dof factor 3-like isoform X2     134   6e-30    
tpg|DAA34031.1|  TPA: Dof-type zinc finger protein 2                    134   7e-30    
ref|XP_002464638.1|  hypothetical protein SORBIDRAFT_01g022330          134   8e-30    
gb|EMS61311.1|  Dof zinc finger protein DOF3.3                          134   9e-30    
gb|EPS73643.1|  hypothetical protein M569_01116                         124   1e-29    
gb|EMT11673.1|  Dof zinc finger protein                                 134   1e-29    
gb|ACT31339.1|  Dof-type zinc finger protein 02                         127   2e-29    
gb|EMT03738.1|  Dof zinc finger protein                                 133   3e-29    
ref|XP_009383149.1|  PREDICTED: cyclic dof factor 1-like                129   3e-29    
ref|XP_002961848.1|  hypothetical protein SELMODRAFT_437759             134   4e-29    
ref|XP_006585699.1|  PREDICTED: cyclic dof factor 3-like isoform X2     127   6e-29    
ref|XP_002890642.1|  Dof-type zinc finger domain-containing protein     130   7e-29    
sp|Q9LQX4.1|DOF13_ARATH  RecName: Full=Dof zinc finger protein DO...    130   7e-29    
ref|XP_011101451.1|  PREDICTED: dof zinc finger protein DOF1.5-like     124   9e-29    
ref|XP_007156312.1|  hypothetical protein PHAVU_003G275800g             131   1e-28    
ref|NP_001237635.1|  uncharacterized protein LOC100527802               124   1e-28    
emb|CDY00286.1|  BnaA06g21870D                                          127   1e-28    
gb|KEH25540.1|  Dof zinc finger DOF5.2-like protein                     129   1e-28    
ref|NP_174001.1|  Dof-type zinc finger DNA-binding family protein       130   1e-28    
ref|XP_002980804.1|  hypothetical protein SELMODRAFT_444655             132   1e-28    
dbj|BAL46027.1|  Dof transcription factor                               132   1e-28    
gb|EPS70091.1|  hypothetical protein M569_04687                         128   1e-28    
gb|KHG15035.1|  Dof zinc finger DOF5.5 -like protein                    127   2e-28    
gb|EYU28083.1|  hypothetical protein MIMGU_mgv1a021256mg                123   2e-28    
ref|XP_010052194.1|  PREDICTED: dof zinc finger protein DOF1.5          124   2e-28    
gb|ACY35971.1|  Dof-type zinc finger protein                            120   3e-28    
emb|CDO96792.1|  unnamed protein product                                123   3e-28    
dbj|BAL46025.1|  Dof transcription factor                               129   4e-28    
ref|XP_003613825.1|  Dof zinc finger protein                            127   4e-28    
ref|XP_011085996.1|  PREDICTED: dof zinc finger protein DOF1.5-like     122   4e-28    
ref|XP_002266522.2|  PREDICTED: dof zinc finger protein DOF1.5          122   5e-28    
ref|XP_001784158.1|  predicted protein                                  120   6e-28    
ref|XP_007212176.1|  hypothetical protein PRUPE_ppa012605mg             122   7e-28    
ref|XP_008225286.1|  PREDICTED: dof zinc finger protein DOF1.5          122   7e-28    
ref|XP_001759349.1|  predicted protein                                  130   7e-28    
ref|XP_006304230.1|  hypothetical protein CARUB_v10010402mg             122   8e-28    
emb|CDX95919.1|  BnaA07g28120D                                          127   8e-28    
gb|EEC70400.1|  hypothetical protein OsI_01385                          128   9e-28    
ref|NP_001042735.1|  Os01g0277500                                       128   9e-28    
ref|XP_004293942.1|  PREDICTED: cyclic dof factor 4-like                122   9e-28    
ref|XP_008383626.1|  PREDICTED: dof zinc finger protein DOF1.5          121   1e-27    
gb|ABK24915.1|  unknown                                                 127   1e-27    
ref|XP_003613833.1|  Dof zinc finger protein                            127   1e-27    
emb|CBI30684.3|  unnamed protein product                                122   1e-27    
ref|XP_009349381.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   1e-27    
gb|KEH25541.1|  Dof zinc finger DOF5.2-like protein                     126   1e-27    
ref|XP_002866490.1|  hypothetical protein ARALYDRAFT_919507             125   1e-27    
ref|XP_003613827.1|  Dof zinc finger protein                            125   1e-27    
ref|XP_010549401.1|  PREDICTED: dof zinc finger protein DOF1.5-like     122   1e-27    
ref|XP_008231782.1|  PREDICTED: cyclic dof factor 3-like                127   1e-27    
gb|AEF13372.1|  Dof-domain transcription factor protein                 121   1e-27    
gb|EPS60030.1|  hypothetical protein M569_14774                         123   1e-27    
ref|XP_010478277.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   1e-27    
ref|XP_010499434.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   1e-27    
ref|XP_010460690.1|  PREDICTED: dof zinc finger protein DOF1.5          121   1e-27    
ref|XP_009352774.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   2e-27    
ref|XP_009794806.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   2e-27    
ref|XP_010103030.1|  Dof zinc finger protein                            120   2e-27    
ref|XP_011008472.1|  PREDICTED: dof zinc finger protein DOF1.5-like     120   2e-27    
ref|NP_174211.1|  Dof zinc finger protein                               121   2e-27    
ref|XP_002893549.1|  Dof-type zinc finger domain-containing protein     121   2e-27    
ref|XP_004489646.1|  PREDICTED: cyclic dof factor 3-like                125   2e-27    
ref|XP_001772347.1|  predicted protein                                  117   2e-27    
ref|XP_009110034.1|  PREDICTED: dof zinc finger protein DOF1.3-like     125   2e-27    
ref|XP_004485893.1|  PREDICTED: cyclic dof factor 4-like                120   3e-27    
ref|XP_007159448.1|  hypothetical protein PHAVU_002G238400g             120   3e-27    
ref|XP_010540512.1|  PREDICTED: dof zinc finger protein DOF1.5-like     121   3e-27    
ref|XP_006467652.1|  PREDICTED: dof zinc finger protein DOF1.5-like     120   3e-27    
ref|XP_009151365.1|  PREDICTED: cyclic dof factor 1                     123   3e-27    
ref|XP_006449501.1|  hypothetical protein CICLE_v10018094mg             120   3e-27    
ref|XP_007025382.1|  Dof-domain transcription factor protein            120   3e-27    
gb|KFK44746.1|  hypothetical protein AALP_AA1G297600                    120   4e-27    
gb|EEE54325.1|  hypothetical protein OsJ_01293                          128   4e-27    
ref|XP_008443229.1|  PREDICTED: dof zinc finger protein DOF1.5          120   4e-27    
ref|XP_009601992.1|  PREDICTED: dof zinc finger protein DOF1.5-like     119   4e-27    
gb|AGV07542.1|  Dof8                                                    126   4e-27    
ref|XP_006644059.1|  PREDICTED: cyclic dof factor 2-like                126   5e-27    
ref|XP_008467024.1|  PREDICTED: dof zinc finger protein DOF1.5-like     120   5e-27    
gb|KGN65638.1|  hypothetical protein Csa_1G475990                       120   5e-27    
ref|XP_010316809.1|  PREDICTED: dof zinc finger protein DOF1.5          119   5e-27    
ref|XP_006362415.1|  PREDICTED: dof zinc finger protein DOF1.5-like     119   5e-27    
ref|XP_004172169.1|  PREDICTED: dof zinc finger protein DOF2.3-like     119   5e-27    
ref|NP_001064563.2|  Os10g0406300                                       120   6e-27    
emb|CDY67393.1|  BnaC04g44370D                                          119   7e-27    
ref|XP_008371466.1|  PREDICTED: dof zinc finger protein DOF1.5-like     119   7e-27    
ref|XP_001783074.1|  predicted protein                                  115   7e-27    
gb|KDP21094.1|  hypothetical protein JCGZ_21565                         119   8e-27    
ref|XP_004134661.1|  PREDICTED: dof zinc finger protein DOF2.3-like     119   1e-26    
gb|AAC79873.1|  putative DNA-binding protein                            119   1e-26    
ref|XP_010686204.1|  PREDICTED: dof zinc finger protein DOF1.5          118   1e-26    
ref|XP_002522580.1|  hypothetical protein RCOM_1015170                  118   1e-26    
ref|XP_010469397.1|  PREDICTED: cyclic dof factor 4                     119   1e-26    
gb|KFK44582.1|  dof zinc finger protein                                 123   1e-26    
ref|XP_006593404.1|  PREDICTED: dof zinc finger protein DOF1.5-li...    118   2e-26    
ref|XP_010277029.1|  PREDICTED: dof zinc finger protein DOF1.5          117   2e-26    
emb|CDX99791.1|  BnaC05g22130D                                          118   2e-26    
emb|CDY71347.1|  BnaCnng72530D                                          117   2e-26    
emb|CDY37670.1|  BnaA04g19980D                                          118   2e-26    
ref|XP_002316826.1|  hypothetical protein POPTR_0011s07400g             117   2e-26    
ref|XP_010413775.1|  PREDICTED: cyclic dof factor 4-like                118   2e-26    
ref|XP_011045933.1|  PREDICTED: dof zinc finger protein DOF1.5          117   2e-26    
ref|XP_009115269.1|  PREDICTED: dof zinc finger protein DOF1.5-like     118   2e-26    
ref|XP_004511166.1|  PREDICTED: cyclic dof factor 2-like isoform X1     123   2e-26    
ref|XP_006415608.1|  hypothetical protein EUTSA_v10008914mg             117   3e-26    
ref|XP_002305070.1|  Dof zinc finger protein DOF2.3                     117   3e-26    
ref|XP_009115413.1|  PREDICTED: dof zinc finger protein DOF1.3-like     121   3e-26    
ref|XP_004511167.1|  PREDICTED: cyclic dof factor 2-like isoform X2     123   3e-26    
gb|KEH36589.1|  Dof domain zinc finger protein                          117   3e-26    
dbj|BAL46026.1|  Dof transcription factor                               123   3e-26    
gb|KHN08443.1|  Dof zinc finger protein DOF1.5                          116   4e-26    
ref|XP_003546029.1|  PREDICTED: dof zinc finger protein DOF1.5-like     116   4e-26    
ref|XP_006410555.1|  hypothetical protein EUTSA_v10017316mg             117   5e-26    
ref|XP_009104997.1|  PREDICTED: cyclic dof factor 5                     122   5e-26    
ref|XP_006295511.1|  hypothetical protein CARUB_v10024615mg             117   5e-26    
ref|NP_180961.1|  Dof-type zinc finger DNA-binding family protein       117   5e-26    
emb|CDY15647.1|  BnaA07g08180D                                          117   5e-26    
gb|KHN18911.1|  Dof zinc finger protein DOF2.3                          116   5e-26    
ref|XP_006415958.1|  hypothetical protein EUTSA_v10007936mg             121   6e-26    
ref|XP_006305125.1|  hypothetical protein CARUB_v10009494mg             121   7e-26    
ref|XP_009102876.1|  PREDICTED: dof zinc finger protein DOF1.5-like     116   8e-26    
ref|XP_010552571.1|  PREDICTED: cyclic dof factor 5-like                121   8e-26    
emb|CDY01768.1|  BnaC06g28080D                                          121   8e-26    
ref|XP_009617825.1|  PREDICTED: dof zinc finger protein DOF1.5-like     116   8e-26    
ref|XP_009109684.1|  PREDICTED: dof zinc finger protein DOF1.5-like     116   8e-26    
ref|NP_001239867.1|  dof zinc finger protein DOF1.5-like                115   9e-26    
emb|CDY43321.1|  BnaC03g58930D                                          116   1e-25    



>emb|CDP02242.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   457 bits (1176),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 265/514 (52%), Positives = 333/514 (65%), Gaps = 37/514 (7%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEM---------DVDPGGAA-----SEANSLAKDSSC  385
             KDP IKLFG TIQ P+AP     +E          D+ P         S  NSL +DS+ 
Sbjct  5     KDPAIKLFGKTIQLPEAPAAAAASECGGDASALSNDISPDDTLVQDRPSSPNSLPEDSNL  64

Query  386   SEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEI-RDGLKAPHVDEDCG  562
               +  G +E+  K+ +GE+ ++SK ++G   M  E ++D T+  + ++  KAP VD +  
Sbjct  65    DRS--GAEEESDKDFSGEKGNDSKTEDGAQSMMPEELIDPTLSSLTKESSKAPSVDSEAA  122

Query  563   STEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
               + S  ++E+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQ
Sbjct  123   PAKASKAEDEQNETSNSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQ  182

Query  743   RYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVL  919
             RYWT+GG  RN+PVGAGRRK KNS + Y H++  ++  N+  D P  I H  LK NG VL
Sbjct  183   RYWTAGGTMRNVPVGAGRRKNKNSVSQYRHISVSETLHNSQPDLPNGIHHPTLKPNGTVL  242

Query  920   TLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvt  1084
             T  SD     S+AS LNIAEKT  N + NGF++P EL I V Y       D     SSVT
Sbjct  243   TFGSDAPLCESMASVLNIAEKTMQNCTRNGFHRPEELRIPVPY-GTGGNGDEHLSGSSVT  301

Query  1085  aasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPW-PYPSSAVQWSSAVPPPGCFSPGF  1261
               S+KD+  K+ LPD    N    +PQ+PCF   PW PYP +AV W S+VPP     PGF
Sbjct  302   TLSSKDEAAKDSLPDKQMPNCQSISPQVPCFPGAPWPPYPWNAVPWGSSVPPAAFCPPGF  361

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTS--SGPNSPTLGKHSRDD------NN  1417
             PM FYP A Y G T+P +W  PW+S P   Q+  S  SGPNSPTLGKHSRDD      ++
Sbjct  362   PMQFYPAAPYWGCTVPGTWTVPWLSPPPTSQNLNSRTSGPNSPTLGKHSRDDSIMKPVDS  421

Query  1418  KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFK  1594
             K+ EPQ  K+SNPEKCLWVPKTLR DDP +AA+SSIWATLGI+ D+VDS+ G G FKAF+
Sbjct  422   KKEEPQ--KESNPEKCLWVPKTLRIDDPGEAARSSIWATLGIKIDKVDSVGGAGLFKAFQ  479

Query  1595  MKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              K DE +  S+   V L+ANPAALSRSL+FHE+S
Sbjct  480   PKGDEKTRVSETSTV-LQANPAALSRSLSFHETS  512



>ref|XP_010088142.1| Dof zinc finger protein [Morus notabilis]
 gb|EXB31954.1| Dof zinc finger protein [Morus notabilis]
Length=543

 Score =   451 bits (1161),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 263/541 (49%), Positives = 339/541 (63%), Gaps = 60/541 (11%)
 Frame = +2

Query  248   KDPTIKLFGMTIQF------------PDAppppppTE-------------------MDVD  334
             KDP IKLFG TI              P+A       E                   MD+D
Sbjct  5     KDPAIKLFGKTIPVAEVPVLCCGGGSPEASSSTAADEVEEEDYVIIKNTNINDDNIMDMD  64

Query  335   PGGAASEANS-LAKDSSCSEAEPGEDEQQQKNEN-GERMDESKEDEGTVLMEGEGIMDQ-  505
                A S ANS   + ++  + E  +D    K E  GE+  ++KE +G   +  E   +  
Sbjct  65    QKRANSVANSSFVEGNTVKDGEEEQDGDNDKKETTGEKPSDTKEVDGAQPVSSEEQRNSD  124

Query  506   TVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKT----------LKKPDKILPC  655
                 + +  K P V+++ G+ + S T+EE+ + SN ++KT          LKKPDKILPC
Sbjct  125   ATSGVSENPKTPSVEKESGTPKASKTEEEQSETSNSQEKTSEASNLQEKTLKKPDKILPC  184

Query  656   PRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HL  832
             PRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+
Sbjct  185   PRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHI  244

Query  833   NAVKSFQNACVDHPERIQHH--ALKANGKVLTLASD-----SVASELNIAEKTAGNGSLN  991
             N  ++ QNA  D P  +  H  +LK+NG VLT  SD     S+AS LN+A+KT  N + N
Sbjct  245   NVSEALQNARSDVPTAVHAHHPSLKSNGTVLTFGSDAPLCESMASVLNLADKTMHNCTQN  304

Query  992   GFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLP  1171
             GF+KP EL I VSY  G    D+S+  SS+T +++KD+  K G  + + QN   F PQ+P
Sbjct  305   GFHKPEELRIPVSY-GGGEYGDNSANGSSITTSNSKDETSKYGSQEQVIQNCQSFPPQMP  363

Query  1172  CFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAP  1351
             CF   PWPYP ++ QWS  VP P    PGFPMPFYP A Y G ++P +WN PW+ +P +P
Sbjct  364   CFPGAPWPYPWNSAQWSPPVPLPAFCPPGFPMPFYPAAAYWGCSVPGTWNIPWIPQPSSP  423

Query  1352  QHHT-SSGPNSPTLGKHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAK  1516
                  SSGPNSPTLGKHSRD+N    N   E +PPK+SN E+CLW+PKTLR DDP +AA+
Sbjct  424   NVTAPSSGPNSPTLGKHSRDENPLKPNSSVEEEPPKESNSERCLWIPKTLRIDDPGEAAR  483

Query  1517  SSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             SSIWATLGI++D+ DSI GG  FKAF+ KDDE +H ++N +V L+ANPAALSRSL+F ES
Sbjct  484   SSIWATLGIKNDKADSISGGGLFKAFRTKDDERNHVAENSKV-LQANPAALSRSLSFQES  542

Query  1694  S  1696
             S
Sbjct  543   S  543



>gb|KDO72593.1| hypothetical protein CISIN_1g011016mg [Citrus sinensis]
Length=495

 Score =   447 bits (1149),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 327/509 (64%), Gaps = 35/509 (7%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCS--------  388
             M EP KD  IKLFG TI  P         E+    G A S  + + +D +CS        
Sbjct  1     MAEP-KDQGIKLFGRTIPLP---------EVTPSVGAAPSVDDRIDQDPTCSTNSSRESD  50

Query  389   EAEPGEDEQQQKNENGERMDESK-EDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGS  565
             ++  GE+   +K  + ++  E+K EDE       E     +   I +  KA  V+++C +
Sbjct  51    KSRDGEERDSEKEMSVDKPVETKQEDEAPPENSEESTNPGSTSGISENPKASPVEKECTT  110

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              + S T+EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  111   VKTSKTEEEQSEPSTSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR  170

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H ALK NG VLT
Sbjct  171   YWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLT  230

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
               SD     S+AS LNIA+KT  N + NGF+KP EL I+++Y  G    D+ +  S VT 
Sbjct  231   FGSDAPLCESMASVLNIADKTMRNCTRNGFHKPEELRIRLTY-RGGENGDNYAHGSPVTV  289

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             +++KD+  K    + + QN  GF P + CF   PWPYP ++ QWS  V PP    PGFPM
Sbjct  290   SNSKDEAGKTTSQEAVVQNCQGFPPHVACFPGAPWPYPWNSAQWSPPVTPPAILPPGFPM  349

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDD-----NNKEGEP  1432
             PFYPPA Y G T+P +WN PW+ +P +P+   SS PNSPTLGKHSR++     +N EG+ 
Sbjct  350   PFYPPAAYWGCTVPGAWNIPWIPQPTSPK-TPSSAPNSPTLGKHSREESLVKASNSEGQE  408

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDE  1609
             Q  K++N E+CLWVPKTLR DDP DAAKSSIW TLGI++D+ DSI RGG FKAF+ K+D 
Sbjct  409   Q-HKENNAERCLWVPKTLRIDDPGDAAKSSIWTTLGIKNDKADSIGRGGLFKAFQQKNDG  467

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
               H +    V L+ANPAALSRSLNF ESS
Sbjct  468   RGHIAGTSPV-LQANPAALSRSLNFQESS  495



>ref|XP_007032561.1| Dof zinc finger protein DOF5.2 [Theobroma cacao]
 gb|EOY03487.1| Dof zinc finger protein DOF5.2 [Theobroma cacao]
Length=518

 Score =   447 bits (1150),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 250/523 (48%), Positives = 324/523 (62%), Gaps = 40/523 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVD----PGGAASEANSLAKDSSCSEAEP  400
             M EP KDP IKLFG TI  PD  P         +     G   +  N    +  C     
Sbjct  1     MSEP-KDPAIKLFGKTIPLPDKSPKAAAAATSANFCATCGDDNNNNNIDQDEDRCCSTNS  59

Query  401   GEDEQQQKNENGER---MDESKEDEGTV----------------LMEGEGIMDQTVDEIR  523
               DE + +    E+    DE+ E E  V                +  GE    +      
Sbjct  60    SPDENKTEEREAEKDTLGDETTETEQEVGGIKEDGLKQEGGAPPVTSGESTNLEATSGAS  119

Query  524   DGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNY  703
             +  K P V+++  + + S  +E++ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNY
Sbjct  120   ENPKTPSVEKESTALKTSKAEEDQSETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNY  179

Query  704   NTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPER  880
             N NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  + P  
Sbjct  180   NVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALHNAQTEIPSG  239

Query  881   IQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagd  1045
             + H ALKANG VLT  SD     S+AS LN+A+KT  N + NGF+KP EL I VSY    
Sbjct  240   VHHPALKANGTVLTFGSDAPLCESMASVLNLADKTMRNTTRNGFHKPEELKIPVSY---R  296

Query  1046  ngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS  1225
              G +    S+  +  ++KD+  K G  D + +N  GF+PQ+PCF   PWPYP ++ QW+S
Sbjct  297   GGQNGFECSNGSSVPTSKDEAGKAGSQDQMVRNCQGFSPQMPCFPGAPWPYPWNSAQWNS  356

Query  1226  AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHS  1402
              +PP    SPGFPMPFYP A Y G T+P +WN PW+ +P +P+    SSGPNSPTLGKHS
Sbjct  357   PIPPHAFCSPGFPMPFYPAAAYWGCTVPGTWNVPWLPQPSSPKKTAPSSGPNSPTLGKHS  416

Query  1403  RDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-  1567
             RD+N    +  GE +P K++N EKCLW+PKTLR +DP +AA+SSIWATLGI++D+ DSI 
Sbjct  417   RDENMGKLSNSGEEEPVKENNAEKCLWIPKTLRINDPGEAARSSIWATLGIKNDKPDSIG  476

Query  1568  RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              GG FK+F+ K DE +   +   V L+ANPAALSRS+NFHESS
Sbjct  477   SGGLFKSFQSKGDERNQVPETSPV-LQANPAALSRSINFHESS  518



>ref|XP_006482609.1| PREDICTED: cyclic dof factor 2-like [Citrus sinensis]
Length=495

 Score =   446 bits (1147),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 254/509 (50%), Positives = 326/509 (64%), Gaps = 35/509 (7%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCS--------  388
             M EP KD  IKLFG TI  P         E+    G A S  + + +D +CS        
Sbjct  1     MAEP-KDQGIKLFGRTIPLP---------EVTPSVGAAPSVDDRIDQDPTCSTNSSRESD  50

Query  389   EAEPGEDEQQQKNENGERMDESK-EDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGS  565
             ++  GE+   +K  + ++  E+K EDE       E     +   I +  KA  V+++C +
Sbjct  51    KSRDGEERDSEKEMSVDKPVETKQEDEAPPENSEESTNPGSTSGISENPKALPVEKECTT  110

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              + S T+EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  111   VKTSKTEEEQSEPSTSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR  170

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H ALK NG VLT
Sbjct  171   YWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLT  230

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
               SD     S+AS LNIA+KT  N + NGF+KP EL I+++Y  G    D+ +  S V  
Sbjct  231   FGSDAPLCESMASVLNIADKTMRNCTRNGFHKPEELRIRLTY-RGGENGDNYAHGSPVPV  289

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             +++KD+  K    + + QN  GF P + CF   PWPYP ++ QWS  V PP    PGFPM
Sbjct  290   SNSKDEAGKTTSQEAVVQNCQGFPPHVACFPGAPWPYPWNSAQWSPPVTPPAILPPGFPM  349

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDD-----NNKEGEP  1432
             PFYPPA Y G T+P +WN PW+ +P +P+   SS PNSPTLGKHSR++     +N EG+ 
Sbjct  350   PFYPPAAYWGCTVPGAWNIPWIPQPTSPK-TPSSAPNSPTLGKHSREESLVKASNSEGQE  408

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDE  1609
             Q  K++N E+CLWVPKTLR DDP DAAKSSIW TLGI++D+ DSI RGG FKAF+ K+D 
Sbjct  409   Q-HKENNAERCLWVPKTLRIDDPGDAAKSSIWTTLGIKNDKADSIGRGGLFKAFQQKNDG  467

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
               H +    V L+ANPAALSRSLNF ESS
Sbjct  468   RGHIAGTSPV-LQANPAALSRSLNFQESS  495



>ref|XP_006431167.1| hypothetical protein CICLE_v10011556mg [Citrus clementina]
 gb|ESR44407.1| hypothetical protein CICLE_v10011556mg [Citrus clementina]
Length=495

 Score =   444 bits (1143),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 254/509 (50%), Positives = 326/509 (64%), Gaps = 35/509 (7%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCS--------  388
             M EP KD  IKLFG TI  P         E+    G A    + + +D +CS        
Sbjct  1     MAEP-KDQGIKLFGRTIPLP---------EVTPSVGAAPFVDDRIDQDPTCSTNSSRESD  50

Query  389   EAEPGEDEQQQKNENGERMDESK-EDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGS  565
             ++  GE+   +K  + ++  E+K EDE       E     +   I +  KA  V+++C +
Sbjct  51    KSRDGEERDSEKEMSVDKPVETKQEDEAPPENSEESTNPGSTSGISENPKASPVEKECTT  110

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              + S T+EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  111   VKTSKTEEEQSEPSTSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR  170

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H ALK NG VLT
Sbjct  171   YWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLT  230

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
               SD     S+AS LNIA+KT  N + NGF+KP EL I+++Y  G    D+ +  S VT 
Sbjct  231   FGSDAPLCESMASVLNIADKTMRNCTRNGFHKPEELRIRLTY-RGGENGDNYAHGSPVTV  289

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             +++KD+  K    + + QN  GF P + CF   PWPYP ++ QWS  V PP    PGFPM
Sbjct  290   SNSKDEAGKTTSQEAVVQNCQGFPPHVACFPGAPWPYPWNSAQWSPPVTPPAILPPGFPM  349

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDD-----NNKEGEP  1432
             PFYPPA Y G T+P +WN PW+ +P +P+   SS PNSPTLGKHSR++     +N EG+ 
Sbjct  350   PFYPPAAYWGCTVPGAWNIPWIPQPTSPK-TPSSAPNSPTLGKHSREESLVKASNSEGQE  408

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDE  1609
             Q  K++N E+CLWVPKTLR DDP DAAKSSIW TLGI++D+ DSI RGG FKAF+ K+D 
Sbjct  409   Q-HKENNAERCLWVPKTLRIDDPGDAAKSSIWTTLGIKNDKADSIGRGGLFKAFQQKNDG  467

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
               H +    V L+ANPAALSRSLNF ESS
Sbjct  468   RGHIAGTSPV-LQANPAALSRSLNFQESS  495



>gb|ACU80551.1| Dof3 protein [Jatropha curcas]
 gb|AIA57946.1| DNA binding with one finger 1 [Jatropha curcas]
 gb|KDP27160.1| hypothetical protein JCGZ_19859 [Jatropha curcas]
Length=518

 Score =   444 bits (1141),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 260/522 (50%), Positives = 324/522 (62%), Gaps = 40/522 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMD---VDPGGAASEAN-----------SLA  370
             M EP KDP IKLFG TI  P+       T         GG+ S  +           S +
Sbjct  1     MSEP-KDPAIKLFGKTIPLPEISHGGTGTSTASAATSGGGSISMDDDSQDQDRPTCASSS  59

Query  371   KDSSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
              + S ++   GE+ +  K+  GE   ESK++ GT  +  E   +     I D  K   V+
Sbjct  60    LEESNTKGGDGEERESDKDAGGETPLESKQENGTPTVTAEESSNPDAG-ISDNPKTSSVE  118

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             +D  +++ S T+EE+   SN ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  119   KDNSTSQTSKTEEEQSDTSNSQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  178

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNS +HY H+   ++ QN   D P  + H ALK+N
Sbjct  179   KNCQRYWTAGGTMRNVPVGAGRRKNKNSGSHYRHITVSEALQNVGTDIPNGVHHPALKSN  238

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT  SD     S+AS LN+AEKT  N   NGF+KP  L I VSY  G    D +S  
Sbjct  239   GTVLTFGSDTPLHESMASVLNLAEKTMQNSPRNGFHKPEALRIPVSY-GGVGKGDDNSNG  297

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSA-----VPP  1237
              SV A+++KDD  K G  + + +N   F PQ+PCF   PWPYP ++ QWSSA     V P
Sbjct  298   PSVMASNSKDDANKIGSQETMVRNGQSFQPQVPCFPGTPWPYPWNSAQWSSATCLSPVTP  357

Query  1238  PGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAP-----QHHTSSGPNSPTLGKHS  1402
             P    PGFPMPFYP A Y G T+P +WN PW+ +P +P     Q  TSSGPNSPTLGKHS
Sbjct  358   PAFCPPGFPMPFYPTAAYWGCTVPGTWNMPWIPQPSSPNQTATQTATSSGPNSPTLGKHS  417

Query  1403  RDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             RD+N    N  GE +P K++N E+C+W+PKTLR DDP +AAKSSIW TLGI +D+VD + 
Sbjct  418   RDENVQKPNNSGE-EPGKENNAERCIWIPKTLRIDDPGEAAKSSIWTTLGITNDKVDFVG  476

Query  1571  G-GAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             G G FKAF+ K DE  H +     LL ANPAALSRSL F ES
Sbjct  477   GRGLFKAFESKGDEK-HRTTEASPLLNANPAALSRSLKFRES  517



>ref|XP_006363404.1| PREDICTED: cyclic dof factor 2-like [Solanum tuberosum]
Length=465

 Score =   439 bits (1130),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 259/488 (53%), Positives = 328/488 (67%), Gaps = 33/488 (7%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNE  430
             DP IKLFG TIQFPD+                A   +SL +D++  E +    E+  K++
Sbjct  3     DPAIKLFGRTIQFPDS--------------SGAHGDDSLPEDNNGEEED----EEAHKDD  44

Query  431   NGERMDESKEDEGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTEISTTDEEEGKMS  607
              G  +D+  EDE  +L  G+ + DQ  +  R D +K P VD DC ST  S ++EE+G+ S
Sbjct  45    FGGNLDDD-EDEMEILT-GKVLQDQNSEPTRTDSMKEPPVDNDC-STRPSKSEEEQGEAS  101

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K LKKPDKI+PCPRC+SM+TKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PVG
Sbjct  102   NSQEKILKKPDKIIPCPRCNSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVG  161

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAE  964
             AGRRK KNS  HY  ++  ++  NA   +P  +Q   L A G    L  +S+AS LNIA+
Sbjct  162   AGRRKNKNSIPHYRQISVSETLSNAQTAYPNGVQQPIL-AFGSPTPLC-ESMASVLNIAD  219

Query  965   KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQN  1144
             KT  N S NGF+KP E G+ VSY    +  D  S  SSVT+A+++D+V K  +PD+LK+N
Sbjct  220   KTMHNCSQNGFHKPQEPGVPVSY-VAGDNGDDHSRRSSVTSANSEDEVNKT-VPDLLKKN  277

Query  1145  YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNA  1324
              H F P + C+   PWPYP S V W+SAVPPPG   PGFPMPFYP A Y GYT+  SWN 
Sbjct  278   CHNFPPYMTCYPGAPWPYPCSPVPWNSAVPPPGYCPPGFPMPFYPAASYWGYTVAGSWNV  337

Query  1325  PWVSRPVAP--QHHTSSGPNSPTLGKHSRDDNNKE---GEPQPPKDSNPEKCLWVPKTLR  1489
             PW+        Q  T+SGPNSPTLGKHSRD+N ++      +P  +SNPEKCLWVPKTLR
Sbjct  338   PWMPPATVSLIQTPTTSGPNSPTLGKHSRDENVQKPLSSMEEPSNESNPEKCLWVPKTLR  397

Query  1490  FDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALS  1669
              DDP +AAKSSIWATLGI+HD VDS+ G  F AF+ K+D+N+  S+N  V L+ANPAALS
Sbjct  398   IDDPGEAAKSSIWATLGIKHDTVDSVGGSPFSAFQPKNDDNNRVSENSTV-LQANPAALS  456

Query  1670  RSLNFHES  1693
             RS+NF+ES
Sbjct  457   RSVNFNES  464



>ref|XP_002531852.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF30530.1| zinc finger protein, putative [Ricinus communis]
Length=497

 Score =   437 bits (1124),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 260/507 (51%), Positives = 323/507 (64%), Gaps = 29/507 (6%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPD----AppppppTEMDVDPGGAASEANSLAKDSSCSEAEP  400
             M EP KDP IKLFG  I FP+           T    D      E  S A  SS  E + 
Sbjct  1     MSEP-KDPAIKLFGKMIPFPEISTSTAAAASATTCSADDDCQDRERPSCA-SSSLEEGDT  58

Query  401   ---GEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTE  571
                GE+ +  K+  GE + ESK++ G+     E     ++  I +  K   V++D  +++
Sbjct  59    TGDGEERESDKDAEGETLAESKQENGSE----ESSNPDSISGITENPKTSSVEKD-DTSK  113

Query  572   ISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYW  751
              S T+EE+   SN ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYW
Sbjct  114   TSKTEEEQSDTSNSQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYW  173

Query  752   TSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA  928
             T+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  I H ALK+NG  LT  
Sbjct  174   TAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVQNDIPNGIHHPALKSNGTFLTFG  233

Query  929   SD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaas  1093
             SD     SVAS LN+A+KT  N + NGF+KP  L I VSY AG    D  S  S  TA++
Sbjct  234   SDTPLHESVASALNLADKTVQNCTRNGFHKPEALRIPVSY-AGVEHGDAHSKGSLATASN  292

Query  1094  TKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPF  1273
             +KD+  K+G    + QN  GF PQ+PC+   PWPYP ++ QWSS VPP     PGFPMPF
Sbjct  293   SKDEASKSGPQATVIQNCQGFPPQIPCYPGTPWPYPWNSAQWSSPVPPTAFCPPGFPMPF  352

Query  1274  YPPAMYLGYTIPCSWNAPWVSRPVAPQHHTS-SGPNSPTLGKHSRDDN----NKEGEPQP  1438
             YP   Y G T+P +WN  W+ +P +P    S SGPNSPTLGKHSRDDN    +  GE  P
Sbjct  353   YPTTAYWGCTVPGTWNMSWIPQPPSPNETASTSGPNSPTLGKHSRDDNMLKPSNSGE-TP  411

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENS  1615
              K+ + E+CLW+PKTLR DDP +AAKSSIW TLGI++DR DSI G G FKAF+ K +E +
Sbjct  412   EKEKSAERCLWIPKTLRIDDPGEAAKSSIWTTLGIKNDRPDSIGGRGLFKAFESKGNEKN  471

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
             HA++   V L+ANPAALSRSL F ESS
Sbjct  472   HAAETSSV-LQANPAALSRSLKFRESS  497



>ref|XP_002283706.1| PREDICTED: cyclic dof factor 2 [Vitis vinifera]
Length=511

 Score =   434 bits (1115),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 252/509 (50%), Positives = 326/509 (64%), Gaps = 28/509 (6%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTE----MDVDPGGAASEANSLAKDSSCSE--AEPGED  409
             KDP IKLFG TI  P+        +      V  GG      + A +SS  E     GE+
Sbjct  5     KDPAIKLFGKTIPLPEVATAAAGNDSPSGATVGGGGEDWVDQNRATNSSPEEDCVRAGEE  64

Query  410   EQQ-QKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKAPHVDEDCGSTEISTT  583
              ++  K+ +G ++ ++++++G      E   D   +  + +  K P  D++  + + S  
Sbjct  65    GREVDKDTSGGKVTDTRQEDGARSSTSEEFTDPDANSGVNENPKTPSADKETATLKCSKN  124

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             +EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  125   EEEQSETSISQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  184

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD--  934
               RN+PVGAGRRK KNS +HY H+   ++ Q+A  D P  I H ALK NG VLT  SD  
Sbjct  185   TMRNVPVGAGRRKNKNSTSHYRHITVSEALQSARTDVPNGIHHPALKTNGTVLTFGSDTP  244

Query  935   ---SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
                S+AS LN+AEKT  N + NGF+KP +L I V Y  G    D     SSVTA+++K++
Sbjct  245   LCESMASVLNLAEKTMRNCTPNGFHKPEKLRIPVPY-GGGENGDDHLSKSSVTASNSKEE  303

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWS-----SAVPPPGCFSP-GFPM  1267
               K  LPD + +N H F PQ+PCF   PWPYP ++ QWS         PP  F P GFPM
Sbjct  304   AGKTALPDQVMRNCHAFPPQIPCFPGAPWPYPWNSAQWSPPVPAIPPVPPPAFCPSGFPM  363

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDDN----NKEGEP  1432
             PFYP A Y G T+P +WN PWV +P A  H   SSGPNSPTLGKHSRD+N    +  GE 
Sbjct  364   PFYPAAAYWGCTVPGAWNIPWVPQPSALNHTAPSSGPNSPTLGKHSRDENMLKASNFGEE  423

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDE  1609
             +  K++N E+CLW+PKTLR DDP +AA+SSIWATLGI++D+ D I GG  FK+F+ K DE
Sbjct  424   ELQKENNSERCLWIPKTLRIDDPGEAARSSIWATLGIKNDKADPISGGRLFKSFQSKADE  483

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
              +H ++   V L+ANPAALSRSLNFHESS
Sbjct  484   KNHIAETSPV-LQANPAALSRSLNFHESS  511



>ref|XP_008230778.1| PREDICTED: cyclic dof factor 2 [Prunus mume]
Length=508

 Score =   432 bits (1112),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 244/509 (48%), Positives = 327/509 (64%), Gaps = 31/509 (6%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppT--EMDVDPGGAASEANSLAKDSSCS-----EAEPGE  406
             KDP IKLFG TI  P+ P     +    + DP       +++ +D + S     E     
Sbjct  5     KDPAIKLFGKTIPVPEVPLSSGESVGAPEPDPSSGTLVEDTVDQDHASSSNSSPEVNTNR  64

Query  407   DEQQQ-----KNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGST  568
             D +++     K+ +GE+  ++K+++G   +  E + +  T   +    K+P VD++  + 
Sbjct  65    DREEKEVNNHKDTSGEKPMQTKQEDGIPPLSSEEVTNPDTASRVGVNPKSP-VDKENATV  123

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             +   T+EE+ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  124   QNLKTEEEQSETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRY  183

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + H ++K+NG VLT 
Sbjct  184   WTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQTDVLNGVHHPSVKSNGTVLTF  243

Query  926   ASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
               D     S+AS L++A+K   NG+ NGF KP  L I  SY       D  S  S+VT +
Sbjct  244   CGDAPLCESMASVLHLADKNIQNGTHNGFQKPEGLRIPASY-GSGVNGDDHSNRSTVTDS  302

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
             ++KD+ CK G  + + Q+Y GF PQ+PCF   PWPYP ++ QWSS V PP    PGFPMP
Sbjct  303   NSKDEACKTGSQEQVMQSYQGFPPQIPCFPGVPWPYPWNSAQWSSPVTPPAFCPPGFPMP  362

Query  1271  FYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD-----NNKEGEP  1432
             +YP A Y G  +  +WN PW+  P +P H   SSGPNSPTLGKHSRD+     NN+E E 
Sbjct  363   YYPAAAYWGCAVQGAWNIPWLPPPSSPNHSAPSSGPNSPTLGKHSRDESTVKQNNEEEE-  421

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDE  1609
               PK+ + E+CLW+PKTLR DDP +AA+SSIWATLGI++D+ DS+ GG  FKAF+ K D 
Sbjct  422   -APKEKSAERCLWIPKTLRIDDPGEAARSSIWATLGIKNDKADSLSGGGLFKAFQPKGDR  480

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
              +H ++   V L+ANPAALSRSLNF ESS
Sbjct  481   KNHLTEASPV-LQANPAALSRSLNFQESS  508



>ref|XP_007215254.1| hypothetical protein PRUPE_ppa004451mg [Prunus persica]
 gb|EMJ16453.1| hypothetical protein PRUPE_ppa004451mg [Prunus persica]
Length=509

 Score =   432 bits (1110),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 243/509 (48%), Positives = 328/509 (64%), Gaps = 30/509 (6%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppT--EMDVDPGGAASEANSLAKDSSCS-----EAEPGE  406
             KDP IKLFG TI  P+ P     +    + DP       +++ +D + S     E     
Sbjct  5     KDPAIKLFGKTIPVPEVPLSSGESVGAPEPDPSSGTLVEDTVDQDHASSSNSSPEVNTNR  64

Query  407   DEQQQ-----KNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGST  568
             D +++     K+ +GE+  ++K+++G   +  E + +  T   +    K+P V+++  + 
Sbjct  65    DREEKEVNNHKDTSGEKPMQTKQEDGIPPLSSEEVTNPDTASRVGVNPKSP-VEKENATV  123

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             +   T+EE+ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  124   KNLKTEEEQSETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRY  183

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + H ++K+NG VLT 
Sbjct  184   WTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQTDVLNGVHHPSVKSNGTVLTF  243

Query  926   ASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
               D     S+AS L++A+K   NG+ NGF KP  L I  SY       D  S  S+VT +
Sbjct  244   CGDAPLCESMASVLHLADKNIQNGTHNGFQKPEGLRIPASY-GSGVNGDDHSNRSTVTDS  302

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
             ++KD+ CK G  + + Q+Y GF PQ+PCF   PWPYP ++ QWSS V PP    PGFPMP
Sbjct  303   NSKDEACKTGSQEQVMQSYQGFPPQIPCFPGAPWPYPWNSAQWSSPVTPPAFCPPGFPMP  362

Query  1271  FYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD-----NNKEGEP  1432
             +YP A Y G  +  +WN PW+  P +P H   SSGPNSPTLGKHSRD+     NN E E 
Sbjct  363   YYPAAAYWGCAVQGAWNIPWLPPPSSPNHSAPSSGPNSPTLGKHSRDESTVKQNNSEEE-  421

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDE  1609
             + PK+ + E+CLW+PKTLR DDP +AA+SSIWATLGI++D+ DS+ GG  FKAF+ K D+
Sbjct  422   EAPKEKSAERCLWIPKTLRIDDPGEAARSSIWATLGIKNDKADSLSGGGLFKAFQPKGDK  481

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
              +H ++   V L+ANPAALSRSLNF ESS
Sbjct  482   KNHLTEASPV-LQANPAALSRSLNFQESS  509



>ref|XP_004233366.1| PREDICTED: cyclic dof factor 2 [Solanum lycopersicum]
Length=467

 Score =   428 bits (1100),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 255/488 (52%), Positives = 326/488 (67%), Gaps = 31/488 (6%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNE  430
             DP IKLFG TIQ PD P          D  GA  + +SL  D++  E E     +  K++
Sbjct  3     DPAIKLFGRTIQLPDIP----------DSSGAQGD-DSLPGDNNGEEDE-----EADKDD  46

Query  431   NGERMDESKEDEGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTEISTTDEEEGKMS  607
              G  +D+ +E+    ++ G+ + DQ  +  + D +K   VD DC ST  S ++EE+G+ S
Sbjct  47    FGGNLDDDEEE--MEILTGKELQDQNSEPTKTDSIKELPVDNDC-STRPSKSEEEQGEAS  103

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K LKKPDKI+PCPRC+SM+TKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PVG
Sbjct  104   NSQEKILKKPDKIIPCPRCNSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVG  163

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAE  964
             AGRRK KNS  HY  ++  ++  NA  D+P  IQ   L A G    L  +S+AS LNIA+
Sbjct  164   AGRRKNKNSIPHYRQISVSETLSNAQTDYPNGIQQPIL-AFGSPTPLC-ESMASVLNIAD  221

Query  965   KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQN  1144
             KT  N S NGF+KP E G+ VSY    +  D  S  SSVT+A+++D+V K  +PD+LK+N
Sbjct  222   KTMHNCSQNGFHKPQEPGVPVSY-VVGDNGDDHSRRSSVTSANSEDEVNKT-VPDLLKKN  279

Query  1145  YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNA  1324
              H F P +  +   PWPYP S V W+SA+PPPG   PGFPMPFYP A Y GYT+  SWN 
Sbjct  280   CHNFPPYMTYYPGAPWPYPCSPVPWNSAIPPPGYCPPGFPMPFYPAASYWGYTVAGSWNV  339

Query  1325  PWVSRPVAP--QHHTSSGPNSPTLGKHSRDDNNKE---GEPQPPKDSNPEKCLWVPKTLR  1489
             PW+S       Q  T+SGP SP LGKHSRD+N ++      +P  +SNPEKCLWVPKTLR
Sbjct  340   PWMSPATVSLIQTPTTSGPISPALGKHSRDENIQKPLSSMEEPSNESNPEKCLWVPKTLR  399

Query  1490  FDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALS  1669
              DDP +AAKSSIWATLGI+HD VDS+ G  F AF+ K+D+N+  S+N  V L+ANPAALS
Sbjct  400   IDDPGEAAKSSIWATLGIKHDTVDSVGGSPFSAFQPKNDDNNRVSENSTV-LQANPAALS  458

Query  1670  RSLNFHES  1693
             RS+NF+ES
Sbjct  459   RSVNFNES  466



>ref|XP_011098639.1| PREDICTED: cyclic dof factor 2-like [Sesamum indicum]
Length=510

 Score =   429 bits (1102),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 263/516 (51%), Positives = 324/516 (63%), Gaps = 41/516 (8%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPG---GAASEA---------NSLAKDSSCS  388
              KDP +KLFG TI+ PD       +   V      GA  ++         NS+ +DSS +
Sbjct  4     VKDPKLKLFGKTIELPDTFAAAAESGGPVSAQTFEGAGEDSLNQDPPCSSNSMLEDSSFN  63

Query  389   EAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKAPHVDEDCGS  565
                 GED++  K+ +G   +  KE++    +  E + D   +  I +   AP  D D GS
Sbjct  64    RD--GEDQESFKSLSGPTQEHEKEEDRAQPLTLEELKDSNANPPIVEDSNAP-ADSDAGS  120

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              ++S  +E++ + SN ++K+LKKPDKILPCPRC+SMDTKFCYFNNYN NQPRHFCK CQR
Sbjct  121   MKMSKNEEDQAETSNSQEKSLKKPDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQR  180

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNS + + HL   ++ Q   VD P  I H AL  NG VLT
Sbjct  181   YWTAGGTMRNVPVGAGRRKNKNSISQFRHLTVPEALQTPRVDLPNGIHHPALNPNGTVLT  240

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
              +SD     S+AS LNI +KT  N S NGF+KP ELGI  S   G   A     S S TA
Sbjct  241   FSSDSRLCESMASVLNIVDKTIMNNSRNGFHKPDELGIPASR--GSKEAGDDCTSRSSTA  298

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             A++  D  K GLP+++  N   F PQ+PCF   PWPYP ++VQWSS V PP      FP+
Sbjct  299   ATSSKDNGKTGLPELMP-NCRPFPPQVPCFSGAPWPYPWNSVQWSSPVSPPTFGPASFPV  357

Query  1268  PFYPPAM-YLGYTIPCSWNAPWV--SRPVAPQHHT--SSGPNSPTLGKHSRDDN------  1414
             PFY  A  Y G  +P +WN PWV    P A Q HT  SSGPNSPTLGKHSRDDN      
Sbjct  358   PFYSTATPYWGCAVPGAWNVPWVIPPTPSASQSHTPPSSGPNSPTLGKHSRDDNILKMAD  417

Query  1415  NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFK  1594
              K+ E +  K+SN EKCLWVPKTLR DDP +AAKSSIWATLGI++DR DS  GG FKAF+
Sbjct  418   TKDEETR--KESNSEKCLWVPKTLRIDDPGEAAKSSIWATLGIKNDRTDSGGGGIFKAFQ  475

Query  1595  M--KDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                K DE +H S+   V L+ANPAALSRSL+FHESS
Sbjct  476   TQSKGDEKTHVSETSTV-LQANPAALSRSLSFHESS  510



>ref|XP_009774295.1| PREDICTED: cyclic dof factor 3-like [Nicotiana sylvestris]
Length=469

 Score =   426 bits (1094),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 258/491 (53%), Positives = 323/491 (66%), Gaps = 38/491 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSS---CSEAEPGEDEQQ  418
             KDP IKLFG TIQ PD                      SL  DSS    +E E  ED Q 
Sbjct  5     KDPAIKLFGKTIQLPDIQE-------------------SLQDDSSPEETNEEEEEEDVQT  45

Query  419   QKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTEISTTDEEE  595
              K++ G  +D+ K++ GT  + G+ + DQ  D+ R D ++ P VD D GST  S ++EE+
Sbjct  46    HKDDFGGHLDDDKDEMGT--LTGKELQDQNSDQSRSDTIEGPPVDND-GSTRPSKSEEEQ  102

Query  596   GKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
             G+ SN ++K LK+PDKILPCPRC+SM+TKFCYFNNYN +QPRHFCK CQRYWT+GG  RN
Sbjct  103   GEASNSQEKILKRPDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRN  162

Query  776   LPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASEL  952
             +PVGAGRRK KNS +HY  ++  ++  NA  D+P  IQ   L A G    L  +S+AS L
Sbjct  163   VPVGAGRRKNKNSISHYRQISVPETLPNAQTDYPNGIQQPIL-AFGSHKPLC-ESMASVL  220

Query  953   NIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDM  1132
             NIA+KT  N   NGF+KP E  +QVSY    +  D  S  SSV+AA+++D+V K G PD+
Sbjct  221   NIADKTMHNCPPNGFHKPEESRVQVSY-GAGDNGDDHSRRSSVSAANSEDEVNKIG-PDL  278

Query  1133  LKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC  1312
             L++N   F P L C+    WPYP S+V W+SAVPPPG   P FP+PFYP A Y GY +  
Sbjct  279   LRKNCPSFPPYLACYPGAAWPYPCSSVHWTSAVPPPGYCPPVFPIPFYPTAAYWGYNVAG  338

Query  1313  SWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDDNNKE---GEPQPPKDSNPEKCLWVP  1477
             SWN P  S P A    T  +SGPNSP LGKHSRD+N  +    + +P K+SN EKCLWVP
Sbjct  339   SWNVPLASPPTASLTQTPPTSGPNSP-LGKHSRDENILKPLNSKEEPSKESNHEKCLWVP  397

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             KTLR DDP +AAKSSIWATLGI+HD VDS+ G  F AF+ K+D N+  S+N  V L+ANP
Sbjct  398   KTLRIDDPGEAAKSSIWATLGIKHDSVDSVGGSPFSAFQSKNDGNNSVSENSTV-LQANP  456

Query  1658  AALSRSLNFHE  1690
             AALSRSLNF+E
Sbjct  457   AALSRSLNFNE  467



>ref|XP_009598842.1| PREDICTED: cyclic dof factor 3-like [Nicotiana tomentosiformis]
Length=470

 Score =   424 bits (1089),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 258/488 (53%), Positives = 318/488 (65%), Gaps = 31/488 (6%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ  D             P  +A+    L  DSS  E    ED +  K+
Sbjct  5     KDPAIKLFGKTIQLTDI------------PESSAT----LQDDSSPEETNEEEDIETHKD  48

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTEISTTDEEEGKM  604
               G  +D+ K++ GT  + G+ +  Q  D  R D ++ P VD DC ST  S ++EE+ + 
Sbjct  49    YFGGNVDDDKDEMGT--LTGKELQGQNSDPSRSDTIEGPPVDNDC-STRPSKSEEEQREA  105

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             SN ++K LK+PDKILPCPRC+SM+TKFCYFNNYN +QPRHFCK CQRYWT+GG  RN+PV
Sbjct  106   SNSQEKILKRPDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPV  165

Query  785   GAGRRKTKNSAAHYHLNAV-KSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIA  961
             GAGRRK KNS  HY   +V ++F NA  D+P  IQ   L A G    L  +S+AS LNIA
Sbjct  166   GAGRRKNKNSIPHYRQMSVPETFPNAQTDYPNGIQQPIL-AFGSHKPLC-ESMASVLNIA  223

Query  962   EKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQ  1141
             +KT  N   NGFYKP E G+QVSY    +  D  S  SSV+AA++ D+V K G PD+L++
Sbjct  224   DKTMHNCPPNGFYKPEESGVQVSY-GAGDNGDDHSRRSSVSAANSDDEVNKIG-PDLLRK  281

Query  1142  NYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWN  1321
             N   F P L C+    WPYP S+V W+SAVPPPG   P FPMPFYP A Y GY +  SWN
Sbjct  282   NCPSFPPYLACYPGAAWPYPCSSVHWTSAVPPPGYCPPVFPMPFYPTAAYWGYNVAGSWN  341

Query  1322  APWVSRPVAP--QHHTSSGPNSPTLGKHSRDDNNKE---GEPQPPKDSNPEKCLWVPKTL  1486
              P VS P A   Q  T+SGPNSPTLGKHSRD+N  +    + +P  +SN EKCLWVPKTL
Sbjct  342   VPLVSPPTASLTQTPTTSGPNSPTLGKHSRDENILKPLSSKEEPSNESNHEKCLWVPKTL  401

Query  1487  RFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAAL  1666
             R DDP +AAKSSIWATLGI+HD VDS+ G  F  F+ K+  N+  S+N  V L+ANPAAL
Sbjct  402   RIDDPGEAAKSSIWATLGIKHDSVDSVGGSPFSTFQSKNGGNNSVSENSTV-LQANPAAL  460

Query  1667  SRSLNFHE  1690
             SRS NF+E
Sbjct  461   SRSRNFNE  468



>ref|XP_009376278.1| PREDICTED: cyclic dof factor 2-like [Pyrus x bretschneideri]
Length=511

 Score =   424 bits (1089),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 314/513 (61%), Gaps = 27/513 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDP----GGAASEANSLAKDSSCSEAEP  400
             M E  KDP IKLFG TI    +           +P    G  A E     + +S S + P
Sbjct  1     MSEAAKDPAIKLFGKTIPVLSSDGDSVGVAGGPEPYPPSGTVAEETVDQDRAASSSNSSP  60

Query  401   GEDEQQQKNEN---------GERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDE  553
               + Q+++ E          GE+  ++K++ G   +  E + +     I        V +
Sbjct  61    EVNTQREREEKEVNDNKDTLGEKPIQAKQENGITTLSSEELTNPDAASIIGVNPESPVQK  120

Query  554   DCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCK  733
             +  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK
Sbjct  121   ENATLKTEKTEEEQSETSNAQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCK  180

Query  734   KCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANG  910
              CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + H ++K NG
Sbjct  181   NCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAVPNAQADVLNGVHHPSVKPNG  240

Query  911   KVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgss  1075
              VLT   D     S+AS L++A+K   N + NGF KP  L I  SY  G    D     S
Sbjct  241   TVLTFCGDMPLCESMASVLHLADKNIQNCTRNGFQKPGGLRIPASY-GGGVNGDDHLTGS  299

Query  1076  svtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP  1255
              VT +++KD+ CK+G  + + QNY GF PQ+PCF   PWPYP ++ QWSS V PP    P
Sbjct  300   MVTDSNSKDEACKSGSQEQVLQNYQGFPPQVPCFPGAPWPYPWNSSQWSSPVTPPAFCPP  359

Query  1256  GFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDDN----NK  1420
             G+PMPFYP A Y G  +   WN PW+  P +  +   SSGPNSPTLGKHSR++N    N 
Sbjct  360   GYPMPFYPAAAYWGCAVQGPWNIPWLPPPSSLNNSAPSSGPNSPTLGKHSREENTMKQNS  419

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKM  1597
               E +P K+ + EK LW+PKTLR DDP +AAKSSIWATLGI++D+ DS+  GG FKAF+ 
Sbjct  420   SEEEEPTKEKSAEKNLWIPKTLRIDDPGEAAKSSIWATLGIKNDKADSVSSGGLFKAFQS  479

Query  1598  KDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             K D+ +H S +   +L+ANPAALSRSLNF ESS
Sbjct  480   KGDQKNHPS-DASPVLQANPAALSRSLNFQESS  511



>ref|XP_009792864.1| PREDICTED: cyclic dof factor 3-like [Nicotiana sylvestris]
Length=464

 Score =   411 bits (1057),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 252/495 (51%), Positives = 308/495 (62%), Gaps = 50/495 (10%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ PD P              A S A++    SS  EAE          
Sbjct  8     KDPAIKLFGRTIQLPDFP--------------APSPADTGDYSSSAGEAE--------LE  45

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
               G+  D   E+E  +  E +G     + E  D ++      DC + + S ++EE+ + S
Sbjct  46    HKGQCDDCKDENEHLIAEELQG--RNPIPEKSDIIEESPSYNDCSTAKTSKSEEEQAETS  103

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K LKKPDKILPCPRC+SM+TKFCYFNNYN +QPRHFCK CQRYWT+GG  RN+PVG
Sbjct  104   NSQEKILKKPDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPVG  163

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASE  949
             AGRRK KN   HY H++  ++      D    IQ   LK NG +L   +D     S+ S 
Sbjct  164   AGRRKHKNPVLHYRHISVSETLP----DLSNGIQPPPLKLNGTILAFDTDKPLRESMGSV  219

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNIA+KT  N S NGF++  ELGIQ       +  D  S  SSVTA S+KD    NGLPD
Sbjct  220   LNIADKTMQNCSGNGFHRYKELGIQAG-----DNGDDRSNGSSVTALSSKDS--DNGLPD  272

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
             M +QN   F+P LPCF   PWPYP S+V  S+AVPPPG + PGFPMPF P   Y G  IP
Sbjct  273   MPRQNCDSFSPHLPCFTGAPWPYPWSSVHLSNAVPPPGYYLPGFPMPFVP--AYWGCAIP  330

Query  1310  CSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDD---NNKEGEPQPPKDSN-PEKCLW  1471
              SWN PW+S P A Q+    +S PNSP LGKH RD+    +   E +P K+SN PEKCLW
Sbjct  331   GSWNVPWMSPPTASQNQMPPTSSPNSPNLGKHPRDEIILKSMGSEEEPRKESNPPEKCLW  390

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
              PKTLR  DP +AAKSSIW+TLGI+HD VDS+ GG+FKAF  K DE +H S+N  V L+A
Sbjct  391   FPKTLRIGDPGEAAKSSIWSTLGIKHDVVDSVSGGSFKAFLPKSDERNHVSENSSV-LKA  449

Query  1652  NPAALSRSLNFHESS  1696
             NPAA+SRSLNF+ESS
Sbjct  450   NPAAMSRSLNFNESS  464



>gb|KHG00596.1| Dof zinc finger DOF5.2 -like protein [Gossypium arboreum]
Length=515

 Score =   410 bits (1053),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 249/526 (47%), Positives = 326/526 (62%), Gaps = 49/526 (9%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCS-----EAE  397
             M EP KDP IKLFG  I  P+  P       D     A    N+   D SCS     E  
Sbjct  1     MSEP-KDPAIKLFGKMIPLPEKSPKVATA--DFSATCADDNTNNDNTDLSCSTNSSPEEN  57

Query  398   PGEDEQQQKNENGER-------MDESKEDEGTV-------LMEGEGIMDQTVDEIRDGLK  535
              GE+ + +K+  G +       + + KE+EG+        +  GE    +      D  K
Sbjct  58    KGEEREAEKDTVGAKTTDVEHEVADRKEEEGSKQDDGAPPVTSGESTNLEANSGASDNSK  117

Query  536   APHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQ  715
              P  +++  + + S T+E++ + SN ++KTLKKP KI+PCPRC+SMDTKFCY+NNYN NQ
Sbjct  118   TPSSEKESTALKTSKTEEDQSETSNPQEKTLKKPTKIIPCPRCNSMDTKFCYYNNYNVNQ  177

Query  716   PRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHH  892
             PRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY  +   ++ QNA +D P  + H 
Sbjct  178   PRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRQVTVSEALQNARIDIPNGVHHT  237

Query  893   ALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngad  1057
             ALKANG VLT  SD     S+AS LN+A+KT  N + NGF++P EL I VSY    +G +
Sbjct  238   ALKANGTVLTFGSDAPLCESMASVLNLADKTMHNTTRNGFHRPEELKIPVSY---KDGEN  294

Query  1058  hssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS----  1225
                 S+  +  ++KD+  K+GL D + QN  GF PQ+ C+    WPYP ++ QWSS    
Sbjct  295   GVECSNGSSVPTSKDEAGKSGLQDQMMQNCQGFPPQMQCYPGALWPYPWNSAQWSSPVPP  354

Query  1226  ---AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRP-VAPQHHTSSGPNSPTLG  1393
                A  PPGC    +PMPFYP A Y G T+P +WN PW  +P  + Q  +SSGP+SPTLG
Sbjct  355   PPPAFCPPGC----YPMPFYPAAAYWGCTVPGTWNGPWHPQPSPSKQSASSSGPDSPTLG  410

Query  1394  KHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVD  1561
             KHSRD+N    +  GE +  K++N E+ LW+PKTLR DDP +AAKSSIWATLGI++D+ D
Sbjct  411   KHSRDENMSKPSNSGEEEQVKENNAERSLWIPKTLRIDDPGEAAKSSIWATLGIKNDKSD  470

Query  1562  SIRGGA-FKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             SI GG  FKAF+ K DE +   +   V L+ANPAALSRS+NF ESS
Sbjct  471   SIGGGGLFKAFQSKGDERTEVPETSPV-LQANPAALSRSINFRESS  515



>ref|XP_002323863.1| hypothetical protein POPTR_0017s12080g [Populus trichocarpa]
 gb|EEF03996.1| hypothetical protein POPTR_0017s12080g [Populus trichocarpa]
Length=506

 Score =   405 bits (1042),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 245/510 (48%), Positives = 315/510 (62%), Gaps = 26/510 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED-  409
             M EP KD   KLFG TIQ P+       T  D D   +  +      +SS  E    +D 
Sbjct  1     MSEP-KDQAFKLFGKTIQVPEISVTTATTTDDDDDDDSQDQDRPSCANSSLDETNITDDY  59

Query  410   -------------EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
                          E   K+  G+   E++ED  + +   E           +  K P V+
Sbjct  60    NNNDKRDHGEEDTETDDKDSVGKTTIENQEDGASPVAAKESSNLDATSGTSENPKTPSVE  119

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + + S T+EE+   SN ++KTLKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  120   KESTALKTSNTEEEQSDTSNSQEKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFC  179

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H +LK N
Sbjct  180   KNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITIPEALQNGRADVPNGVHHPSLKTN  239

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT  SD     S+AS LN+A+KT  N ++NGF+KP  L + VSYG G+NG DHS+GS
Sbjct  240   GTVLTFGSDAPLHESMASVLNLADKTMRNCTMNGFHKPEALRVPVSYGGGENGDDHSNGS  299

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S   + S+ D+  K+   +   QNY G+ PQ+PCF   PWPYP ++ QWSS VPPP    
Sbjct  300   SVTVSNSS-DEAGKSVSKESAMQNYQGYPPQIPCFPGVPWPYPWNSAQWSSPVPPPAFCP  358

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG-PNSPTLGKHSRDDNNKEGE  1429
               FPMPFYP A Y G T+P +WN PW+ +P +P+  +SS  PNSPTLGKHSRD+N  +  
Sbjct  359   SSFPMPFYPAAAYWGCTVPGAWNVPWLPQPSSPKQTSSSSDPNSPTLGKHSRDENLLKPS  418

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDD  1606
                 +  N E+CLW+PKTLR DDP +AAKSSIW TLGI++D+  S  G G FKAF  K +
Sbjct  419   NSKEELVNTERCLWIPKTLRIDDPGEAAKSSIWTTLGIKNDKPGSFGGRGLFKAFDSKVE  478

Query  1607  ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             +N  A  +   +L ANPAALSRSL F ESS
Sbjct  479   KNRAAETS--PVLHANPAALSRSLKFQESS  506



>ref|XP_007139523.1| hypothetical protein PHAVU_008G037000g [Phaseolus vulgaris]
 gb|ESW11517.1| hypothetical protein PHAVU_008G037000g [Phaseolus vulgaris]
Length=503

 Score =   400 bits (1027),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 303/511 (59%), Gaps = 40/511 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPG--------  403
             KDPTIKLFG TI           +E+     GA + ++    D S  ++           
Sbjct  5     KDPTIKLFGKTIPL---------SEITTGSAGAPASSSGDVVDESVEQSHASSSNSSRES  55

Query  404   ---EDEQQQKNENGERM-DESKEDEG-TVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGST  568
                E+    K+  GE+  D  KED   T  +E    +D T     +    P +D++  + 
Sbjct  56    HTREEGVVDKDSLGEKTPDNKKEDRAPTQSLEEVNNLDTTSGTCEESNALP-IDKETTTL  114

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
               S T+EE  + S  +DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  115   RTSKTEEELSETSKSQDKNLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRY  174

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVLT  922
             WT+GG  RN+PVGAGRRK K+S +HY    V   + QN  +D P    H +LK NG VLT
Sbjct  175   WTAGGTMRNVPVGAGRRKNKSSTSHYRQITVPDAALQNPQIDLPNGAYHPSLKCNGAVLT  234

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
               SD     S+ S LN+A+KT  N   NGF+KP EL I V + A     D  S  SSVT+
Sbjct  235   FGSDTPLCESMTSVLNLADKTVHNYPRNGFHKPEELKIPVPH-ASGEKRDDQSNKSSVTS  293

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
               + +    NG  +    N H F PQ+P F    WP P + VQWSS VPPP    PGF +
Sbjct  294   TKSAEGASTNGAQEQAMPNSHSFPPQVPYFTGNSWPIPWNPVQWSSPVPPPAFCHPGFTV  353

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTS-SGPNSPTLGKHSRDDN------NKEG  1426
             PFYP A Y G  +  +WN PW+++P +P+  TS SGPNSPTLGKHSR+DN      +  G
Sbjct  354   PFYPAAAYWGCAVSGAWNIPWIAQPSSPKGATSNSGPNSPTLGKHSREDNILKSNESGGG  413

Query  1427  EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKD  1603
             E    K++N EKCLWVPKTLR DD  DAAKS+IW TLGI++D+VDS+ R   FK F  K 
Sbjct  414   EDGHNKENNKEKCLWVPKTLRIDDSGDAAKSTIWTTLGIRNDKVDSVPRETLFKGFPSKL  473

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             DE +H S     +L+ANPAALSRSLNFHE+S
Sbjct  474   DEKNH-SMQASPVLQANPAALSRSLNFHETS  503



>ref|XP_009621216.1| PREDICTED: cyclic dof factor 3-like isoform X2 [Nicotiana tomentosiformis]
Length=445

 Score =   392 bits (1006),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 242/495 (49%), Positives = 296/495 (60%), Gaps = 69/495 (14%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ P       P     D G  +S A              GEDE + K+
Sbjct  8     KDPAIKLFGRTIQLPH-----FPAAFPADTGDYSSSA--------------GEDELEHKD  48

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
              N              + E   I++++               DC + + S ++ E+ + S
Sbjct  49    RN-------------PIPENSEIIEESPSY-----------NDCSTAKTSKSEVEQAETS  84

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K LKKPDK LPCPRC+SM+TKFCYFNNYN +Q RHFCK CQRYWT+GG  RN+PVG
Sbjct  85    NSQEKILKKPDKTLPCPRCNSMETKFCYFNNYNVSQRRHFCKNCQRYWTAGGTMRNVPVG  144

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASE  949
             AGRRK KNS  HY H+    S      D    +Q   LK NG +L   +D     S+ S 
Sbjct  145   AGRRKHKNSVLHYRHI----SISETLTDLSNGVQPPPLKLNGTILAFDTDKPLRESMGSV  200

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNIA+KT  N S NGF++  ELGIQ       +  D  S  SSVTA S+KD    NG PD
Sbjct  201   LNIADKTMQNCSGNGFHRYKELGIQAG-----DNGDDHSDGSSVTALSSKDS--DNGSPD  253

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
             M +QN + F+P LPCF   PWPYP S+V  S+AVPPPG + PGFPMPF P   Y G  IP
Sbjct  254   MPRQNCNSFSPHLPCFTGAPWPYPWSSVHLSNAVPPPGYYLPGFPMPFVP--AYWGCAIP  311

Query  1310  CSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDD---NNKEGEPQPPKDSNP-EKCLW  1471
              SWN PW+S P A Q+    +S PNSPTLGKH RD+    +   E +P K+SNP EKCLW
Sbjct  312   GSWNVPWMSPPTASQNQMPPTSSPNSPTLGKHPRDEIILKSVGSEEEPRKESNPREKCLW  371

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
              PKTLR  DP +AAKSSIWATLGI+H  VDS+ GG+FKA   K DE +  S+N  + L+A
Sbjct  372   FPKTLRIGDPGEAAKSSIWATLGIKHGAVDSVSGGSFKALLPKSDERNRVSENSSI-LKA  430

Query  1652  NPAALSRSLNFHESS  1696
             NPAA+SRSLNF+ESS
Sbjct  431   NPAAMSRSLNFNESS  445



>ref|XP_004304291.1| PREDICTED: cyclic dof factor 2-like [Fragaria vesca subsp. vesca]
Length=511

 Score =   394 bits (1011),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 233/512 (46%), Positives = 315/512 (62%), Gaps = 34/512 (7%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEM---------DVDPGGAASEANSLAKDSSCSEAEP  400
             +DP IKLFG TI  P+APP    +           D+    A+S  +S       ++   
Sbjct  5     RDPAIKLFGKTIPLPEAPPSLSDSAAAVVEKVAAPDLGDRVASSSNSSSPGGEEVNDGRD  64

Query  401   GEDEQQQKNENG-------ERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDED  556
             G +E+++ N  G       E+  ++KE++  +    E + +      + +  KAP VD++
Sbjct  65    GGEEKEEVNNGGDDEESLGEKAVQNKEEDEVLPFCSEELTNPDEASRVGESPKAP-VDKE  123

Query  557   CGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKK  736
               + +    +EE+ + SN ++KTLKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFCK 
Sbjct  124   TAALKTLKAEEEQSETSNSQEKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKN  183

Query  737   CQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGK  913
             CQRYWT+GG  RN+PVGAGRRK KN+ + Y H+   ++  N   D    + H +L++NG 
Sbjct  184   CQRYWTAGGTMRNVPVGAGRRKNKNTPSQYRHITVSEALPNGRPDVLNGVHHPSLQSNGT  243

Query  914   VLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsss  1078
             VLT  +D     S+ S L +A+K   N + NGF+KP  L I      G    D  S  S+
Sbjct  244   VLTFCADTPLCESMTSVLQLADKNVQNCTPNGFHKPEGLIIPA---YGGGNGDDHSNRST  300

Query  1079  vtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPG  1258
             VT +++K++  K G  + + QNY G+ PQ+PCF   PWPY  +  QWSS V PP    PG
Sbjct  301   VTDSNSKEETSKPGPQEPVMQNYPGYPPQIPCFPGAPWPYLWNPAQWSSPVSPPAFCPPG  360

Query  1259  FPMPFYPPAMYLGYTIPCSWNAPWVSRPVAP-QHHTSSGPNSPTLGKHSRDDN----NKE  1423
             +PMPFYP A Y G  +  +WN PWV +P +P Q   SSG NSPTLGKHSRD+N       
Sbjct  361   YPMPFYPAAAYWGCAVQGTWNMPWVPQPSSPNQTAPSSGSNSPTLGKHSRDENPVKQTSS  420

Query  1424  GEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMK  1600
              E + PK+ N E+CLW+PKTLR DDP +AA+SSIWATLGI++D+ DSI  GG FKAF+ K
Sbjct  421   EEEETPKEKNAERCLWIPKTLRIDDPGEAARSSIWATLGIKNDKADSISSGGLFKAFRSK  480

Query  1601  DDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              DE +H ++   V L+ANPAALSRSL F ESS
Sbjct  481   GDEKNHIAEASPV-LQANPAALSRSLKFQESS  511



>ref|XP_002306032.1| ascorbate oxidase promoter-binding family protein [Populus trichocarpa]
 gb|EEE86543.1| ascorbate oxidase promoter-binding family protein [Populus trichocarpa]
Length=503

 Score =   394 bits (1011),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 319/506 (63%), Gaps = 24/506 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANS--LAKDSSCSEAEPGE  406
             M EP KDP IKLFG TIQ  +          D       S A+S     DS  ++   GE
Sbjct  1     MLEP-KDPAIKLFGKTIQVTEISSTTTTDNDDSQDQDRPSCASSSLYDADSDNNKRYHGE  59

Query  407   D--EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIST  580
             +  E   K+   + + E +ED  + +   E           +  K P ++++    + S 
Sbjct  60    EDIEADDKDSVEKSLTEKQEDGVSPVATEEPSNPDATSGTSENPKTPSIEKESEGLQTSR  119

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
             T+EE+   SN  +KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+G
Sbjct  120   TEEEDSDTSNSPEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAG  179

Query  761   GMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-  934
             G  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H ++K NG VLT  SD 
Sbjct  180   GTMRNVPVGAGRRKNKNSASHYRHITIPEALQNVRADVPNGVYHPSMKTNGTVLTFGSDT  239

Query  935   ----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
                 S+AS LN+A+KT  N + NG +KP  + I VSYG+G+NG DHS+GSS   + S  D
Sbjct  240   PLHESMASVLNLADKTTRNCTRNGSHKPDAVRIPVSYGSGENGDDHSNGSSVTVSNSI-D  298

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
             +  K+   +   QN  GF P++PCF   PWPYP ++ QWSS +PPP    PGFPMPFYP 
Sbjct  299   EAGKSMSKESAMQNCQGFPPEIPCFPGVPWPYPWNSAQWSSPLPPPAFCPPGFPMPFYPA  358

Query  1283  AMYLGYTIPCSWNAPWVSRP-VAPQHHTSSGPNSPTLGKHSRDD------NNKEGEPQPP  1441
             A Y G T+P +WN PW+ +P    Q  +SSGPNSPTLGKHSRD+      N++EGE    
Sbjct  359   AAYWGCTVPGAWNIPWLPQPSSPKQTSSSSGPNSPTLGKHSRDENMLKSSNSEEGESA--  416

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSH  1618
             K++N E+CLW+PKTLR  DP +AAKSSIW TLGI++D+ D I G G FKAF  K ++N  
Sbjct  417   KENNTERCLWIPKTLRIVDPGEAAKSSIWTTLGIKNDKPDLIGGRGLFKAFDSKVEKNHE  476

Query  1619  ASKNCRVLLEANPAALSRSLNFHESS  1696
             A  +   +L+ANPAALSRSL F ESS
Sbjct  477   AETS--PVLQANPAALSRSLKFQESS  500



>ref|XP_010257754.1| PREDICTED: cyclic dof factor 1-like [Nelumbo nucifera]
Length=512

 Score =   391 bits (1004),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 234/510 (46%), Positives = 310/510 (61%), Gaps = 29/510 (6%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEA--------EPG  403
             KDP IKLFG TI           + +   P   A   + L +D S S A           
Sbjct  5     KDPAIKLFGKTIPLTSNDETSAVSAISGAPTAIAYAKDKLDEDRSSSAALQDEKSKRAAA  64

Query  404   EDEQQQKNEN---GERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTE-  571
             E ++QQK ++   G+    + ED G      +     T  E+ D  +   V+++  +T+ 
Sbjct  65    EQQRQQKEKDPSGGKPTKPTGEDGGPPTSLKKLSDPATSLEMIDEPQTASVEKEAATTKG  124

Query  572   -ISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
               +  ++ E   S  ++KTLKKPDKILPCPRC+SMDTKFCYFNNYN NQPRHFCK CQRY
Sbjct  125   CKTEEEQNETTTSIPQEKTLKKPDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRY  184

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q    D P+ + H ALK NG +LT 
Sbjct  185   WTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQTTRTDAPDGVHHSALKPNGTLLTF  244

Query  926   ASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
             +SD     S+AS LN+ EKT  N + NGF +  E  I VS G  +     S   SS+T++
Sbjct  245   SSDSPLCESMASMLNLTEKTIRNCTRNGFNRAEEQRIPVSCGVENGDDRSSGCGSSITSS  304

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP-GFPM  1267
             +  +D  +  L D + +N +GF PQ+PCF   PWPYP ++ QWSSAVPPP  F P  FP+
Sbjct  305   NCTEDGNRVSLQDPMMRNCNGFPPQIPCFPGTPWPYPWNSAQWSSAVPPPPAFCPSSFPV  364

Query  1268  PFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRD-----DNNKEGE  1429
              FYP A Y G T+P +WN PW+     +  +  S    +  LGKHSRD      NNKE +
Sbjct  365   SFYPTATYWGCTLPANWNIPWISPPSSSSSNGGSGSGPNSPLGKHSRDGSILKSNNKE-K  423

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR-GGAFKAFKMKDD  1606
               P K+SN EKCLW+PKTLR DDP +AA+SSIW+TLGI++++ DSI  GG FK F+ K +
Sbjct  424   ADPSKESNSEKCLWIPKTLRIDDPGEAARSSIWSTLGIKNNKADSISAGGLFKVFQPKSE  483

Query  1607  ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             E +H +    ++L+ANPAALSRSLNFHE+S
Sbjct  484   EKNHTA-GASLVLQANPAALSRSLNFHETS  512



>ref|XP_011035770.1| PREDICTED: cyclic dof factor 2 [Populus euphratica]
Length=509

 Score =   390 bits (1003),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 241/513 (47%), Positives = 312/513 (61%), Gaps = 29/513 (6%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED-  409
             M EP KD   KLFG TIQ P+       T  D D   +  +      +SS  E    +D 
Sbjct  1     MAEP-KDQAFKLFGKTIQVPEISVTTATTTDDDDDDDSQDQDRPSCANSSLDETNITDDY  59

Query  410   -------------EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
                          E   K+  G+   E++ED  + +   E           +  K P ++
Sbjct  60    DNNDKRDHGEEDRETDDKDSVGKTPIENQEDGASPVAAKESSNLDATSGTSENPKTPSIE  119

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + + S T+EE+   SN ++KTLKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  120   KESTALKTSNTEEEQSDTSNSQEKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFC  179

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQR WT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H +LK N
Sbjct  180   KNCQREWTAGGTMRNVPVGAGRRKNKNSASHYRHITIPEALQNGRADVPNGVHHPSLKTN  239

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT  SD     S+AS LN+A+KT  N ++NGF+KP  L + VSYG G+NG DHS+GS
Sbjct  240   GTVLTFGSDAPLHESMASVLNLADKTMLNCTMNGFHKPEALRVPVSYGGGENGDDHSNGS  299

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S   + S+ D+  K+   +   QNY G+ PQ+PCF   PWPYP ++  W S VP P    
Sbjct  300   SVTVSNSS-DEAGKSVSKESAMQNYQGYPPQIPCFPGVPWPYPWNSAHWRSPVPRPAFCP  358

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG-PNSPTLGKHSRDDNN---K  1420
               FPMPFYP A Y G T+P +WN PW+ +P +P+  +SS  PNSPTLGKHSRD+N     
Sbjct  359   SSFPMPFYPAAAYWGCTVPGAWNIPWLPQPSSPKQTSSSSDPNSPTLGKHSRDENVLKPS  418

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKM  1597
               + +  K +N E+CLW+PKTLR DDP  AAKSSIW TLGI++D+  S  G G FKAF  
Sbjct  419   NSKEELVKQNNTERCLWIPKTLRIDDPGAAAKSSIWTTLGIKNDKPGSFGGRGLFKAFDS  478

Query  1598  KDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             K ++N  A  +   +L ANPAALSRSL F ESS
Sbjct  479   KVEKNRAAETS--PVLHANPAALSRSLKFQESS  509



>ref|XP_008379360.1| PREDICTED: cyclic dof factor 2 [Malus domestica]
 ref|XP_008379361.1| PREDICTED: cyclic dof factor 2 [Malus domestica]
Length=512

 Score =   390 bits (1003),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 237/514 (46%), Positives = 311/514 (61%), Gaps = 28/514 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQF--PDAppppppTEMDVDPGGAASEANSLAKDSSCS------  388
             M E  KDP IKLFG TI     D          + DP        ++ +D + S      
Sbjct  1     MSEAAKDPAIKLFGKTIPVLSSDGDSVGVAGAPEXDPSAGTVAEETVDQDRAASSSSNSS  60

Query  389   -EAEPGED-EQQQKNEN----GERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
              E     D E+++ N+N    GE+  ++K++ G   +  E + +     I        V+
Sbjct  61    PEVNTHRDREEKEVNDNKDTLGEKPIQTKQENGITALSSEELKNPDAASIIGVNPESPVE  120

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  121   KENATLKTEKTEEEQSETSNSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  180

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + H ++K N
Sbjct  181   KNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQADVLNGVHHPSVKQN  240

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT   D     S+AS L++A+K   + + NGF KP    I  S   G    D     
Sbjct  241   GTVLTFCGDMPLCESMASVLHLADKNIQSCTRNGFQKPEGSRIPAS-XGGGVNGDDHLTG  299

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S+VT +++KD+  K+G  + + QNY GF PQ+ CF   PWPYP ++ QWSS V PP    
Sbjct  300   STVTDSNSKDEAFKSGSQEQVMQNYQGFPPQIXCFPGAPWPYPWNSSQWSSPVTPPAFCP  359

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRDDN----N  1417
             PG+PMPFYP A Y G  +   WN PW+     +     SSGPNSPTLGKHSR++N    N
Sbjct  360   PGYPMPFYPAAAYWGCAVQGPWNIPWLPXPSSSNNSAPSSGPNSPTLGKHSREENTXKQN  419

Query  1418  KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFK  1594
                E +PPK+ + EK LW+PKTLR DDP  AAKSSIWATLGI++D+ DS+  GG FKAF+
Sbjct  420   SSEEEEPPKEKSAEKNLWIPKTLRIDDPGXAAKSSIWATLGIKNDKADSVSSGGLFKAFQ  479

Query  1595  MKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              K D+ +H S +   +L+ANPAALSRSLNF ESS
Sbjct  480   SKGDQKNHLS-DASPVLQANPAALSRSLNFQESS  512



>ref|XP_008365508.1| PREDICTED: cyclic dof factor 2-like [Malus domestica]
Length=512

 Score =   390 bits (1002),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 237/514 (46%), Positives = 311/514 (61%), Gaps = 28/514 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQF--PDAppppppTEMDVDPGGAASEANSLAKDSSCS------  388
             M E  KDP IKLFG TI     D          + DP        ++ +D + S      
Sbjct  1     MSEAAKDPAIKLFGKTIPVLSSDGDSVGVAGAPERDPSAGTVAEETVDQDRAASSSSNSS  60

Query  389   -EAEPGED-EQQQKNEN----GERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
              E     D E+++ N+N    GE+  ++K++ G   +  E + +     I        V+
Sbjct  61    PEVNTHRDREEKEVNDNKDTLGEKPIQTKQENGITALSSEELKNPDAASIIGVNPESPVE  120

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  121   KENATLKTEKTEEEQSETSNSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  180

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + H ++K N
Sbjct  181   KNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQADVLNGVHHPSVKQN  240

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT   D     S+AS L++A+K   + + NGF KP    I  S   G    D     
Sbjct  241   GTVLTFCGDMPLCESMASVLHLADKNIQSCTRNGFQKPEGSRIPAS-XGGGVNGDDHLTG  299

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S+VT +++KD+  K+G  + + QNY GF PQ+ CF   PWPYP ++ QWSS V PP    
Sbjct  300   STVTDSNSKDEAFKSGSQEQVMQNYQGFPPQIXCFPGAPWPYPWNSSQWSSPVTPPAFCP  359

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRDDN----N  1417
             PG+PMPFYP A Y G  +   WN PW+     +     SSGPNSPTLGKHSR++N    N
Sbjct  360   PGYPMPFYPAAAYWGCAVQGPWNIPWLPXPSSSNNSAPSSGPNSPTLGKHSREENTXKQN  419

Query  1418  KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFK  1594
                E +PPK+ + EK LW+PKTLR DDP  AAKSSIWATLGI++D+ DS+  GG FKAF+
Sbjct  420   SSEEEEPPKEKSAEKNLWIPKTLRIDDPGXAAKSSIWATLGIKNDKADSVSSGGLFKAFQ  479

Query  1595  MKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              K D+ +H S +   +L+ANPAALSRSLNF ESS
Sbjct  480   SKGDQKNHLS-DASPVLQANPAALSRSLNFQESS  512



>ref|XP_009621215.1| PREDICTED: cyclic dof factor 3-like isoform X1 [Nicotiana tomentosiformis]
Length=464

 Score =   386 bits (992),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 238/487 (49%), Positives = 294/487 (60%), Gaps = 50/487 (10%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ P       P     D G  +S A              GEDE + K 
Sbjct  8     KDPAIKLFGRTIQLPH-----FPAAFPADTGDYSSSA--------------GEDELEHKG  48

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
             +  +  DE++      L+ GE      + E  + ++      DC + + S ++ E+ + S
Sbjct  49    QCDDCTDENEH-----LIAGELQDRNPIPENSEIIEESPSYNDCSTAKTSKSEVEQAETS  103

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K LKKPDK LPCPRC+SM+TKFCYFNNYN +Q RHFCK CQRYWT+GG  RN+PVG
Sbjct  104   NSQEKILKKPDKTLPCPRCNSMETKFCYFNNYNVSQRRHFCKNCQRYWTAGGTMRNVPVG  163

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASE  949
             AGRRK KNS  HY H+    S      D    +Q   LK NG +L   +D     S+ S 
Sbjct  164   AGRRKHKNSVLHYRHI----SISETLTDLSNGVQPPPLKLNGTILAFDTDKPLRESMGSV  219

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNIA+KT  N S NGF++  ELGIQ       +  D  S  SSVTA S+KD    NG PD
Sbjct  220   LNIADKTMQNCSGNGFHRYKELGIQAG-----DNGDDHSDGSSVTALSSKDS--DNGSPD  272

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
             M +QN + F+P LPCF   PWPYP S+V  S+AVPPPG + PGFPMPF P   Y G  IP
Sbjct  273   MPRQNCNSFSPHLPCFTGAPWPYPWSSVHLSNAVPPPGYYLPGFPMPFVP--AYWGCAIP  330

Query  1310  CSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDD---NNKEGEPQPPKDSNP-EKCLW  1471
              SWN PW+S P A Q+    +S PNSPTLGKH RD+    +   E +P K+SNP EKCLW
Sbjct  331   GSWNVPWMSPPTASQNQMPPTSSPNSPTLGKHPRDEIILKSVGSEEEPRKESNPREKCLW  390

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
              PKTLR  DP +AAKSSIWATLGI+H  VDS+ GG+FKA   K DE +  S+N  + L+A
Sbjct  391   FPKTLRIGDPGEAAKSSIWATLGIKHGAVDSVSGGSFKALLPKSDERNRVSENSSI-LKA  449

Query  1652  NPAALSR  1672
             NPAA+SR
Sbjct  450   NPAAMSR  456



>ref|XP_011008971.1| PREDICTED: cyclic dof factor 3-like [Populus euphratica]
 ref|XP_011013651.1| PREDICTED: cyclic dof factor 3-like [Populus euphratica]
Length=502

 Score =   387 bits (995),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 319/506 (63%), Gaps = 25/506 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDV-DPGGAASEANSLA-KDSSCSEAEPGE  406
             M EP +DP IKLFG TIQ  +          D  D    +  ++SL   DS  ++ + GE
Sbjct  1     MLEP-RDPAIKLFGKTIQVTEISSTTTTDNDDSQDQDRPSCASSSLCDTDSDNNKRDHGE  59

Query  407   D--EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIST  580
             +  E   K+   + + E +ED  + +   E           +  K P ++++    +   
Sbjct  60    EDIEADDKDSVEKSLTEKQEDGVSPVAAEEPSNPDANSRTSENPKTPSIEKESEGLQTLR  119

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
             T EE    SN ++KTLKKPDKILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+G
Sbjct  120   T-EEHSDTSNSQEKTLKKPDKILPCPRCKSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAG  178

Query  761   GMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-  934
             G  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H ++K NG VLT  SD 
Sbjct  179   GTMRNVPVGAGRRKNKNSASHYRHITIPEALQNVRADVPNGVYHPSMKTNGTVLTFGSDT  238

Query  935   ----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
                 S+AS LN+A+KT  N + N  +KP  + I VSYG+G+NG DHS+GSS   + S  D
Sbjct  239   PLHESMASVLNLADKTTRNCTRNVSHKPDAVRIPVSYGSGENGDDHSNGSSVTVSNSI-D  297

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
             +  K+   +   QN  GF P++PCF   PWPYP ++ QWSS +PPP    PGFPMPFYP 
Sbjct  298   EAGKSMSKESAMQNCQGFTPEIPCFPGVPWPYPWNSAQWSSPLPPPAFCPPGFPMPFYPA  357

Query  1283  AMYLGYTIPCSWNAPWVSRPVAP-QHHTSSGPNSPTLGKHSRDD------NNKEGEPQPP  1441
             A Y G T+P +WN PW+ +  +P Q   SS PNSPTLGKHSRD+      N++EGE    
Sbjct  358   AAYWGCTVPGAWNIPWLPQSSSPKQASLSSSPNSPTLGKHSRDENVLKSSNSEEGESA--  415

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSH  1618
             K++N E+CLW+PKTLR  DP +AAKSSIW TLGI++D+ D I G G FKAF+ K ++N H
Sbjct  416   KENNTERCLWIPKTLRIVDPGEAAKSSIWTTLGIKNDKPDLIGGRGLFKAFESKVEKN-H  474

Query  1619  ASKNCRVLLEANPAALSRSLNFHESS  1696
              ++   V L+ANPAALSRSL F ESS
Sbjct  475   GAETSPV-LQANPAALSRSLKFQESS  499



>ref|XP_010029305.1| PREDICTED: cyclic dof factor 2 [Eucalyptus grandis]
 gb|KCW56202.1| hypothetical protein EUGRSUZ_I01947 [Eucalyptus grandis]
Length=516

 Score =   386 bits (992),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 235/531 (44%), Positives = 303/531 (57%), Gaps = 58/531 (11%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             MP   +DP IKLFG TI  PD           + PG AA+ A    +  S     P  ++
Sbjct  1     MPGEARDPAIKLFGKTISLPD-----------IPPGDAAAAAVDTGQVPSADPPSPARED  49

Query  413   ---------------------------QQQKNENGERMDESKEDEGTVLME-GEGIMDQT  508
                                        +  K    E+   +K + G   M   EG     
Sbjct  50    IGMAGVDGGEEEEGDEDEYEEDDDEEGRDDKETQDEKPAIAKLENGAQFMNLEEGTNRDA  109

Query  509   VDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             +    +  + P VD++  +   S ++EE+   SN ++K LKKPDKILPCPRC+SMDTKFC
Sbjct  110   ISVTNENPRTPSVDKESTTPRTSKSEEEQSDTSNSQEKVLKKPDKILPCPRCNSMDTKFC  169

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACV  865
             Y+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY HL   ++ Q+   
Sbjct  170   YYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHLAVPEALQSVRT  229

Query  866   DHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVS  1030
             D P  + H  LK NG VLT  SD     S+AS L++A+K   N   NGF+KP E  I  S
Sbjct  230   DFPNGVHHPPLKPNGTVLTFGSDAPLCESMASVLHLADKAMHNSRKNGFHKP-EGVIMPS  288

Query  1031  YgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSA  1210
                       +   SS TAA++     KNG  +++  N  GF PQLPCF   PWPY  ++
Sbjct  289   PCGSVRSGVETMNGSSATAANSNLVESKNGTKEIVMPNCQGFPPQLPCFPGAPWPYAWNS  348

Query  1211  VQWSSAVPP-PGCFS-PGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHH-TSSGPNS  1381
               WS  + P P  F  PGF +PFY    Y   ++P +WN PWV++P +P H  TSS PNS
Sbjct  349   APWSPPISPGPQTFCPPGFAVPFYAGPAYWSCSVPGAWNIPWVAQPTSPNHSATSSAPNS  408

Query  1382  PTLGKHSRDDNNKEGEP-----QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQ  1546
             PTLGKHSRD+  K G+P     + PK++NPE+ LW+PKTLR DDP +AAKSSIWATLGI+
Sbjct  409   PTLGKHSRDE--KIGKPNDSTEEEPKEANPERSLWIPKTLRIDDPGEAAKSSIWATLGIK  466

Query  1547  HDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             ++  +S  RG   KAF+ K +E +H  +   V L+ANPAALSRS NF ESS
Sbjct  467   NEASNSAGRGVLLKAFQSKSEEKNHVVEASSV-LQANPAALSRSRNFQESS  516



>ref|XP_011085751.1| PREDICTED: cyclic dof factor 2-like [Sesamum indicum]
Length=497

 Score =   384 bits (985),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 242/512 (47%), Positives = 305/512 (60%), Gaps = 46/512 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAE---------  397
              KDP IKLFG TI+ P+                AA E +S  +D SCS            
Sbjct  4     VKDPKIKLFGKTIELPETCAAAVEIGEAAQSCDAAGE-DSSNQDPSCSSDSMIDNSNLNG  62

Query  398   PGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIS  577
               ED +  K ++  + ++ KE++         + +       +  KA   D D  + + S
Sbjct  63    DAEDHESHKCQSVPKQNDGKEEDVAHPSTSNELKEDATPAADEDSKALSADSDARAVQTS  122

Query  578   TTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
              T++++ +  N ++KTLKKPDKILPCPRC+SM+TKFCYFNNYN NQPRHFCKKCQRYWT+
Sbjct  123   KTEDDQIETGNSQEKTLKKPDKILPCPRCNSMETKFCYFNNYNVNQPRHFCKKCQRYWTA  182

Query  758   GGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD  934
             GG  RN+PVGAGRRK K+SA+ + HL   +S Q+A VD P  + H  L  NG +L  +SD
Sbjct  183   GGTMRNVPVGAGRRKNKSSASQFCHLTVPESLQSARVDLPNGVHHPVLNPNGTILAFSSD  242

Query  935   -----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                  S+ S L+IA+KT  +G+ NGF KP E G                 S S T AS+K
Sbjct  243   APLCESMVSVLDIADKTLRDGARNGFQKPAENG-------------DDQSSGSSTTASSK  289

Query  1100  DDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYP  1279
             D V + GLP+++  N+H F PQ+PCF   PWPYP  +VQWSS V  P      FP+PFY 
Sbjct  290   DKVGQIGLPELIP-NHHPFPPQVPCFPGAPWPYPWPSVQWSSLVSAPAFGPASFPLPFYS  348

Query  1280  PA-MYLGYTIPCSWNAPWVSRPV----APQHHTSSGPNSPTLGKHSRDDN-----NKEGE  1429
              A  Y G  +P +WN PWV  P           SS PNSPTLGKHSRDDN     N E E
Sbjct  349   TAPPYWGCAVPGAWNVPWVIPPAPTSSQSHSSPSSSPNSPTLGKHSRDDNILKPANSEEE  408

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAF--KMK  1600
              +  K+SN EKCLWVPKTLR DDP +AAKSSIWATLGI++DRVD + GG  FKAF  + K
Sbjct  409   TR--KESNSEKCLWVPKTLRIDDPGEAAKSSIWATLGIKNDRVDPVGGGGLFKAFGSQSK  466

Query  1601  DDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              D  + A +   V L+ANPAALSRSL+FHESS
Sbjct  467   GDCKAQAPETSTV-LQANPAALSRSLSFHESS  497



>gb|KHN11617.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=503

 Score =   383 bits (983),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 238/501 (48%), Positives = 309/501 (62%), Gaps = 20/501 (4%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ--  421
             KDP IKLFG TI  P+  P                ++   +  +S  E+    D Q++  
Sbjct  5     KDPAIKLFGKTIPVPEILPGSNGAPASSSGDVVVDDSVDASSTNSSRESHTNTDAQEKDF  64

Query  422   -KNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGSTEISTTDEEE  595
              K+  GE+  + K+++G      E + +  T     +       + +  + + + T+EE+
Sbjct  65    DKDTLGEKPTDDKKEDGAPAQSSEEVANPDTASGTCEESIIQSTEREATTLKTTKTEEEQ  124

Query  596   GKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
             G+ SN +DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN
Sbjct  125   GETSNSQDKNLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRN  184

Query  776   LPVGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----  934
             +PVGAGRRK K+ A+HY    V   + QN   D P    H +LK NG VLT  +D     
Sbjct  185   VPVGAGRRKNKSVASHYRQITVSEAALQNPRTDLPNGAYHPSLKCNGTVLTFGTDTPLCE  244

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S+AS LN+A+KT  N + NGF+KP EL I VS+ +G+ G D S+ SS  +  S  +    
Sbjct  245   SMASVLNLADKTMHNYTRNGFHKPEELRIPVSHASGEKGDDQSNKSSVTSTTSV-EGAST  303

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
             N   + + QN   F  Q+P F   PWP P + VQWSS VPPP    PGF MPFYP   Y 
Sbjct  304   NRPKEQVMQNCQSFPSQVPYFPGTPWPIPWNPVQWSSPVPPPAFCPPGFTMPFYPATAYW  363

Query  1295  GYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD-----NNKEGEPQPPKDSNP  1456
             G  +P +WN PW+++P +P   T +SGPNSPTLGKHSR+D     N   GE    K++N 
Sbjct  364   GCAMPGTWNIPWLAQPSSPNGATPNSGPNSPTLGKHSREDYTFKPNESGGEDGHSKENNK  423

Query  1457  EKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNC  1633
             EK LWVPKTLR DD  +AAKSSIWATLGI++D+ DS+ GG  FKAF  K D+ +H+ ++ 
Sbjct  424   EKSLWVPKTLRIDDSGEAAKSSIWATLGIKNDKADSVPGGTLFKAFPSKHDDKNHSMQSS  483

Query  1634  RVLLEANPAALSRSLNFHESS  1696
             RVLL ANPAALSRSLNFHE+S
Sbjct  484   RVLL-ANPAALSRSLNFHETS  503



>ref|XP_006338444.1| PREDICTED: cyclic dof factor 2-like [Solanum tuberosum]
Length=469

 Score =   380 bits (976),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 296/495 (60%), Gaps = 45/495 (9%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ PD P           P    +  NS +          GE EQ+ K 
Sbjct  8     KDPAIKLFGWTIQLPDFPA----------PAPEDTGDNSFSA---------GEVEQELKR  48

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTEISTTDEEEGKM  604
             +  + +D      G   +  E + DQ   + R D +K      +  + + S ++EE  + 
Sbjct  49    QCDDCID------GNEHLTTEDLQDQNPIQQRCDIIKESPDYYESSTAKTSKSEEEHSET  102

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             SN +++ LKKPDK LPCPRC+SM+TKFCYFNNYN +QPRHFCK CQRYWT+GG  RN+PV
Sbjct  103   SNSQERNLKKPDKTLPCPRCNSMETKFCYFNNYNASQPRHFCKNCQRYWTAGGTMRNVPV  162

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL-----ASDSVAS  946
             GAGRRK KNS  HY H++  ++  NA  +         LK NG +LT       S+S+ S
Sbjct  163   GAGRRKHKNSVLHYSHISVSEALSNARTNFSNETHQPPLKFNGTILTFDTENPLSESMVS  222

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP  1126
              LN+A+KT  N S NGF K  EL IQ       +  D  S  SSVTA S+KD+   NGLP
Sbjct  223   VLNVADKTMQNCSGNGFQKYKELRIQAG-----DNGDDHSDGSSVTAVSSKDN--DNGLP  275

Query  1127  DMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTI  1306
             D  ++NY+ F   LPCF   PWPY  S+V   +AVPPPG   PG PMPF+P   Y G TI
Sbjct  276   DTPRKNYNSFPTHLPCFTEAPWPYIWSSVHCRNAVPPPGYSLPGIPMPFFPATTYWGCTI  335

Query  1307  PCSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDDN--NKEG-EPQPPKDSNPEKCLW  1471
             P SWN PW+  P A  +    +  P+SPT GKHSRD+N    EG E +  K+S+P + LW
Sbjct  336   PGSWNVPWMFPPTASHNQMPLTPAPDSPTSGKHSRDENVLKSEGTEEEQRKESDPGRRLW  395

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
              PKTLR DDP +AAKS IWA LGI+H+ VDS+ GG   AF  K+DE S  S+N   LL+ 
Sbjct  396   FPKTLRIDDPGEAAKSPIWAILGIKHEVVDSVGGGLLNAFLPKNDERSCVSEN-STLLQV  454

Query  1652  NPAALSRSLNFHESS  1696
             NPAA+SRSLNF+ESS
Sbjct  455   NPAAMSRSLNFNESS  469



>ref|XP_003551736.1| PREDICTED: cyclic dof factor 2-like [Glycine max]
 gb|KHN13609.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=501

 Score =   381 bits (978),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 245/505 (49%), Positives = 313/505 (62%), Gaps = 28/505 (6%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD-----AppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED  409
              KDP IKLFG TI  P+     A  P   +   VD    AS  NS +++S       G+D
Sbjct  4     VKDPAIKLFGKTIPVPEIPRGSAGAPASSSGDVVDDSVDASSTNS-SRESHTKRDALGKD  62

Query  410   EQQQKNENGERMDESKEDEGTVLMEGEGI--MDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
                 K+  GE+  + K+++G      E +  +D       + + A   + +  + + + T
Sbjct  63    --VDKDTLGEKPTDDKKEDGAPTQSSEEVTNLDTASGSCEESV-ALSTEREATTLKTTKT  119

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             +EE+ + SN +DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  120   EEEQSETSNSQDKNLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  179

Query  764   MTRNLPVGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-  934
               RN+PVGAGRRK K+SA+HY    V   + QN   D P    H +LK NG VLT  +D 
Sbjct  180   TMRNVPVGAGRRKNKSSASHYRQITVSEAALQNPRTDLPNGAYHPSLKCNGTVLTFGTDT  239

Query  935   ----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
                 S+AS LN+A+KT  N + NGF+KP EL I V + +G+ G D S+ SS  +  S + 
Sbjct  240   PLCESMASVLNLADKTMPNYTRNGFHKPEELRIPVPHASGEKGDDQSNKSSVTSTTSVEG  299

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
              +  NG  + + QN   F PQ+P F   PWP P + VQWSS VPPP    PGF MPFYP 
Sbjct  300   AIT-NGPKEQVVQNCQSFPPQVPYFPGTPWPIPWNPVQWSSPVPPPAFCPPGFTMPFYPA  358

Query  1283  AMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD-----NNKEGEPQPPK  1444
               Y G  +P +WN PW+ +P +P   T +SGPNSPTLGKHSR+D     N   GE    K
Sbjct  359   TAYWGCAVPGTWNIPWLVQPSSPNGATPNSGPNSPTLGKHSREDSTFKSNESGGEDGHSK  418

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHA  1621
             ++N EK LWVPKTLR DD E AAKSSIWATLGI++D+ DS+ GG  FKAF  K D+ +H 
Sbjct  419   ENNKEKSLWVPKTLRIDDSE-AAKSSIWATLGIKNDKADSVPGGTLFKAFPSKHDDKNH-  476

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
             S     +L+ANPAALSRSLNFHE+S
Sbjct  477   SMQASPVLQANPAALSRSLNFHETS  501



>ref|XP_010258324.1| PREDICTED: cyclic dof factor 2-like [Nelumbo nucifera]
Length=508

 Score =   380 bits (976),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 311/517 (60%), Gaps = 38/517 (7%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M EP KDP IKLFG TI    +         D D   AA+E   L KD   +     +D 
Sbjct  1     MLEP-KDPAIKLFGKTIPL-MSNDEMSAVSTDSDAPTAANE-EKLHKDRPSATTVQEQDN  57

Query  413   QQQKNENGERMDESKEDEG-----TVLMEGEGIMDQTVDEIRD---------GLKAPHVD  550
             + +K    E+ +E K+  G     T   +G G+   +V E+ D           K P VD
Sbjct  58    KSKKAGGQEQDEEEKDQSGGKPAKTEGEDGNGLPPASVKEVTDHDTSLVINENPKTPSVD  117

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + + S T+EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  118   KETATPKASKTEEEQSETSIPQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  177

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q +  D P+ + H     N
Sbjct  178   KNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITTSEALQTSRADAPDGVHHPT--PN  235

Query  908   GKVLTLASD-----SVASELNIAEKTAGN-GSLNGFYKPVELGIQVSYgagdngadhssg  1069
             G VLT  SD     S+AS LN+AEKT  N  + NGF++P E  I VS GA +     S  
Sbjct  236   GTVLTFGSDAPLCESMASVLNLAEKTMRNCTTRNGFHRPEEQRIPVSSGAENGDDRSSGS  295

Query  1070  sssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCF  1249
             S + +  + + +  +  L + + +N HGF PQ+P F   PWPYP ++ QWSSAVPPP   
Sbjct  296   SITASNHTEEGN--RVSLQEPVMRNCHGFPPQIPYFPGTPWPYPWNSAQWSSAVPPPAFC  353

Query  1250  SPGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRDD-----  1411
                FP+ FYP A Y G T+P +WN PW+   P +P         +  LGKHSRD      
Sbjct  354   PSSFPISFYPAATYWGCTVPGTWNIPWISQPPSSPSPGGPGSSPNSPLGKHSRDGKVLKP  413

Query  1412  NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS-IRGGAFKA  1588
             +N E E Q  ++S+ EKCLW+PKTLR DDP +AA+SSIWATLGI++D+ DS   GG  K 
Sbjct  414   SNSEKEDQLKQNSS-EKCLWIPKTLRIDDPSEAARSSIWATLGIKNDKPDSKTAGGLLKV  472

Query  1589  FKMK-DDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             F+ K DDE +H ++  +V L+ANPAALSRSLNF E S
Sbjct  473   FQPKGDDEKNHMAETSQV-LQANPAALSRSLNFQERS  508



>ref|XP_003533537.1| PREDICTED: cyclic dof factor 2-like [Glycine max]
Length=503

 Score =   380 bits (975),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 237/501 (47%), Positives = 308/501 (61%), Gaps = 20/501 (4%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ--  421
             KDP IKLFG TI  P+  P                ++   +  +S  E+    D Q++  
Sbjct  5     KDPAIKLFGKTIPVPEILPGSNGAPASSSGDVVVDDSVDASSTNSSRESHTNTDAQEKDF  64

Query  422   -KNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGSTEISTTDEEE  595
              K+  GE+  + K+++G      E + +  T     +       + +  + + + T+EE+
Sbjct  65    DKDTLGEKPTDDKKEDGAPAQSSEEVANPDTASGTCEESIIQSTEREATTLKTTKTEEEQ  124

Query  596   GKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
             G+ SN +DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN
Sbjct  125   GETSNSQDKNLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRN  184

Query  776   LPVGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----  934
             +PVGAGRRK K+ A+HY    V   + QN   D P    H +LK NG VLT  +D     
Sbjct  185   VPVGAGRRKNKSVASHYRQITVSEAALQNPRTDLPNGAYHPSLKCNGTVLTFGTDTPLCE  244

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S+AS LN+A+KT  N + NGF+KP EL I VS+ +G+ G D S+ SS  +  S  +    
Sbjct  245   SMASVLNLADKTMHNYTRNGFHKPEELRIPVSHASGEKGDDQSNKSSVTSTTSV-EGAST  303

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
             N   + + QN      Q+P F   PWP P + VQWSS VPPP    PGF MPFYP   Y 
Sbjct  304   NRPKEQVMQNCQSSPSQVPYFPGTPWPIPWNPVQWSSPVPPPAFCPPGFTMPFYPATAYW  363

Query  1295  GYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD-----NNKEGEPQPPKDSNP  1456
             G  +P +WN PW+++P +P   T +SGPNSPTLGKHSR+D     N   GE    K++N 
Sbjct  364   GCAMPGTWNIPWLAQPSSPNGATPNSGPNSPTLGKHSREDYTFKPNESGGEDGHSKENNK  423

Query  1457  EKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNC  1633
             EK LWVPKTLR DD  +AAKSSIWATLGI++D+ DS+ GG  FKAF  K D+ +H+ ++ 
Sbjct  424   EKSLWVPKTLRIDDSGEAAKSSIWATLGIKNDKADSVPGGTLFKAFPSKHDDKNHSMQSS  483

Query  1634  RVLLEANPAALSRSLNFHESS  1696
             RVLL ANPAALSRSLNFHE+S
Sbjct  484   RVLL-ANPAALSRSLNFHETS  503



>ref|XP_008443398.1| PREDICTED: cyclic dof factor 2 [Cucumis melo]
Length=514

 Score =   377 bits (968),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 313/523 (60%), Gaps = 44/523 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPD---AppppppTEMDV-DPGGAASEANSLAKDSSCSEAEP  400
             M EP KDP IKLFG TI  P+   A P  P + + +  P    +   +   DSS S   P
Sbjct  1     MSEP-KDPAIKLFGKTIPLPEPSPATPHLPSSSLPIPTPADHTTAVANHDHDSSSSTLSP  59

Query  401   -------GEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDC  559
                    GED +  K+   E+   +K ++     +G+G +  + +E  +   +    E+ 
Sbjct  60    EANIDVDGEDLEVDKDAISEKSGGTKLEDRDGDGDGDGGLSVSTEEFTNSDTSVVKTENS  119

Query  560   -------GSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQP  718
                     +   +T  +E+ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQP
Sbjct  120   KVLSGEESNPSSTTKTDEQNETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQP  179

Query  719   RHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAV-KSFQNACVDHPERIQHHA  895
             RHFCK CQRYWT+GG  RN+PVGAGRRK K+SA+H+    V ++ Q+A  D P  I H  
Sbjct  180   RHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSASHHRQIIVSEALQHARTDVPNGIHHST  239

Query  896   LKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadh  1060
             LK NG VL   SD     S+AS LNIA+KT  N + NGF KP  L I V+Y   +NG + 
Sbjct  240   LKPNGNVLAFGSDAPLCESMASILNIADKTRQNSTRNGFQKPEALKIPVAY---ENGEND  296

Query  1061  ssgsssvtaasTKDDVCKNGLPDMLKQNYHGFA-PQLPCFQAPPWPYPSSAVQWSSAVPP  1237
                  S       ++  K G  D +  N  GF  P +P F   PWPYP ++ QWSS VPP
Sbjct  297   DQSQESAPTPFINNEEGKTGPQDQVIHNCQGFLPPHVPFFPGTPWPYPWNSPQWSSPVPP  356

Query  1238  PGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSR-----PVAPQHHTSSGPNSPTLGKHS  1402
             P  + PG PMPFYP A + G T+P +W  PWVS+     PVA  H     PNSPTLGKHS
Sbjct  357   PTFYPPGIPMPFYPTAPFWGCTVPGAWPIPWVSQPPPLSPVAQNH----APNSPTLGKHS  412

Query  1403  RDDNNKE----GEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             RD+N  +    GE +  KD+  EKCLW+PKTLR DDP +AAKSSIWATLGI++D+ DS+ 
Sbjct  413   RDENVTKQSDFGEHEQQKDNKTEKCLWIPKTLRIDDPGEAAKSSIWATLGIKNDKTDSVS  472

Query  1571  GGAFKAFKMKD-DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              G FKAF+ K  DE +H ++   V L+ NPAALSRS+ FHESS
Sbjct  473   EGLFKAFQSKKIDEKNHKTEASPV-LQVNPAALSRSIKFHESS  514



>ref|XP_004168502.1| PREDICTED: dof zinc finger protein DOF5.2-like [Cucumis sativus]
Length=502

 Score =   375 bits (963),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 313/511 (61%), Gaps = 32/511 (6%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPD---AppppppTEMDVDPGGAASEANSLAKDSSCSEAE-P  400
             M EP KDP IKLFG TI  PD   A P  P +   + P    +   +   DSS S  +  
Sbjct  1     MSEP-KDPAIKLFGKTIPLPDPSPATPHLPSSLPILSPPHHTTPLPNHDHDSSSSTFDVD  59

Query  401   GEDEQQQKNENGERMDESKED--EGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTE  571
              ED +  K+   E+   +K +  +G + +  E   +     +R +  K    DE   ST 
Sbjct  60    AEDLELDKDAVSEKSGGAKLENGDGGLSVSTEEFTNSDTSVVRSENSKVLSGDESNPST-  118

Query  572   ISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYW  751
              +T  +E+ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYW
Sbjct  119   -TTKTDEQNETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYW  177

Query  752   TSGGMTRNLPVGAGRRKTKNSAAHYHLNAV-KSFQNACVDHPERIQHHALKANGKVLTLA  928
             T+GG  RN+PVGAGRRK K+SA+H+    V ++ Q+A  D P  I H  LK N  VL   
Sbjct  178   TAGGTMRNVPVGAGRRKNKSSASHHRQIIVSEALQHARTDVPNGIHHSTLKPNANVLAFG  237

Query  929   SD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaas  1093
             SD     S+AS LNIA++T  N + NGF KP    I V+Y  G+N       + + +  +
Sbjct  238   SDAPLCESMASILNIADQTRQNSTRNGFQKPEAPKIPVAYENGENDDQSPESAPTPSFIN  297

Query  1094  TKDDVCKNGLPDMLKQNYHGFA-PQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
              ++   K G  D +  N  GF  P +P F   PWPYP ++ QWSS VPPP  + PG PMP
Sbjct  298   NEEG--KTGPQDQVIHNCQGFLPPHVPFFPGTPWPYPWNSPQWSSPVPPPTFYPPGIPMP  355

Query  1271  FYPPAMYLGYTIPCSWNAPWVSRPVA----PQHHTSSGPNSPTLGKHSRDDNNKE----G  1426
             FYP A + G T+P +W  PWVS+P +    PQ+H    PNSPTLGKHSRD+N  +    G
Sbjct  356   FYPTAPFWGCTVPGAWPIPWVSQPPSLSPVPQNH---APNSPTLGKHSRDENVTKQSDFG  412

Query  1427  EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD-  1603
             E +  KD+  EKCLW+PKTLR DDP +AAKSSIWATLGI++D+ DS+  G FKAF+ K  
Sbjct  413   EDEQQKDTKTEKCLWIPKTLRIDDPGEAAKSSIWATLGIKNDKTDSVSEGLFKAFQSKKI  472

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             DE +H ++   V L+ NPAALSRS+ FHESS
Sbjct  473   DEKNHKTEASPV-LQVNPAALSRSIKFHESS  502



>ref|XP_004147502.1| PREDICTED: dof zinc finger protein DOF5.2-like [Cucumis sativus]
 gb|KGN59557.1| hypothetical protein Csa_3G825020 [Cucumis sativus]
Length=502

 Score =   374 bits (959),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 241/511 (47%), Positives = 312/511 (61%), Gaps = 32/511 (6%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPD---AppppppTEMDVDPGGAASEANSLAKDSSCSEAE-P  400
             M EP KDP IKLFG TI  PD   A P  P +   + P    +   +   DSS S  +  
Sbjct  1     MSEP-KDPAIKLFGKTIPLPDPSPATPHLPSSLPILSPPHHTTPLPNHDHDSSSSTFDVD  59

Query  401   GEDEQQQKNENGERMDESKED--EGTVLMEGEGIMDQTVDEIR-DGLKAPHVDEDCGSTE  571
              ED +  K+   E+   +K +  +G + +  E   +     +R +  K    DE   ST 
Sbjct  60    AEDLELDKDAVSEKSVGAKLENGDGGLSVSTEEFTNSDTSVVRSENSKVLSGDESNPST-  118

Query  572   ISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYW  751
              +T  +E+ + SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYW
Sbjct  119   -TTKTDEQNETSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYW  177

Query  752   TSGGMTRNLPVGAGRRKTKNSAAHYHLNAV-KSFQNACVDHPERIQHHALKANGKVLTLA  928
             T+GG  RN+PVGAGRRK K+SA+H+    V ++ Q+A  D P  I H  LK N  VL   
Sbjct  178   TAGGTMRNVPVGAGRRKNKSSASHHRQIIVSEALQHARTDVPNGIHHSTLKPNANVLAFG  237

Query  929   SD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaas  1093
             SD     S+AS LNIA++T  N + NGF KP    I V+Y  G+N       + + +  +
Sbjct  238   SDAPLCESMASILNIADQTRQNSTRNGFQKPEAPKIPVAYENGENDDQSPESAPTPSFIN  297

Query  1094  TKDDVCKNGLPDMLKQNYHGFA-PQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
              ++   K G  D +  N  GF  P +P F   PWPYP ++ QWSS VPPP  + PG PMP
Sbjct  298   NEEG--KTGPQDQVIHNCQGFLPPHVPFFPGTPWPYPWNSPQWSSPVPPPTFYPPGIPMP  355

Query  1271  FYPPAMYLGYTIPCSWNAPWVSRPVA----PQHHTSSGPNSPTLGKHSRDDN----NKEG  1426
             FYP A + G T+P +W  PWVS+P +    PQ+H    PNSPTLGKHSRD+N    +  G
Sbjct  356   FYPTAPFWGCTVPGAWPIPWVSQPPSLSPVPQNH---APNSPTLGKHSRDENVTRQSDLG  412

Query  1427  EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD-  1603
             E +  KD+  EKCLW+PKTLR DDP +AAKSSIWATLGI++D+ DS+  G FK F+ K  
Sbjct  413   EDEQQKDTKTEKCLWIPKTLRIDDPGEAAKSSIWATLGIKNDKTDSVSEGLFKVFQSKKI  472

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             DE +H ++   V L+ NPAALSRS+ FHESS
Sbjct  473   DEKNHKTEASPV-LQVNPAALSRSIKFHESS  502



>ref|XP_009360614.1| PREDICTED: cyclic dof factor 1-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score =   374 bits (959),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 232/521 (45%), Positives = 311/521 (60%), Gaps = 40/521 (8%)
 Frame = +2

Query  221   SATVMPEPTKDPTIKLFGMTIQF----PDAppppppTEMDVDPGGAASEANSLAKDSSCS  388
             S   M E  KDP I LFG TI       D+       E D   G  A E  ++ +D + S
Sbjct  12    SVANMSEAAKDPAINLFGKTISVLSSGGDSVGVTRAPEPDPSSGTVAEE--TVDQDHAAS  69

Query  389   -------EAEPGEDEQQQK-NEN----GERMDESKEDEGTVLMEGEGIMD-QTVDEIRDG  529
                    E     D +++K N+N    GE+  +  ++ G   +  E + +      I   
Sbjct  70    SSSNSSPEVNAHRDREEKKVNDNKDTLGEKPIQKTQENGIPTLSSEELANPDAASRIGVN  129

Query  530   LKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNT  709
              ++P V+++  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN 
Sbjct  130   RESP-VEKESATLKTEKTEEEQSETSNSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNV  188

Query  710   NQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQ  886
             NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  D    + 
Sbjct  189   NQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQADGLNGVH  248

Query  887   HHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdng  1051
             H +++ NG VLT   D     SVAS +++A+K   N + N F KP  L    SY      
Sbjct  249   HPSVQPNGTVLTFCRDTPLCESVAS-VHLADKNIQNCTRNEFQKPEGLRTPASY-GAGVT  306

Query  1052  adhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV  1231
              D     S+ T +++KD+ CK G  + +  NY GF PQ+PCF   PWPYP     W+S +
Sbjct  307   GDDHLTGSTATDSNSKDEACKFGSQEQVMHNYQGFPPQIPCFPGAPWPYP-----WNSPI  361

Query  1232  PPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRD  1408
              PP    PG+PM FYP A Y G  +  +W+ PW+     +    +SSGPNSPTLGKHSR+
Sbjct  362   APPAFCPPGYPMSFYPAAAYWGCAVQGAWSIPWLPPPLSSNNSASSSGPNSPTLGKHSRE  421

Query  1409  DN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RG  1573
             +N    N   E  PP++ + E+ LW+PKTLR DDP +AAKSSIWATLGI++D+ DS+  G
Sbjct  422   ENTVKQNSSEEEAPPREKSAERNLWIPKTLRIDDPGEAAKSSIWATLGIKNDKADSVSSG  481

Query  1574  GAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             G FKAF+ K D+ +H S   +V L+ANPAALSRSLNF E+S
Sbjct  482   GLFKAFQSKGDQKNHLSDASQV-LQANPAALSRSLNFQETS  521



>ref|XP_004232217.1| PREDICTED: cyclic dof factor 3-like [Solanum lycopersicum]
Length=462

 Score =   369 bits (947),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 228/494 (46%), Positives = 291/494 (59%), Gaps = 50/494 (10%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TIQ PD             P  A  +++ LA          GE EQ+ K 
Sbjct  8     KDPAIKLFGWTIQLPDF------------PAPAPEDSSFLA----------GEVEQELKG  45

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
                + +D+++       +  E   DQ   + R  +   +   +  + + S + EE G+ S
Sbjct  46    LYDDCIDDNEH------LTTEDSQDQNPIQQRCDIINYY---ESSTAKTSKSKEEHGETS  96

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N  ++ LKKP+K LPCPRC+SM+TKFCYFNNYN +QPRHFCK CQRYWT+GG  RN+PVG
Sbjct  97    NSHERNLKKPEKTLPCPRCNSMETKFCYFNNYNASQPRHFCKNCQRYWTAGGTMRNVPVG  156

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL-----ASDSVASE  949
             AGRRK KNS  HY H++  ++  N   + P   QH  L  NG +L+       S+S+ S 
Sbjct  157   AGRRKHKNSVLHYSHVSVSEALSNVRTNFPTETQHPPLTLNGTILSFDTDKPVSESMVSV  216

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LN+A+K   N S NGF K  EL IQ       +  D  S  SSVTA S+KD    NGLP+
Sbjct  217   LNVADKGMQNCSGNGFQKYKELRIQAG-----DNGDDHSDGSSVTAISSKDS--DNGLPN  269

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
               ++NY+ F   LPCF   PWPY  S+V   +AVPPPG   PG PM F P   Y G TIP
Sbjct  270   TPRKNYNSFPTHLPCFTGAPWPYIWSSVHCRNAVPPPGYSLPGIPMSFIPATTYWGCTIP  329

Query  1310  CSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDDN---NKEGEPQPPKDSNPEKCLWV  1474
              SWN PW+S P A  +    +  PNSPT  KHSRD+N   +   E +  K+S+P K LW 
Sbjct  330   GSWNVPWMSPPTASHNQMPLTPDPNSPTSRKHSRDENVLKSTGTEEEQRKESDPGKRLWF  389

Query  1475  PKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEAN  1654
             PKTLR DDP +AAKS IWATLGI+H+ V+S+ GG    F  K+DE S  S+N   LL+ N
Sbjct  390   PKTLRIDDPGEAAKSPIWATLGIKHEVVNSVGGGLLSDFLPKNDERSCVSEN-STLLQVN  448

Query  1655  PAALSRSLNFHESS  1696
             PAA+SRSLNF+ESS
Sbjct  449   PAAMSRSLNFNESS  462



>ref|XP_009360613.1| PREDICTED: cyclic dof factor 3-like isoform X1 [Pyrus x bretschneideri]
Length=539

 Score =   368 bits (944),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/538 (43%), Positives = 308/538 (57%), Gaps = 56/538 (10%)
 Frame = +2

Query  221   SATVMPEPTKDPTIKLFGMTIQF----PDAppppppTEMDVDPGGAASEANSLAKDSSCS  388
             S   M E  KDP I LFG TI       D+       E D   G  A E  ++ +D + S
Sbjct  12    SVANMSEAAKDPAINLFGKTISVLSSGGDSVGVTRAPEPDPSSGTVAEE--TVDQDHAAS  69

Query  389   EAEPGEDE-QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEI---------------  520
              +     E    ++   ++++++K  E  V     G +    D +               
Sbjct  70    SSSNSSPEVNAHRDREEKKVNDNKAKEAIVSKRKRGFISYVEDTLGEKPIQKTQENGIPT  129

Query  521   -------------RDGL-KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCP  658
                          R G+ +   V+++  + +   T+EE+ + SN +DKTLKKPDKILPCP
Sbjct  130   LSSEELANPDAASRIGVNRESPVEKESATLKTEKTEEEQSETSNSQDKTLKKPDKILPCP  189

Query  659   RCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLN  835
             RC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+ 
Sbjct  190   RCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHIT  249

Query  836   AVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFY  1000
               ++  NA  D    + H +++ NG VLT   D     SVAS +++A+K   N + N F 
Sbjct  250   VSEAMPNAQADGLNGVHHPSVQPNGTVLTFCRDTPLCESVAS-VHLADKNIQNCTRNEFQ  308

Query  1001  KPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQ  1180
             KP  L    SY       D     S+ T +++KD+ CK G  + +  NY GF PQ+PCF 
Sbjct  309   KPEGLRTPASY-GAGVTGDDHLTGSTATDSNSKDEACKFGSQEQVMHNYQGFPPQIPCFP  367

Query  1181  APPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQH  1357
               PWPYP     W+S + PP    PG+PM FYP A Y G  +  +W+ PW+     +   
Sbjct  368   GAPWPYP-----WNSPIAPPAFCPPGYPMSFYPAAAYWGCAVQGAWSIPWLPPPLSSNNS  422

Query  1358  HTSSGPNSPTLGKHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSI  1525
              +SSGPNSPTLGKHSR++N    N   E  PP++ + E+ LW+PKTLR DDP +AAKSSI
Sbjct  423   ASSSGPNSPTLGKHSREENTVKQNSSEEEAPPREKSAERNLWIPKTLRIDDPGEAAKSSI  482

Query  1526  WATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             WATLGI++D+ DS+  GG FKAF+ K D+ +H S   +V L+ANPAALSRSLNF E+S
Sbjct  483   WATLGIKNDKADSVSSGGLFKAFQSKGDQKNHLSDASQV-LQANPAALSRSLNFQETS  539



>ref|XP_004491816.1| PREDICTED: cyclic dof factor 2-like [Cicer arietinum]
Length=493

 Score =   363 bits (932),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 219/511 (43%), Positives = 292/511 (57%), Gaps = 48/511 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG TI  PD     P     +  G    E+     DSS + ++   DEQ+Q 
Sbjct  4     TKDPAIKLFGKTIPVPDILVGTPA----LSSGDVVDESIDQNHDSSINSSK---DEQEQ-  55

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDED----CGSTEISTTDEE  592
                 E + ++  D+ T   + +G+  ++ +E      A    E+      + + S  +EE
Sbjct  56    ----EIVMDTLGDKPTDGKKEDGVPTKSSEEFSTPDAASRTGEESEREAATLKTSKIEEE  111

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             + + SN  DK LKKPDKILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  112   QDETSNSHDKNLKKPDKILPCPRCSSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  171

Query  773   NLPVGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVLTLAS-----  931
             N+PVGAGRRK KNS++HY    V   + QN+  D P R    +LK NG +LT  S     
Sbjct  172   NVPVGAGRRKNKNSSSHYRQITVTESTLQNSRTDFPRRSYQPSLKCNGTLLTFGSETPLC  231

Query  932   DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYg--------agdngadhssgsssvta  1087
             +SVAS L +A++T  N + NGF KP EL I V +         +  +    +        
Sbjct  232   ESVASVLKLADRTVQNYARNGFDKPEELRICVPHATGEKGDDQSNKSSITSTKSMEGGRT  291

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
               +++    NG    L+ +Y  F P        PWP+P + +QWSS VPPP    PGF +
Sbjct  292   NVSQEQAMSNGQSFPLQGHY--FRP------GTPWPFPWNPMQWSSPVPPPSLCQPGFSL  343

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQ-HHTSSGPNSPTLGKHSRDDNNKEGEPQP--  1438
             P YP   Y G T+P +WN PW ++P++P   + +S PNSPTLGKHSR+DN+         
Sbjct  344   PLYPATTYWGCTVPGAWNIPWQAQPLSPNGANLNSSPNSPTLGKHSREDNSIRSSDSSGT  403

Query  1439  ----PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKD  1603
                  K+S+ EKCLW PKTLR DD  +A KSS W TLGI++D  +S+   G F+AF  K 
Sbjct  404   DGDGKKESSEEKCLWFPKTLRIDDSREAEKSSFWTTLGIKNDNTNSVPSRGLFEAFPSKC  463

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             D+ +H S    ++L+ANPAALSRSLNF E+S
Sbjct  464   DDKNH-SVQASLVLQANPAALSRSLNFQETS  493



>ref|XP_006477464.1| PREDICTED: cyclic dof factor 3-like [Citrus sinensis]
 gb|KDO55555.1| hypothetical protein CISIN_1g011752mg [Citrus sinensis]
Length=478

 Score =   358 bits (919),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 227/503 (45%), Positives = 301/503 (60%), Gaps = 40/503 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSC--SEAEPG  403
             M + +KDP I+LFG  I FP D   P   +E    P      +    ++ +   S A   
Sbjct  1     MRQESKDPAIRLFGKKIAFPSDGEVPVIFSEELPSPAAKEECSIEAEEEKAEEDSSAVKA  60

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
              +  QQ +     +DESK  E                E     K P +D++   ++ + +
Sbjct  61    AETTQQDDTTPPNIDESKIPESP--------------EANVNPKTPSIDDETAKSKAAKS  106

Query  584   D--EEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
             +  + +   SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+
Sbjct  107   EKSQNDASNSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKACQRYWTA  166

Query  758   GGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA--  928
             GG  RN+PVGAGRRK KN A+ Y H+   ++ Q A +D P  I H ++K+NG+VL+    
Sbjct  167   GGTMRNVPVGAGRRKNKNCASQYRHITISEALQAARIDAPNGISHPSVKSNGRVLSFGLD  226

Query  929   ---SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                 DS+AS LN+AEK   NG+ NGF+   E  I V    G+NG D SSGSS   +    
Sbjct  227   APICDSMASVLNLAEKKVLNGTRNGFHGFQEQEIPVPCRGGENGDDCSSGSSITVSNPM-  285

Query  1100  DDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYP  1279
             ++V +NG+ + L ++ +GF   +PC    PWPYP     W+++VPPP     GFPM FY 
Sbjct  286   EEVGRNGMQEPLMRSINGFPSPIPCLPGVPWPYP-----WNASVPPPAFCPSGFPMSFY-  339

Query  1280  PAMYLGYTIPCSWNAPWVSRPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNP  1456
             PA +    IP +WN PW+S   +P Q   SSGPNSPTLGKHSRD +  + E    ++ + 
Sbjct  340   PAAFWNCGIPSTWNMPWISPQSSPNQKSPSSGPNSPTLGKHSRDADMIKSENMDKEELSK  399

Query  1457  EK--CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSHASK  1627
             EK  C+ VPKTLR DDP +AAKSSIWATLGI++   +S+ GG  FK  + K DE SH ++
Sbjct  400   EKNRCVLVPKTLRIDDPNEAAKSSIWATLGIKN---ESLAGGRLFKGLQSKSDEKSHMAE  456

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                V L ANPAALSRSLNFHES+
Sbjct  457   TSPV-LRANPAALSRSLNFHEST  478



>ref|XP_006440609.1| hypothetical protein CICLE_v10019949mg [Citrus clementina]
 gb|ESR53849.1| hypothetical protein CICLE_v10019949mg [Citrus clementina]
Length=478

 Score =   358 bits (918),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 227/503 (45%), Positives = 301/503 (60%), Gaps = 40/503 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSC--SEAEPG  403
             M + +KDP I+LFG  I FP D   P   +E    P      +    ++ +   S A   
Sbjct  1     MRQESKDPAIRLFGKKIAFPSDGEVPVIFSEELPSPAAKEECSIEAEEEKTEEDSSAVKA  60

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
              +  QQ +     +DESK  E                E     K P +D++   ++ + +
Sbjct  61    AETTQQDDTTPPNIDESKIPESP--------------EANVNPKTPSIDDETAKSKAAKS  106

Query  584   D--EEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
             +  + +   SN ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+
Sbjct  107   EKSQNDASNSNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKACQRYWTA  166

Query  758   GGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA--  928
             GG  RN+PVGAGRRK KN A+ Y H+   ++ Q A +D P  I H ++K+NG+VL+    
Sbjct  167   GGTMRNVPVGAGRRKNKNCASQYRHITISEALQAARIDAPNGISHPSVKSNGRVLSFGLD  226

Query  929   ---SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                 DS+AS LN+AEK   NG+ NGF+   E  I V    G+NG D SSGSS   +    
Sbjct  227   APICDSMASVLNLAEKKVLNGTQNGFHGFQEQEIPVPCRGGENGDDCSSGSSITVSNPM-  285

Query  1100  DDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYP  1279
             ++V +NG+ + L ++ +GF   +PC    PWPYP     W+++VPPP     GFPM FY 
Sbjct  286   EEVGRNGMQEPLMRSINGFPSPIPCLPGVPWPYP-----WNASVPPPAFCPSGFPMSFY-  339

Query  1280  PAMYLGYTIPCSWNAPWVSRPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNP  1456
             PA +    IP +WN PW+S   +P Q   SSGPNSPTLGKHSRD +  + E    ++ + 
Sbjct  340   PAAFWNCGIPSTWNMPWISPQSSPNQKSPSSGPNSPTLGKHSRDADMIKSENMDKEELSK  399

Query  1457  EK--CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSHASK  1627
             EK  C+ VPKTLR DDP +AAKSSIWATLGI++   +S+ GG  FK  + K DE SH ++
Sbjct  400   EKNRCVLVPKTLRIDDPNEAAKSSIWATLGIKN---ESLAGGRLFKGLQSKSDEKSHMAE  456

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                V L ANPAALSRSLNFHES+
Sbjct  457   TSPV-LRANPAALSRSLNFHEST  478



>ref|XP_003618507.1| Dof zinc finger protein [Medicago truncatula]
 gb|AES74725.1| DOF-type zinc finger DNA-binding family protein [Medicago truncatula]
Length=495

 Score =   355 bits (912),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 225/521 (43%), Positives = 293/521 (56%), Gaps = 68/521 (13%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFP-------DAppppppTEMD-VDPGGAASEANSLAKDSSCSEAEPG  403
             KDP IKLFG TI  P       D+   P  +  D VD G   +  + + ++    + +  
Sbjct  5     KDPAIKLFGKTIPVPEIPTGSGDSIGAPSSSSGDAVDDGINQNHGSFMDEEEREIDEDTM  64

Query  404   EDEQQQ-KNENGERMDESKE-----DEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGS  565
             EDE  + K E  E + +S E     D  + L+E E I   T DE ++ LK   + E+   
Sbjct  65    EDESTKCKKEKDEALTQSSEKITDLDTNSRLVE-ESINPSTEDE-QNTLKTSKIMEE---  119

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
                           N  DKTLKKPDKILPCPRC SMDTKFCY+NNYN NQPRHFCKKCQR
Sbjct  120   -----------HTENSHDKTLKKPDKILPCPRCYSMDTKFCYYNNYNVNQPRHFCKKCQR  168

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVL  919
             YWT+GG  RN+PVGAGRRK KNSA+H+    V   + QN+  D P  + H +L  NG V 
Sbjct  169   YWTAGGAMRNVPVGAGRRKNKNSASHFRQITVPETAVQNSLSDSPNGVHHPSLNCNGTVF  228

Query  920   TLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvt  1084
             T  +D     S+ S LN+A++       NGF +P  L I V Y   +   +HS  SS  +
Sbjct  229   TFRTDTPLCESMESALNLADQGVNISQKNGFIRPEALRIHVPYVGEEKSDEHSIKSSDTS  288

Query  1085  aasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGF  1261
                T+D    + +  ++  N   F PQ+P + + PW  P S  QWSS V PPP  F  GF
Sbjct  289   TTLTEDAAASSSVEQVMP-NCQSFQPQVPYYPSAPWLLPWSPSQWSSQVQPPPAFFPQGF  347

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDD---------  1411
              MP YPP  Y G+++P +WN PW+++P +P   T +SGPNSPTLGKHSR++         
Sbjct  348   AMPLYPPPAYWGFSMPGAWNNPWLAQPSSPNSATVNSGPNSPTLGKHSREESMLKPTDST  407

Query  1412  -----NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG  1576
                  NNKE           EK LWVPKTLR DD  +A KSSI  TLGI++D+ D+IRGG
Sbjct  408   GSDEGNNKE-----------EKSLWVPKTLRIDDLGEAEKSSILTTLGIKNDKADAIRGG  456

Query  1577  A-FKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
               FKAF  K +E      +    ++ANPAA+SRS++FHE+S
Sbjct  457   GLFKAFASKSNEKDSVQNS--PAMQANPAAMSRSISFHETS  495



>gb|AEM97871.1| DOF domain class transcription factor [Corylus heterophylla]
Length=471

 Score =   351 bits (900),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 265/400 (66%), Gaps = 25/400 (6%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             K P ++E+  +   + T++E+   +N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN +
Sbjct  85    KTPSIEEEKANANTAKTEKEQSDTTNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVH  144

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH  889
             QPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY  +    + Q A +D      +
Sbjct  145   QPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKNSASHYRQITISDALQVARMDASNGTHY  204

Query  890   HALKANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdnga  1054
               LK+NG+VL+        DS+AS L++A+K   NG+ NGF+   E  I V     +NG 
Sbjct  205   PTLKSNGRVLSFGLDVPICDSMASVLSLADKKVLNGAQNGFHSFEEQRIPVPGKGRENGD  264

Query  1055  dhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP  1234
             D SSGSS++T +++ +   K+  P+   QN +GF PQ+PC    PWPY     QW+SAVP
Sbjct  265   DCSSGSSNITVSNSMEG-GKHCPPEPFAQNINGFPPQIPCLPGVPWPY-----QWNSAVP  318

Query  1235  PPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS-RPVAPQHHTSSGPNSPTLGKHSRDD  1411
             PP    PGFPMPFYP A Y    +P +WN PW+S +P   Q   SS P+SPTLGKH RD 
Sbjct  319   PPALCPPGFPMPFYPTA-YWNCGVPGTWNVPWLSPQPSPNQKSPSSAPHSPTLGKHPRDG  377

Query  1412  -----NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG  1576
                  +N E E +PPK  N   C+ VPKTLR DDP +AAKSSIWATLGI+++ +    GG
Sbjct  378   DMLKPDNLERE-EPPKQKN--GCILVPKTLRIDDPSEAAKSSIWATLGIKNESI--CGGG  432

Query  1577  AFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              FKAF+ K DE    ++   VLL ANPAALSRSLNFHE+S
Sbjct  433   MFKAFQSKGDEKHRIAETSAVLL-ANPAALSRSLNFHENS  471



>ref|XP_004297294.1| PREDICTED: cyclic dof factor 2-like [Fragaria vesca subsp. vesca]
Length=525

 Score =   352 bits (903),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 239/527 (45%), Positives = 301/527 (57%), Gaps = 41/527 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDP-----------------GGAASEAN  361
             M E    PTIKLFG TI    AP        + DP                  G   E +
Sbjct  1     MSEKEISPTIKLFGQTIPLASAPLSGHEIPTNDDPPCGASASAADSKIAAAAAGVVEEED  60

Query  362   SLAKDSSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKA  538
             S  K  SCSE    E+ + ++  +G+ +    E+E       E +   T    I +  K 
Sbjct  61    SSVKLPSCSETTSPEEPENKETISGKELAADTEEENPSDQFTEDLKPPTTSSGICENPKT  120

Query  539   PHVDEDCG-STEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQ  715
             P  D +   S + S   E+  + S+ +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQ
Sbjct  121   PSADRETSVSLKSSKNGEQSDETSSSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQ  180

Query  716   PRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKN---SAAHY-HLNAVKSFQNACVDHPERI  883
             PRHFCK CQRYWT+GG+ RN+PVGAGRRK KN   SA+HY H+    + Q A        
Sbjct  181   PRHFCKNCQRYWTAGGIMRNVPVGAGRRKNKNASSSASHYRHMLMSDALQTAHSSAAAAA  240

Query  884   QHH----ALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYg  1036
              +      L  NG VLT  SD     S+AS L++AEKT  N + NGF+ P +  I V   
Sbjct  241   SNGAHNPTLGRNGTVLTFGSDSPLCESMASVLSLAEKTK-NSAQNGFHVPDQQRILVPSI  299

Query  1037  agdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGF-APQLPCFQAPPWPYPSSAV  1213
             AGDNG D SSGSS+VTA+ + + VCK+G  +    N  GF + Q+PCF   PWPY  ++ 
Sbjct  300   AGDNGDDQSSGSSNVTASYSSERVCKSGKQEPAVHNCQGFPSHQVPCFPGAPWPYAWNSP  359

Query  1214  QWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHH--TSSGPNSPT  1387
             QW+SA+PPP  F  GFP+ FYP   Y G T P SWN P  S P +   H  TSSGPNSPT
Sbjct  360   QWTSAMPPPAFFHSGFPISFYPAPPYWGCTGPGSWNVPCNSPPSSTISHCGTSSGPNSPT  419

Query  1388  LGKHSRDDN---NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             LGKH RD +       + +     N   C+ +PKTLR DDP +AAKSSIW TLGI++++ 
Sbjct  420   LGKHPRDGDILHQASSQKEESSRQNKSGCVLIPKTLRIDDPSEAAKSSIWETLGIKNEKG  479

Query  1559  DSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             +SI  GG FK+F+ K DE     +   V L+ANPAA SRSLNFHE S
Sbjct  480   NSINEGGIFKSFQSKADERRQVVEQSSV-LQANPAAFSRSLNFHERS  525



>ref|XP_002281994.1| PREDICTED: cyclic dof factor 3 [Vitis vinifera]
Length=473

 Score =   350 bits (898),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/501 (46%), Positives = 302/501 (60%), Gaps = 41/501 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M EP KDP  KLFG TI    A    P +  DV   GAA     +A+       E G +E
Sbjct  1     MQEP-KDPAFKLFGKTIPML-ADGDAPVSSGDVGDSGAA-----VAR-------EDGLEE  46

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
             + +K+  G +  E+K ++G+     E    +TV E  +  K P + E+  + + S  ++ 
Sbjct  47    ETEKDALGGKPAETKGEDGSE----ESRNSETVAESNENPKTPSIAEENVTLKTSKAEKG  102

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             +    + ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  103   QSDSPDSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTMR  162

Query  773   NLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----D  934
             N+PVGAGRRK KNSA+HY H+   ++ Q   ++    +    LK+NG VLT  S     D
Sbjct  163   NVPVGAGRRKNKNSASHYRHITISEALQTVRIEATNGVHQPTLKSNGTVLTFGSDAPFCD  222

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S+ S LN+ EK   NG+ NGF+   E GI VS+   +NG DHSS SS   + S+++   K
Sbjct  223   SMTSVLNLEEKKMPNGARNGFHTHEEQGIPVSFRVQENGDDHSSASSITVSNSSEEG-SK  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
              GL +  K+N HG   ++PC    PWPYP     W+SAVPPP C        +  PA Y 
Sbjct  282   YGLHEA-KRNSHGVPSRIPCIPGIPWPYP-----WNSAVPPPFCPPGFPMPFY--PAAYW  333

Query  1295  GYTIPCSWNAPWVSRP--VAPQHHTSSGPNSPTLGKHSRDDN----NKEGEPQPPKDSNP  1456
                +   WN PW+S P   A Q   +S  NSPTLGKHSR+ +    +   + + PK  + 
Sbjct  334   NCHVTAPWNIPWLSPPSSSANQKTPNSRQNSPTLGKHSREGDILKPSIVEDEETPKQRSS  393

Query  1457  EKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNC  1633
             E+CLWVPKTLR DDP +AAKSSIW TLGI++D+VDS+ GG  F AF +K D+ +HA  + 
Sbjct  394   ERCLWVPKTLRIDDPAEAAKSSIWTTLGIKNDKVDSVSGGGLFNAFHLKGDDKNHAI-DT  452

Query  1634  RVLLEANPAALSRSLNFHESS  1696
               +L ANPAALSRSLNF ESS
Sbjct  453   SAVLRANPAALSRSLNFQESS  473



>emb|CAN79859.1| hypothetical protein VITISV_035904 [Vitis vinifera]
Length=473

 Score =   350 bits (897),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 230/501 (46%), Positives = 301/501 (60%), Gaps = 41/501 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M EP KDP  KLFG TI    A    P +  DV   GAA     +A+       E G +E
Sbjct  1     MQEP-KDPAFKLFGKTIPML-ADGDAPVSSGDVGDSGAA-----VAR-------EDGLEE  46

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
             + +K+  G +  E+K ++G+     E    +TV E  +  K P + E+  + + S  ++ 
Sbjct  47    ETEKDALGGKPAETKGEDGSE----ESRNSETVAESNENPKTPSIAEENVTLKTSKAEKG  102

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             +    + ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  103   QSDSPDSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGTMR  162

Query  773   NLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----D  934
             N+PVGAGRRK KNSA+HY H+   ++ Q   ++    +    LK+NG VLT  S     D
Sbjct  163   NVPVGAGRRKNKNSASHYRHITISEALQTVQIEATNGVHQPTLKSNGTVLTFGSDAPFCD  222

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S+ S LN+ EK   NG+ NGF+   E GI VS+   +NG DHSS SS   + S+++   K
Sbjct  223   SMTSVLNLEEKKMPNGARNGFHTHKEQGIPVSFRVQENGDDHSSASSITVSNSSEEG-SK  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
              GL +  K+N HG   ++PC    PWPYP     W+SAVPPP C        +  PA Y 
Sbjct  282   YGLHEA-KRNSHGVPSRIPCIPGIPWPYP-----WNSAVPPPFCPPGFPMPFY--PAAYW  333

Query  1295  GYTIPCSWNAPWVSRP--VAPQHHTSSGPNSPTLGKHSRDDN----NKEGEPQPPKDSNP  1456
                +   WN PW+S P   A Q   +S  NSPTLGKHSR+ +    +   + + PK  + 
Sbjct  334   NCHVTAPWNIPWLSPPSSSANQKTPNSRQNSPTLGKHSREGDILKPSIVEDEETPKQRSS  393

Query  1457  EKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNC  1633
             E+CLWVPKTLR DDP +AAKSSIW TLGI +D+VDS+ GG  F AF +K D+ +HA  + 
Sbjct  394   ERCLWVPKTLRIDDPAEAAKSSIWTTLGIXNDKVDSVSGGGLFNAFHLKGDDKNHA-MDT  452

Query  1634  RVLLEANPAALSRSLNFHESS  1696
               +L ANPAALSRSLNF ESS
Sbjct  453   SAVLRANPAALSRSLNFQESS  473



>ref|XP_008361785.1| PREDICTED: cyclic dof factor 2-like [Malus domestica]
Length=524

 Score =   351 bits (900),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 303/522 (58%), Gaps = 56/522 (11%)
 Frame = +2

Query  257   TIKLFGMTIQFPDAppppppTEMDVDPGG---------AASEANSLAKDSSCSEAE----  397
             TIKLFG TI    AP     +    +P G         A       A+D  CSE      
Sbjct  13    TIKLFGKTIPLAMAPLNRESSSAIDEPCGSVDHDVAATACGGGGGGAED--CSETRQKLS  70

Query  398   --------PGEDE-------QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDG  529
                      GED        QQ++ ++G+ +   K+D  T  +  E +   T    I + 
Sbjct  71    SSSSAATNSGEDNLEREGDAQQEETKSGKELAADKQDADTSDLITEDLKAPTTSSGISEN  130

Query  530   LKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNT  709
              K P  D      E S  + ++ + S+ +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN 
Sbjct  131   PKTPSADR-----ETSCKNGDQSETSSSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNV  185

Query  710   NQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH--YHLNAVKSFQNACVDHPERI  883
             NQPRHFCK CQRYWT+GG+ RN+PVGAGRRK KNS+A   +H+    +FQ A       +
Sbjct  186   NQPRHFCKNCQRYWTAGGIMRNVPVGAGRRKNKNSSASQFHHVLMSDAFQAAHASAANGV  245

Query  884   QHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdn  1048
              +  L +NG VL   SD     S+AS LN+AEK   N   NGF  P E  + VS  AGDN
Sbjct  246   HNATLGSNGTVLNFGSDSPLCESMASVLNLAEKNQ-NCMQNGFRGP-EQRLLVSPTAGDN  303

Query  1049  gadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSA  1228
             G D SSGSS   + ST+    K  L +   Q    F PQ+PCF   PWPYP ++ QW+SA
Sbjct  304   GDDRSSGSSITASNSTERGG-KANLQEPSAQKCQSFPPQVPCFPGSPWPYPCNSAQWASA  362

Query  1229  VPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQH-HTSSGPNSPTLGKHSR  1405
             +PPPG    GFPM FYP   Y G T+P SWN P +S      H  TSSGPNSPTLGKHSR
Sbjct  363   MPPPGFCHSGFPMAFYPAPPYWGCTVPGSWNVPCLSPSSTLSHCTTSSGPNSPTLGKHSR  422

Query  1406  DDN-----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             D++     + E E +P KD++ E+C+W+PKTLR DD  +AA+SS WATLGI+++R +   
Sbjct  423   DEDIPNPSSSENE-EPAKDNSSERCVWIPKTLRIDDSNEAARSSAWATLGIRNERGNCAN  481

Query  1571  --GGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
               GG FKAF+ K DE + A +  R  L++NPAA SRSLNFHE
Sbjct  482   EGGGHFKAFQSKGDEKTPAVEASRA-LQSNPAAFSRSLNFHE  522



>ref|XP_008339890.1| PREDICTED: cyclic dof factor 2-like [Malus domestica]
Length=524

 Score =   349 bits (896),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 302/522 (58%), Gaps = 56/522 (11%)
 Frame = +2

Query  257   TIKLFGMTIQFPDAppppppTEMDVDPGG---------AASEANSLAKDSSCSEAE----  397
             TIKLFG TI    AP     +    +P G         A       A+D  CSE      
Sbjct  13    TIKLFGKTIPLAMAPLNRESSSAIDEPCGSVDHDVAATACGGGGGGAED--CSETRQKLS  70

Query  398   --------PGEDE-------QQQKNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDG  529
                      GED        QQ++ ++G+ +   K+D  T  +  E +    T   I + 
Sbjct  71    SSSSAATNSGEDNLEREGDAQQEETKSGKELAADKQDADTSDLITEDLKAPXTSSGISEN  130

Query  530   LKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNT  709
              K P  D      E S  + ++ + S+ +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN 
Sbjct  131   PKTPSADR-----ETSCKNGDQSETSSSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNV  185

Query  710   NQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH--YHLNAVKSFQNACVDHPERI  883
             NQPRHFCK CQRYWT+GG+ RN+PVGAGRRK KNS+A   +H+    +FQ A       +
Sbjct  186   NQPRHFCKNCQRYWTAGGIMRNVPVGAGRRKNKNSSASQFHHVLMSDAFQAAHASAANGV  245

Query  884   QHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdn  1048
              +  L +NG VL   SD     S+AS LN+AEK   N   NGF  P E  + VS  AGDN
Sbjct  246   HNATLGSNGTVLNFGSDSPLCESMASVLNLAEKNQ-NCMQNGFRGP-EQRLLVSPTAGDN  303

Query  1049  gadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSA  1228
             G D SSGSS   + ST+    K  L +   Q    F PQ+PCF   PWPYP ++ QW+SA
Sbjct  304   GDDRSSGSSITASNSTERGG-KANLQEPSAQKCQSFPPQVPCFPGSPWPYPCNSAQWASA  362

Query  1229  VPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQH-HTSSGPNSPTLGKHSR  1405
             +PPPG    GFPM FYP   Y G T+P SWN P +S      H  TSSGPNSPTLGKHSR
Sbjct  363   MPPPGFCHSGFPMAFYPAPPYWGCTVPGSWNVPCLSPSSTLSHCTTSSGPNSPTLGKHSR  422

Query  1406  DDN-----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             D++     + E E +P KD++ E+C+W+PKTLR DD  +AA+SS WATLGI+++R +   
Sbjct  423   DEDIPNPSSSENE-EPAKDNSSERCVWIPKTLRIDDSNEAARSSAWATLGIRNERGNCAN  481

Query  1571  --GGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
               GG FKAF+ K DE   A +  R  L++NPAA SRSLNFHE
Sbjct  482   EGGGHFKAFQSKGDEKXPAVEASRA-LQSNPAAFSRSLNFHE  522



>emb|CDP12294.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   347 bits (889),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 224/510 (44%), Positives = 294/510 (58%), Gaps = 43/510 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG  I   +           V   G  S + S  ++S  S+++   D ++ ++
Sbjct  8     KDPEIKLFGKKIALLENGKRILVV---VPAAGEDSSSVSGGENSVGSDSDLSMDSRKAED  64

Query  428   ENGERMDESKEDE----GTVLMEGEGIMDQTVDEI---------RDGLKAPHVDEDCGST  568
             E  +   E+  D+    G +      + D   +E+                  DED    
Sbjct  65    EKDQEKRETASDKDCPSGKLCSSEPRVKDPIAEELPILKSSSDSDGNSNNYSTDEDSPVK  124

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             +    + ++   ++ + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  125   QPPKAENDQSDATDSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRY  184

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT+GG  RN+PVGAGRRK KNSA+H  H+   ++ Q A +D P    H   K NG VL+ 
Sbjct  185   WTAGGTMRNVPVGAGRRKNKNSASHCRHITISEALQAARIDTPNGFHHLNFKPNGTVLSF  244

Query  926   AS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
              S     DS+AS LN+AEK + NGS NGFYK ++ GI VS    +NG D SSGSS  T+ 
Sbjct  245   GSDSPLCDSMASVLNLAEKKSPNGSQNGFYK-LDHGISVSLKGTENGDDCSSGSSVTTSN  303

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
             ST D   KNGL + + Q  +GF   + C    PW +P     WSS VP P    PGFPMP
Sbjct  304   STVDGA-KNGLQEPVMQQINGFPSPVSCLPGVPWAFP-----WSSTVPLPAICPPGFPMP  357

Query  1271  FYPPAMYLGYTIPCSWNAPWVSRPVAP---QHHTSSGPNSPTLGKHSRD-----DNNKEG  1426
             FYP   +    +P +W+ PW+  PV P   Q ++ SGPNSPTLGKHSR+      NN EG
Sbjct  358   FYPTPFW-NCGVPGAWSIPWLP-PVFPTGNQKNSGSGPNSPTLGKHSRNGELIKQNNPEG  415

Query  1427  EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDD  1606
             +    + ++ E  + +PKTLR DDP++AAKSSIW TLGI +D +   RGG FKA + K D
Sbjct  416   KDSQEQRAS-EGSILIPKTLRIDDPDEAAKSSIWTTLGINYDSIS--RGGLFKALQPKGD  472

Query  1607  ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             E  H +    V L+ANPAALSRS+ F ES+
Sbjct  473   EKKHLTTASPV-LQANPAALSRSVTFQESA  501



>ref|XP_008221604.1| PREDICTED: cyclic dof factor 1-like [Prunus mume]
Length=515

 Score =   346 bits (888),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 224/523 (43%), Positives = 303/523 (58%), Gaps = 47/523 (9%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFP------DAppppppTEMDVDPGGAASEANSLAKDSSCSEA  394
             M   ++ PTIKLFG TI         +A      +    D   AA+      +D  CS+ 
Sbjct  1     MSSESEGPTIKLFGKTIPLALAPLNHEASSAIDESCGTFDSDIAATACGGGVED--CSDD  58

Query  395   EPGEDEQQQKNE---NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAP--------  541
             +         N    N  R+D+    E  +  E +G  D T D+I + LKAP        
Sbjct  59    KQKLSSSATTNSLEGNSTRVDKETISEKELTAEKQG--DDTSDQITEDLKAPTTSSGISE  116

Query  542   -----HVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYN  706
                   VD +  S + S+ + ++ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN
Sbjct  117   NPKTPSVDRETSSLK-SSNNGDQSEASCSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYN  175

Query  707   TNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAA--HYHLNAVKSFQNACVDHPER  880
              NQPRHFCK CQRYWT+GG+ RN+PVGAGRRK KNS+A  + H+    + Q A       
Sbjct  176   VNQPRHFCKNCQRYWTAGGIMRNVPVGAGRRKNKNSSASQYRHMLMSDALQTARASAANG  235

Query  881   IQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagd  1045
               +  L +NG VLT  SD     S+AS LN+AE+ A N + +GF++P +  +  S    +
Sbjct  236   AHNTTLGSNGTVLTFGSDSPLCESMASVLNLAEQ-AQNCTQSGFHRPEQRIVVSSIPGDN  294

Query  1046  ngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS  1225
               A  S  S + + +S +    K GL +   ++   F PQ+PCF   PWPYP ++ QW S
Sbjct  295   RDAHSSGSSITASNSSERGG--KVGLQEPAIKSCQSFPPQVPCFPGSPWPYPWNSAQWPS  352

Query  1226  AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHH--TSSGPNSPTLGKH  1399
              +PPP     GFP+ FYP     G T+P SWN P +S P +   H  TSSGPNSPTLGKH
Sbjct  353   GMPPPPFCHSGFPISFYPAPPCWGCTVPDSWNLPSLSSPSSTLSHCATSSGPNSPTLGKH  412

Query  1400  SRDDN-----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             SRD +     + + E    K++  ++C+W+PKTLR DDP +AAKSSIWATLGI++++ + 
Sbjct  413   SRDGDILNAASSQNEDH-AKNNTSDRCVWIPKTLRIDDPSEAAKSSIWATLGIKNEKGNC  471

Query  1565  I-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
                GG F+AF+ K DE +HA +   V L+ANPAALSRSLNFHE
Sbjct  472   TNEGGLFRAFQSKGDEKNHAVEASPV-LQANPAALSRSLNFHE  513



>ref|XP_008341584.1| PREDICTED: cyclic dof factor 2-like isoform X2 [Malus domestica]
Length=507

 Score =   346 bits (887),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 228/517 (44%), Positives = 304/517 (59%), Gaps = 39/517 (8%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQF----PDAppppppTEMDVDPGGAASEANSLAKDSSCS----  388
             M E  KDP I LFG TI       D+       E D   G  A E  ++ +D + S    
Sbjct  1     MSEAAKDPAINLFGKTISVLSSGSDSVRVTGAPEXDPSSGTVAEE--TVDQDRAASSSSN  58

Query  389   ---EAEPGED-EQQQKNEN----GERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAP  541
                E     D E+++ N+N    GE+  ++K + G   +  E + +      I    ++P
Sbjct  59    SSPEVNAHRDREEKEVNDNKDTLGEKPIQTKRENGIPTLSSEELTNPDAASRIGVNRESP  118

Query  542   HVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPR  721
              ++++  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPR
Sbjct  119   -IEKENATLKTERTEEEQSETSNSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPR  177

Query  722   HFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHAL  898
             HFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++  NA  +    + H ++
Sbjct  178   HFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAVPNAQABVLNGVHHPSV  237

Query  899   KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhs  1063
             + NG VLT   D     S+AS L++A+K   N + NGF KP  L    S   G    D  
Sbjct  238   QPNGTVLTFXRDTPLCESMASVLHMADKNIQNCTRNGFQKPEGLRTPAS-XGGGVIGDDH  296

Query  1064  sgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPG  1243
                S+VT +++KD  CK G  + +  N+ GF PQ+PCF     P       W S   PP 
Sbjct  297   LTGSTVTDSNSKDXACKFGSQEQVMHNFQGFPPQIPCF-----PGAPWPYPWXSPXXPPA  351

Query  1244  CFSPGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTSSGPNSPTLGKHSRDDN--  1414
                PG+PM FYP A Y    +  +WN PW+     +    +SSGPNSPTLGKHSR++N  
Sbjct  352   FCPPGYPMSFYPAAAYWXCAVQGAWNIPWLPPPLSSNNSASSSGPNSPTLGKHSREENTV  411

Query  1415  --NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFK  1585
               N   E  PP++ + E+ LW+PKTLR DDP +AAKSSIWATLGI+HD+ DS+  GG FK
Sbjct  412   KQNSSEEEVPPREKSAERNLWIPKTLRIDDPGEAAKSSIWATLGIKHDKADSVSSGGLFK  471

Query  1586  AFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             AF+ K D+ +H S   +V L ANPAALSRSLNF E+S
Sbjct  472   AFQSKGDQKNHLSDASQV-LHANPAALSRSLNFQETS  507



>ref|XP_009360328.1| PREDICTED: cyclic dof factor 2-like [Pyrus x bretschneideri]
Length=523

 Score =   345 bits (886),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 193/419 (46%), Positives = 254/419 (61%), Gaps = 26/419 (6%)
 Frame = +2

Query  500   DQTVDEIRDGLKAPHVDEDCGST--------EISTTDEEEGKMSNGKDKTLKKPDKILPC  655
             D T D+I + +KAP                 E S+ + ++ +  + +DKTLKKPDKILPC
Sbjct  107   DDTSDQITEDIKAPTASSGISENPKTPSADRETSSKNGDQSETGSSQDKTLKKPDKILPC  166

Query  656   PRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAA--HYH  829
             PRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG+ RN+PVGAGRRK KNS+A  + H
Sbjct  167   PRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGIMRNVPVGAGRRKNKNSSASQYRH  226

Query  830   LNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-----VASELNIAEKTAGNGSLNG  994
             +    + Q A         +  L  NG VLT  SDS     +AS LN+AE+   N   NG
Sbjct  227   IFMSDALQAAHASTANGAHNATLGGNGTVLTFGSDSPLCESMASVLNLAERNQ-NCMQNG  285

Query  995   FYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPC  1174
             F+ P +  +       +     S  S + + ++ +     +  P    QN   F PQ+PC
Sbjct  286   FHGPEQRLLVSPTAGDNGDDRSSGSSITASNSTERGGRASSQEPSA--QNCQTFPPQVPC  343

Query  1175  FQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQ  1354
             F   PWPYP ++ QW+SA+PPPG    GFPM FYP   Y G T+P  WN P +S      
Sbjct  344   FPGSPWPYPWNSAQWASAMPPPGFCHSGFPMSFYPAPPYWGCTVPGPWNVPCLSPSSTLS  403

Query  1355  H-HTSSGPNSPTLGKHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKS  1519
             H  T SGPNSPTLGKHSRD++    +     +P K+++ E+C+W+PKTLR DDP +AA+S
Sbjct  404   HCATRSGPNSPTLGKHSRDEDIPNPSSSQNEEPAKENSSERCVWIPKTLRIDDPNEAARS  463

Query  1520  SIWATLGIQHDRVDSIR--GGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             SIWATLGI++++ +     GG FKAF+ K DE +H  +   V L+ANPAA SRSLNF E
Sbjct  464   SIWATLGIKNEKGNCTNEGGGLFKAFQSKADEKNHVVEASPV-LQANPAAFSRSLNFRE  521



>ref|XP_009339156.1| PREDICTED: cyclic dof factor 3-like [Pyrus x bretschneideri]
Length=463

 Score =   343 bits (880),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 282/493 (57%), Gaps = 42/493 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG  I  P           D               +    +AE  +D   QK
Sbjct  4     TKDPAIKLFGKKISLP---ADIEDLGFDRPVEKEVEVELEEECEEEEEDAETEQDSPSQK  60

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             +      D+  + +       E +    V+      K P +DE+   T+ + T++E+   
Sbjct  61    STESIEQDDGSQPKSEDPTNLETLPGSVVNP-----KTPSIDEESAQTKTAQTEKEQS-T  114

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  115   ENSEEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVPV  174

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSVAS  946
             GAGRRK KNSA+H+ H+   ++ + A +D P  + H ALK+NG+VL+        DS+AS
Sbjct  175   GAGRRKNKNSASHFRHMTISEALEAARIDAPNGVHHPALKSNGRVLSFGVDAPICDSMAS  234

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP  1126
              LN A+K   NG+ NG +K  E   QV         +    SS+ +   +K  V      
Sbjct  235   SLNPADKKVLNGTRNGLHKSEE---QVFPSPCKARDNGDDSSSASSVNVSKPHV------  285

Query  1127  DMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTI  1306
                 QN +GF+ Q+PC    PWPYP     W++AVPPP    PGFP+ F  PA Y    +
Sbjct  286   ----QNVNGFSSQIPCLPGVPWPYP-----WNAAVPPPAFCPPGFPLSFC-PAPYWNCGV  335

Query  1307  PCSWNAPWVS-RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK--CLWVP  1477
             P +WN PW   +P +P     SG NSPTLGKHSRD++  + E    ++ + +K  C+ VP
Sbjct  336   PGAWNVPWFGPQPASPS--PLSGSNSPTLGKHSRDEDILKPEILEKEEPSRQKNGCVLVP  393

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             KTLR DDP +AAKSSIWATLGI++D +    GG FKAF+ K D+    S++    L ANP
Sbjct  394   KTLRIDDPSEAAKSSIWATLGIKNDSISG--GGLFKAFQSKSDKKKTVSESSPA-LRANP  450

Query  1658  AALSRSLNFHESS  1696
             AALSRSLNFHESS
Sbjct  451   AALSRSLNFHESS  463



>ref|XP_002269461.2| PREDICTED: cyclic dof factor 2 [Vitis vinifera]
Length=477

 Score =   342 bits (877),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 220/497 (44%), Positives = 289/497 (58%), Gaps = 42/497 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI  P      P       P    S   S   D+S     P +D   QK 
Sbjct  5     KDPAIKLFGKTISLP----LNPHLSPTSPPPPPLSSTTSFPDDTSQGLQPPSQD---QKP  57

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDC---GSTEISTTDEEEG  598
               G+   E KE++GT          QT +E++D   +P V E+     + + ++ D E+ 
Sbjct  58    LEGQEF-EGKEEDGT--------SRQTSEELKDPTASPGVSENPETPSADKETSKDGEQS  108

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             ++S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  109   EISGSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNV  168

Query  779   PVGAGRRKTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----S  937
             PVGAGRRK KNS+A  + H+   ++ Q A       I H AL  NG VL   SD     S
Sbjct  169   PVGAGRRKNKNSSASQYRHIMVSEALQTARASAANGIHHPALGNNGTVLNFGSDGPLCES  228

Query  938   VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
             VAS LN+A+KT  N   NGF+K  +   ++    G         S ++T ++ K ++   
Sbjct  229   VASVLNLADKTQ-NCMQNGFHKSEQ---RIPASCGGGENGDDHSSITLTNSAEKGNIA--  282

Query  1118  GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
             GL  ++K N+  F+P +PCF    W YP +  QWSS +PPP    PGFP+ FYP   Y G
Sbjct  283   GLEPVVK-NFQAFSPHVPCFPGASWSYPWNPAQWSSKIPPPAFCPPGFPISFYPAPAYWG  341

Query  1298  YTIPCSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRD----DNNKEGEPQPPKDSNPE  1459
              T+P SWN P +    +   H+  ++  NSPTLGKH+RD    +    G+    K++NPE
Sbjct  342   CTVPGSWNIPCIPPTSSSPIHSALATNHNSPTLGKHARDGEVLNPANPGKEDHQKENNPE  401

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRV  1639
             + +W+PKTLR DDP +AAKSSIW TLGI++D   S  G   KAF+ K DE    ++   V
Sbjct  402   RGVWIPKTLRIDDPNEAAKSSIWTTLGIKND--GSNGGSLLKAFQSKGDEKKRIAEMSPV  459

Query  1640  LLEANPAALSRSLNFHE  1690
              L+ANPAALSRSLNFHE
Sbjct  460   -LQANPAALSRSLNFHE  475



>ref|XP_009587736.1| PREDICTED: cyclic dof factor 3 [Nicotiana tomentosiformis]
Length=503

 Score =   342 bits (877),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 223/513 (43%), Positives = 294/513 (57%), Gaps = 44/513 (9%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPG-GAASEANSLAKDS---------SCSEAE  397
             KDP IKLFG  I  P+     P T    DPG G +  A+   KDS          C E E
Sbjct  5     KDPEIKLFGKKIALPENIKMWPLTVSGEDPGEGNSGNASCGVKDSETNIGSDCDGCLEDE  64

Query  398   P----GEDEQQQKNE----NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDE  553
                   +DE+ Q+ E    +GE  +   E++    M  E    + + E  +  K P++DE
Sbjct  65    KVSSEEKDEENQEAEKDHISGELSETKSEEKDQNQMMEESEDPRLLSESDNNPKTPNIDE  124

Query  554   DCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCK  733
             D  + + S T E +   +  + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK
Sbjct  125   DSPALKTSKT-ENDPNDAYSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCK  183

Query  734   KCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALKANG  910
              CQRYWT+GG  RN+PVGAGRRK KNSA H +H+   +  Q A +D P    H   K NG
Sbjct  184   SCQRYWTAGGTMRNVPVGAGRRKNKNSATHCHHITIPEVLQAARIDPPNGFHHPTFKPNG  243

Query  911   KVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgss  1075
              VL+   D     S+AS LN+ EK   NG  NGFY P     + S+       D     S
Sbjct  244   TVLSFGPDSPLCESMASVLNLTEKKVANGIHNGFYGPEN---KNSFRKAGENGDDCCSGS  300

Query  1076  svtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP  1255
             SVT +++  D   +   ++   N +GFAP +PC  + PWPYP     W++AVP P  F P
Sbjct  301   SVTTSTSMIDGGTHRRNELAVPNVNGFAPPVPCIPSVPWPYP-----WNAAVPLPAIFPP  355

Query  1256  GFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG--PNSPTLGKHSRDDN----N  1417
             G+P+PF PP  Y    +   W+ PW++ P   ++   SG  PNSP LGKHSR+ +    N
Sbjct  356   GYPLPFCPPP-YWNCNMLGPWSIPWLTPPSPTENPKGSGSAPNSP-LGKHSREGDLLKSN  413

Query  1418  KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKM  1597
                E +P ++ N E+ + VPKTLR DDP++AAKSSIW+TLGI++D V   RGG FKA + 
Sbjct  414   SPDEKEPSEEKNSERSVLVPKTLRIDDPDEAAKSSIWSTLGIKYDSVS--RGGLFKALQP  471

Query  1598  KDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             K D+  H +     +L+ANPAALSRSL+F E +
Sbjct  472   KSDKKDHTA-TTSPMLQANPAALSRSLSFQERA  503



>ref|XP_008350923.1| PREDICTED: cyclic dof factor 2-like [Malus domestica]
Length=522

 Score =   342 bits (878),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 197/443 (44%), Positives = 264/443 (60%), Gaps = 24/443 (5%)
 Frame = +2

Query  407   DEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKAPHVDEDCGSTEISTT  583
             D Q+++  +G+ +   K+ + T     E I   T    I +  K P  D      E S+ 
Sbjct  87    DAQKEETISGKELAADKQHDDTSDRITEDIKAPTTSSGISENPKTPSADR-----ETSSK  141

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             + +  +  + +DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  142   NGDLSETGSSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  201

Query  764   MTRNLPVGAGRRKTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS  937
             + RN+PVGAGRRK KNS+A  + H+    + Q A         +  L +NG VLT  SDS
Sbjct  202   IMRNVPVGAGRRKNKNSSASQYRHIFMSDALQAAHASTANGAHNATLGSNGTVLTFGSDS  261

Query  938   -----VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
                  +AS LN+AE+   N   NGF+ P +  +       +     S  S + + ++ + 
Sbjct  262   PLCESMASVLNLAERNQ-NCVQNGFHGPEQRLLVSPTAGDNGDDRSSGSSITASNSTERG  320

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
                 +  P    QN   F PQ+PCF   PWPYP ++ QW+SA+PPPG    GFPM FYP 
Sbjct  321   GRASSQEPSA--QNCQTFPPQVPCFPGSPWPYPWNSAQWASAMPPPGFCHSGFPMSFYPA  378

Query  1283  AMYLGYTIPCSWNAPWVSRPVAPQH-HTSSGPNSPTLGKHSRDDN----NKEGEPQPPKD  1447
               Y G T+P  WN P +S      H  T  GPNSPTLGKHSRD++    +     +P K+
Sbjct  379   PPYWGCTVPGPWNVPCLSPSSTLSHCATRPGPNSPTLGKHSRDEDIPNPSSSQNEEPAKE  438

Query  1448  SNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR--GGAFKAFKMKDDENSHA  1621
             ++ E+C+W+PKTLR DDP +AA+SSIWATLGI++++ +     GG FKAF+ K DE +H 
Sbjct  439   NSSERCVWIPKTLRIDDPNEAARSSIWATLGIKNEKGNCTNEGGGLFKAFQSKGDEKNHV  498

Query  1622  SKNCRVLLEANPAALSRSLNFHE  1690
              +   V L+ANPAA SRSLNF E
Sbjct  499   VEASPV-LQANPAAFSRSLNFRE  520



>ref|XP_007209109.1| hypothetical protein PRUPE_ppa005339mg [Prunus persica]
 gb|EMJ10308.1| hypothetical protein PRUPE_ppa005339mg [Prunus persica]
Length=466

 Score =   340 bits (872),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 222/495 (45%), Positives = 286/495 (58%), Gaps = 43/495 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG  I  P        T+ +       SE      +         +   ++ 
Sbjct  4     TKDPAIKLFGKKIPLPADIEDLGFTQPEEKEVDVESEEEDEEDEEEEEAETEQDPPSRKS  63

Query  425   NENGERMDESKEDEGTVLMEGEGIM-DQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              E+ ++ D     E    M   GI+ D  V+ +      P +DE+   +  + T+  E  
Sbjct  64    PESMDQDDGPPNSEDPTNM---GILSDSNVNPM-----PPSMDEESPKSNTAKTENTEA-  114

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  115   -TNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVP  173

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSVA  943
             VGAGRRK KNSA+HY H+   ++ Q A +D P    H ALK++G+VL+        DS+A
Sbjct  174   VGAGRRKNKNSASHYRHITISEALQAAQIDAPNGAHHPALKSSGRVLSFGVDAPICDSMA  233

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+A+K   NG+ NGF+K  E  I       +NG D S  SS+         V K  L
Sbjct  234   SVLNLADKKILNGTQNGFHKSEERVIPTPCKGRENGDDSSRASSAT--------VSKPQL  285

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
                  QN +GF+ Q+PC    PWPYP     W+SAVPPP    PGFP+ F  PA Y    
Sbjct  286   -----QNVNGFSSQIPCLPGVPWPYP-----WNSAVPPPAFCPPGFPLSFC-PAPYWNCG  334

Query  1304  IPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKC--LW  1471
             +P +WN PW   +P +P Q   SSG NSPTLGKHSRD +  + E    ++ + +K   + 
Sbjct  335   VPGTWNVPWFGPQPASPNQKSPSSGSNSPTLGKHSRDGDILKPESLEKEEPSKQKSGRVL  394

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
             VPKTLR DDP +AAKSSIWATLGI++D +    GG FKAF+ K D+  + S+     L A
Sbjct  395   VPKTLRIDDPSEAAKSSIWATLGIKNDSISG--GGLFKAFQSKSDQKKNVSETSPA-LRA  451

Query  1652  NPAALSRSLNFHESS  1696
             NPAALSRSLNF ESS
Sbjct  452   NPAALSRSLNFQESS  466



>ref|XP_008239933.1| PREDICTED: cyclic dof factor 3 [Prunus mume]
Length=466

 Score =   339 bits (869),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 223/495 (45%), Positives = 285/495 (58%), Gaps = 43/495 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG  I  P        T+ +       SE      +         +   ++ 
Sbjct  4     TKDPAIKLFGKKIPLPADIEDLGFTQPEEKEVDVESEEEDEEDEEEEEAETEQDPPSRKS  63

Query  425   NENGERMDESKEDEGTVLMEGEGIM-DQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              E+ ++ D     E    M   GI+ D  V+ +   +     DE+   +  S T+  E  
Sbjct  64    PESRDQDDGPPNTEDPTNM---GILPDSNVNPMPLSM-----DEESPKSNTSKTENTE--  113

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  114   TTNSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVP  173

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSVA  943
             VGAGRRK KNSA+HY H+   ++ Q A +D P    H ALK+NG+VL+        DS+A
Sbjct  174   VGAGRRKNKNSASHYRHITISEALQAAQIDAPNGAHHPALKSNGRVLSFGVDAPICDSMA  233

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+A+K   NG+ NGF+K  E  I       +NG D S  SS+         V K  L
Sbjct  234   SVLNLADKKVLNGTQNGFHKSEERVIPTPCKGRENGDDSSRASSAT--------VSKPQL  285

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
                  QN +GF+ Q+PC    PWPYP     W+SAVPPP    PGFP+ F  PA Y    
Sbjct  286   -----QNVNGFSSQIPCLPGVPWPYP-----WNSAVPPPAFCPPGFPLSFC-PAPYWNCG  334

Query  1304  IPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKC--LW  1471
             +P +WN PW   +P +P Q   SSG NSPTLGKHSRD +  + E    ++ + +K   + 
Sbjct  335   VPGTWNVPWFGPQPASPNQKSPSSGSNSPTLGKHSRDGDILKPESLEKEEPSKQKSGRVL  394

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEA  1651
             VPKTLR DDP +AAKSSIWATLGI++D +    GG FKAF+ K D+ +  S+     L A
Sbjct  395   VPKTLRIDDPSEAAKSSIWATLGIKNDSISG--GGLFKAFQSKSDQKNIVSETSPA-LRA  451

Query  1652  NPAALSRSLNFHESS  1696
             NPAALSRSLNF ESS
Sbjct  452   NPAALSRSLNFQESS  466



>ref|XP_008341583.1| PREDICTED: cyclic dof factor 1-like isoform X1 [Malus domestica]
Length=525

 Score =   340 bits (871),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 228/535 (43%), Positives = 304/535 (57%), Gaps = 57/535 (11%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQF----PDAppppppTEMDVDPGGAASEANSLAKDSSCS----  388
             M E  KDP I LFG TI       D+       E D   G  A E  ++ +D + S    
Sbjct  1     MSEAAKDPAINLFGKTISVLSSGSDSVRVTGAPEXDPSSGTVAEE--TVDQDRAASSSSN  58

Query  389   ---EAEPGED-EQQQKNEN----------------------GERMDESKEDEGTVLMEGE  490
                E     D E+++ N+N                      GE+  ++K + G   +  E
Sbjct  59    SSPEVNAHRDREEKEVNDNKVKEAIVSKRKRGFISYVEDTLGEKPIQTKRENGIPTLSSE  118

Query  491   GIMD-QTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCD  667
              + +      I    ++P ++++  + +   T+EE+ + SN +DKTLKKPDKILPCPRC+
Sbjct  119   ELTNPDAASRIGVNRESP-IEKENATLKTERTEEEQSETSNSQDKTLKKPDKILPCPRCN  177

Query  668   SMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVK  844
             SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   +
Sbjct  178   SMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSE  237

Query  845   SFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPV  1009
             +  NA  +    + H +++ NG VLT   D     S+AS L++A+K   N + NGF KP 
Sbjct  238   AVPNAQABVLNGVHHPSVQPNGTVLTFXRDTPLCESMASVLHMADKNIQNCTRNGFQKPE  297

Query  1010  ELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP  1189
              L    S   G    D     S+VT +++KD  CK G  + +  N+ GF PQ+PCF    
Sbjct  298   GLRTPAS-XGGGVIGDDHLTGSTVTDSNSKDXACKFGSQEQVMHNFQGFPPQIPCF----  352

Query  1190  WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWV-SRPVAPQHHTS  1366
              P       W S   PP    PG+PM FYP A Y    +  +WN PW+     +    +S
Sbjct  353   -PGAPWPYPWXSPXXPPAFCPPGYPMSFYPAAAYWXCAVQGAWNIPWLPPPLSSNNSASS  411

Query  1367  SGPNSPTLGKHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWAT  1534
             SGPNSPTLGKHSR++N    N   E  PP++ + E+ LW+PKTLR DDP +AAKSSIWAT
Sbjct  412   SGPNSPTLGKHSREENTVKQNSSEEEVPPREKSAERNLWIPKTLRIDDPGEAAKSSIWAT  471

Query  1535  LGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             LGI+HD+ DS+  GG FKAF+ K D+ +H S   +V L ANPAALSRSLNF E+S
Sbjct  472   LGIKHDKADSVSSGGLFKAFQSKGDQKNHLSDASQV-LHANPAALSRSLNFQETS  525



>ref|XP_010108679.1| Dof zinc finger protein [Morus notabilis]
 gb|EXC19990.1| Dof zinc finger protein [Morus notabilis]
Length=497

 Score =   338 bits (868),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 210/512 (41%), Positives = 294/512 (57%), Gaps = 50/512 (10%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSE------AEPGED  409
             KD  IKLFG TI            E  +      S+A ++    S S+      + P ++
Sbjct  5     KDSAIKLFGKTIPLLLNQEVSCNDEPSMATSVVDSDAGTVGTGESFSDQKLLRVSSPNKE  64

Query  410   EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRD---------GLKAPHVDEDCG  562
                ++  +G++   S ++      E + + DQ+ ++ +D           K+P V+ +  
Sbjct  65    SSSEEEGDGDKETSSGKENS----EKDNVSDQSAEDTKDPTTSVVISENHKSPLVERETS  120

Query  563   STEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
             S + S+   E+ ++SN ++KTL+KPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQ
Sbjct  121   SLK-SSKSAEQSEISNPQEKTLRKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQ  179

Query  743   RYWTSGGMTRNLPVGAGRRKTKN-SAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKV  916
             RYWT+GG  RN+PVGAGRRK KN SA+HY HL    + + A V+    + +  L +NG V
Sbjct  180   RYWTAGGTMRNVPVGAGRRKNKNSSASHYRHLVISDALEKAQVNAANGVHNPTLGSNGTV  239

Query  917   LTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             LT  +D     S+AS LN+ E+T  N + NGF+ P     +V    G      +    S 
Sbjct  240   LTFGTDSPLCESMASALNLVERTK-NSAPNGFHNPEN---RVIVSIGVGDNADNQSCGSS  295

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
               AST  D  K G P  + ++Y GF  Q+PCF  PPWPYP ++ QW+SA+PPP     GF
Sbjct  296   ITASTSSD--KGGKP--VIKDYQGFPSQVPCFPGPPWPYPWNSAQWTSALPPPAFCHSGF  351

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD-------DNNK  1420
             P+ FYPP  Y G T+P SWN P  S   +  + ++S      LGKH RD        ++K
Sbjct  352   PVSFYPPPPYWGSTVPGSWNVPCFSPASSTTNLSTSA-----LGKHPRDGEILNPTSSHK  406

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKM  1597
             E   +    S+ E+C+ +PKTLR DDP +AA+SSIW TLGI+++ + S+ GG  +KAF+ 
Sbjct  407   ENSDKENSTSS-ERCVLIPKTLRIDDPTEAARSSIWTTLGIKNETLSSVSGGGLYKAFQS  465

Query  1598  KDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             K D  +H  +   V L+ANPAALSRSL F ES
Sbjct  466   KGDRKTHVVETSPV-LQANPAALSRSLTFLES  496



>ref|XP_007223292.1| hypothetical protein PRUPE_ppa005580mg [Prunus persica]
 gb|EMJ24491.1| hypothetical protein PRUPE_ppa005580mg [Prunus persica]
Length=453

 Score =   336 bits (861),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 205/433 (47%), Positives = 275/433 (64%), Gaps = 21/433 (5%)
 Frame = +2

Query  437   ERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGK  616
             E   E +ED+ +  +  +     T   I +  K P VD +  S + S+ + ++ + S  +
Sbjct  25    ELTAEKQEDDTSYQITEDLKTPTTSSGISENPKTPSVDRETSSLK-SSNNGDQSEASCSQ  83

Query  617   DKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGR  796
             +KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG+ RN+PVGAGR
Sbjct  84    EKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGIMRNVPVGAGR  143

Query  797   RKTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELN  955
             RK KNS+A  + H+    + Q A         +  L +NG VLT  SD     S+AS LN
Sbjct  144   RKNKNSSASQYRHMLMSDALQTARASAANGAHNTTLGSNGTVLTFGSDSPLCESMASVLN  203

Query  956   IAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDML  1135
             +AE+ A N + +GF++P E  I VS     +  D  S  SS+TA+++ +   K GL +  
Sbjct  204   LAEQ-AQNCTQSGFHRP-EQRIGVS-SIPGDNRDAHSSGSSITASNSSERGGKVGLQEPA  260

Query  1136  KQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCS  1315
              ++   F PQ+PCF   PWPYP ++ QW S +PPP     GFP+ FYP   Y G T+P S
Sbjct  261   IKSCQSFPPQVPCFPGSPWPYPWNSAQWPSGMPPPPFCHSGFPISFYPAPPYWGCTVPDS  320

Query  1316  WNAPWVSRPVAPQHH--TSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEKCLWV  1474
             WN P +S P +   H  TSSGPNSPTLGKHSRD++     + + E    K++  + C+W+
Sbjct  321   WNLPSLSSPSSTLSHCATSSGPNSPTLGKHSRDEDILNPASSQNEDH-AKNNTSDGCVWI  379

Query  1475  PKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEA  1651
             PKTLR DDP +AAKSSIWATLGI++++ +    GG F+AF+ K DE +H  +   V L+A
Sbjct  380   PKTLRIDDPSEAAKSSIWATLGIKNEKGNCTNEGGLFQAFQSKGDEKNHVVEASPV-LQA  438

Query  1652  NPAALSRSLNFHE  1690
             NPAALSRSLNFHE
Sbjct  439   NPAALSRSLNFHE  451



>ref|XP_004489399.1| PREDICTED: cyclic dof factor 2-like [Cicer arietinum]
Length=496

 Score =   337 bits (863),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 220/507 (43%), Positives = 292/507 (58%), Gaps = 39/507 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKD--------SSCSEAEPG  403
             +DP IKLFG TI   +  P    +      G  AS ++  A D        SS +E + G
Sbjct  5     RDPAIKLFGKTIPVSEISPGSGDST-----GAPASSSSGDAVDDVICQNHVSSNTEMD-G  58

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGSTEIST  580
             E+ +  +    E + E  +++ T+    E I D  T     + +K  + +E+   + + T
Sbjct  59    EEREIDEESKEEEVIECNKEDKTITQSSEKIADLDTSSRGEESIKPSNEEEE---STLKT  115

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
                +E +  N +DKTLKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT+G
Sbjct  116   AKNKEEQSENSQDKTLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKNCQRYWTAG  175

Query  761   GMTRNLPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKANGKVLTLASD  934
             G  RN+PVGAGRRK KN A+HY    +     QN+  D P  + HH++  NG   T  +D
Sbjct  176   GAMRNVPVGAGRRKNKNFASHYRQITIPDVIVQNSQSDSPNGVHHHSVNCNGTAFTFGTD  235

Query  935   -----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                  S+ S LNI +K   +   NGF +P EL I V Y   +   DHS+ SS  +   T+
Sbjct  236   TPLCESMESVLNIVDKAVTSCPTNGFNRPEELRISVPYAGEEKSNDHSNKSSDASTTPTE  295

Query  1100  DDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP-GFPMPFY  1276
             D    + L  ++ QN   FAPQ P + + PW  P S  QWSS V  P  F P G  MP Y
Sbjct  296   DATTNSSLEQVV-QNSQSFAPQFPHYPSAPWVLPWSPSQWSSQVQSPHAFFPQGIAMPLY  354

Query  1277  PPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKE------GEPQP  1438
             PP  Y G+T+P +WN PW+++P +P   T S   SPTLGKHSR++N          + Q 
Sbjct  355   PPPAYWGFTMPGAWNNPWLAQPSSPSSATPS---SPTLGKHSREENTLTSNDAVGSDEQS  411

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENS  1615
              K +N EK LWVPKTLR DD  +A KSSI  TLGI++ + DSI  GG FKAF+ K DE  
Sbjct  412   SKGNNKEKSLWVPKTLRIDDLGEAQKSSILTTLGIKNSKPDSICGGGLFKAFQPKGDEKE  471

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
                 +   +L+ANPAALSRS++FHE+S
Sbjct  472   DTQNS--PVLQANPAALSRSISFHETS  496



>emb|CAN60326.1| hypothetical protein VITISV_028596 [Vitis vinifera]
Length=475

 Score =   333 bits (854),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 264/430 (61%), Gaps = 29/430 (7%)
 Frame = +2

Query  449   ESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDC---GSTEISTTDEEEGKMSNGKD  619
             E +E EG    E +G   QT +E++D   +P V E+     + + ++ D E+ ++S  ++
Sbjct  57    EGQEFEGK---EEDGTSRQTSEELKDPTASPGVSENPETPSADKETSKDGEQSEISGSQE  113

Query  620   KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRR  799
             KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRR
Sbjct  114   KTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRR  173

Query  800   KTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNI  958
             K KNS+A  + H+   ++ Q A       I H AL  NG VL   SD     SVAS LN+
Sbjct  174   KNKNSSASQYRHIMVSEALQTARASAANGIHHPALGNNGTVLNFGSDGPLCESVASVLNL  233

Query  959   AEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLK  1138
             A+KT  N   NGF+K  +   ++    G         S ++T ++ K ++   GL  ++K
Sbjct  234   ADKTQ-NCMQNGFHKSEQ---RIPASCGGGENGDDHSSITLTNSAEKGNIA--GLEPVVK  287

Query  1139  QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSW  1318
              N+  F P +PCF    W YP +  QWSS +PPP    PGFP+ FYP   Y G T+P SW
Sbjct  288   -NFQAFPPHVPCFPGASWSYPWNPAQWSSKIPPPAFCPPGFPISFYPAPAYWGCTVPGSW  346

Query  1319  NAPWVSRPVAPQHHT--SSGPNSPTLGKHSRD----DNNKEGEPQPPKDSNPEKCLWVPK  1480
             N P +    +   H+  ++  NSPTLGKH+RD    +    G+    K++NPE+ +W+PK
Sbjct  347   NIPCIPPTSSSPIHSALATNHNSPTLGKHARDGEVLNPANPGKEDHQKENNPERGVWIPK  406

Query  1481  TLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPA  1660
             TLR DDP +AAKSSIW TLGI++D   S  G   KAF+ K DE    ++   V L+ANPA
Sbjct  407   TLRIDDPNEAAKSSIWTTLGIKND--GSNGGSLLKAFQSKGDEKKRIAEMSPV-LQANPA  463

Query  1661  ALSRSLNFHE  1690
             ALSRSLNFHE
Sbjct  464   ALSRSLNFHE  473



>ref|XP_011017304.1| PREDICTED: cyclic dof factor 2-like [Populus euphratica]
Length=500

 Score =   331 bits (849),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 271/452 (60%), Gaps = 25/452 (6%)
 Frame = +2

Query  386   SEAEPGEDEQQQKNE-NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCG  562
             S  E GE E     E +GE +   K+++ T     +     T   I + LK P  + +  
Sbjct  59    SHEERGEQEGNNNRETSGEEICNDKQEDVTSNQINKDSKGPTSSGISENLKTPSAERETS  118

Query  563   STEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
             S + S+ DEE+ + S  ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCKKCQ
Sbjct  119   SLK-SSKDEEQSETSISQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKKCQ  177

Query  743   RYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKV  916
             RYWT+GG  RN+PVGAGRRK K +SA+HY HL   ++ + A V       + +L  NG V
Sbjct  178   RYWTAGGTMRNVPVGAGRRKNKSSSASHYRHLMVSEALRTAQVHAMNGFHNPSLGNNGTV  237

Query  917   LTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             LT  SD     SVAS LN++EKT  N   NG+ +P E  I VS G      D  S  SS 
Sbjct  238   LTFGSDSPLCESVASVLNLSEKTQ-NSVRNGYRRP-EHRILVSCGGTGGDGDDHSSVSSA  295

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
             TA+++ D  C     + + ++Y  F PQ PCF  PPWPYP     W+SA+ PP     GF
Sbjct  296   TASNSSDKGCNGTSREAVNKDYQSFPPQAPCFPGPPWPYP-----WNSAITPPTFCPSGF  350

Query  1262  PMPFYPPAMYLGYTIPCSWNA-PWVSRPVAPQHH--TSSGPNSPTLGKHSRDDN--NKEG  1426
             P+ F+P   Y G  +P  WN  P  S P A  +H   SS P  P LGKHSRD N  N   
Sbjct  351   PVSFFPAPAYWGCAVPSPWNVPPCASSPSATLNHRTQSSSPTFP-LGKHSRDGNILNPTC  409

Query  1427  EPQPPKD-SNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK  1600
               +P +D +  E  + VPKTLR DDP +AAKSSIWATLGI +++  SI GG  FK F+ K
Sbjct  410   LEEPSRDGTKSETGVLVPKTLRIDDPSEAAKSSIWATLGITNEKSSSINGGGLFKGFQSK  469

Query  1601  DDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             +++ ++ +    V L+ANPAA SRSLNFHE++
Sbjct  470   NEDRNYMAGTTSV-LQANPAAFSRSLNFHENT  500



>ref|XP_010693252.1| PREDICTED: cyclic dof factor 2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   330 bits (847),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 214/504 (42%), Positives = 297/504 (59%), Gaps = 49/504 (10%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNE  430
             DP IKLFG TI               +      ++ +S+  DS+ +E    +D   ++ E
Sbjct  3     DPAIKLFGKTIP--------------LQDNDNDNDDHSIPSDSTNTEDHISKDTVFEERE  48

Query  431   NGERMDESKEDEGTVLMEGEGIMDQTVDE--IRDG-LKAPHVDEDCGST------EISTT  583
             N  ++DE   D  T+  +  G+  +  D+   +D  L  P + E   +       E S +
Sbjct  49    N-HKVDE---DGNTLQTKQNGVSPEVSDKSICQDASLVTPDIPEALSNVDEKEAGESSKS  104

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             +EE+ + S  ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  105   EEEKAETSPSQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  164

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD--  934
               RN+PVGAGRRK KNSA+HY ++   ++ QNA  + P  + H AL  NG VLT +SD  
Sbjct  165   TMRNVPVGAGRRKNKNSASHYRNITIPEALQNARTEIPNGL-HPALPNNGMVLTFSSDSP  223

Query  935   ---SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
                S+AS LN+AEK   N   N F KP +L + + +      A   SG +    +++KDD
Sbjct  224   LCESMASILNLAEKPVRNCPPNAFQKPEDLKVSIPF------AGLESGVNHDDGSNSKDD  277

Query  1106  VCKNGLPDM-LKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
               K+  P+    QN   F  Q+PC+   PWPYP ++ QWS  V  P     GF MPFYP 
Sbjct  278   ASKSAAPNEPAAQNCLPFPAQIPCYPGAPWPYPWNSTQWSPPVAAPPFCPNGFAMPFYPA  337

Query  1283  AMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN---NKEGEPQPPKDSN  1453
               Y G  +P +WN PW+++P  P +   S   +  LGKHSRD N   +   E +  ++++
Sbjct  338   PAYWGCAVPGAWNIPWIAQPSPPSNSNPSSAPTSPLGKHSRDGNMLTSTNSEDKEVEENS  397

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQ-HDRVDSI-RG-GAFKAFKMKDDENSHAS  1624
              E+ LW+PKTLR DDP +AAKSSIW+TLGI+ +++ +SI RG G FKAF+ K + N+   
Sbjct  398   SERSLWIPKTLRIDDPGEAAKSSIWSTLGIKNNEKPESIGRGFGLFKAFQSKREGNTRME  457

Query  1625  KNCRVLLEANPAALSRSLNFHESS  1696
              +   +LEANPAALSRS NF E++
Sbjct  458   TS--PVLEANPAALSRSQNFQENT  479



>ref|XP_011087240.1| PREDICTED: cyclic dof factor 1 [Sesamum indicum]
Length=497

 Score =   331 bits (848),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 222/514 (43%), Positives = 281/514 (55%), Gaps = 50/514 (10%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD------------AppppppTEMDVDPGGAASEANSLAKDSSCS  388
              K+P IKLFG  I  P+                      D D   +        ++ +  
Sbjct  4     VKEPEIKLFGRKIVLPEHGGVPAGGESSGESHGGSGGGADCD-RCSEVSGGEGEEEKADE  62

Query  389   EAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGS  565
             E +P   E+ Q  E  E   + +E+    L E E   +   V E  +  K P +DE   S
Sbjct  63    EKQPQGTEEDQDAETCETKPQGQEEN---LGEAEESHNPDAVVESDENPKTPSIDEGIVS  119

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              E   T+  +   +NG+ KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  120   EEHPKTENGQSDATNGQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQR  179

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNSA+H  H+   ++ Q A +D P    H A K NG VL+
Sbjct  180   YWTAGGTMRNVPVGAGRRKNKNSASHCRHITISEALQAARIDAPNGFHHPAFKPNGTVLS  239

Query  923   LASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
                D     S+AS LN+ +K   NG  NG+Y+P + G            D  S  SSVTA
Sbjct  240   FGPDSTLCESMASALNLVDKRVPNGVKNGYYRP-DHGSGSESCKNRENGDDCSNGSSVTA  298

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             +S+  D  KNG    L  + +GF   +PC     WP+P     W+SAVP P    P +PM
Sbjct  299   SSSVQDGGKNGPQQPLMHSINGFPSPVPCIPGVAWPFP-----WNSAVPLPAMCPPAYPM  353

Query  1268  PFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPP  1441
             PFY PA Y   ++P +WN PW+S   P   Q  T S P+SP LGKHSR+     GE   P
Sbjct  354   PFY-PAPYWNCSLPNAWNVPWLSVPSPTVNQKATGSNPSSP-LGKHSRN-----GELLKP  406

Query  1442  KDS---------NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFK  1594
             K++         NPE  + VPKTLR DDPE+AAKSSIW TLGI++D +   R G FKA +
Sbjct  407   KNTEGKEHLEPKNPESSIVVPKTLRIDDPEEAAKSSIWETLGIKYDTIS--REGLFKALQ  464

Query  1595  MKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              K DE   A     V L+ANPAALSRS+NF E +
Sbjct  465   PKGDEKKQAVSASPV-LQANPAALSRSINFQEGA  497



>ref|XP_003621247.1| Dof zinc finger protein [Medicago truncatula]
 gb|AES77465.1| DOF-type zinc finger DNA-binding family protein [Medicago truncatula]
Length=486

 Score =   330 bits (846),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 226/509 (44%), Positives = 295/509 (58%), Gaps = 51/509 (10%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ-  421
             TKD  IKLFG TI   +          DV       + +  + +SS +E+   +DEQ Q 
Sbjct  4     TKDSAIKLFGKTIPILEVRVG------DVVVESIDDDHHHFSTNSS-NESRNNKDEQDQE  56

Query  422   --KNENGER-MDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDED---------CGS  565
               KN  GE+  DE  ED         GI  Q+ +E  +   A   DE+           +
Sbjct  57    IEKNTLGEKPSDEKNED---------GIPIQSTEEFTNPDAASRTDEESITVSTERKAAT  107

Query  566   TEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              + S T+EE+ + SN +DK LKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  108   LKTSKTEEEQDETSNSQDKILKKPDKIVPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR  167

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVL  919
             YWT+GG  RN+PVGAGRRK K+S++HY    V   + QN+ +       H ++K NG +L
Sbjct  168   YWTAGGTMRNVPVGAGRRKNKSSSSHYRQITVSEATLQNSRI-------HPSVKCNGTIL  220

Query  920   TLAS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvt  1084
             T  S     +S+AS L  A+KT  N + NG++K  EL I V + + + G D S+ SS  +
Sbjct  221   TFGSNSPVCESMASVLKHADKTMQNYTRNGYHKHEELRICVPHTSEEQGEDQSNKSSVTS  280

Query  1085  aasTKDDVCKNGLPDMLKQNYHGFAPQLPCF-QAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
               ST +    N   +    N H F PQ   F    PW  P + VQ SS +PPP    PGF
Sbjct  281   TKST-EGATTNVSQEQAMWNDHSFPPQGGYFPHGTPWHLPWNPVQMSSPIPPPAFCPPGF  339

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQ--HHTSSGPNSPTLGKHSRDDNN-KEGEP  1432
              MPFYP   Y G T+P +WN P  ++P +P   +H S+ PNSPTLGKHSR+DN  K  E 
Sbjct  340   SMPFYPATTYWGCTMPSAWNIPRQAQPSSPNGANHDST-PNSPTLGKHSREDNMLKSSEG  398

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDE  1609
                K+ + EK LW PKTLR DD E+A KSS W TLGI+++  DS+     F+AF  K DE
Sbjct  399   DGKKEISEEKSLWFPKTLRIDDSEEAEKSSFWTTLGIKNNNADSVPPRRLFQAFPSKCDE  458

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
              +H  +   V L+ANPAALSRSL+FHE+S
Sbjct  459   KNHLVQVSSV-LQANPAALSRSLHFHETS  486



>ref|XP_006379668.1| hypothetical protein POPTR_0008s08740g [Populus trichocarpa]
 gb|ERP57465.1| hypothetical protein POPTR_0008s08740g [Populus trichocarpa]
Length=500

 Score =   330 bits (846),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 272/452 (60%), Gaps = 25/452 (6%)
 Frame = +2

Query  386   SEAEPGEDEQQQKNE-NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCG  562
             S  E GE E     E +GE +   K+++ T     +     T   I +  K P  + +  
Sbjct  59    SHKERGEQEGNNNRETSGEEIANDKQEDVTSNQINKDSKGPTSSGISENPKTPSAERETS  118

Query  563   STEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
             S + S+ +EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQ
Sbjct  119   SLK-SSKNEEQSETSISQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQ  177

Query  743   RYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKV  916
             RYWT+GG  RN+PVGAGRRK K +SA+HY HL   ++ + A V       + +L  NG V
Sbjct  178   RYWTAGGTMRNVPVGAGRRKNKSSSASHYRHLMVSEALRTAQVHAMNGFHNPSLGNNGTV  237

Query  917   LTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             LT  SD     SVAS LN++EKT  N   NG+++P E  I VS G      D  S  SS 
Sbjct  238   LTFGSDSPLCESVASVLNLSEKTQ-NSVRNGYHRP-EHRILVSCGGTGGDGDDHSSVSSA  295

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
             TA+++ +  C     + + ++Y  F PQ PCF  PPWPYP     W+SA+ PP     GF
Sbjct  296   TASNSSEKGCNGTSREAVNKDYQSFPPQAPCFPGPPWPYP-----WNSAITPPTFCPSGF  350

Query  1262  PMPFYPPAMYLGYTIPCSWNA-PWVSRPVAPQHHT--SSGPNSPTLGKHSRDDN--NKEG  1426
             P+ F+P   Y G T+P  WN  P  S P A  +H+  SS P  P LGKHSRD N  N   
Sbjct  351   PVSFFPAPAYWGCTVPSPWNVPPCASSPSATLNHSTQSSSPTFP-LGKHSRDGNILNPPC  409

Query  1427  EPQPPKD-SNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK  1600
               +P +D +  E  + VPKTLR DDP +AAKSSIWATLGI +++  SI GG  FK F+ K
Sbjct  410   LEEPSRDGTKSETGVLVPKTLRIDDPSEAAKSSIWATLGITNEKSSSINGGGLFKGFQSK  469

Query  1601  DDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              ++ ++ +    V L+ANPAA SRSLNFHE++
Sbjct  470   SEDRNYMAGTTSV-LQANPAAFSRSLNFHENT  500



>ref|XP_009369285.1| PREDICTED: cyclic dof factor 3-like [Pyrus x bretschneideri]
Length=465

 Score =   328 bits (841),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 215/499 (43%), Positives = 280/499 (56%), Gaps = 52/499 (10%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG  I  P           D+D  G A       +  S  E E  ED + ++
Sbjct  4     TKDPAIKLFGKKIALP----------ADIDDLGFARPVEKEVEVESEEEDEEEEDAETEQ  53

Query  425   NENGERMDESKE-DEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             +    +  ES E D+G+     +    + + +     K P  DE+   ++ + T E+E  
Sbjct  54    DSPSRKSTESIEQDDGSPPKTEDPANLEILPDSNVNPKTPSTDEESAQSKTAQT-EKEPS  112

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
               N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  113   TENSEEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVP  172

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-----VA  943
             VGAGRRK KNSA+HY H    ++ Q A +D P    H  LK+NG+VL+   D+     +A
Sbjct  173   VGAGRRKNKNSASHYRHFTITEALQAARIDAPNGAHHPPLKSNGRVLSFGVDAPICDPMA  232

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+A+K   + + NG +K  E   Q                    +    DD      
Sbjct  233   SVLNLADKNVSSSTRNGLHKGEEQVFQA----------------PCKSRENGDDSSSASS  276

Query  1124  PDMLK---QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
              ++ K   QN +GF+ Q+PC     WPYP     W++AVPPP    PGFP+ F  PA Y 
Sbjct  277   VNVSKAHLQNVNGFSSQIPCLPGVLWPYP-----WNAAVPPPAFCPPGFPLSFC-PAPYW  330

Query  1295  GYTIPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK--  1462
                +P +WN PW   +P +P Q    S  NSPTLGKHSRD++    E    ++ + +K  
Sbjct  331   NCGVPGTWNVPWFGPQPPSPNQKSPHSSSNSPTLGKHSRDEDVVRPENMDKQEPSRQKNG  390

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHASKNCRV  1639
             C+ VPKTLR DDP +AAKSSIWATLGI++   DSI G G FKAF+ K D+     +    
Sbjct  391   CVLVPKTLRIDDPSEAAKSSIWATLGIKN---DSISGKGLFKAFQPKSDQKKIVPETSPA  447

Query  1640  LLEANPAALSRSLNFHESS  1696
              + ANPAALSRSLNFHESS
Sbjct  448   -MRANPAALSRSLNFHESS  465



>gb|ACU80550.1| Dof1 protein [Jatropha curcas]
Length=471

 Score =   327 bits (838),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 214/501 (43%), Positives = 289/501 (58%), Gaps = 57/501 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KD  IKLFG  I            + D DP      A S  +  S    E GE E+ +K
Sbjct  11    SKDSAIKLFGKKIPL----------KSDSDP-----PAISCDELPSWERVEEGEAEKTEK  55

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             + +   + E+ +++ T     E   DQ   E  +  K P + E+   ++IS T++E+   
Sbjct  56    DSSAGNVKETSQEDDT-----EESSDQ---ETNENPKTPSISEESAKSKISETEKEQNDP  107

Query  605   SNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +N   ++K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  108   ANTTTQEKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNV  167

Query  779   PVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSV  940
             PVGAGRRK K+SA+HY H+   ++ Q A ++ P    + ALK NG+VL+        DS+
Sbjct  168   PVGAGRRKNKHSASHYRHITISEALQAARIEAPNGTHNPALKTNGRVLSFGLDTPTCDSM  227

Query  941   ASELNIAEKTAGNGSL-NGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
             AS LN+A++   NG+  NGF+    L  Q        G ++    SS ++ +  + V + 
Sbjct  228   ASVLNLADQNVLNGATRNGFHN---LEGQKKILGSCKGRENGDDCSSASSVTVSNSVEEG  284

Query  1118  G---LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
             G     + + QN +GFA  + C    PWPYP     W+SA+PPP    PG+PM FYPP  
Sbjct  285   GKICQQEHIMQNVNGFASPIQCLPGVPWPYP-----WNSALPPPVFCPPGYPMSFYPPFG  339

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD-----DNNKEGEPQPPKDSN  1453
               G+ IP        S   +      S PNSPTLGKHSRD      ++ E E  P + + 
Sbjct  340   NYGWNIPLLSPQ---SSSSSTNQKAQSSPNSPTLGKHSRDGDALKQDDLEKEESPKRKNG  396

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNC  1633
                C+ VPKTLR DDP +AAKSSIWATLGI+++   S  GG FK+F+ K++E +H +K  
Sbjct  397   ---CVLVPKTLRIDDPTEAAKSSIWATLGIKNETYSS--GGLFKSFQSKNNEKNHVNKTS  451

Query  1634  RVLLEANPAALSRSLNFHESS  1696
              V L ANPAALSRS+NFHESS
Sbjct  452   PV-LHANPAALSRSINFHESS  471



>gb|KDP31262.1| hypothetical protein JCGZ_11638 [Jatropha curcas]
Length=471

 Score =   327 bits (838),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 214/501 (43%), Positives = 289/501 (58%), Gaps = 57/501 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KD  IKLFG  I            + D DP      A S  +  S    E GE E+ +K
Sbjct  11    SKDSAIKLFGKKIPL----------KSDSDP-----PAISCDELPSWERVEEGEAEKTEK  55

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             + +   + E+ +++ T     E   DQ   E  +  K P + E+   ++IS T++E+   
Sbjct  56    DSSAGNVKETSQEDDT-----EESSDQ---ETNENPKTPSISEESAKSKISETEKEQNDP  107

Query  605   SNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +N   ++K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  108   ANTTTQEKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNV  167

Query  779   PVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSV  940
             PVGAGRRK K+SA+HY H+   ++ Q A ++ P    + ALK NG+VL+        DS+
Sbjct  168   PVGAGRRKNKHSASHYRHITISEALQAARIEAPNGTHNPALKTNGRVLSFGLDTPICDSM  227

Query  941   ASELNIAEKTAGNGSL-NGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
             AS LN+A++   NG+  NGF+    L  Q        G ++    SS ++ +  + V + 
Sbjct  228   ASVLNLADQNVLNGATRNGFHN---LEGQKKILGSCKGRENGDDCSSASSVTVSNSVEEG  284

Query  1118  G---LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
             G     + + QN +GFA  + C    PWPYP     W+SA+PPP    PG+PM FYPP  
Sbjct  285   GKICQQEHIMQNVNGFASPIQCLPGVPWPYP-----WNSALPPPVFCPPGYPMSFYPPFG  339

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD-----DNNKEGEPQPPKDSN  1453
               G+ IP        S   +      S PNSPTLGKHSRD      ++ E E  P + + 
Sbjct  340   NYGWNIPLLSPQ---SSSSSTNQKAQSSPNSPTLGKHSRDGDALKQDDLEKEESPKRKNG  396

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNC  1633
                C+ VPKTLR DDP +AAKSSIWATLGI+++   S  GG FK+F+ K++E +H +K  
Sbjct  397   ---CVLVPKTLRIDDPTEAAKSSIWATLGIKNETYSS--GGLFKSFQSKNNEKNHVNKTS  451

Query  1634  RVLLEANPAALSRSLNFHESS  1696
              V L ANPAALSRS+NFHESS
Sbjct  452   PV-LHANPAALSRSINFHESS  471



>ref|XP_008360848.1| PREDICTED: cyclic dof factor 3-like [Malus domestica]
Length=466

 Score =   326 bits (836),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 218/501 (44%), Positives = 286/501 (57%), Gaps = 55/501 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAA-------SEANSLAKDSSCSEAEPG  403
             TKDP IKLFG  I  P           D++  G A               +    +AE  
Sbjct  4     TKDPAIKLFGKKISLP----------ADIEDLGFARPVEKEVEVELEEECEEEEEDAETE  53

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
             +D   QK+      D+  + +       E +    V+      K P +DE+   T+ + T
Sbjct  54    QDSPSQKSTESIEQDDGSQPKSEDPTNLEXLPGSDVNP-----KTPSIDEESAQTKTAQT  108

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             ++E+    N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  109   EKEQS-TENSEEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGG  167

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA----  928
               RN+PVGAGRRK KNSA+HY H+   ++ + A +D P  + H ALK+NG+VL+      
Sbjct  168   TMRNVPVGAGRRKNKNSASHYRHMTISEALEAARIDAPNGVHHPALKSNGRVLSFGVDAP  227

Query  929   -SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
               DS+AS LN A+K   NG+ NG +K  E   QV         +    SS+ +   +K  
Sbjct  228   ICDSMASSLNPADKKVPNGTRNGLHKSEE---QVFPSPCKAXDNGDDSSSASSVNVSKPH  284

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPA  1285
             V          QN +GF+ Q+PC    PWPYP     W++AVPPP    P FP+ F  PA
Sbjct  285   V----------QNVNGFSSQIPCLPGVPWPYP-----WNAAVPPPPFCPPXFPLSFC-PA  328

Query  1286  MYLGYTIPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
              Y    +P +WN PW   +P +P Q    SG NSPTLGKHSRD++  + E    ++ + +
Sbjct  329   PYWNCGVPGTWNVPWFGPQPASPNQKSPRSGSNSPTLGKHSRDEDVLKPEILEKEEPSRQ  388

Query  1460  K--CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNC  1633
             K  C+ VPKTLR DDP +AAKSSIWATLGI++D +    GG FKAF+ K D+    S++ 
Sbjct  389   KNGCVLVPKTLRIDDPSEAAKSSIWATLGIKNDSISG--GGLFKAFQSKSDKKKTVSESS  446

Query  1634  RVLLEANPAALSRSLNFHESS  1696
                L ANPAALSRSLNFHESS
Sbjct  447   PA-LRANPAALSRSLNFHESS  466



>ref|XP_009619973.1| PREDICTED: cyclic dof factor 1-like [Nicotiana tomentosiformis]
Length=493

 Score =   327 bits (838),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 225/514 (44%), Positives = 292/514 (57%), Gaps = 58/514 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVD-----PGGAASEANSLAKD--------SSC  385
              KDP IKLFG  I  P+            D     P GA   ++   +D        SS 
Sbjct  4     VKDPEIKLFGKNIALPENGKILSVIVSGEDSGVEKPSGAKEISSGWDRDPCSVDKEASSP  63

Query  386   SEAEPG---EDEQQQKNE-NGERMDESKE--DEGTVLMEGEGIMDQTVDEIRDGLKAPHV  547
              E++ G   E+E+  K++  GE  +++ E  D+  V+ E E    ++  E  +  K+P +
Sbjct  64    DESDDGSEYENEKADKDQVTGELTEDTSEEKDQDQVMKESEN--PKSPSESENKPKSPPI  121

Query  548   DEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHF  727
             D++  + + S T   E   ++ + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHF
Sbjct  122   DDESLTVKASKT---ENDATDSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHF  178

Query  728   CKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALKA  904
             CK CQRYWT+GG  RN+PVGAGRRK KNSA+H +H+   ++ Q A +D P    H  LK 
Sbjct  179   CKSCQRYWTAGGTMRNVPVGAGRRKNKNSASHCHHIMISEALQAARIDPPNGFHHPMLKP  238

Query  905   NGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssg  1069
             NG VL+   D     S+AS +N+AEK   NG  NG+YKP       SY  G+NG D SSG
Sbjct  239   NGTVLSFGPDSPLCESMASVMNLAEKKTPNGIRNGYYKPEHK--NPSYIGGENGDDCSSG  296

Query  1070  sssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCF  1249
             SS  T +  +    KN  P+ + Q  +GF   +PC    PWP+P       +AVP P   
Sbjct  297   SSVTTNSMAEG--IKNRPPEAVMQTINGFPSPVPCLPGVPWPFP------YAAVPFPAMN  348

Query  1250  SPGFPMPFYPPAMYLGYTIPCSWNAPWVSRP--VAPQHHTSSGPNSPTLGKHSRDD----  1411
                FPMPF PP  Y    +P  W+ PW++ P   A Q+ + S PNSP LGKHSRD     
Sbjct  349   PAAFPMPFCPPP-YWNCNVPGPWSIPWLAPPPTTANQNGSGSSPNSP-LGKHSRDGDLLR  406

Query  1412  -NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKA  1588
              NN EG+       N E  + VPKTLR DDP++AAKSSIW+TLGI +D V   RGG FK 
Sbjct  407   PNNPEGQ------KNSEGSVLVPKTLRIDDPDEAAKSSIWSTLGISYDSVS--RGGLFKG  458

Query  1589  FKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             F+ K  E  H +    V L+ANP A SRSL+F E
Sbjct  459   FQPKSSEKDHPATTSPV-LQANPVAFSRSLSFQE  491



>ref|XP_008367550.1| PREDICTED: cyclic dof factor 3-like [Malus domestica]
Length=466

 Score =   326 bits (835),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 219/501 (44%), Positives = 287/501 (57%), Gaps = 55/501 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAA-------SEANSLAKDSSCSEAEPG  403
             TKDP IKLFG  I  P           D++  G A               +    +AE  
Sbjct  4     TKDPAIKLFGKKISLP----------ADIEDLGFARPVEKEVEVELEEECEEEEEDAETE  53

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
             +D   QK+      D+  + +       E +    V+      K P +DE+   T+ + T
Sbjct  54    QDSPSQKSTESIEQDDGSQPKSEDPTNLEXLPGSDVNP-----KTPSIDEESAQTKTAQT  108

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             ++E+    N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  109   EKEQS-TENSEEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGG  167

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA----  928
               RN+PVGAGRRK KNSA+HY H+   ++ + A +D P  + H ALK+NG+VL+      
Sbjct  168   TMRNVPVGAGRRKNKNSASHYRHMTISEALEAARIDAPNGVHHPALKSNGRVLSFGVDAP  227

Query  929   -SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
               DS+AS LN A+K   NG+ NG +K  E   QV         +    SS+ +   +K  
Sbjct  228   ICDSMASSLNPADKKVPNGTRNGLHKSEE---QVFPSPCKAXDNGDDSSSASSVNVSKPH  284

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPA  1285
             V          QN +GF+ Q+PC    PWPYP     W++AVPPP    PGFP+ F  PA
Sbjct  285   V----------QNVNGFSSQIPCLPGVPWPYP-----WNAAVPPPPFCPPGFPLSFC-PA  328

Query  1286  MYLGYTIPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
              Y    +P +WN PW   +P +P Q    SG NSPTLGKHSRD++  + E    ++ + +
Sbjct  329   PYWNCGVPGTWNVPWFGPQPASPNQKSPRSGSNSPTLGKHSRDEDVLKPEILEKEEPSRQ  388

Query  1460  K--CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNC  1633
             K  C+ VPKTLR DDP +AAKSSIWATLGI++D +    GG FKAF+ K D+    S++ 
Sbjct  389   KNGCVLVPKTLRIDDPXEAAKSSIWATLGIKNDSISG--GGLFKAFQSKSDKKKTVSESS  446

Query  1634  RVLLEANPAALSRSLNFHESS  1696
                L ANPAALSRSLNFHESS
Sbjct  447   PA-LRANPAALSRSLNFHESS  466



>ref|XP_006364590.1| PREDICTED: cyclic dof factor 3-like [Solanum tuberosum]
Length=503

 Score =   327 bits (837),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 216/523 (41%), Positives = 293/523 (56%), Gaps = 66/523 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD----AppppppTEMDVDPGGAASEANSLAKDSSCSEAEP----  400
              K+P IKLFG  I  P+     P      + DV    +ASE  +  + S+ S+ +P    
Sbjct  4     VKEPEIKLFGKKIFLPENGKILPVIVTGEDSDVGKSVSASEVVTADESSTGSDRDPCLVD  63

Query  401   --GEDEQQQKNENGERMDESKEDEGTVLME-GEGIMDQ----TVDEIRDGLKAPH-----  544
               G + QQ ++++G   ++ + D+  +  E  E  +++     + E  D LK+P      
Sbjct  64    KEGNNSQQDESDDGSEYEKEETDKDRMTRELSEAKLEEKDQNLMMEESDNLKSPSENKTK  123

Query  545   ---VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQ  715
                VD+D    + S T++++   SN + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQ
Sbjct  124   THTVDDDSPRVKSSKTEDDQNDASNTQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQ  183

Query  716   PRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHH  892
             PRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+H  H+   ++ + A +D P    H 
Sbjct  184   PRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSASHCRHIMISEALEAARIDPPTGFHHP  243

Query  893   ALKANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYK-----PVELGIQVSYgag  1042
             A K NG VL+        DS+AS LN+AE    NG  NGFY+     P  +G +      
Sbjct  244   AFKPNGTVLSFGPDLPLCDSMASVLNLAENNTPNGIRNGFYRREHKNPSGIGGE------  297

Query  1043  dngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWS  1222
                 D  S  SSVT +++  +  KN  P+ +    + F   +PC    PWP P +AV + 
Sbjct  298   --NGDDCSSGSSVTTSNSMAEGVKNRPPEAVMHTINAFPSPVPCLPGVPWPIPYAAVPFP  355

Query  1223  SAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGK  1396
             +  P       G+P+PF PP  Y    +P  W+ PW++   P A Q  +SS PNSP LGK
Sbjct  356   AITP------AGYPVPFCPPP-YWNCNVPGPWSLPWLTPPSPTANQKGSSSAPNSP-LGK  407

Query  1397  HSRDD-----NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVD  1561
             HSRD      NN EG+       N E  + +PKTLR DDP++AAKSSIW+TLGI++D V 
Sbjct  408   HSRDGELLKPNNPEGQ------KNSEGSVLIPKTLRIDDPDEAAKSSIWSTLGIKYDSVS  461

Query  1562  SIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
               RGG FKA + K  E  H +      L+ANPAA SRSL+F E
Sbjct  462   --RGGLFKALQPKSSEKDHPATTSPA-LQANPAAFSRSLSFQE  501



>ref|XP_006373325.1| hypothetical protein POPTR_0017s12080g [Populus trichocarpa]
 gb|ERP51122.1| hypothetical protein POPTR_0017s12080g [Populus trichocarpa]
Length=431

 Score =   324 bits (830),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 199/433 (46%), Positives = 260/433 (60%), Gaps = 23/433 (5%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED-  409
             M EP KD   KLFG TIQ P+       T  D D   +  +      +SS  E    +D 
Sbjct  1     MSEP-KDQAFKLFGKTIQVPEISVTTATTTDDDDDDDSQDQDRPSCANSSLDETNITDDY  59

Query  410   -------------EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD  550
                          E   K+  G+   E++ED  + +   E           +  K P V+
Sbjct  60    NNNDKRDHGEEDTETDDKDSVGKTTIENQEDGASPVAAKESSNLDATSGTSENPKTPSVE  119

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ++  + + S T+EE+   SN ++KTLKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  120   KESTALKTSNTEEEQSDTSNSQEKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFC  179

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             K CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ QN   D P  + H +LK N
Sbjct  180   KNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITIPEALQNGRADVPNGVHHPSLKTN  239

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             G VLT  SD     S+AS LN+A+KT  N ++NGF+KP  L + VSYG G+NG DHS+GS
Sbjct  240   GTVLTFGSDAPLHESMASVLNLADKTMRNCTMNGFHKPEALRVPVSYGGGENGDDHSNGS  299

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S   + S+ D+  K+   +   QNY G+ PQ+PCF   PWPYP ++ QWSS VPPP    
Sbjct  300   SVTVSNSS-DEAGKSVSKESAMQNYQGYPPQIPCFPGVPWPYPWNSAQWSSPVPPPAFCP  358

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG-PNSPTLGKHSRDDNNKEGE  1429
               FPMPFYP A Y G T+P +WN PW+ +P +P+  +SS  PNSPTLGKHSRD+N  +  
Sbjct  359   SSFPMPFYPAAAYWGCTVPGAWNVPWLPQPSSPKQTSSSSDPNSPTLGKHSRDENLLKPS  418

Query  1430  PQPPKDSNPEKCL  1468
                 +  N E+CL
Sbjct  419   NSKEELVNTERCL  431



>ref|XP_004235992.1| PREDICTED: cyclic dof factor 1-like [Solanum lycopersicum]
Length=501

 Score =   325 bits (833),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 215/518 (42%), Positives = 291/518 (56%), Gaps = 58/518 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD----AppppppTEMDVDPGGAASEANSLAKDSSCSEAEP----  400
              K+P IKLFG  I  P+     P      + DV    +ASE  +  + S+ S+ +P    
Sbjct  4     VKEPEIKLFGKKIVLPENGMILPVIVTGEDSDVGKSMSASEVVTADESSTGSDRDPCLVD  63

Query  401   --GEDEQQQKNENGERMDESKEDEGTVLME-GEGIMDQ----TVDEIRDGLKAPH-----  544
               G   QQ ++++G   ++ + D+  +  E  E  +++     + E  + LK+P      
Sbjct  64    KEGNSSQQDESDDGSEYEKDEADKDRMTRELSEAKLEEKDQNLMMEESENLKSPSENKTK  123

Query  545   ---VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQ  715
                +D+D  + + S T++++   SN + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQ
Sbjct  124   THTIDDDSPTVKSSKTEDDQNDASNSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQ  183

Query  716   PRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHH  892
             PRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+H  H+   ++ + A +D P    H 
Sbjct  184   PRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSASHCRHIMISEALEAARIDPPNGFSHP  243

Query  893   ALKANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngad  1057
               K NG VL+        DS+AS LN+AE    NG  NG Y+P     +   G G    D
Sbjct  244   VFKPNGTVLSFGPDLPLCDSMASVLNLAENKTPNGIRNGLYRP-----ENPSGIGGENGD  298

Query  1058  hssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPP  1237
               S  SSVT +++  +  KN  P+ + Q  + F   +PC    PWP P       +AVP 
Sbjct  299   DCSSGSSVTTSNSMAEGVKNCPPEAVMQTINAFPSPVPCLPGVPWPIP------YAAVPF  352

Query  1238  PGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDD  1411
             P     G+PMPF PP  Y    +P  W+ PW++   P A Q  + S PNSP LGKHSRD 
Sbjct  353   PAISPAGYPMPFCPPP-YWNCNVPGPWSLPWLTPPSPTANQKGSVSAPNSP-LGKHSRDG  410

Query  1412  -----NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG  1576
                  NN EG+       N E  + VPKTLR DDP++AAKSSIW+TLGI++D V   RGG
Sbjct  411   ELLKPNNPEGQ------KNSEGSVLVPKTLRIDDPDEAAKSSIWSTLGIKYDSVS--RGG  462

Query  1577  AFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
              FK+ + K+ E  H +      L+ANPAA SRSL+F E
Sbjct  463   LFKSLQPKNSEKDHPTTTSPS-LQANPAAFSRSLSFQE  499



>ref|XP_008356629.1| PREDICTED: cyclic dof factor 3-like [Malus domestica]
 gb|ADL36682.1| DOF domain class transcription factor [Malus domestica]
Length=465

 Score =   323 bits (828),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 218/499 (44%), Positives = 282/499 (57%), Gaps = 52/499 (10%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             TKDP IKLFG  I  P           D++  G A       +  S  E E  EDE+ ++
Sbjct  4     TKDPAIKLFGKKIALP----------ADIEDLGFARPVEKEVEVESEEEDEEEEDEETEQ  53

Query  425   NENGERMDESKE-DEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             +    +  ES E D+G+     +    + + +     K P  DE    ++ + T E+E  
Sbjct  54    DSPSRKSTESIEQDDGSPPKTEDPANLEILPDSNVNPKTPSTDEASALSKTAQT-EKEPS  112

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
               N ++K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  113   TENSEEKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVP  172

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-----VA  943
             VGAGRRK KNSA+HY H    ++ Q A +D P    H ALK+NG+VL+   D      +A
Sbjct  173   VGAGRRKNKNSASHYRHFTITEALQAARIDAPNGAHHPALKSNGRVLSFGVDVPICDPMA  232

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+A+K   + + NG +K  E   QV      +  +    SS+ +   +K  +     
Sbjct  233   SVLNLADKNVSSSTRNGLHKGEE---QVFRAPCKSRENGDDSSSASSVNVSKPHLV----  285

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
                   N +GF+ Q+PC    PWPYP     W++AVPPP    PGFP+ F   A Y    
Sbjct  286   ------NVNGFSSQIPCLPGVPWPYP-----WNAAVPPPAFCPPGFPLSFC-AAPYWNCG  333

Query  1304  IPCSWNAPWVS-RPVAP-QHHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEK  1462
             +P +WN PW   +P  P Q    S  NSPTLGKHSRD++     N E E +P +  N   
Sbjct  334   VPGTWNVPWFGPQPATPNQKSPHSSSNSPTLGKHSRDEDVVRPENLEKE-EPSRQKN--G  390

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHASKNCRV  1639
             C+ VPKTLR DDP +AAKSSIWATLGI++   DSI G G FKAF+ K D+     +    
Sbjct  391   CVLVPKTLRIDDPSEAAKSSIWATLGIKN---DSISGKGLFKAFQPKSDQKKTVPETSPA  447

Query  1640  LLEANPAALSRSLNFHESS  1696
              + ANPAALSRSLNFHESS
Sbjct  448   -MRANPAALSRSLNFHESS  465



>ref|XP_010693253.1| PREDICTED: cyclic dof factor 2 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   322 bits (825),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 191/398 (48%), Positives = 256/398 (64%), Gaps = 23/398 (6%)
 Frame = +2

Query  542   HVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPR  721
             +VDE   + E S ++EE+ + S  ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPR
Sbjct  71    NVDEK-EAGESSKSEEEKAETSPSQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPR  129

Query  722   HFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHAL  898
             HFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY ++   ++ QNA  + P  + H AL
Sbjct  130   HFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRNITIPEALQNARTEIPNGL-HPAL  188

Query  899   KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhs  1063
               NG VLT +SD     S+AS LN+AEK   N   N F KP +L + + +      A   
Sbjct  189   PNNGMVLTFSSDSPLCESMASILNLAEKPVRNCPPNAFQKPEDLKVSIPF------AGLE  242

Query  1064  sgsssvtaasTKDDVCKNGLPDM-LKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPP  1240
             SG +    +++KDD  K+  P+    QN   F  Q+PC+   PWPYP ++ QWS  V  P
Sbjct  243   SGVNHDDGSNSKDDASKSAAPNEPAAQNCLPFPAQIPCYPGAPWPYPWNSTQWSPPVAAP  302

Query  1241  GCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN--  1414
                  GF MPFYP   Y G  +P +WN PW+++P  P +   S   +  LGKHSRD N  
Sbjct  303   PFCPNGFAMPFYPAPAYWGCAVPGAWNIPWIAQPSPPSNSNPSSAPTSPLGKHSRDGNML  362

Query  1415  -NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQ-HDRVDSI-RG-GAF  1582
              +   E +  ++++ E+ LW+PKTLR DDP +AAKSSIW+TLGI+ +++ +SI RG G F
Sbjct  363   TSTNSEDKEVEENSSERSLWIPKTLRIDDPGEAAKSSIWSTLGIKNNEKPESIGRGFGLF  422

Query  1583  KAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             KAF+ K + N+    +   +LEANPAALSRS NF E++
Sbjct  423   KAFQSKREGNTRMETS--PVLEANPAALSRSQNFQENT  458



>ref|XP_011071702.1| PREDICTED: cyclic dof factor 3-like [Sesamum indicum]
Length=496

 Score =   320 bits (819),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 225/516 (44%), Positives = 292/516 (57%), Gaps = 55/516 (11%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDS-SCSEAEPGEDEQQQK  424
             K+P IKLFG  I  P+        +       +      +  DS   S  E GE ++ + 
Sbjct  3     KEPEIKLFGRKIFLPENGGGEYSGDSSGG--SSDGSGGGIDCDSLEVSRGEQGEGDRGKD  60

Query  425   NENGER--MDESKEDEGTVLME----GE----GIMDQT-----VDEIRDGLKAPHVDEDC  559
              +  ER  M   +E     L E    GE    G  D++     + E  D  K   +D+D 
Sbjct  61    GDGEERHGMANDEEQAAGELYETAALGEDQNPGATDESHNANALSESDDNSKTASIDDDV  120

Query  560   GSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKC  739
             GS      D ++   +N + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK C
Sbjct  121   GSENAPKADNDQSDATNAQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKSC  180

Query  740   QRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALKANGKV  916
             QRYWT+GG  RN+PVGAGRRK KNSA+H  H+   ++ Q A +D P    +  LK NG +
Sbjct  181   QRYWTAGGTMRNVPVGAGRRKNKNSASHCRHITISEALQAARIDEPNGFHNLKLKPNGTI  240

Query  917   LTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             L+   D     S+AS LN+AEK A NG  NG+YK ++ G  VS     + +D  S  SS+
Sbjct  241   LSFGPDSPLCESMASALNLAEKRAPNGLRNGYYK-IDQGGSVS----GDKSDDQSIGSSI  295

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
             T +S+  D  KNGLP  + QN +GF   +PC    PWP+P     W+SAVP P    PG+
Sbjct  296   TMSSSSADGGKNGLPQPVMQNINGFPAPVPCMPGVPWPFP-----WNSAVPIPAICPPGY  350

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSR--PVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQ  1435
             P+P+YP   +   ++P +WN PW+S   P   Q  T SGP+SP LGKHSR+     GE  
Sbjct  351   PLPYYPAPYW-NCSVPNAWNVPWLSVPPPTVNQKATGSGPSSP-LGKHSRN-----GELL  403

Query  1436  PPKDSN---------PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKA  1588
              PK S+          E  + VPKTLR DDP++AAKSSIWA LGI++D     R G FKA
Sbjct  404   RPKSSDGKEHSDAKSEESSVVVPKTLRIDDPKEAAKSSIWAALGIKYDSFS--REGLFKA  461

Query  1589  FKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              + K DE      N   LL+ANPAALSRS++F ES+
Sbjct  462   LQPKGDEKKQKV-NTSALLQANPAALSRSISFQESA  496



>ref|XP_009628724.1| PREDICTED: cyclic dof factor 1-like [Nicotiana tomentosiformis]
Length=462

 Score =   317 bits (811),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 209/506 (41%), Positives = 276/506 (55%), Gaps = 69/506 (14%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCS-EAEPGEDEQQQ  421
              +DP IKLFG TI+ P          +D       S A   + D   + EAE      Q 
Sbjct  4     VRDPAIKLFGKTIRLP----------LDDLLDQRTSSATITSHDDLITFEAE----LTQS  49

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             KN           D+ T     + +  +T   I D  K    D++  S + +T  E+  +
Sbjct  50    KN----------RDDFTNSSADKAVETETSSGISDDPKKEDADKETWSPK-ATKKEDPSE  98

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +  ++K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  RN+P
Sbjct  99    ANVTQEKALKKPDKILPCPRCNSMETKFCYYNNYNINQPRHFCKKCQRYWTAGGTMRNVP  158

Query  782   VGAGRRKTKNS--AAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----DSV  940
             VG+GRRK K+S    + H+    + Q A  +    +    L+ANG VL   S     DS+
Sbjct  159   VGSGRRKNKSSPTTGYRHIMVSDALQAARFEAAHGMNLPMLRANGTVLACGSDKPLCDSM  218

Query  941   ASELNIAEKTAG---NGSLNGFYKPV---ELGIQVSYgagdngadhssgsssvtaasTKD  1102
             AS LN+AEK+     NGS    +      E G ++S GA                     
Sbjct  219   ASILNLAEKSQNSVQNGSEQRTHSACRGKETGNEISSGACS-------------------  259

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
                 N   D   +N+  F PQ+  F   PWPY  +A  W+SAVP P   +P FP+PFYP 
Sbjct  260   -TASNSTHDSAWKNFQAFPPQVHHFPGHPWPYSYNAAPWTSAVPQPN-LAPRFPVPFYPA  317

Query  1283  AMYLGYTIPCSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDDN-----NKEGEPQPP  1441
               Y G T+   WN PWVS P +    +  S+ P SPTLGKHSRD++     N E E  P 
Sbjct  318   PPYWGCTVASPWNVPWVSPPASSPDCSVLSATPTSPTLGKHSRDEHTLNPSNSEKE-DPL  376

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSH  1618
             +D + E+ + VPKTLR DDP++AAKSSIW+TLGIQ+++ DS  G   FKAF  K D+  +
Sbjct  377   QDIDRERSVLVPKTLRVDDPDEAAKSSIWSTLGIQNEKNDSTNGARLFKAFNSKVDDQRN  436

Query  1619  ASKNCRVLLEANPAALSRSLNFHESS  1696
                +  ++L+ANPAALSRSLNFHES+
Sbjct  437   HESDASLVLQANPAALSRSLNFHEST  462



>dbj|BAH58100.1| Dof zinc finger protein [Ipomoea batatas]
Length=497

 Score =   318 bits (814),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 215/521 (41%), Positives = 282/521 (54%), Gaps = 64/521 (12%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD---------AppppppTEMDVDPGGAASEANSLAKDSSC--SE  391
              KD  IKLFG  I  P+         A       E D       S+ +  + DS    S 
Sbjct  4     VKDSEIKLFGKKIALPENGRVVLFDGAGEYAESCENDC-----VSDRDRCSDDSKLNGSA  58

Query  392   AEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIR---------DGLKAPH  544
              + G D  +   +  E  D+    E     + +   DQ +DE+          + +K P 
Sbjct  59    GKGGADVDEIDTQKPEDDDKELLSEEFSEEKDQ---DQDMDELESTKNESESDNNVKTPP  115

Query  545   VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRH  724
              DED  S + S T+ ++ + +N + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRH
Sbjct  116   ADEDSPSPKTSKTENDQTETNNSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRH  175

Query  725   FCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALK  901
             FCK CQRYWT+GG  RN+PVGAGRRK KNSA+H  H+   ++ Q A +D P    H   K
Sbjct  176   FCKSCQRYWTAGGTMRNVPVGAGRRKNKNSASHCRHITITEALQAARIDAPNGFHHPTYK  235

Query  902   ANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhss  1066
              NG VL+        +S+AS LN+A+K   NG  NGFYK      Q +            
Sbjct  236   PNGTVLSFGPESPLCESMASLLNLADKKVPNGMRNGFYK----HEQGNSPNKVGENGDDC  291

Query  1067  gsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGC  1246
              S S    ++     K    + +  N +GF   +PC    PWP+P     W++AVP P  
Sbjct  292   SSVSSVTTTSSAAGGKYPPQEAVMPNINGFPTPVPCLPGVPWPFP-----WNAAVPLPAI  346

Query  1247  FSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDD---  1411
               PGFPMPF  PA Y    +P  W+ PW++   P A Q  +SS PNSP LGKHSR+    
Sbjct  347   CPPGFPMPFC-PAPYWNCAVPGPWSLPWLAPPSPTANQKTSSSSPNSP-LGKHSREGELL  404

Query  1412  --NNKEGEPQPPKDSNPEK----CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG  1573
               NN E      K+S+ +K     + VPKTLR DDP++AAKSSIW+TLGI++D +   RG
Sbjct  405   TPNNPEA-----KESSEQKRSGNSVLVPKTLRIDDPDEAAKSSIWSTLGIKYDSIS--RG  457

Query  1574  GAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             G FKA + K DE +H +      L+ANPAALSRSL+F ES+
Sbjct  458   GLFKALQPKSDEKNHTATPPSA-LQANPAALSRSLSFQESA  497



>ref|XP_003549682.1| PREDICTED: cyclic dof factor 3 [Glycine max]
 gb|KHN18558.1| Dof zinc finger protein DOF3.3 [Glycine soja]
Length=471

 Score =   317 bits (811),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 214/496 (43%), Positives = 280/496 (56%), Gaps = 42/496 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP I+LFG  I FP+          DVD    ++E      +    E   G+ + + +N
Sbjct  5     RDPAIRLFGQKIPFPE----------DVDKEEESAEDREQEMEEHEDE---GDKDTRVEN  51

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
                E ++         L   E  +  T  E     K P ++E+   ++   +++E+G  +
Sbjct  52    VTKEELEADPP-----LDAEETKISGTSPEAIVNPKTPSIEEETAKSKGGKSEKEQGDAA  106

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++KTLKKPDK+LPCPRC SMDTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PVG
Sbjct  107   NSQEKTLKKPDKVLPCPRCKSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVG  166

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-------SDSVA  943
             AGRRK KNS +HY H+   ++ Q A +D         LK NG+VL+          DS+A
Sbjct  167   AGRRKNKNSTSHYRHITISEALQAARIDAQNGTHLPTLKGNGRVLSFGLDAHAPICDSMA  226

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S +N+ EK A NG+ NGF+   E              D SS +SS+T +S K +  K+  
Sbjct  227   SLMNLGEKKALNGTRNGFHHGFEDQRLPVPCKSGENGDDSSTTSSITISSPKGENNKSTF  286

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
                     HGF PQ+PC    PWPY      W+S VPPP     GFP+PFY PA +    
Sbjct  287   QQQPLPQNHGFLPQVPCIPGVPWPY-----TWNSPVPPPALCPSGFPLPFY-PATFWNCG  340

Query  1304  IPCSWNAPWV--SRPVAPQHHTSSGPNSPTLGKHSRD-DNNKEGEPQPPKDSNPEK-CLW  1471
             +P +WN PW   S P +     SS PNSPTLGKHSRD D  K+      + S P    + 
Sbjct  341   MPGNWNVPWFSSSSPASNLKSPSSSPNSPTLGKHSRDSDMIKQDSLHKEEASTPRNGSVL  400

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVLLE  1648
             VPKTLR DDP +AAKSSIWATLGI++   +S+ GGA FKAF+ K  E +H       +L 
Sbjct  401   VPKTLRIDDPSEAAKSSIWATLGIKN---ESVSGGAMFKAFQSKKGEKNHVE--ASPMLM  455

Query  1649  ANPAALSRSLNFHESS  1696
             ANPAALSRSLNFHE+S
Sbjct  456   ANPAALSRSLNFHENS  471



>ref|XP_010917059.1| PREDICTED: cyclic dof factor 2 [Elaeis guineensis]
Length=457

 Score =   316 bits (810),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 206/497 (41%), Positives = 278/497 (56%), Gaps = 58/497 (12%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +D  IKLFG TI           +  +  P    SE +S  ++    E    E   + K+
Sbjct  5     RDLAIKLFGKTIPL--------QSTGESPPVSGGSEESSGKEEKDHKE----ETTPETKD  52

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
             ++ E  D  ++ +    + GE       D++  G      +++  + + S + E+    S
Sbjct  53    QDIESPDSEEKSDSPTSIAGE------TDKLSFG------NQEDTNIKDSKSKEQSNGTS  100

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++K  KKPDKILPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PVG
Sbjct  101   NSQEKAPKKPDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVG  160

Query  788   AGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASEL  952
             AGRRK K+S +HY    + + Q    D  E I H  + +NG VL+  SD     S+AS L
Sbjct  161   AGRRKNKSSISHYRHITMDTLQTVRSDAMEAIHHPPINSNGTVLSFGSDTPLCESMASVL  220

Query  953   NIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDM  1132
             N+ EK   N + NG+++  E  + +S        D  S  SS  A+++K +  K GL   
Sbjct  221   NLVEKNMKNCTRNGYHQMEEQMVPLS--CRAENGDEHSSGSSAMASNSKHEAAKTGL---  275

Query  1133  LKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC  1312
                   G    +P F   PWPY     QW+ A   P C S  F +P YP   Y G  +P 
Sbjct  276   -----QGVPAPIPYFNGTPWPY-----QWNPAT--PFCTS-SFAIPVYPATAYWGCAVPG  322

Query  1313  SWNAPWVSRPVAPQHHTS----SGPNSPTLGKHSRDDNNKEGEPQPPKD----SNPEKCL  1468
             SW  PW+S P+A     S    SGPNSPTLGKHSRD +  +G     +D    +N E C+
Sbjct  323   SWGIPWLS-PLASSPPNSGSPGSGPNSPTLGKHSRDGHILKGSNVEKEDGFKQTNQETCI  381

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHASKNCRVLL  1645
             WVPKTLR DD ++AAKSSIWA +GI++D+ D++ G G FKAF+ K D  +H S+  + LL
Sbjct  382   WVPKTLRIDDADEAAKSSIWAMIGIKNDKADAVSGRGIFKAFQPKIDIKNHTSETSQ-LL  440

Query  1646  EANPAALSRSLNFHESS  1696
              ANPAALSRSL+F ESS
Sbjct  441   HANPAALSRSLHFQESS  457



>gb|ACU18293.1| unknown [Glycine max]
Length=471

 Score =   315 bits (808),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 214/496 (43%), Positives = 280/496 (56%), Gaps = 42/496 (8%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP I+LFG  I FP+          DVD    ++E      +    E   G+ + + +N
Sbjct  5     RDPAIRLFGQKIPFPE----------DVDKEEESAEDREQEMEEHEDE---GDKDTRVEN  51

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
                E ++         L   E  +  T  E     K P ++E+   ++   +++E+G  +
Sbjct  52    VTKEELEADPP-----LDAEETKISGTSPEAIVNPKTPSIEEETAKSKGGKSEKEQGDAA  106

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++KTLKKPDK+LPCPRC SMDTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PVG
Sbjct  107   NSQEKTLKKPDKVLPCPRCKSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVG  166

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-------SDSVA  943
             AGRRK KNS +HY H+   ++ Q A +D         LK NG+VL+L         DS+A
Sbjct  167   AGRRKNKNSTSHYRHITISEALQAARIDAQNGTHLPTLKGNGRVLSLGLDAHAPICDSMA  226

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S +N+ EK A NG+ NGF+   E              D SS +SS+T +S K +  K+  
Sbjct  227   SLMNLGEKKALNGTRNGFHHGFEDQRLPVPCKSGENGDDSSTTSSITISSPKGENNKSTF  286

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
                     HGF PQ+PC    PW Y      W+S VPPP     GFP+PFY PA +    
Sbjct  287   QQQPLPQNHGFLPQVPCIPGVPWSY-----TWNSPVPPPALCPSGFPLPFY-PATFWNCG  340

Query  1304  IPCSWNAPWV--SRPVAPQHHTSSGPNSPTLGKHSRD-DNNKEGEPQPPKDSNPEK-CLW  1471
             +P +WN PW   S P +     SS PNSPTLGKHSRD D  K+      + S P    + 
Sbjct  341   MPGNWNVPWFSSSSPASNLKSPSSSPNSPTLGKHSRDSDMIKQDSLHKEEASTPRNGSVL  400

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVLLE  1648
             VPKTLR DDP +AAKSSIWATLGI++   +S+ GGA FKAF+ K  E +H       +L 
Sbjct  401   VPKTLRIDDPSEAAKSSIWATLGIKN---ESVSGGAMFKAFQSKKGEKNHVE--ASPMLM  455

Query  1649  ANPAALSRSLNFHESS  1696
             ANPAALSRSLNFHE+S
Sbjct  456   ANPAALSRSLNFHENS  471



>ref|XP_009771503.1| PREDICTED: cyclic dof factor 1-like [Nicotiana sylvestris]
Length=492

 Score =   315 bits (808),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 211/517 (41%), Positives = 276/517 (53%), Gaps = 65/517 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPD-------------------AppppppTEMDVDPGGAASEANSL  367
              KDP IKLFG  I  P+                   +      +  D DP     EA+S 
Sbjct  4     VKDPEIKLFGKKIALPENGKILSVIVSGEDSGVEKTSGAKEISSGWDRDPCLVDKEASSP  63

Query  368   AKDSSCSEAEPGE-DEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPH  544
              +    SE E  + D+ Q   E  E + E K D+  V+ E E    ++  E  +  K P 
Sbjct  64    DESDDGSEYENEKTDKDQVTRELTEDISEEK-DQDQVMKESEN--PKSPSESENKPKTPP  120

Query  545   VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRH  724
             +D++  + +   T   E   ++ + KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRH
Sbjct  121   IDDESPTVKSFKT---ENDATDSQQKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRH  177

Query  725   FCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH-YHLNAVKSFQNACVDHPERIQHHALK  901
             FCK CQRYWT+GG  RN+PVGAGRRK KNS +H +H+   ++ Q A +D      H  LK
Sbjct  178   FCKSCQRYWTAGGTMRNVPVGAGRRKNKNSVSHCHHVMISEALQAARIDPSNGFHHPTLK  237

Query  902   ANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhss  1066
              NG VL+        DS+AS +N+AEK   NG  NG+YKP        +         + 
Sbjct  238   PNGTVLSFGPDLPLCDSMASVINLAEKKTPNGIRNGYYKP-------EHKNSSCLGGENG  290

Query  1067  gsssvtaasTKDDV--CKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPP  1240
                S  ++ T + +   KN  P+ + Q  +GF   +PC    PWP+P +A  + S  P  
Sbjct  291   DDCSSGSSVTTNSMAGVKNRPPEAVMQTMNGFPSPVPCLPGVPWPFPYAAAPFPSMNPA-  349

Query  1241  GCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRP--VAPQHHTSSGPNSPTLGKHSRDD-  1411
                   FP+PF PP  Y    IP  W+ PW++ P   A Q+ + S PNSP LGKHSRD  
Sbjct  350   -----VFPIPFCPPP-YWNCNIPGPWSIPWLASPSPTANQNGSGSAPNSP-LGKHSRDGD  402

Query  1412  ----NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA  1579
                 NN EG+       N E  + VPKTLR DDP++AAKSSIW+TLGI +D V   RGG 
Sbjct  403   LLRPNNPEGQ------KNSEGSVLVPKTLRIDDPDEAAKSSIWSTLGINYDSVS--RGGL  454

Query  1580  FKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             FK F+ K  E  H +    V L+ANP A SRSL+F E
Sbjct  455   FKGFQPKSSEKDHPATTSPV-LQANPVAFSRSLSFQE  490



>gb|KHN13218.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=488

 Score =   315 bits (806),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 216/510 (42%), Positives = 288/510 (56%), Gaps = 53/510 (10%)
 Frame = +2

Query  248   KDPTI-KLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDS------SCSEAEPGE  406
             KD T+ KLFG TI  P+           +  G  A  +  +  DS      S S    GE
Sbjct  5     KDSTMMKLFGNTIPAPE-----------IPAGAPAFSSGDVFGDSVGQNRGSSSVNGDGE  53

Query  407   DEQQQKNENGERMDESK-EDE----GTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTE  571
             + + Q++  GE   ESK EDE     TV   GEG ++ + ++           ED     
Sbjct  54    EHEIQQDIMGEETTESKKEDEVTNLDTVSRSGEGSINPSTEK-----------EDLTLKT  102

Query  572   ISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYW  751
                T++E+G+  N ++KTL+KPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK C RYW
Sbjct  103   SKKTEQEQGE--NSQNKTLRKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCMRYW  160

Query  752   TSGGMTRNLPVGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVLTL  925
             T+GG+ RN+PVGAGRRK KN A+ Y    V   +  ++  D    + + +L  N  +L  
Sbjct  161   TAGGVMRNVPVGAGRRKNKNFASQYRHITVPEAALSSSQPDLSNGVSNPSLNCNATLLAY  220

Query  926   ASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
              SD     S+ S LN+A+K   N + NGF    EL I V+Y  G+   D S+ SS  +  
Sbjct  221   GSDRPLCESMTSVLNLADKAVNNSTTNGFNGSEELEIPVTYVGGEKVNDDSNKSSDTSTK  280

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP-GFPM  1267
              TK +   N   + + +N H F P +P F   PWP+P +   W+S VP P  F P GF M
Sbjct  281   PTKGETT-NRSQEQVIENCHPFPPHVPYFPGAPWPFPWNPAPWNSLVPLPPPFFPQGFTM  339

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTS-SGPNSPTLGKHSRDDNNKEG-----E  1429
             P YP A Y   TIP + + PW+++P       S SGPNS TLGKHSR++N  +      E
Sbjct  340   PLYPAAAYWSLTIPGARSIPWLAQPSLLNTTVSNSGPNSLTLGKHSREENMHKSNGVAVE  399

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDD  1606
              +  K++N EKCLWVPKTLR DD  +AAK+SIW TLGI++++ D   GG  FK+   +  
Sbjct  400   DEHSKENNKEKCLWVPKTLRIDDLGEAAKTSIWTTLGIKNNKADLFPGGGLFKSLPSQGG  459

Query  1607  ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             E +   KN  V   ANPAALSRS+NF E+S
Sbjct  460   EKNRVIKNSPV-PHANPAALSRSINFQETS  488



>ref|XP_010939813.1| PREDICTED: cyclic dof factor 3-like [Elaeis guineensis]
Length=483

 Score =   313 bits (802),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 207/503 (41%), Positives = 280/503 (56%), Gaps = 61/503 (12%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP IKLFG TI  P                 A  EA +++          G+DE+++ 
Sbjct  23    SRDPAIKLFGKTIPLP-----------------AGGEAPAVS----------GDDEREKD  55

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGL-KAPHVDEDCGSTEISTTDEEEGK  601
                G   +E+  +   +  +     D++   I     + P    D  +  +     EE K
Sbjct  56    EAKGSSDEEATHESTDMDHDSPNSEDKSGSPISSTANETPKNSADQETIPVKNLKPEEQK  115

Query  602   --MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
               ++  +++T KKPDKILPCPRC+S+DTKFCY+NNYN NQPRHFC+ CQRYWT+GG  RN
Sbjct  116   NEVNTSQERTKKKPDKILPCPRCNSLDTKFCYYNNYNVNQPRHFCRNCQRYWTAGGTMRN  175

Query  776   LPVGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----  934
             +PVGAGRRK KNS + +    +   +FQ A  + PE I H   K NG VL+  SD     
Sbjct  176   VPVGAGRRKNKNSMSQFRRITLSDAAFQTAGPEVPEPIHHTPQKPNGTVLSFGSDTPLCE  235

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S+AS LN+AEKT  N + NGF++P E   Q+         D  S  SSVTA+++ DD   
Sbjct  236   SMASVLNLAEKTGNNCNRNGFHRPEE---QMIPFPAVENCDEHSTGSSVTASNSTDDGSG  292

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
               + + + Q+  GF  ++P     PWPY      WS   P P      FP+ F+P   Y 
Sbjct  293   ANMQEPVIQDCQGFPSRIPYINGSPWPY-----LWS---PVPAFCPSSFPVSFHPAPAYW  344

Query  1295  GYTIPCSWNAPWVSRPVA--PQHHTSSGPNSPTLGKHSRD------DNNKEGEPQPPKDS  1450
             G  +  +W+ PW+  P+A      + SGPNSPTLGKHSR+       N+++G    PK S
Sbjct  345   GCPVAGTWSIPWL-LPLASSDNGSSGSGPNSPTLGKHSREGELLSHTNSEKG--GSPKQS  401

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASK  1627
               E CLW+PKTLR DDPE+AAKSSIWATLG +HD  + + GG  FKAF+ K +  +H ++
Sbjct  402   KQEGCLWIPKTLRIDDPEEAAKSSIWATLGFKHDTANGVSGGGLFKAFQKKVEVKNHTAE  461

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                  L ANPAALSRSLNF ESS
Sbjct  462   TSPA-LHANPAALSRSLNFQESS  483



>ref|XP_003524761.1| PREDICTED: cyclic dof factor 3-like [Glycine max]
 gb|KHN48693.1| Dof zinc finger protein DOF3.3 [Glycine soja]
Length=473

 Score =   311 bits (797),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 212/498 (43%), Positives = 279/498 (56%), Gaps = 44/498 (9%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP I+LFG  I FP+        ++ VD      E+    +     E E  ED Q  K+
Sbjct  5     RDPAIRLFGQKIPFPE--------DVVVDKEEKEIESGEEREQ----EMEKYED-QGHKD  51

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
                E + E + +        E     +  E     K P ++E+   ++   T++E+G  +
Sbjct  52    AGVENVTEEELEVDPPPNAEETKNSGSSPEAIVNPKTPSIEEETEKSKGDKTEKEQGDAA  111

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N ++KTLKKPDK+LPCPRC SMDTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PVG
Sbjct  112   NSQEKTLKKPDKVLPCPRCKSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVG  171

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHA--LKANGKVLTLA-------SDS  937
             AGRRK KNS +HY H+   ++ Q A      RI  H   LK NG+VL+          DS
Sbjct  172   AGRRKNKNSTSHYRHITISEALQAA------RIDSHLPPLKGNGRVLSFGLDAHAPICDS  225

Query  938   VASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             +AS  N+ EK   N + NGF+   E   +           D SS +SS+T +S+K +  K
Sbjct  226   MASVNNLGEKKPLNCTRNGFHHGFEDQRLPPVPCKSGENGDDSSTTSSITVSSSKGENNK  285

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
             N          HGF PQLPC     WPY      W+S VPPP     GFP+PFY PA + 
Sbjct  286   NTFQQQSVPQNHGFLPQLPCIPGVSWPY-----TWNSPVPPPAMCPSGFPLPFY-PATFW  339

Query  1295  GYTIPCSWNAPWVSRPVAPQH--HTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK--  1462
                +P +WN P  S   +  +    SS PNSPTLGKHSRD +  +    P ++++  +  
Sbjct  340   NCGMPGNWNVPLFSSHSSASNLESRSSSPNSPTLGKHSRDGDMIKQYSLPKEEASKPRNG  399

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVL  1642
              + VPKTLR DDP +AAKSSIWATLGI+++ V    GG FKAF+ K +E +H       L
Sbjct  400   GVLVPKTLRIDDPSEAAKSSIWATLGIKNESVSG--GGMFKAFQSKKNEKNHVE--ASPL  455

Query  1643  LEANPAALSRSLNFHESS  1696
             L ANPAALSRSLNFHE+S
Sbjct  456   LMANPAALSRSLNFHENS  473



>ref|XP_008802580.1| PREDICTED: cyclic dof factor 3-like [Phoenix dactylifera]
Length=483

 Score =   311 bits (798),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 211/500 (42%), Positives = 279/500 (56%), Gaps = 55/500 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEP-GEDEQQQ  421
             ++DP IKLFG TI  P                 A  EA ++++D    + +  G  +++ 
Sbjct  23    SRDPAIKLFGKTIPLP-----------------AGGEAPAVSRDDEREKDDAKGSSDREA  65

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              +E+  +  +S   EG    + E  +  T  E          D++    +    +E++ +
Sbjct  66    AHESKGKDHDSPNSEG----KSEPPISSTGSETPKN----SSDQETIPAKNLQPEEQKNE  117

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +  ++KT KKPDKIL CPRC S+DTKFCY+NNYN NQPRHFC+ CQRYWT+GG  RN+P
Sbjct  118   ANTSQEKTTKKPDKILACPRCSSLDTKFCYYNNYNVNQPRHFCRHCQRYWTAGGTMRNVP  177

Query  782   VGAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----SV  940
             VGAGRRK KNS + +   ++   SFQ A  + PE +    LK NG VL+  SD     S+
Sbjct  178   VGAGRRKNKNSMSQFRHISLSDASFQTARPEAPEPVHPTPLKPNGTVLSFGSDTPLCESM  237

Query  941   ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNG  1120
             AS LN+AEKT  N + NGF++P E   Q+         D  S  SSVTA+++ DD     
Sbjct  238   ASVLNLAEKTMKNCNRNGFHRPEE---QMVPFPAVENGDEQSTGSSVTASNSTDDGSGAN  294

Query  1121  LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGY  1300
             + + + Q   GF  Q P     PWPY      WS   P P       PMPF+P   Y G 
Sbjct  295   IREPVVQGCRGFPAQFPYINGSPWPY-----LWS---PVPAFCPSSVPMPFHPAPAYWGC  346

Query  1301  TIPCSWNAPWVSRPVA--PQHHTSSGPNSPTLGKHSR-----DDNNKEGEPQPPKDSNPE  1459
              +  +W+ PW   P+A      + SGPNSPTLGKHSR     D  N E E + PK  N E
Sbjct  347   PVAGTWSIPW-PLPLASSDNGSSGSGPNSPTLGKHSREGEMLDQANSEKESR-PKQGNQE  404

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHASKNCR  1636
             +CLW+PKTLR DDPE+AAKSSIWATLG + D  D I G G FKAF+ K +  +  ++  +
Sbjct  405   RCLWIPKTLRIDDPEEAAKSSIWATLGFKKDSADRISGAGLFKAFQKKAEVKNLIAETSQ  464

Query  1637  VLLEANPAALSRSLNFHESS  1696
             V L ANPAALSRSLNF ESS
Sbjct  465   V-LHANPAALSRSLNFLESS  483



>ref|XP_011013327.1| PREDICTED: cyclic dof factor 2-like [Populus euphratica]
Length=496

 Score =   310 bits (795),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 215/515 (42%), Positives = 284/515 (55%), Gaps = 54/515 (10%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQ-----  415
             D  IKLFG TI            E DV      S AN++ + SS + A P E E+     
Sbjct  3     DLAIKLFGKTIPL-----QVNQLEEDV------SRANNMHESSSRTPAAPPETEEYCYTA  51

Query  416   --------------QQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDE  553
                             +  +GE +   K+++ T     E   D T   I +  + P V+ 
Sbjct  52    TTCLHEKDKEEQEGNHRESSGEEISNEKQEDVTSCQITEESKDPTSSRISENPQTPSVER  111

Query  554   DCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCK  733
             +  S + S+ DEE+ + S  ++KT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK
Sbjct  112   ETSSLK-SSKDEEQSETSISQEKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCK  170

Query  734   KCQRYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHALKAN  907
             KCQRYWT+GG  RN+PVGAGRRK K +SA+HY HL    + +   V     + + A   N
Sbjct  171   KCQRYWTAGGTMRNVPVGAGRRKNKSSSASHYRHLMVSDALRTVQVHAMNGVHNPAFGNN  230

Query  908   GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
               VL   SD     SV+S LN++EKT      N +++P E  I V  G   +  D  S  
Sbjct  231   STVLAFGSDSRLCESVSSVLNLSEKTQ-KSVRNEYHRP-EHRIFVPCGGAGSNGDDRSSG  288

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS  1252
             S  TA+ + +  C       + ++Y  F  Q+P F  PPWPYP     W++A+PPP    
Sbjct  289   SLATASDSSEKGCNGNSRGAVNKDYQSFPSQVPWFPGPPWPYP-----WNTALPPPTFCP  343

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAP--QHHTS-SGPNSPTLGKHSRDDNNKE  1423
             PGFP+ FYP   Y G T+P  WN P    P +P  +H T  S P SP LGKHSRD N   
Sbjct  344   PGFPVSFYPAPTYWGCTVPSPWNVPPCVSPPSPSLKHCTQDSSPTSP-LGKHSRDGNILH  402

Query  1424  G---EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAF  1591
                 E    + +   K + VPKT R DDP +AAKSSIWATLGI  ++ +SI GG  FK F
Sbjct  403   PAYLEEASREGTKSVKGVLVPKTSRIDDPSEAAKSSIWATLGIMSEKSNSINGGGLFKGF  462

Query  1592  KMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + K+++ ++ +    V L+ANPAALSRSLNFHE++
Sbjct  463   QSKNEDKNYMAGTTSV-LQANPAALSRSLNFHENT  496



>emb|CDP00347.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   307 bits (787),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 195/499 (39%), Positives = 274/499 (55%), Gaps = 57/499 (11%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI  P           D  P    S +N+ A              + +KN
Sbjct  5     KDPEIKLFGKTISLPQNTSVSSSVHAD-HPDDRQSSSNTAA-------------SEDKKN  50

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQ-TVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
               GE + E+K+++       E + ++ ++  I D  K    + +  S +   T+EE G  
Sbjct  51    TLGEELAENKQEDDLSNPTAEELTERASISGISDDHKTSSAENETLSPK--NTNEELGDN  108

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             ++ ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  109   NSSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  168

Query  785   GAGRRKTKNS--AAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----DSVA  943
             G+GRRK KN+  +++ H+    + Q A  D    +   ALKANG VLT  S     +S+A
Sbjct  169   GSGRRKNKNTCPSSYRHIMVSDALQAARGDGANGLHLPALKANGTVLTFGSERPLCESMA  228

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             + LN+AE+   N   NGF+ P     +  +       + +   S+ ++++  +   K G 
Sbjct  229   TVLNLAERPR-NHLPNGFHVP-----EQRFSIPCGVREIAKDRSTGSSSTISNSTEKGGS  282

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
              + +  N  G+   +P F  PPWP                  SPGFP+ FYP   + G  
Sbjct  283   VESVSNNCQGYIQAVPPFSGPPWP------------------SPGFPISFYPAPPFWGCA  324

Query  1304  IPCSWNAPWVS-RPVAPQHHT-SSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEK  1462
              P  WN PW+S  P +P H   S+ P SPTLGKH+R+ N     N   E +     N E 
Sbjct  325   APTPWNLPWLSPAPSSPDHSALSATPTSPTLGKHTRNGNVLSPTNLLKEEETFDRKNAEG  384

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRV  1639
              + +PKTLR DDP +AAKSSIW+TLGI++++ +SI RG  FKAF  K D  +  + +  +
Sbjct  385   SILIPKTLRIDDPNEAAKSSIWSTLGIKNEKSESINRGSLFKAFPSKGDPKNRVA-DTSL  443

Query  1640  LLEANPAALSRSLNFHESS  1696
             +L+ANPAA SRS +F ES+
Sbjct  444   VLQANPAAFSRSQSFREST  462



>ref|XP_007155301.1| hypothetical protein PHAVU_003G1893001g, partial [Phaseolus vulgaris]
 gb|ESW27295.1| hypothetical protein PHAVU_003G1893001g, partial [Phaseolus vulgaris]
Length=424

 Score =   305 bits (781),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 193/402 (48%), Positives = 248/402 (62%), Gaps = 27/402 (7%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             + P ++E+   ++   +++E+G  +N ++KTLKKPDK+LPCPRC SMDTKFCY+NNYN N
Sbjct  36    ETPSIEEETAKSKADKSEKEQGDAANSQEKTLKKPDKVLPCPRCKSMDTKFCYYNNYNVN  95

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH  889
             QPR+FCK CQRYWT+GG  RN+PVGAGRRK KNS +HY H++  ++ Q A +D       
Sbjct  96    QPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNSTSHYRHISISEALQAARIDSHNGTHL  155

Query  890   HALKANGKVLTLA-------SDSVASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYgagd  1045
               LK NG+VL+          DS+AS LN+ EK   NG+ NGF    E  G+ +   +G+
Sbjct  156   PTLKGNGRVLSFGLDANAPICDSMASVLNLGEKKVPNGTKNGFPHGFEDQGLPIPRKSGE  215

Query  1046  ngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS  1225
             NG D S+ SS   + S  +   KN          HGF PQLPC    PWP+      W+S
Sbjct  216   NGDDSSTTSSITVSNSMGES-SKNTFQQQPVLQPHGFIPQLPCV---PWPF-----TWNS  266

Query  1226  AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSR--PVAPQHHTSSGPNSPTLGKH  1399
              VPPP     GFP+PFYPPA +    +P +WN PW S     +  +  SS PNSPTLGKH
Sbjct  267   PVPPPALCPSGFPLPFYPPATFWNCGMPGNWNVPWFSSLSSASNPNSPSSAPNSPTLGKH  326

Query  1400  SRD-DNNKEGEPQPPKDSNPEK-CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG  1573
             SRD D  K+      + S P    + VPKTLR DDP +AAKSSIWATLGI+++ +    G
Sbjct  327   SRDGDMIKQDSLHKEEASKPRNGGVLVPKTLRIDDPNEAAKSSIWATLGIKNESLSG--G  384

Query  1574  GAFK-AFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             G FK AF+ K DE S        +L ANPAALSRSLNFHE+S
Sbjct  385   GMFKAAFQSKKDEKSRVE--ASPVLMANPAALSRSLNFHENS  424



>ref|XP_010029927.1| PREDICTED: cyclic dof factor 3 [Eucalyptus grandis]
 gb|KCW83620.1| hypothetical protein EUGRSUZ_B00515 [Eucalyptus grandis]
Length=462

 Score =   306 bits (784),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 213/502 (42%), Positives = 281/502 (56%), Gaps = 56/502 (11%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M E T DP I+LFG  I        P  +  D   G   S  NS             +DE
Sbjct  1     MVEMTSDPAIRLFGKKIPLSYTGESPEASSGD---GVVYSGVNSEE-----------DDE  46

Query  413   QQQKNENGERMD-ESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE  589
               +K  + E    E +ED+  V  E       TV+      K P ++E+   T+ S  D+
Sbjct  47    GSEKCHSIEHFAMEVQEDDDQVSPE-------TVNP-----KTPSIEEESAKTKASGIDQ  94

Query  590   EEGKMSNGKDKT-LKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGM  766
             E+G  SN ++K  LKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG 
Sbjct  95    EQGDSSNSQEKPPLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGT  154

Query  767   TRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL-----A  928
              RN+PVGAGRRK+K+SA+HY  +   ++ Q A +D P        K NG VLT      A
Sbjct  155   MRNVPVGAGRRKSKSSASHYRQITLSEALQAARIDAPNGTHLPNGKINGTVLTFGLDPSA  214

Query  929   SDSVASELNIAEK--TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
              DS+A  LN++ K  +A N   NGF      G+ V   +G+   D SS SS   +  T +
Sbjct  215   GDSMAVALNLSNKEGSAMNRMQNGFCDFGRNGVSVPQRSGEKNDDCSSRSSVAISNLTDE  274

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPP  1282
                 NG  ++   + +GF PQ PC+   P PYP     W+ A+ PP  +  GF +P YP 
Sbjct  275   G---NGNSNLEGSSANGFHPQFPCYPGVPQPYP-----WNPAMLPPPFYPSGFAVPIYPA  326

Query  1283  AMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEG----EPQPPKDS  1450
              ++    +  SWN P +S P   Q  ++SGP+SPTLGKH+R+    E     E +P K  
Sbjct  327   PLW-NCGLHSSWNFPLLSPPS--QKGSNSGPDSPTLGKHAREGEMVEKVDSVEDEPRKRK  383

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKN  1630
             N   C+ VPKTLR DDP +AAKS+IWATLGI+ D +   + G F+ F+ K +E +H S+ 
Sbjct  384   N--GCVLVPKTLRIDDPSEAAKSTIWATLGIKKDWLG--KDGLFQGFQSKGEEKNHVSET  439

Query  1631  CRVLLEANPAALSRSLNFHESS  1696
               VL  ANPAALSRS+ FHESS
Sbjct  440   ASVLC-ANPAALSRSIKFHESS  460



>gb|KHN01870.1| Dof zinc finger protein DOF3.3 [Glycine soja]
Length=470

 Score =   306 bits (783),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 213/517 (41%), Positives = 269/517 (52%), Gaps = 85/517 (16%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPG----EDEQ  415
             KDP IKLFG  I FP                 A  E  S A D    E + G    + ++
Sbjct  5     KDPAIKLFGQKIAFPGEADSQAI---------AGGETGSPAMDVDKDEEDFGIGNPDKDE  55

Query  416   QQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEE  595
             + K+   E++ E  +       E +   D    +  +G++ P+           + DEE 
Sbjct  56    KDKDPRAEKVSEKTK-------EADPPPDAADSKTSEGIQNPNT---------PSIDEES  99

Query  596   GKMSNGKD----------KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
              K  N K           KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPR+FCK CQR
Sbjct  100   AKSKNDKSENDQQENNNNKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQR  159

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT  922
             YWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q A +D P     H LK NG+VL+
Sbjct  160   YWTAGGTMRNVPVGAGRRKNKNSASHYRHITISEALQAARIDAPNGT--HLLKQNGRVLS  217

Query  923   LA-----SDSVASELNIAEKTAG---NGSLNGFYKPVELGIQVSYgagdngadhssgsss  1078
                     DS+AS LN+  +  G   N + NGF+  +E          +N       S+S
Sbjct  218   FGLDPPICDSMASILNLTAEKKGSLNNNTRNGFHT-IEDQRNKDNHNNNNNNGDDCSSAS  276

Query  1079  vtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPG  1258
                 S ++         ++  N +GF   +PC    PWPYP     + SA   P    PG
Sbjct  277   SITVSNEESGKSTSQESIMVPNSNGFIHHVPCISTLPWPYP-----FPSAA--PAMCPPG  329

Query  1259  FPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-------SSGPNSPTLGKHSRDDNN  1417
             FPM FYP A          WN PW   P    HH+       SSGPNSPTLGKHSRDD+ 
Sbjct  330   FPMSFYPAAF---------WNIPWF--PSQHSHHSAPTPRSPSSGPNSPTLGKHSRDDDA  378

Query  1418  KE----GEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFK  1585
             ++     E  P +  N    + VPKTLR DDP +AAKSSIWATLGI+++ V    GG FK
Sbjct  379   EKQDHLQEESPSRQRN--GSVLVPKTLRIDDPSEAAKSSIWATLGIKNECVTG--GGMFK  434

Query  1586  AFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              F+ K DE  H  +   V L ANPAALSRSLNFHE+S
Sbjct  435   GFQSKKDEKDHVVEASPV-LRANPAALSRSLNFHENS  470



>ref|XP_004299352.1| PREDICTED: cyclic dof factor 3-like [Fragaria vesca subsp. vesca]
Length=462

 Score =   304 bits (778),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 213/504 (42%), Positives = 276/504 (55%), Gaps = 68/504 (13%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASE---ANSLAKDSSCSEAEPGEDEQQ  418
             KDP IKLFGM I  P                GA  E     SLA++   S  +  E++ +
Sbjct  6     KDPAIKLFGMKIPLP---------------AGADDEDLRFTSLAREEKRSRVDNQEEDVE  50

Query  419   QKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEG  598
              K+    +  ES E++       +    + + E     K P +DE+    + S  ++E+ 
Sbjct  51    DKDSPSTKATESIEEQDDSPKTEDSTSMEMLPECNVNPKTPSIDEESAKPK-SPEEKEQN  109

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
               +N K+KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  110   DATNSKEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNV  169

Query  779   PVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL-----ASDSV  940
             PVGAGRRK KNSA+HY  +    + Q A +D P    H  LK+NG+VL+        DS+
Sbjct  170   PVGAGRRKNKNSASHYRQITISDALQVARMDAPNGAHHPGLKSNGRVLSFGVDTPVCDSM  229

Query  941   ASELNIAEKTAGNGSL-NGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVC--  1111
             AS LN+A K   NG+  NGF+K  EL                            DD+   
Sbjct  230   ASVLNLANKKVLNGTTRNGFHKSEELVFPAPC----------------KDKENGDDITAS  273

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMY  1291
             K  +P     N +GF+  +PC    PWPY     QW+SAVPPP    PG P+P + PA Y
Sbjct  274   KPQIP-----NANGFSSHIPCLPGVPWPY-----QWNSAVPPPAFAPPGMPIPVF-PAPY  322

Query  1292  LGYTIPCSWNAPWVS-RPVAPQHHT-SSGPNSPTLGKHSRDDNNKEGE-----PQPPKDS  1450
                 IP     PW + +P +P   T +S  +SP LGKHSR+      E      +P K  
Sbjct  323   WNCGIPFQVPVPWFNPQPASPNQKTPNSASSSPILGKHSREREILRPEVHLEKEEPSKQK  382

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF--KMKDDENSHAS  1624
             N   C+ VPKTLR DDP +AAKSSIW+TLGI++D + S + G FKAF  + K D+  H  
Sbjct  383   N--GCVLVPKTLRIDDPSEAAKSSIWSTLGIKNDCISSGK-GLFKAFQSQSKGDQKKHVL  439

Query  1625  KNCRVLLEANPAALSRSLNFHESS  1696
             +    +L ANPAALSRSLNFHES+
Sbjct  440   ETSPAML-ANPAALSRSLNFHEST  462



>ref|XP_006578570.1| PREDICTED: cyclic dof factor 3-like [Glycine max]
Length=470

 Score =   301 bits (771),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 218/515 (42%), Positives = 269/515 (52%), Gaps = 81/515 (16%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppT--EMDVDPGGAASEANSLAKDSS-CSEAEPGEDEQQ  418
             KDP IKLFG  I FP           E D  P      A  + KD        P +DE+ 
Sbjct  5     KDPAIKLFGQKIAFPGEADSQAIAGGETDWPP------AMDVDKDEEDFGIGNPDKDEKD  58

Query  419   QKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEG  598
              K+   E++ E  +       E +   D    +  +G++ P+           + DEE  
Sbjct  59    -KDPRAEKVSEKTK-------EADPPPDAADSKTSEGIQNPNT---------PSIDEESA  101

Query  599   KMSNGKD----------KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             K  N K           KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPR+FCK CQRY
Sbjct  102   KSKNDKSENDQQENNNNKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQRY  161

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q A +D P     H LK NG+VL+ 
Sbjct  162   WTAGGTMRNVPVGAGRRKNKNSASHYRHITISEALQAARIDAPNGT--HLLKQNGRVLSF  219

Query  926   A-----SDSVASELNI-AEK--TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
                    DS+AS LN+ AEK  T  N + NGF+  +E          +N       S+S 
Sbjct  220   GLDPPICDSMASILNLTAEKKGTLNNNTRNGFHT-IEDQRNKDNHNNNNNNGDDCSSASS  278

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
                S ++         ++  N +GF  Q+PC    PWPYP     + SA   P    PGF
Sbjct  279   ITVSNEESGKSTSQESIMVPNSNGFIHQVPCISTLPWPYP-----FPSAA--PAMCPPGF  331

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHT-------SSGPNSPTLGKHSRDDNNK  1420
             PM FYP A          WN PW   P    HH+       SSGPNSPTLGKHSR    K
Sbjct  332   PMSFYPAAF---------WNIPWF--PSQHSHHSAPTPRSPSSGPNSPTLGKHSRVVAEK  380

Query  1421  EG---EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF  1591
             +    E  P +  N    + VPKTLR DDP +AAKSSIWATLGI+++ V    GG FK F
Sbjct  381   QDHLQEESPSRQRN--GSVLVPKTLRIDDPSEAAKSSIWATLGIKNECVTG--GGMFKGF  436

Query  1592  KMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + K DE  H  +   V L ANPAALSRSLNFHE+S
Sbjct  437   QSKKDEKDHVVEASPV-LRANPAALSRSLNFHENS  470



>ref|XP_010089911.1| Dof zinc finger protein [Morus notabilis]
 gb|EXB38571.1| Dof zinc finger protein [Morus notabilis]
Length=496

 Score =   299 bits (766),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 223/532 (42%), Positives = 288/532 (54%), Gaps = 87/532 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP IKLFG  I  P                 A  EA +++ +   S+    ED  +++
Sbjct  4     SKDPAIKLFGKKIAVP-----------------ADDEARAVSGEELASQPLEKEDVNEEE  46

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGL-------------KAPHVDEDCGS  565
              E      E K+       E  G       E  D +             K P V+E+   
Sbjct  47    TET-----EMKDSPPRSASENSGQDSDPPSETEDSINPETLPDSSNVNPKTPSVNEESAK  101

Query  566   TEISTTDEEEGKMS--NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKC  739
             + I+  D E+   S  N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK C
Sbjct  102   SNIAKIDNEKNNASAANAQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKAC  161

Query  740   QRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVD-------------HPE  877
             QRYWT+GG  RN+PVGAGRRK KNS++HY H+   ++ Q A ++             H  
Sbjct  162   QRYWTAGGTMRNVPVGAGRRKNKNSSSHYRHITISEALQAARIEAAPPNGTHPHHHHHHH  221

Query  878   RIQHHALKANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgag  1042
                H ALK+NG+VL+ A      DS+AS LN+ +        NGF+K  E G       G
Sbjct  222   HHHHPALKSNGRVLSFALDAPICDSMASVLNLTDNK--KAPRNGFHKTEERGFP-GPCKG  278

Query  1043  dngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWS  1222
                 D  S +SS+T +++ D+V +N   +    N +GF+  +PC    PWPYP     W+
Sbjct  279   RENGDDCSSASSITVSNSMDEVGRNSTQEPQVHNMNGFS-SIPCIPGVPWPYP-----WN  332

Query  1223  SAV-----PPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSS---GPN  1378
             SAV     PPP    PGFPM FY PA Y    +P +WN PW + P       +S   G N
Sbjct  333   SAVPPPPPPPPPFCPPGFPMSFY-PAAYWNCAVPGTWNIPWFAPPQPSSPSQNSPSLGSN  391

Query  1379  SPTLGKHSRD------DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLG  1540
             SPTLGKHSRD      D+ ++ EP  PK+ +    + VPKTLR DDP +AAKSSIWATLG
Sbjct  392   SPTLGKHSRDGEILKSDSLEKEEPSKPKNGS----VLVPKTLRIDDPTEAAKSSIWATLG  447

Query  1541  IQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             I++D +    GG FKAF+ K DE    ++   V L ANPAALSRSL FHESS
Sbjct  448   IKNDGISG--GGMFKAFQSKSDEKKSMAETSPV-LRANPAALSRSLKFHESS  496



>emb|CBI22234.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   296 bits (757),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 196/502 (39%), Positives = 254/502 (51%), Gaps = 124/502 (25%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTE----MDVDPGGAASEANSLAKDSSCSE--AEPGED  409
             KDP IKLFG TI  P+        +      V  GG      + A +SS  E     GE+
Sbjct  5     KDPAIKLFGKTIPLPEVATAAAGNDSPSGATVGGGGEDWVDQNRATNSSPEEDCVRAGEE  64

Query  410   EQQ-QKNENGERMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKAPHVDEDCGSTEISTT  583
              ++  K+ +G ++ ++++++G      E   D   +  + +  K P  D++  + + S  
Sbjct  65    GREVDKDTSGGKVTDTRQEDGARSSTSEEFTDPDANSGVNENPKTPSADKETATLKCSKN  124

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             +EE+ + S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  125   EEEQSETSISQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  184

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD--  934
               RN+PVGAGRRK KNS +HY H+   ++ Q+A  D P  I H ALK NG VLT  SD  
Sbjct  185   TMRNVPVGAGRRKNKNSTSHYRHITVSEALQSARTDVPNGIHHPALKTNGTVLTFGSDTP  244

Query  935   ---SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
                S+AS LN+AEKT  N + NGF+KP +L I V YG                     D 
Sbjct  245   LCESMASVLNLAEKTMRNCTPNGFHKPEKLRIPVPYG---------------------DQ  283

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPA  1285
             V +N                                     +PPP     GFPMPFYP A
Sbjct  284   VMRN-------------------------------------LPPPAFCPSGFPMPFYPAA  306

Query  1286  MYLGYTIPCSWNAPWVSRPVAPQHHT-SSGPNSPTLGKHSRDDN----NKEGEPQPPKDS  1450
              Y G T+P +WN PWV +P A  H   SSGPNSPTLGKHSRD+N    +  GE +  K++
Sbjct  307   AYWGCTVPGAWNIPWVPQPSALNHTAPSSGPNSPTLGKHSRDENMLKASNFGEEELQKEN  366

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKN  1630
             N E                                              + DE +H ++ 
Sbjct  367   NSE----------------------------------------------RSDEKNHIAET  380

Query  1631  CRVLLEANPAALSRSLNFHESS  1696
               V L+ANPAALSRSLNFHESS
Sbjct  381   SPV-LQANPAALSRSLNFHESS  401



>ref|XP_004508727.1| PREDICTED: cyclic dof factor 3-like [Cicer arietinum]
Length=444

 Score =   296 bits (759),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 201/492 (41%), Positives = 266/492 (54%), Gaps = 61/492 (12%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             T+D TI LFG  I           +  D D G        L ++   +  +P  +   ++
Sbjct  4     TRDSTISLFGHKIPL---------SAGDRDGGEGYEGEQELHEEKYQTHEDPEAENVTER  54

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
              +        +E E +     EGI +         LK P ++E     EI+ + +++ + 
Sbjct  55    VQETYPPSNLEEAENSGNSSPEGITN---------LKTPSIEE-----EIAKSKDDKSEK  100

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
                ++KTLKKPDK+LPCPRC+SMDTKFCY+NNYN NQPR+FC+ CQRYWT+GG TRN+PV
Sbjct  101   EQSQEKTLKKPDKLLPCPRCNSMDTKFCYYNNYNVNQPRYFCRACQRYWTAGGATRNVPV  160

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----DSVAS  946
             GAGRRK KNSA+HY H+   ++ Q A +D P     H+LK+NG+V++  S     DS+AS
Sbjct  161   GAGRRKNKNSASHYNHITISEALQEATIDSPNGTHIHSLKSNGRVISFGSDAPICDSMAS  220

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP  1126
               N  EK   +G+ N F+   +  +    G   +   +S G S+ +  ST         P
Sbjct  221   VQNTGEKKVVDGTRNRFHGLEDQSLHGENGDEYSSVSNSMGESNKSTTST--------FP  272

Query  1127  DMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP-GFPMPFYPPAMYLGYT  1303
               + QN +GF PQLPC    PWPY      W+S VPPP    P GF  P Y P       
Sbjct  273   QPVLQN-NGFLPQLPCMPNVPWPY-----TWNSPVPPPHGLCPLGFSFPIYQPTF-----  321

Query  1304  IPCSWNAPWV--SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVP  1477
                 WN PW       +     SSGPNSPTLGKHSRD        +P K  N    + VP
Sbjct  322   ----WNVPWFPSHSYASSSMSPSSGPNSPTLGKHSRDSEQDSSHKEPSKHRNGR--VLVP  375

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             KTLR DDP +AAKSSIW TLGI+++     RGG FKAF+ K  E +    +   +L ANP
Sbjct  376   KTLRIDDPSEAAKSSIWTTLGIKNESAS--RGGMFKAFQSKRGERNGIETSS--VLMANP  431

Query  1658  AALSRSLNFHES  1693
             AALSRSLNFHE+
Sbjct  432   AALSRSLNFHEN  443



>ref|XP_010937173.1| PREDICTED: cyclic dof factor 3-like [Elaeis guineensis]
Length=457

 Score =   296 bits (757),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 202/499 (40%), Positives = 274/499 (55%), Gaps = 60/499 (12%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++D  IKLFG TI FP                  AS+ N   ++   S  +    E + K
Sbjct  4     SRDQAIKLFGKTIAFP------------------ASDDNRKKEEDKGSSDKATIHETKDK  45

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
               +   +D   + E  +       +  + D+    +K                +E++ + 
Sbjct  46    GHDS--LDLETKSEPPISSSANETLRTSADQAATAMKN------------LKPEEQKNET  91

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
                ++K +K+PDKILPCPRC S+DTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  92    GTSQEKMMKRPDKILPCPRCSSLDTKFCYYNNYNVNQPRHFCKHCQRYWTAGGTMRNVPV  151

Query  785   GAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----SVA  943
             GAGRRK KNSA+ +   +V   +FQ    + P+ I H  LK NG VL+   D     SVA
Sbjct  152   GAGRRKNKNSASQFRHISVSDATFQTVRPEVPDPIHHPPLKPNGTVLSFGLDTPRCESVA  211

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVS-YgagdngadhssgsssvtaasTKDDVCKNG  1120
             S  N+A KT  N + NGF++P E   QV+ + A +NG D SSGSS   + ST D +  N 
Sbjct  212   SVFNLANKTMKNCNQNGFHRPEE---QVAPFSAVENGDDRSSGSSVTASNSTGDGIGANQ  268

Query  1121  LPDMLKQNYHGFAPQLPCFQ-APPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
                ++ QN  G   Q P    + PWPYP     WS   P P  FS  +P+ FYP   Y  
Sbjct  269   QEPVI-QNCQGVPDQSPYISGSSPWPYP-----WS---PVPAFFSSNYPLSFYPAPAYWS  319

Query  1298  YTIPCSWNAPWVSRPV-APQHHTSSGPNSPTLGKHSRD----DNNKEGEPQPPKDSNPEK  1462
                P +W+ PW+  P  +    + +G NSPTLGKHSR+    DN    + +  K SN E+
Sbjct  320   CAGPGTWSFPWICPPTSSSNGSSGAGSNSPTLGKHSREGEVLDNTDSEKGESLKPSNQER  379

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRV  1639
             C W+PKTLR  DP++AAKSSIW T+G ++D  D I GG  FKAF+ K+   +H ++  ++
Sbjct  380   CPWIPKTLRMHDPKEAAKSSIWTTMGFKYDSADVISGGMLFKAFQKKEGTKNHTAETSQI  439

Query  1640  LLEANPAALSRSLNFHESS  1696
              L ANPAALSR+L F ESS
Sbjct  440   -LHANPAALSRALYFQESS  457



>ref|XP_007138175.1| hypothetical protein PHAVU_009G186600g [Phaseolus vulgaris]
 gb|ESW10169.1| hypothetical protein PHAVU_009G186600g [Phaseolus vulgaris]
Length=480

 Score =   296 bits (757),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 213/520 (41%), Positives = 276/520 (53%), Gaps = 81/520 (16%)
 Frame = +2

Query  248   KDPTIKLFGMTIQF---PDApppppp----TEMDVDPGGAASEANSLAKDSSCSEAEPGE  406
             KDP I+LFG  I F   PDA              +     A E      D + SEAE  +
Sbjct  5     KDPAIRLFGQKIAFSGEPDARTIAAVEIAWPPPPMVVVRVAEEEEEEDDDVADSEAE--D  62

Query  407   DEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTD  586
             DE + K+   E  +++KE +   L        +T + I++    P +DE+   ++ + ++
Sbjct  63    DENKDKDPPEEVSEKTKEAD---LPPNAADCKKTPEGIQNP-NTPSIDEESAKSKSNKSE  118

Query  587   EEEGKM---------SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKC  739
              ++            S   +K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPR+FCK C
Sbjct  119   NDQTDPTTASATTTNSQDNNKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKAC  178

Query  740   QRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKV  916
             QRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q A +D P     H LK NG+V
Sbjct  179   QRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITISEALQAARIDSPNGT--HLLKPNGRV  236

Query  917   LTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             L+        DS+AS LN+AEK     + NGF           +   D        SS+ 
Sbjct  237   LSFGLDPPICDSMASVLNLAEKK----TRNGF-----------HSNEDQRNKDDDCSSAS  281

Query  1082  taasTKDDVCKNGLPDMLKQNYHGF----APQLPCFQAPPWPYPSSAVQWSSAVP-PPGC  1246
             +   + ++  K+   + L  N +GF       +PC    PW YP     W+S VP PP  
Sbjct  282   SITVSNEESGKSTSQESLMPNNNGFIHHHHHHVPCISTVPWAYP-----WNSGVPSPPAL  336

Query  1247  FSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTS-------SGPNSPTLGKHSR  1405
               PGFPM FYP A          WN PW   P   Q+H +       SGPNSPTLGKHSR
Sbjct  337   CPPGFPMSFYPHAF---------WNIPWF--PTHSQNHAAPAPRSPGSGPNSPTLGKHSR  385

Query  1406  DDNNKEGE---PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG  1576
             DD+    E    +P +  N    + VPKTLR DDP +AAKSSIWATLGI+++ V     G
Sbjct  386   DDDVARQEHLHEEPSRQRN--GSVLVPKTLRIDDPSEAAKSSIWATLGIKNECVSG--AG  441

Query  1577  AFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              FK F+ K DE     +   V L ANPAALSRSLNFHE+S
Sbjct  442   MFKGFQSKKDEKDRVVETSPV-LRANPAALSRSLNFHENS  480



>ref|XP_010552851.1| PREDICTED: cyclic dof factor 2-like [Tarenaya hassleriana]
Length=468

 Score =   295 bits (754),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 212/527 (40%), Positives = 277/527 (53%), Gaps = 106/527 (20%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppT----------EMDVDPGGAASEANSLAKDSSCSEAEP  400
             DP IKLFG TI  P+    P             + D DP  A S  +SL +D++  ++  
Sbjct  3     DPAIKLFGKTIPLPEMDASPSGAASSSGGEVVDQRDQDP--APSPDSSLGEDNTREDSGG  60

Query  401   G--------------EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKA  538
             G              E E++ + EN     E    E + + E  G+     D++    + 
Sbjct  61    GGGGGEEGGCGGEETESEKEIQEENVNDCGEEHGGESSSIQES-GVASSPSDKV----ET  115

Query  539   PHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQP  718
             P  D        +   EEE   S+ + K LKKPDKILPCPRC+SMDTKFCY+NNYN NQP
Sbjct  116   PKPD--------AAKTEEETDASSQETK-LKKPDKILPCPRCNSMDTKFCYYNNYNVNQP  166

Query  719   RHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHAL  898
             RHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+H + +   S   A +  P    HH  
Sbjct  167   RHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHLNRHVNISAAEA-MQKPRTDLHHPN  225

Query  899   KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYgagdngadh  1060
               N  ++T  SD     S+AS LN+A+K A   + NGF +P E L IQ+ Y         
Sbjct  226   GTN--LITFGSDQLLCESMASGLNLADK-AKLKTRNGFCEPTEGLKIQIPY---------  273

Query  1061  ssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAP-PWPYPSSAVQWSSAVPP  1237
                           D   N  P  ++   +   P+ PCF  P  WPY  +   W+     
Sbjct  274   ----------ENNGDTSSN--PPSIEAGVNSSTPKAPCFPGPQAWPYVWNGAPWTV----  317

Query  1238  PGCFSPGFPMPFYPPAMYLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRD  1408
                      +PFYPP +YL Y    P +WN  PW+ +P +P   + SGPNSPTLGKHSRD
Sbjct  318   ---------LPFYPPPVYLSYPGVPPATWNGFPWMVQPNSP---SGSGPNSPTLGKHSRD  365

Query  1409  DN-------NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI  1567
             +N       +KE EP   + S+PE+ LWVPKTLR DDPE+AAKSSIW TLGI    ++  
Sbjct  366   ENMAGPGTSSKETEPSSKEKSDPERSLWVPKTLRMDDPEEAAKSSIWKTLGI----MNGE  421

Query  1568  RGGAFKAFKMKDDENSHASKN---CRV-LLEANPAALSRSLNFHESS  1696
             R   F+AF+    + + A +N    RV  L+ANPAA+SRS+NFHE S
Sbjct  422   RPETFRAFRSNKGKGAIAKENPSPPRVSALQANPAAMSRSVNFHERS  468



>ref|XP_003527086.1| PREDICTED: cyclic dof factor 3-like [Glycine max]
 gb|KHN26253.1| Dof zinc finger protein DOF3.3 [Glycine soja]
Length=458

 Score =   294 bits (752),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 205/508 (40%), Positives = 261/508 (51%), Gaps = 79/508 (16%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG  I F                   A E +  A  +   ++ P  D    K+
Sbjct  5     KDPAIKLFGQKIAF-------------------AGEVDPPAISAGEIDSPPAMD--VDKD  43

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQT--VDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             E  +  D   EDE       E + ++T   D   +   +    E   +    + DEE  K
Sbjct  44    EEDDFGDSETEDEKDKDPRAEKVSEKTKEADPPPNAADSKKTPEGIQNPNTPSIDEESAK  103

Query  602   MSNGKD------KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
                 K       KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPR+FCK CQRYWT+GG
Sbjct  104   SKTNKSENNNNNKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGG  163

Query  764   MTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA----  928
               RN+PVGAGRRK KNSA+HY H+   ++ Q A +D      HH LK NG+VL+      
Sbjct  164   TMRNVPVGAGRRKNKNSASHYRHITISEALQAARIDAAPNGTHHLLKPNGRVLSFGLELD  223

Query  929   ---SDSVASELNI-AEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasT  1096
                 DS+AS LN+ AEK    G+LN   +        +     + +  +  +     +++
Sbjct  224   PPICDSMASVLNLTAEK---KGTLNNNSRNNNNNNNNNGDDCSSASSITVSNEENGKSTS  280

Query  1097  KDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFY  1276
             ++ +        +  N +GF   +PC    PWPYP  +         P    PGFPM FY
Sbjct  281   QESI--------VVPNSNGFIHHVPCISTLPWPYPFPSGA-------PAMCPPGFPMSFY  325

Query  1277  PPAMYLGYTIPCSWNAPWVSRPVAPQHHTSS----GPNSPTLGKHSRDDNNKE----GEP  1432
             P A          WN PW   P    HH+S+     PNSPTLGKHSRDD+  +     E 
Sbjct  326   PAAF---------WNIPWF--PSQHSHHSSAPTPRSPNSPTLGKHSRDDDATKQYHLQEE  374

Query  1433  QPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDEN  1612
             QPP        L VPKTLR DDP +AAKSSIWATLGI+++ V    GG FK F+ K +E 
Sbjct  375   QPPSRQRNGSVL-VPKTLRIDDPSEAAKSSIWATLGIKNECVTG--GGMFKGFQSKKEEK  431

Query  1613  SHASKNCRVLLEANPAALSRSLNFHESS  1696
              H  +   V L ANPAALSRSLNFHE+S
Sbjct  432   DHVVEASPV-LRANPAALSRSLNFHENS  458



>gb|KEH33316.1| DOF-type zinc finger DNA-binding family protein [Medicago truncatula]
Length=465

 Score =   294 bits (753),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 268/505 (53%), Gaps = 64/505 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             TKDP IKLFG  I FP +        E +V P  A         +S   + E   ++  +
Sbjct  4     TKDPEIKLFGKKILFPGEGEALMIDGEENVSPAAAMDVEEERDSESENEDDEEETEKDPE  63

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              +++ E   E+        ++       T+ E     K P +DE+   +E +   E    
Sbjct  64    ADKDTEEKKEADPPPDAAEIKNNNNSAATLPE--GNPKTPSIDEETSKSE-NEQSETTAN  120

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              ++ ++KTLKKPDK+L CPRC+S DTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+P
Sbjct  121   NNDTQEKTLKKPDKLLLCPRCNSADTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVP  180

Query  782   VGAGRRKTKN-SAAHY-HLNAVKSFQNACVDHPERIQH-HALKANGKVLTLA------SD  934
             VGAGRRK KN S++HY H+   ++   A +  P    H   LK NG+VL          D
Sbjct  181   VGAGRRKNKNNSSSHYRHITISEALDAARIISPNGTHHLQNLKTNGRVLNFGLDHPHIYD  240

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S++++LN AEK   N + N        G + S             +SSVT + + ++  K
Sbjct  241   SMSNDLNPAEKKVLNDTRNN-------GDRFS------------SASSVTVSKSMEESGK  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-AVPPPGCFSP-GFPMPFYPPAM  1288
             N   + L Q  +GF PQ+PC  + PWPY      WSS A+P P    P GFPM FYP   
Sbjct  282   NMTQESLPQKNNGFIPQVPCMTSVPWPY-----TWSSGAIPSPQTLCPPGFPMSFYPAPF  336

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGE---------PQPP  1441
                      WN PW   P  P     S P SPTLGKHSRDD+N   E          + P
Sbjct  337   ---------WNVPWFP-PHTPATTPRSSPKSPTLGKHSRDDDNTNDENAKQDSLQTEESP  386

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHA  1621
             K  N   C+ VPKTLR DDP +AAKSSIW TLGI+++ +   RGG  KAF+ K D  +H 
Sbjct  387   KQRN--GCVLVPKTLRIDDPTEAAKSSIWETLGIKNEGLS--RGGMTKAFQSKKDGKNHV  442

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
                   +L ANPAAL+RSLNFHE+S
Sbjct  443   Q--TSPMLMANPAALARSLNFHENS  465



>ref|XP_004154970.1| PREDICTED: dof zinc finger protein DOF3.3-like [Cucumis sativus]
 gb|KGN63675.1| AOBP (Ascorbate oxidase promoter-binding protein) [Cucumis sativus]
Length=467

 Score =   293 bits (751),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 214/506 (42%), Positives = 282/506 (56%), Gaps = 64/506 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP-DAppppppTEMDV-------DPGGAASEANSLAKD-SSCSEAE  397
              KDP IK+FG  IQ P D       T+ D         PG  A     L KD    SE+ 
Sbjct  4     VKDPPIKIFGKEIQLPPDCEVSLIETDDDDSDSFSDKQPGDGA-----LLKDVGKVSESS  58

Query  398   PGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIS  577
              G++E    +E          D   V         QT +E     +   +DE+    E S
Sbjct  59    AGKEETLHDSE----------DSACV---------QTANEAHMNPEVVSMDEN-DKLETS  98

Query  578   TTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
               ++E+    N K+K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT 
Sbjct  99    KPEKEQNGAPNSKEK-LKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTE  157

Query  758   GGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA--  928
             GG  RN+PVGAGRRK KNSA+HY  +   ++ Q A +D P  I   A K+NG+VL  +  
Sbjct  158   GGTMRNVPVGAGRRKNKNSASHYRQITISEALQAAQIDVPNGINCLATKSNGRVLNFSVN  217

Query  929   ---SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                 +S+++ LN A +   NG+ N FY+P + GI+     G+ G D SS SS   ++S +
Sbjct  218   APVCESMSTVLNPAGRKVLNGTRNEFYRPDDQGIKAPCKGGETGDDCSSASSVTMSSSME  277

Query  1100  DDVCKN-GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFY  1276
             +   +    P M  QN +GF PQ+P     PWP       W++ +PPP    PG P+PFY
Sbjct  278   EGARRCPQEPQM--QNINGFPPQIPYLPGVPWP-----CSWNAPMPPPAFCPPGVPLPFY  330

Query  1277  PPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD------DNNKEGEPQP  1438
              PA Y    +P +WN PW   P  P    +SG NSPTLGKHSRD       +N E E +P
Sbjct  331   -PATYWSCGVPGAWNIPWF--PPQPCSQ-NSGANSPTLGKHSRDVGDKLQADNSEKE-EP  385

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSH  1618
             PK  N    + +PKTLR DDP +AAKSSIW TLGI++D + ++     K F+ K ++ + 
Sbjct  386   PKQKN--GSVLIPKTLRIDDPNEAAKSSIWETLGIKNDSIKAV--DLSKVFQSKGEQKNS  441

Query  1619  ASKNCRVLLEANPAALSRSLNFHESS  1696
              S+    +L+ANPAALSRS+ FHE S
Sbjct  442   VSEMLSPVLQANPAALSRSITFHERS  467



>ref|XP_009788566.1| PREDICTED: cyclic dof factor 1-like [Nicotiana sylvestris]
Length=461

 Score =   293 bits (750),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 202/499 (40%), Positives = 269/499 (54%), Gaps = 61/499 (12%)
 Frame = +2

Query  260   IKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGE  439
             +KLFG TI  P           D+     +S A +   D   SEAE      Q KN    
Sbjct  4     VKLFGKTIHLPLD---------DLLDQRNSSAATTSHDDLITSEAE----LTQIKNR---  47

Query  440   RMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKD  619
                    D+ T     E +  +T   I D  K    D++  S + +T  E+  + +  ++
Sbjct  48    -------DDFTNSTADEAVEPETSSGISDDPKKEDADKETSSPK-ATKKEDPSEANVTQE  99

Query  620   KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRR  799
             K LKK DK+LPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  RN+PVG+GRR
Sbjct  100   KALKKLDKMLPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGSGRR  159

Query  800   KTKNS--AAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-----VASELNI  958
             K K+S    + H+    + Q A  +    +    L+ NG VL   SD      +AS LN+
Sbjct  160   KNKSSPTTGYRHIMVSDALQAARFEAAHGMNLPMLRTNGTVLAFGSDKPLCDPMASILNL  219

Query  959   AEKTAGNGSLNGF-----YKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             AEK+  N   NGF       P   G + +     +GA                    N  
Sbjct  220   AEKSQ-NSVQNGFNGSEQRTPSACGGKETGNNISSGACS---------------TASNSA  263

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
              D+  +N+  F PQ+  F   PWPY  +A  W+SAVP P    P FP+PFYP   Y G T
Sbjct  264   HDLAWKNFQAFPPQVHQFPGHPWPYSYNAAPWTSAVPQPNLAPPRFPVPFYPAPPYWGCT  323

Query  1304  IPCSWNAPWVSRPVAPQHHT--SSGPNSPTLGKHSRDD-----NNKEGEPQPPKDSNPEK  1462
             +   WN PWVS P +    +  S+ P SPTLGKHSRD+     +N E E +P +D + E+
Sbjct  324   VASPWNVPWVSPPSSSPDCSVLSATPTSPTLGKHSRDERTLNPSNSEKE-EPLQDIDGER  382

Query  1463  CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSHASKNCRV  1639
              + +PKTLR DDP +AAKSSIW+TLGIQ+++ DS  G   FKAF  K D+  +   +  +
Sbjct  383   SVLIPKTLRVDDPYEAAKSSIWSTLGIQNEKNDSTNGARLFKAFNSKVDDQRNHESDASL  442

Query  1640  LLEANPAALSRSLNFHESS  1696
             +L+ANPAALSRSLNF ES+
Sbjct  443   VLQANPAALSRSLNFQEST  461



>ref|XP_006438711.1| hypothetical protein CICLE_v10031433mg [Citrus clementina]
 gb|ESR51951.1| hypothetical protein CICLE_v10031433mg [Citrus clementina]
Length=468

 Score =   293 bits (750),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 182/424 (43%), Positives = 246/424 (58%), Gaps = 42/424 (10%)
 Frame = +2

Query  482   EGEGIMDQTVDEIR-----DGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKI  646
             E E +  +  D I+     D  K   VD +  S + S+ + E+ + SN ++KTLKKPDKI
Sbjct  63    EHEDVTSKQKDPIKSSGNSDNPKTLSVDRETRSLK-SSKNGEQSETSNSQEKTLKKPDKI  121

Query  647   LPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY  826
             LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K+S+A  
Sbjct  122   LPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSSASN  181

Query  827   HLN-----AVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAG  976
             +       A+++FQ    +    +       NG +LT  SD     SVAS  N+++K+  
Sbjct  182   YRQIMISEALRTFQ---ANASGGVHKPYSGNNGTILTFGSDSPLHESVASVPNLSDKSQ-  237

Query  977   NGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGF  1156
             N   NGF++  E  I VS          +  S + +++  K   C +   D+  +NY G 
Sbjct  238   NCLRNGFHR-SEQKILVS-------GTDNGSSITASSSLEKGGNCTSQ--DIRTKNYRGS  287

Query  1157  APQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS  1336
              PQ+P F  PPWP+      W++ +PPPG +  GFP+ FYP   Y G  +P   N P V 
Sbjct  288   VPQVPYFPGPPWPH-----HWNTPMPPPGFYPSGFPVSFYPETTYWGCAVPGYCNMPCVP  342

Query  1337  RPVAPQ-HHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
                + Q        ++PTLGKHSRD +     + E E       N E+C+ VPKTLR DD
Sbjct  343   PNASLQSQFVPKTLSTPTLGKHSRDGDIITPASTEKEEPSTGSRNSERCVLVPKTLRIDD  402

Query  1499  PEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
             P +AAKSSIWATLGI++++  S     FK F+ K D  ++ ++   V L+ANPAALSRSL
Sbjct  403   PSEAAKSSIWATLGIKNEKTTSAGECLFKGFQSKSDHRNYIAETSEV-LQANPAALSRSL  461

Query  1679  NFHE  1690
             NFHE
Sbjct  462   NFHE  465



>ref|XP_006483138.1| PREDICTED: cyclic dof factor 3-like [Citrus sinensis]
Length=494

 Score =   293 bits (751),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 184/435 (42%), Positives = 247/435 (57%), Gaps = 44/435 (10%)
 Frame = +2

Query  455   KEDEGTVLMEGE--GIMDQTVDEI-----RDGLKAPHVDEDCGSTEISTTDEEEGKMSNG  613
             KE  G  ++E E   +  +  D I      D  K   VD +  S + S+ + E+ + SN 
Sbjct  78    KEHSGQQIIEDEHEDVTSKQKDPITSSGNSDNPKTLSVDRETRSLK-SSKNGEQSETSNS  136

Query  614   KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAG  793
             ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAG
Sbjct  137   QEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAG  196

Query  794   RRKTKNSAAHYHLN-----AVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVA  943
             RRK K+S+A  +       A+++FQ    +    +       NG +LT  SD     SVA
Sbjct  197   RRKNKSSSASNYRQIMISEALRTFQ---ANASGGVHKPYSGNNGTILTFGSDSPLHESVA  253

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S  N+++K+  N   NGF++  E  I VS     +    SS        +++        
Sbjct  254   SVPNLSDKSQ-NCLRNGFHR-SEQKILVSGTDNGSSITASSSLEKGGNCTSQ--------  303

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
              D+  +NY G  PQ+P F  PPWP+      W++ +PPPG +  GFP+ FYP   Y G  
Sbjct  304   -DIRTKNYRGSVPQVPYFPGPPWPH-----HWNTPMPPPGFYPSGFPVSFYPETTYWGCA  357

Query  1304  IPCSWNAPWVSRPVAPQ-HHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEKC  1465
             +P   N P V    + Q        ++PTLGKHSRD +     + E E       N E+C
Sbjct  358   VPGYCNMPCVPPNASLQSQFVPKTLSTPTLGKHSRDGDIITPASTEKEEPSTGSRNSERC  417

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLL  1645
             + VPKTLR DDP +AAKSSIWATLGI++++  S     FK F+ K D  ++ ++   V L
Sbjct  418   VLVPKTLRIDDPSEAAKSSIWATLGIKNEKTTSAGECLFKGFQSKSDHRNYIAETSEV-L  476

Query  1646  EANPAALSRSLNFHE  1690
             +ANPAALSRSLNFHE
Sbjct  477   QANPAALSRSLNFHE  491



>gb|ACJ85660.1| unknown [Medicago truncatula]
Length=465

 Score =   292 bits (748),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 203/505 (40%), Positives = 267/505 (53%), Gaps = 64/505 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             TKDP IKLFG  I FP +        E +V P  A         +S   + E   ++  +
Sbjct  4     TKDPEIKLFGKKILFPGEGEALMIDGEENVSPAAAMDVEEERDSESGNEDDEEETEKDPE  63

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              +++ E   E+        ++       T+ E     K P +DE+   +E +   E    
Sbjct  64    ADKDTEEKKEADPPPDAAEIKNNNNSAATLPE--GNPKTPSIDEETSKSE-NEQSETTAN  120

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              ++ ++KTLKKPDK+L CPRC+S DTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+P
Sbjct  121   NNDTQEKTLKKPDKLLLCPRCNSADTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVP  180

Query  782   VGAGRRKTKN-SAAHY-HLNAVKSFQNACVDHPERIQH-HALKANGKVLTLA------SD  934
             VGAGRRK KN S++HY H+   ++   A +  P    H   LK NG+VL          D
Sbjct  181   VGAGRRKNKNNSSSHYRHITISEALDAARIISPNGTHHLQNLKTNGRVLNFGLDHPHIYD  240

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S++++LN A K   N + N        G + S             +SSVT + + ++  K
Sbjct  241   SMSNDLNPAGKKVLNDTRNN-------GDRFS------------SASSVTVSKSMEESGK  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-AVPPPGCFSP-GFPMPFYPPAM  1288
             N   + L Q  +GF PQ+PC  + PWPY      WSS A+P P    P GFPM FYP   
Sbjct  282   NMTQESLPQKNNGFIPQVPCMTSVPWPY-----TWSSGAIPSPQTLCPPGFPMSFYPAPF  336

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGE---------PQPP  1441
                      WN PW   P  P     S P SPTLGKHSRDD+N   E          + P
Sbjct  337   ---------WNVPWFP-PHTPATTPRSSPKSPTLGKHSRDDDNTNDENAKQDSLQTEESP  386

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHA  1621
             K  N   C+ VPKTLR DDP +AAKSSIW TLGI+++ +   RGG  KAF+ K D  +H 
Sbjct  387   KQRN--GCVLVPKTLRIDDPTEAAKSSIWETLGIKNEGLS--RGGMTKAFQSKKDGKNHV  442

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
                   +L ANPAAL+RSLNFHE+S
Sbjct  443   Q--TSPMLMANPAALARSLNFHENS  465



>ref|XP_004514828.1| PREDICTED: cyclic dof factor 3-like [Cicer arietinum]
Length=484

 Score =   293 bits (749),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 205/524 (39%), Positives = 274/524 (52%), Gaps = 83/524 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP IKLFG  I F                   + EA +L    + + +    D +Q++
Sbjct  4     SKDPAIKLFGQNIPF-------------------SGEAEALTITGNQTASPTIMDVEQEE  44

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVD------EIRDGLKAPHVDEDCGSTEISTTD  586
              +  E  +E +E +     E +    +  D      E ++   A  + +D  +T+  + D
Sbjct  45    RDFDESTNEDEEKDKEHEAEKDTEKKKETDPPPNNAETKNNNSATTLAKDIHNTKRLSID  104

Query  587   EEEG-----------KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCK  733
             EE                N ++K LKKPDKIL CPRC+S+DTKFCY+NNYN NQPR+FCK
Sbjct  105   EETSISENDQTDAATTNHNSQEKILKKPDKILSCPRCNSIDTKFCYYNNYNVNQPRYFCK  164

Query  734   KCQRYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHA-LKA  904
              CQRYWT+GG  RN+PVGAGRRK K NS++HY H+   ++ Q A V  P    H + LK 
Sbjct  165   ACQRYWTAGGTMRNVPVGAGRRKNKNNSSSHYRHITISEALQAARVVAPNGTHHLSNLKT  224

Query  905   NGKVLTLA------SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhss  1066
             NG++L+         DS+ +  N AEK   N + N  +  +E G ++      N   +SS
Sbjct  225   NGRILSFGLDHPQICDSLENVFNPAEKKGLNSTRNSEFHSIE-GTKIPVSRSQNDGHNSS  283

Query  1067  gsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP-PPG  1243
              SS   A S ++   K    + L Q  +GF PQ+PC  + PWPYP     WSS +P PP 
Sbjct  284   ASSKTVANSIEES-GKTMSQESLPQKNNGFIPQVPCITSVPWPYP-----WSSTIPSPPA  337

Query  1244  CFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGP-------NSPTLGKHS  1402
                PGFPM FYP A          WN PW      P H + + P       NSPTLGKH 
Sbjct  338   LCPPGFPMSFYPAAF---------WNVPWF-----PSHPSVTNPMSLNSSLNSPTLGKHL  383

Query  1403  RDDNNKEGEPQPPKDSNPEK------CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             R+D+N +   +     N E        + VPKTLR DDP +AAKSSIWATLGI ++ V  
Sbjct  384   RNDDNDDNLAKQDHLQNEESPKQRNGSVLVPKTLRIDDPSEAAKSSIWATLGITNECVSG  443

Query  1565  IRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
               GG  KAF+ K D   H ++    +L ANPAAL+RSLNFHESS
Sbjct  444   --GGMTKAFQSKKDGKKHVAE-TSPMLRANPAALARSLNFHESS  484



>gb|KDO82954.1| hypothetical protein CISIN_1g038013mg [Citrus sinensis]
Length=494

 Score =   293 bits (749),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 185/435 (43%), Positives = 250/435 (57%), Gaps = 44/435 (10%)
 Frame = +2

Query  455   KEDEGTVLMEGE--GIMDQTVDEI-----RDGLKAPHVDEDCGSTEISTTDEEEGKMSNG  613
             KE  G  ++E E   +  +  D I      D  K   VD +  S + S+ + E+ + SN 
Sbjct  78    KEHSGQQIIEDEHEDVTSKQKDPITSSGNSDNPKTLSVDRETRSLK-SSKNGEQSETSNS  136

Query  614   KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAG  793
             ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAG
Sbjct  137   QEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAG  196

Query  794   RRKTKNSAAHYHLN-----AVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVA  943
             RRK K+S+A  +       A+++FQ    +    +       NG +LT  SD     SVA
Sbjct  197   RRKNKSSSASNYRQIMISEALRTFQ---ANASGGVYKPYSGNNGTILTFGSDSPLHESVA  253

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S  N+++K+  N   NGF++  E  I VS          +  S + +++  K   C +  
Sbjct  254   SVPNLSDKSQ-NCLRNGFHR-SEQKILVS-------GTDNGSSITASSSLEKGGNCTSQ-  303

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
              D+  +NY G  PQ+P F  PPWP+      W++ +PPPG +  GFP+ FYP   Y G  
Sbjct  304   -DIRTKNYRGSVPQVPYFPGPPWPH-----HWNTPMPPPGFYPSGFPVSFYPETTYWGCA  357

Query  1304  IPCSWNAPWVSRPVAPQ-HHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPEKC  1465
             +P   N P V    + Q        ++PTLGKHSRD +     + E E       N E+C
Sbjct  358   VPGYCNMPCVPPNASLQSQFVPKTLSTPTLGKHSRDGDIITPASTEKEEPSTGSRNSERC  417

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLL  1645
             + VPKTLR DDP +AAKSSIWATLGI++++  S     FK F+ K D  ++ ++   V L
Sbjct  418   VLVPKTLRIDDPSEAAKSSIWATLGIKNEKTTSAGECLFKGFQSKSDHRNYIAETSEV-L  476

Query  1646  EANPAALSRSLNFHE  1690
             +ANPAALSRSLNFHE
Sbjct  477   QANPAALSRSLNFHE  491



>ref|XP_008806017.1| PREDICTED: cyclic dof factor 2 [Phoenix dactylifera]
Length=461

 Score =   290 bits (743),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 203/502 (40%), Positives = 272/502 (54%), Gaps = 62/502 (12%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++D  IKLFG TI        PP +    + GG A + +  A       A P     + K
Sbjct  4     SRDLAIKLFGKTIPLQPTGESPPVSGGSEESGGKAEKDHKEA-------ATP-----ETK  51

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             +++ E  D  ++ +      GE       D++  G      +++  + + ST  E+  + 
Sbjct  52    DQDMESPDSEEKSDPPTPTAGE------TDKLSSG------NQEDTNMKDSTPKEQSNET  99

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             SN ++K  KKPDKILPCPRC S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  100   SNSQEKAPKKPDKILPCPRCSSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  159

Query  785   GAGRRKTKNSAAHYHLNAVK--SFQNACVDHPERIQHHALKANGKVLTLASD-----SVA  943
             GAGRRK K+S  HY   A+   + Q    D  E I H  +K NG VL+  SD     S+A
Sbjct  160   GAGRRKNKSSIPHYRHIAMSDATLQAVRSDAMEAIHHPPIKPNGTVLSFGSDMPLCESMA  219

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+AEK   N + NG+++  E  + +   A +     S  S           +  N  
Sbjct  220   SALNLAEKNMKNCTRNGYHQMEEKTVPLPCRAENGDEHSSGSSV----------MAPNSK  269

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
              +  K +  G    +PCF   PW Y     QW+ A   P C S  F +PFYP   Y G  
Sbjct  270   QEAAKTSLQGVPAPIPCFNGTPWAY-----QWNPAA--PLCTS-SFAIPFYPAPAYWGCA  321

Query  1304  IPCSWNAPWVSRPVA------PQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKD----SN  1453
             +P SW+ PW+S P+A            SGPNSPTLGKHSRD N  +      +D    +N
Sbjct  322   VPGSWSFPWLS-PLASSPPPPNSGSPGSGPNSPTLGKHSRDGNILKSSNLEKEDGLTQTN  380

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHASKN  1630
              E+C+W PKTLR DD ++AAKSSIWA +GI++D+  ++ G G FKAF+ K    +H ++ 
Sbjct  381   QERCIWAPKTLRIDDADEAAKSSIWAMIGIKNDKAGAVSGRGIFKAFQPKAGIKNHTNET  440

Query  1631  CRVLLEANPAALSRSLNFHESS  1696
              + LL ANPAALSRSL F ESS
Sbjct  441   SQ-LLHANPAALSRSLRFQESS  461



>gb|AFK34595.1| unknown [Medicago truncatula]
Length=465

 Score =   290 bits (742),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 202/505 (40%), Positives = 266/505 (53%), Gaps = 64/505 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             TKDP IKLFG  I FP +        E +V P  A         +S   + E   ++  +
Sbjct  4     TKDPEIKLFGKKILFPGEGEALMIDGEENVSPAAAMDVEEERDSESGNEDDEEETEKDPE  63

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              +++ E   E+        ++       T+ E     K P +DE+   +E +   E    
Sbjct  64    ADKDTEEKKEADPPPDAAEIKNNNNSAATLPE--GNPKTPSIDEETSKSE-NEQSETTAN  120

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              ++ ++KTLKKPDK+L CPRC+S DTKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+P
Sbjct  121   NNDTQEKTLKKPDKLLLCPRCNSADTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVP  180

Query  782   VGAGRRKTKN-SAAHY-HLNAVKSFQNACVDHPERIQH-HALKANGKVLTLA------SD  934
             VGAGRRK KN S++HY H+   ++   A +  P    H   LK NG+VL          D
Sbjct  181   VGAGRRKNKNNSSSHYRHITISEALDAARIISPNGTHHLQNLKTNGRVLNFGLDHPHIYD  240

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             S++++LN A K   N + N        G + S             +SSVT + + ++  K
Sbjct  241   SMSNDLNPAGKKVLNDTRNN-------GDRFS------------SASSVTVSKSMEESGK  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-AVPPPGCFSP-GFPMPFYPPAM  1288
             N   + L Q  +GF PQ+PC  + PWPY      WSS A+P P    P GFPM FYP   
Sbjct  282   NMTQESLPQKNNGFIPQVPCMTSVPWPY-----TWSSGAIPSPQTLCPPGFPMSFYPAPF  336

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGE---------PQPP  1441
                      WN PW   P  P       P SPTLGKHSRDD+N   E          + P
Sbjct  337   ---------WNVPWFP-PHTPATTPRFSPKSPTLGKHSRDDDNTNDENAKQDSLQTEESP  386

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHA  1621
             K  N   C+ VPKTLR DDP +AAKSSIW TLGI+++ +   RGG  KAF+ K D  +H 
Sbjct  387   KQRN--GCVLVPKTLRIDDPTEAAKSSIWETLGIKNEGLS--RGGMTKAFQSKKDGKNHV  442

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
                   +L ANPAAL+RSLNFHE+S
Sbjct  443   Q--TSPMLMANPAALARSLNFHENS  465



>ref|XP_004138169.1| PREDICTED: dof zinc finger protein DOF3.3-like [Cucumis sativus]
Length=386

 Score =   285 bits (728),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 241/389 (62%), Gaps = 30/389 (8%)
 Frame = +2

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             E S  ++E+    N K+K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRY
Sbjct  15    ETSKPEKEQNGAPNSKEK-LKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRY  73

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL  925
             WT GG  RN+PVGAGRRK KNSA+HY  +   ++ Q A +D P  I   A K+NG+VL  
Sbjct  74    WTEGGTMRNVPVGAGRRKNKNSASHYRQITISEALQAAQIDVPNGINCLATKSNGRVLNF  133

Query  926   A-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
             +      +S+++ LN A +   NG+ N FY+P + GI+     G+ G D SS SS   ++
Sbjct  134   SVNAPVCESMSTVLNPAGRKVLNGTRNEFYRPDDQGIKAPCKGGETGDDCSSASSVTMSS  193

Query  1091  sTKDDVCKN-GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPM  1267
             S ++   +    P M  QN +GF PQ+P     PWP       W++ +PPP    PG P+
Sbjct  194   SMEEGARRCPQEPQM--QNINGFPPQIPYLPGVPWP-----CSWNAPMPPPAFCPPGVPL  246

Query  1268  PFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD------DNNKEGE  1429
             PFY PA Y    +P +WN PW   P  P    +SG NSPTLGKHSRD       +N E E
Sbjct  247   PFY-PATYWSCGVPGAWNIPWF--PPQPCSQ-NSGANSPTLGKHSRDVGDKLQADNSEKE  302

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDE  1609
              +PPK  N    + +PKTLR DDP +AAKSSIW TLGI++D + ++     K F+ K ++
Sbjct  303   -EPPKQKN--GSVLIPKTLRIDDPNEAAKSSIWETLGIKNDSIKAV--DLSKVFQSKGEQ  357

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHESS  1696
              +  S+    +L+ANPAALSRS+ FHE S
Sbjct  358   KNSVSEMLSPVLQANPAALSRSITFHERS  386



>ref|XP_009761438.1| PREDICTED: cyclic dof factor 3-like [Nicotiana sylvestris]
Length=487

 Score =   286 bits (733),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 176/396 (44%), Positives = 236/396 (60%), Gaps = 31/396 (8%)
 Frame = +2

Query  545   VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRH  724
              DED  + + S  +E E   +    +TLKKPDKILPCPRC+S DTKFCY+NN N NQPRH
Sbjct  111   TDEDPQTVK-SAENENEPNNATDSQQTLKKPDKILPCPRCNSTDTKFCYYNNNNVNQPRH  169

Query  725   FCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHAL  898
             FC+ CQRYWT+GG  RNLPVGAGRRK KN A+HY   ++       A ++ P    H   
Sbjct  170   FCRSCQRYWTAGGTMRNLPVGAGRRKNKNLASHYRHISIPDDVLLAAQIESPNGFHHPMY  229

Query  899   KANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhs  1063
             K NG VL+        +S+AS LN AEK A N   NGFYK      Q    +   G ++ 
Sbjct  230   KPNGTVLSFGPELPLCESMASALNPAEKRAPNVIPNGFYK------QEHRNSSCKGGENG  283

Query  1064  sgsssvtaasTKDDVCKNGLP---DMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP  1234
                S  ++  T + + + G     + + +N +GF    PCF   P+P+P     W++AVP
Sbjct  284   DDCSKGSSIKTSNMMVEGGNSKPHEAVMRNINGFLSPAPCFHGVPFPFP-----WNAAVP  338

Query  1235  PPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG--PNSPTLGKHSRD  1408
                 +  GFPMPFY PA Y   ++P  W+ PW+S+P   ++  +SG  PNSP LGKHSR+
Sbjct  339   MSAIYPFGFPMPFY-PAPYWNCSVP-RWSNPWLSQPCRTENEKASGSDPNSP-LGKHSRE  395

Query  1409  DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKA  1588
              ++ EG  +P +  + ++ + VPKTLR DDP++AAKSSIW+TLGI++D     RGG FKA
Sbjct  396   GDDPEGN-EPVEQKSSKRSILVPKTLRIDDPDEAAKSSIWSTLGIKYDSAS--RGGFFKA  452

Query  1589  FKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              + K D+  H   N   +L ANPAALSRSL   E +
Sbjct  453   LQPKIDDRDHKD-NTSPVLHANPAALSRSLVLQERT  487



>ref|XP_002514746.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF47852.1| zinc finger protein, putative [Ricinus communis]
Length=488

 Score =   286 bits (732),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 254/406 (63%), Gaps = 29/406 (7%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             K P ++E+   ++ S +++++   +N ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN N
Sbjct  94    KTPSINEESAKSKNSKSEKQQNDGTNTQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNIN  153

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH  889
             QPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+HY H+   ++ Q A ++ P    +
Sbjct  154   QPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITISEALQAARIEAPNGTCN  213

Query  890   H-ALKANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdng  1051
             + AL+ NG+VL+        DS+AS L++A+K   N S NGF+   +   +V     +NG
Sbjct  214   NPALRPNGRVLSFGLDTPICDSMASVLSLADKKVLNSSRNGFHHFEDKMTRVPCKGRENG  273

Query  1052  adhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV  1231
              D  SG SSVT +++ ++  + G  +    + +GFA  + C    PW YP     W+SA+
Sbjct  274   GDDCSGGSSVTVSNSMEEGRRTGAQEPFMPSINGFASPITCLSGVPWAYP-----WNSAL  328

Query  1232  ---PPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWV---SRPVAPQHHTSSGPNSPTLG  1393
                P      PGFPM FYPP    G  +   WN P +   S   +     SS PNSPTLG
Sbjct  329   PPPPAFCPPPPGFPMSFYPPIWNCG--VAGGWNIPLLSPQSSSSSSNQKASSSPNSPTLG  386

Query  1394  KHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVD  1561
             KHSRD +    +  G+ +P K  N   C+ VPKTLR DDP +AAKSSIWATLGI+++  +
Sbjct  387   KHSRDGDALKPDDLGKEEPGKRKN--GCVLVPKTLRIDDPNEAAKSSIWATLGIKNESFN  444

Query  1562  SIRGGAFKAFKMKDDENSHASK-NCRVLLEANPAALSRSLNFHESS  1696
                GG  KA + K DE +H  + +   +L ANPAALSRS+NFHES+
Sbjct  445   G--GGLLKALQPKSDEKNHIPQTSSSSVLRANPAALSRSINFHEST  488



>ref|XP_008453209.1| PREDICTED: cyclic dof factor 3 [Cucumis melo]
Length=469

 Score =   285 bits (730),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 205/497 (41%), Positives = 280/497 (56%), Gaps = 44/497 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IK+FG  IQ P      P  E+           +      S S+ +PG+    + 
Sbjct  4     IKDPPIKIFGKEIQLP------PDCELSF-----IESDDDDDHSDSFSDKQPGDGALPK-  51

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
              + G+  + S   E T+    +    QT +E     +   +DE+    E    ++E+   
Sbjct  52    -DVGKASESSAAKEETLHDSEDSACVQTANEAHMNPEVVSMDEN-DKLETGKPEKEQNDA  109

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              N K+K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT GG  RN+PV
Sbjct  110   PNSKEK-LKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTEGGTMRNVPV  168

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----SDSVAS  946
             GAGRRK KNSA+HY  +   ++ Q A +D P  +   A K+NG+VL  +      +S+++
Sbjct  169   GAGRRKNKNSASHYRQITISEALQAAQIDVPNGVNCLATKSNGRVLNFSVNAPVCESMST  228

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN-GL  1123
              LN   +   NG+ N FY+P + GI+     G+ G + SS SS   ++S ++   +    
Sbjct  229   VLNPTGRKVLNGTRNEFYRPDDQGIKAPCKGGETGDECSSASSVTMSSSMEEGARRCPQE  288

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
             P M  QN +GF PQ+P   + PWP       W++ VPPP    PG P+PFY PA Y    
Sbjct  289   PQM--QNINGFPPQIPYLPSVPWP-----CSWNAPVPPPTFCPPGVPLPFY-PATYWSCG  340

Query  1304  IPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDD------NNKEGEPQPPKDSNPEKC  1465
             +P +WN PW   P  P    +SG NSPTLGKHSRD       +N E E +PPK  N    
Sbjct  341   VPGAWNIPWF--PPQPCSQ-NSGANSPTLGKHSRDGGDKLQADNSEKE-EPPKQKN--GS  394

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLL  1645
             + +PKTLR DDP +AAKSSIW TLGI++D + ++     K F+ K ++ +  S+    +L
Sbjct  395   VLIPKTLRIDDPNEAAKSSIWETLGIKNDSIKAV--DLSKVFQSKGEQKNSVSEVLSPVL  452

Query  1646  EANPAALSRSLNFHESS  1696
             +ANPAALSRS  FHE S
Sbjct  453   QANPAALSRSRTFHERS  469



>ref|XP_010528346.1| PREDICTED: cyclic dof factor 2 isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   285 bits (730),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 209/535 (39%), Positives = 279/535 (52%), Gaps = 115/535 (21%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppT-----------EMDVDPGGAASEANSLAKDSSCS---  388
             DP IKLFG TI  P+    P                D DP  A+   +S+ +D++     
Sbjct  3     DPAIKLFGKTIPLPEIAASPSGAVSSSGGGGLIDRRDQDP--ASVPDSSVGEDNTTDDGC  60

Query  389   --------------EAEPGEDEQQQKNENG---ERMDESKEDEGTVLMEGEGIMDQTVDE  517
                           E    E E Q++N NG   E   ES   E        G+ D+    
Sbjct  61    DDGGGGGGNGGCGGEERESEKEMQEENINGRGEEHGGESSIQESGATSGKSGLTDR----  116

Query  518   IRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFN  697
                 ++ P      G  E  + +E     ++ ++  LKKPDKILPCPRC+SMDTKFCY+N
Sbjct  117   ----METPKAQ--AGKAEEESQNE---TGASSQETKLKKPDKILPCPRCNSMDTKFCYYN  167

Query  698   NYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPE  877
             NYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA+H++ +   S     +  P 
Sbjct  168   NYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHFNRHV--SISAEAMQKPR  225

Query  878   RIQHHALKANGK-VLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYg  1036
                HH    NG  +LT  SD     S+AS LN+A+K A   + NGF++P E L IQ+ Y 
Sbjct  226   TELHH---PNGTHLLTFGSDQLLCESMASGLNLADK-AMLKTRNGFHEPAEGLKIQIPY-  280

Query  1037  agdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQL-PCFQAPPWPYPSSAV  1213
                                 +++V  +  P   +    G  P++      PPWPY  + V
Sbjct  281   --------------------ENNVNSSSNPPSEEAGASGSMPKVPCFPAPPPWPYSWNGV  320

Query  1214  QWSSAVPPPGCFSPGFPMPFYPPAMYLG--YTIPCSWNA-PWVSRPVAPQHHTSSGPNSP  1384
              W+              +PFYPP  Y       P +WN  PW+++P +P   + SGPNSP
Sbjct  321   PWTV-------------LPFYPPPTYWSCPGAPPVTWNGFPWMAQPNSP---SGSGPNSP  364

Query  1385  TLGKHSRDDN-------NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGI  1543
             TLGKHSRD+N       +KE EP   + SNPE+ LWVPKTLR DDPE+AAKSSIW TLGI
Sbjct  365   TLGKHSRDENTAEPGTSSKETEPSTKEKSNPERYLWVPKTLRIDDPEEAAKSSIWETLGI  424

Query  1544  QHDRVDSIRGGAFKAFKMKDDENSHASKNCRV----LLEANPAALSRSLNFHESS  1696
             ++D     +G  F+AF+ K ++ + A +N       +L+ANPAA+SRS+NFHE S
Sbjct  425   KNDE----KGETFRAFRSKKEKGARAKENPSSPPVPVLQANPAAMSRSMNFHERS  475



>ref|XP_009587069.1| PREDICTED: cyclic dof factor 3-like [Nicotiana tomentosiformis]
Length=490

 Score =   285 bits (729),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 179/424 (42%), Positives = 247/424 (58%), Gaps = 33/424 (8%)
 Frame = +2

Query  455   KEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKK  634
             +ED+  ++ E E    +T  E  +  K P  DED  + + S  + E    ++ +   LKK
Sbjct  86    EEDQNQMVEESEN--PKTSSESENSPKFP-TDEDHQTVKSSENENEPNNATDSQQTLLKK  142

Query  635   PDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNS  814
             PDK+LPCPRC+S DTKFCY+NN N NQPRHFC+ CQRYWT+GG  RNLPVGAGRRK KN 
Sbjct  143   PDKVLPCPRCNSTDTKFCYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNL  202

Query  815   AAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVLTLA-----SDSVASELNIAEKTA  973
             A+HYH  ++       + ++ P    H  LK NG VL+        DS+AS LN AEK A
Sbjct  203   ASHYHHISIPDDVLLASRIESPNGFHHPMLKPNGTVLSFGPELPLCDSMASALNPAEKRA  262

Query  974   GNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP---DMLKQN  1144
              N   NGFYK      Q    +   G ++    S  ++    + + + G     + + +N
Sbjct  263   PNVIPNGFYK------QEHRNSSCKGGENGDDCSKESSVMASNMMVEGGNSKPHEAVMRN  316

Query  1145  YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNA  1324
              +GF    PC    P+P+P     W++AVP    +  GFPMPFY PA Y   ++P  W+ 
Sbjct  317   TNGFPSPAPCLHGVPFPFP-----WNAAVPMSAIYPFGFPMPFY-PAPYWNCSVP-PWSN  369

Query  1325  PWVSRPVAPQHHTSSG--PNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
             PW+S+P   ++  +SG  PNSP LGKHSR+ ++ E   +P +  + ++ + VPKTLR DD
Sbjct  370   PWLSQPSRTENEKASGSDPNSP-LGKHSREGDDPECN-EPVEQKSSKRSILVPKTLRIDD  427

Query  1499  PEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
             P++AAKSSIW+TLGI++D     RGG FKA + K D+  H +      L ANPAALSRSL
Sbjct  428   PDEAAKSSIWSTLGIKYDSAS--RGGFFKALQPKIDDKDHKA-TASPELHANPAALSRSL  484

Query  1679  NFHE  1690
             +  E
Sbjct  485   SLQE  488



>ref|XP_009591911.1| PREDICTED: cyclic dof factor 1-like [Nicotiana tomentosiformis]
Length=401

 Score =   280 bits (715),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 186/490 (38%), Positives = 251/490 (51%), Gaps = 99/490 (20%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              +DP IKLFG TI                    A++E   ++K            E  Q 
Sbjct  4     VRDPEIKLFGQTIGLTQERGLWNRKSSSYSTSTASNEDKIISKG-----------EFTQS  52

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
              ++ E +D + +     L+E E     T   I D LK    D++      + + +   + 
Sbjct  53    KQDNELVDPTADS----LVEPE-----TSSGISDELKIQDADKE------TLSPKSIEEE  97

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              + ++KTLKKPDK++PCPRC+SM+TKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PV
Sbjct  98    DSSEEKTLKKPDKLVPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPV  157

Query  785   GAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASE  949
             G+GRRK K+S          S  N  +  P      AL AN  VLT  SD     S+ S 
Sbjct  158   GSGRRKNKSS----------STSNYGMHLP------ALSANETVLTFGSDKPLCDSMVSV  201

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNIAEK  GN   NG      +  +    +  +                          D
Sbjct  202   LNIAEKEIGNDQSNGVCSTSSVITEKEKNSSTH--------------------------D  235

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
             +  +N+  F PQ+P F   PWPY                   GFP+ FYP   Y G T+ 
Sbjct  236   LTWKNFQAFHPQVPYFLGAPWPYS------------------GFPVSFYPAQPYWGCTVA  277

Query  1310  CSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLR  1489
               WN PW+S   + Q   ++GP SPTLGKHSRD  +K    Q  ++   E+C+ +PKTLR
Sbjct  278   SPWNVPWLS---SDQSVHNTGPTSPTLGKHSRD-GSKLSTSQSGREG--ERCVLIPKTLR  331

Query  1490  FDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSHASKNCRVLLEANPAAL  1666
              DDP +AAKSSIW+TLGI+++++DS+RG   FKAF  K D  +  S +   +L+ANPAAL
Sbjct  332   IDDPNEAAKSSIWSTLGIKNEKIDSVRGARLFKAFNTKADHRNRES-DASFVLQANPAAL  390

Query  1667  SRSLNFHESS  1696
             SRSLNF ES+
Sbjct  391   SRSLNFREST  400



>ref|XP_010037173.1| PREDICTED: cyclic dof factor 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW48845.1| hypothetical protein EUGRSUZ_K02480 [Eucalyptus grandis]
Length=479

 Score =   282 bits (721),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 229/406 (56%), Gaps = 56/406 (14%)
 Frame = +2

Query  539   PHVDEDCGSTEISTT--DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             P + E+  ++ I+ T   EE G   N +DKTLKKPDKI+PCPRC+SMDTKFCY+NNYN N
Sbjct  110   PSIQEESTTSHITETGAQEEHGTPKNSQDKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVN  169

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH-LNAVKSFQNACVDHPERIQH  889
             QPRHFC+ CQRYWT+GG  RN+PVGAGRRK KN+A  Y  +   ++ Q A VD P   Q 
Sbjct  170   QPRHFCRACQRYWTAGGTMRNVPVGAGRRKNKNAATRYRPITISEALQAARVDSPNGAQL  229

Query  890   HALKANGKVLTLASDSVASEL-----NIAE-KTAGNGSLNGFYKPVELGIQVSYgagdng  1051
               L+ NG VLT   DS          NI+E K   NG  NGF + +E G           
Sbjct  230   PHLRTNGAVLTFGLDSPVCNSQSPIPNISEKKKVLNGYKNGF-RDIENG-----------  277

Query  1052  adhssgsssvtaasTKDDVCKNGLPDMLKQ---NYHGFAPQLPCFQAPPWPYPSSAVQWS  1222
                   SS+ ++ +  + + + GL    +Q   N +GF+ Q+PC    PWPYP     W+
Sbjct  278   ----DDSSTSSSVTISNSMNEKGLNFPQEQGMGNVNGFSTQIPCLPGVPWPYP-----WN  328

Query  1223  SAVPPPG-CFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLG  1393
             S +P P  C S   PM FYP A +    +P +WN P +S   P   Q  T+SGPN+PTLG
Sbjct  329   STIPSPAFCPSGCPPMSFYPAAFWACGVLPNAWNIPCMSPQSPFCNQKATTSGPNAPTLG  388

Query  1394  KHSRDDNNKEG-----EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             KHSR+    +      + +PP+  N    + VPKTLR DDP +AAKSSIWA LGI     
Sbjct  389   KHSRESEPLKSDISLEQAEPPRQKN--GSILVPKTLRIDDPSEAAKSSIWAALGI-----  441

Query  1559  DSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                     KAF+ K  E           L ANPAALSRSLNFHE++
Sbjct  442   --------KAFEPKSREGKVKDAETLPHLHANPAALSRSLNFHENT  479



>ref|XP_010037174.1| PREDICTED: cyclic dof factor 3-like isoform X2 [Eucalyptus grandis]
Length=477

 Score =   281 bits (719),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 229/406 (56%), Gaps = 56/406 (14%)
 Frame = +2

Query  539   PHVDEDCGSTEISTT--DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             P + E+  ++ I+ T   EE G   N +DKTLKKPDKI+PCPRC+SMDTKFCY+NNYN N
Sbjct  108   PSIQEESTTSHITETGAQEEHGTPKNSQDKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVN  167

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH-LNAVKSFQNACVDHPERIQH  889
             QPRHFC+ CQRYWT+GG  RN+PVGAGRRK KN+A  Y  +   ++ Q A VD P   Q 
Sbjct  168   QPRHFCRACQRYWTAGGTMRNVPVGAGRRKNKNAATRYRPITISEALQAARVDSPNGAQL  227

Query  890   HALKANGKVLTLASDSVASEL-----NIAE-KTAGNGSLNGFYKPVELGIQVSYgagdng  1051
               L+ NG VLT   DS          NI+E K   NG  NGF + +E G           
Sbjct  228   PHLRTNGAVLTFGLDSPVCNSQSPIPNISEKKKVLNGYKNGF-RDIENG-----------  275

Query  1052  adhssgsssvtaasTKDDVCKNGLPDMLKQ---NYHGFAPQLPCFQAPPWPYPSSAVQWS  1222
                   SS+ ++ +  + + + GL    +Q   N +GF+ Q+PC    PWPYP     W+
Sbjct  276   ----DDSSTSSSVTISNSMNEKGLNFPQEQGMGNVNGFSTQIPCLPGVPWPYP-----WN  326

Query  1223  SAVPPPG-CFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLG  1393
             S +P P  C S   PM FYP A +    +P +WN P +S   P   Q  T+SGPN+PTLG
Sbjct  327   STIPSPAFCPSGCPPMSFYPAAFWACGVLPNAWNIPCMSPQSPFCNQKATTSGPNAPTLG  386

Query  1394  KHSRDDNNKEG-----EPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             KHSR+    +      + +PP+  N    + VPKTLR DDP +AAKSSIWA LGI     
Sbjct  387   KHSRESEPLKSDISLEQAEPPRQKN--GSILVPKTLRIDDPSEAAKSSIWAALGI-----  439

Query  1559  DSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                     KAF+ K  E           L ANPAALSRSLNFHE++
Sbjct  440   --------KAFEPKSREGKVKDAETLPHLHANPAALSRSLNFHENT  477



>ref|XP_004137585.1| PREDICTED: dof zinc finger protein DOF3.3-like [Cucumis sativus]
 gb|KGN64006.1| DOF domain class transcription factor [Cucumis sativus]
Length=430

 Score =   279 bits (714),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 197/498 (40%), Positives = 254/498 (51%), Gaps = 85/498 (17%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDPTIKLFG  I   D          D +P    S A    KD++  E E   D+    
Sbjct  4     SKDPTIKLFGRQIPLSD----------DAEPPALLSHAEH-RKDAAIDEPEKPVDDSDDS  52

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
               N ER +E+  +                       K P +DE+  +T +    E E   
Sbjct  53    G-NIERGEEASVNP----------------------KTPSIDEETTTTPVDGEPESEKSN  89

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             S   +KTLKKPDK+LPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  90    S---EKTLKKPDKLLPCPRCKSMETKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVPV  146

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH-HALKANGKVLTLASDS------V  940
             GAGRRK+KNSA++Y H+   ++ + A ++ P        +  NG+VL+   D+      +
Sbjct  147   GAGRRKSKNSASYYRHITISEALEAARIESPNGTHKPKFISNNGRVLSFNLDAPTSDPVM  206

Query  941   ASELNIAE-KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
              S LN+ E +   NG      K V+ G + S          SS                 
Sbjct  207   GSVLNLGENRVLSNGVKKFEEKGVDQGCEKSSSLSSMPVQSSSE----------------  250

Query  1118  GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
                  LK N  GF  Q+ C    PWP+      W+S+VPPP    PGFPM F+P A +  
Sbjct  251   -----LKIN--GFPSQISCLSGVPWPF-----VWNSSVPPPAFTPPGFPMSFFPAAAW-N  297

Query  1298  YTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK---CL  1468
               +P  WN PW S P   +   S    S TLGKH RD    + +    K+   +K    +
Sbjct  298   SGVPGPWNTPWFS-PQPEKSLCSDTKASSTLGKHQRDHEMSKEDAISSKEEGIKKRNGHV  356

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA--FKAFKMKDDENSHASKNCRVL  1642
               PKTLR DDP +AAKSSIWATLGI++   +SI GG   FK F+ K  E  H ++   V 
Sbjct  357   LTPKTLRIDDPSEAAKSSIWATLGIKN---ESITGGKNLFKTFQPKGHEKVHVAETSSV-  412

Query  1643  LEANPAALSRSLNFHESS  1696
             L+ANPAALSRSL FHESS
Sbjct  413   LQANPAALSRSLVFHESS  430



>ref|XP_007157611.1| hypothetical protein PHAVU_002G084000g [Phaseolus vulgaris]
 gb|ESW29605.1| hypothetical protein PHAVU_002G084000g [Phaseolus vulgaris]
Length=480

 Score =   280 bits (716),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 201/515 (39%), Positives = 271/515 (53%), Gaps = 66/515 (13%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQF-------PDAppppppTEMDVDPGGAASEANSLAKDS-SCS  388
             M    KD  IKLFG TI          +     P    D     +   ++S  ++  S +
Sbjct  1     MSGAVKDSAIKLFGRTISLSRHHQVSANGSSSEPAPPQDYSHHHSPPSSSSFPREVMSTT  60

Query  389   EAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGST  568
             E EP  D    K  +G+ +  +++DE       E +   T     +  K P  + +    
Sbjct  61    EREPERD----KEPSGKELTSTQDDEAL----HEELKSPTSSCNLENPKTPSTEIETSLM  112

Query  569   EISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             +     ++    S  +DKT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  113   KSPKKGDQTDTTSASEDKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKHCQRY  172

Query  749   WTSGGMTRNLPVGAGRRKTKNS---AAHYHLNAVKSFQNACVDHPERIQHHALKANGKVL  919
             WT+GG  RN+PVGAGRRK KN+   A+HY    V          PE +Q+ +L +   VL
Sbjct  173   WTAGGTMRNVPVGAGRRKNKNTSSAASHYRQIMV----------PETLQNGSLHS--AVL  220

Query  920   TLAS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvt  1084
             T  S     DS+AS L++AEKT  NG LNGF+ P      V+     +  +    S   +
Sbjct  221   TFGSDFPLCDSMASVLSLAEKTQ-NGVLNGFHSPKHNVSTVNNNNSGDDINSVGASVMAS  279

Query  1085  aasTKDDVCKNGLPDMLKQNYH-GFAPQLPCF-----QAPPWPYPSSAVQWSSAVPPPGC  1246
                 K D   +   + + + YH GF+PQL C       + PWPYP     W+ A+ P   
Sbjct  280   TLCEKRDNATSSHDESVDKIYHQGFSPQL-CLPGSSSSSSPWPYP-----WNPAMTPSAF  333

Query  1247  FSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEG  1426
             +    P+ FYP   + G   P SW+  +       Q  +SSGPNSPTLGKHSRD +    
Sbjct  334   YQ---PVSFYPTQAFWGCMPPPSWSVNY-------QSASSSGPNSPTLGKHSRDGDILLQ  383

Query  1427  EPQPPKDSNPEK---CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFK  1594
             +P     SN  +    + +PKTLR DDP +AAKSSIW+TLGI++++ +S+ GG  FKAF 
Sbjct  384   KPGTESSSNMAENSNTVLIPKTLRIDDPTEAAKSSIWSTLGIKNEKGNSLNGGGLFKAFA  443

Query  1595  MK---DDENSHASKNCRVLLEANPAALSRSLNFHE  1690
              K   DD+ +H       +L+ANPAALSRSL FHE
Sbjct  444   SKGGSDDKKNHVVVEASPVLQANPAALSRSLVFHE  478



>ref|XP_004505416.1| PREDICTED: cyclic dof factor 2-like [Cicer arietinum]
Length=465

 Score =   279 bits (714),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 198/503 (39%), Positives = 266/503 (53%), Gaps = 62/503 (12%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KD  IKLFG TI  P            ++P  ++S ++    +S+       E E+  + 
Sbjct  5     KDSAIKLFGRTISLP------------LNPNDSSSPSSPTQLNSAIQH----EPEEPSRK  48

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
             E     D+    + T  ++        ++   +  K P  + +  S   S+T+ E+ + S
Sbjct  49    ELTTVQDDDASQQTTEDLKSPTTSSAILE---NPPKTPSAETE-SSLPKSSTNGEQSETS  104

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
               ++KTLKKPDK++PCPRC+SM+TKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PVG
Sbjct  105   VSEEKTLKKPDKVVPCPRCNSMETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVG  164

Query  788   AGRRKTKN-SAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-----VAS  946
             AGRRK KN S +HY HL   ++   A +  P  + +  L     VL   SDS     +AS
Sbjct  165   AGRRKNKNPSTSHYRHLMIPEA---AKLSSPNGLHNSVLGNGAAVLAFDSDSPLCNTMAS  221

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP  1126
              LNIAE+   N   N F+   E    VSYG  ++ +  +   S       KD    NG  
Sbjct  222   VLNIAER-HQNRMPNVFHHATEPNTFVSYGGENDHSITTPTLSER-----KDHTGSNG--  273

Query  1127  DMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTI  1306
               + +   GF PQL    +   PYP     W+ A+PPP    P +P+ FY P  Y G  +
Sbjct  274   -SMDKRVDGFPPQLQYIPSTLLPYP-----WNPAIPPPTFCPPSYPLAFYTPPPYFG-CM  326

Query  1307  PCSWNAPWVSRPVAPQHHTS---------SGPNSPTLGKHSRDDN--NKEGEPQPPKDSN  1453
             P SWN   +S    PQ  +S         S P SPTLGKHSRD N    + E    + SN
Sbjct  327   PPSWNISCIS----PQSTSSVNHCDSLHRSIPYSPTLGKHSRDGNIITPQNEKHDQEHSN  382

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK-DDENSHASK  1627
              E  + +PKTLRFDDP +AAKSS+W+ LGI +D+ +SI GG  F AF+ K  D+N     
Sbjct  383   TESSVLIPKTLRFDDPSEAAKSSLWSKLGINNDKANSINGGTMFNAFQSKGKDKNHSVEA  442

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                 L+ ANPAALSRS  FHE +
Sbjct  443   AASTLMYANPAALSRSRTFHEQT  465



>ref|XP_010528347.1| PREDICTED: cyclic dof factor 2 isoform X2 [Tarenaya hassleriana]
Length=472

 Score =   279 bits (714),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 179/395 (45%), Positives = 233/395 (59%), Gaps = 72/395 (18%)
 Frame = +2

Query  587   EEEGKMSNG---KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
             EEE +   G   ++  LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+
Sbjct  125   EEESQNETGASSQETKLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTA  184

Query  758   GGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGK-VLTLASD  934
             GG  RN+PVGAGRRK KNSA+H++ +   S     +  P    HH    NG  +LT  SD
Sbjct  185   GGTMRNVPVGAGRRKNKNSASHFNRHV--SISAEAMQKPRTELHH---PNGTHLLTFGSD  239

Query  935   -----SVASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYgagdngadhssgsssvtaasT  1096
                  S+AS LN+A+K A   + NGF++P E L IQ+ Y                     
Sbjct  240   QLLCESMASGLNLADK-AMLKTRNGFHEPAEGLKIQIPY---------------------  277

Query  1097  KDDVCKNGLPDMLKQNYHGFAPQL-PCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPF  1273
             +++V  +  P   +    G  P++      PPWPY  + V W+              +PF
Sbjct  278   ENNVNSSSNPPSEEAGASGSMPKVPCFPAPPPWPYSWNGVPWTV-------------LPF  324

Query  1274  YPPAMYLG--YTIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-------NKE  1423
             YPP  Y       P +WN  PW+++P +P   + SGPNSPTLGKHSRD+N       +KE
Sbjct  325   YPPPTYWSCPGAPPVTWNGFPWMAQPNSP---SGSGPNSPTLGKHSRDENTAEPGTSSKE  381

Query  1424  GEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD  1603
              EP   + SNPE+ LWVPKTLR DDPE+AAKSSIW TLGI++D     +G  F+AF+ K 
Sbjct  382   TEPSTKEKSNPERYLWVPKTLRIDDPEEAAKSSIWETLGIKNDE----KGETFRAFRSKK  437

Query  1604  DENSHASKNCRV----LLEANPAALSRSLNFHESS  1696
             ++ + A +N       +L+ANPAA+SRS+NFHE S
Sbjct  438   EKGARAKENPSSPPVPVLQANPAAMSRSMNFHERS  472



>gb|ADO60984.1| cycling DOF factor-like 1 [Helianthus annuus]
Length=445

 Score =   276 bits (705),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 207/515 (40%), Positives = 258/515 (50%), Gaps = 105/515 (20%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNE  430
             DP IKLFG TIQ PD        + DVD                    E         + 
Sbjct  3     DPAIKLFGKTIQLPD--------DADVD----------------AVNTEDPPPSDDDDDC  38

Query  431   NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSN  610
               +   + + DE  V  E E       +++ +   +  ++E+  +T  +  +    K+S 
Sbjct  39    KSDGDCKGQPDEKPVDKEEEITHSSISEDVTEPNASSTLNENPTTTLSAENESATAKVSK  98

Query  611   GKDK------TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
              +++      TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  99    SEEEQSEQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  158

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----S  937
             N+PVGAGRRK K S + Y    V          P  + +  LK NG VLT  SD     S
Sbjct  159   NVPVGAGRRKNKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCES  212

Query  938   VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
             +AS L IA+KT    S   F KP ++ I                       S+ DD    
Sbjct  213   MASVLKIADKTMRQDS---FRKPEDIII--------------------PGPSSNDD----  245

Query  1118  GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
                +  + +  G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G
Sbjct  246   ---NTNRPSATGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWG  296

Query  1298  YTIPC------------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDN  1414
               IP              W+  WV  P +  +H         + S P SPTLGKHSR +N
Sbjct  297   CAIPVPGPSSGPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN  354

Query  1415  NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR-GGAFKAF  1591
                GE +  K++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S   GG FKAF
Sbjct  355   ---GEDEIIKENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTSGNGGGVFKAF  411

Query  1592  KMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + K ++ S   K     L+ANPAALSRSLNF ESS
Sbjct  412   QSKSEDKSPI-KEASPALQANPAALSRSLNFQESS  445



>gb|ADO60985.1| cycling DOF factor-like 1 [Helianthus annuus]
Length=445

 Score =   275 bits (703),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 207/515 (40%), Positives = 258/515 (50%), Gaps = 105/515 (20%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNE  430
             DP IKLFG TIQ PD        + DVD                    E         + 
Sbjct  3     DPAIKLFGKTIQLPD--------DADVD----------------AVNTEDPPPSDDDDDC  38

Query  431   NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSN  610
               +   + + DE  V  E E       +++ +   +  ++E+  +T  +  +    K+S 
Sbjct  39    KSDGDCKGQPDEKPVDKEEEITHSSISEDVTEPNASSTLNENPTTTLSAENESATXKVSK  98

Query  611   GKDK------TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
              +++      TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  99    SEEEQSEQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  158

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----S  937
             N+PVGAGRRK K S + Y    V          P  + +  LK NG VLT  SD     S
Sbjct  159   NVPVGAGRRKNKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCES  212

Query  938   VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
             +AS L IA+KT    S   F KP ++ I                       S+ DD    
Sbjct  213   MASVLKIADKTMRQDS---FRKPEDIII--------------------PGPSSNDD----  245

Query  1118  GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
                +  + +  G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G
Sbjct  246   ---NTNRPSATGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWG  296

Query  1298  YTIPC------------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDN  1414
               IP              W+  WV  P +  +H         + S P SPTLGKHSR +N
Sbjct  297   CAIPVPXPSSGPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN  354

Query  1415  NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR-GGAFKAF  1591
                GE +  K++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S   GG FKAF
Sbjct  355   ---GEDEIIKENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTSGNGGGVFKAF  411

Query  1592  KMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + K ++ S   K     L+ANPAALSRSLNF ESS
Sbjct  412   QSKSEDKSPI-KEASPALQANPAALSRSLNFQESS  445



>ref|XP_004173656.1| PREDICTED: dof zinc finger protein DOF3.3-like, partial [Cucumis 
sativus]
Length=395

 Score =   271 bits (693),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 222/402 (55%), Gaps = 51/402 (13%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             K P +DE+  +T +    E E   S   +KTLKKPDK+LPCPRC SM+TKFCY+NNYN N
Sbjct  31    KTPSIDEETTTTPVDGEPESEKSNS---EKTLKKPDKLLPCPRCKSMETKFCYYNNYNVN  87

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH  889
             QPRHFCK CQRYWT+GG  RN+PVGAGRRK+KNSA++Y H+   ++ + A ++ P     
Sbjct  88    QPRHFCKACQRYWTAGGTMRNVPVGAGRRKSKNSASYYRHITISEALEAARIESPNGTHK  147

Query  890   -HALKANGKVLTLASDS------VASELNIAE-KTAGNGSLNGFYKPVELGIQVSYgagd  1045
                +  NG+VL+   D+      + S LN+ E +   NG      K V+ G + S     
Sbjct  148   PKFISNNGRVLSFNLDAPTSDPVMGSVLNLGENRVLSNGVKKFEEKGVDQGCEKSSSLSS  207

Query  1046  ngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS  1225
                  SS                      LK N  GF  Q+ C    PWP+      W+S
Sbjct  208   MPVQSSSE---------------------LKIN--GFPSQISCLSGVPWPF-----VWNS  239

Query  1226  AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSR  1405
             +VPPP    PGFPM F+P A +    +P  WN PW S P   +   S    S TLGKH R
Sbjct  240   SVPPPAFTPPGFPMSFFPAAAW-NSGVPGPWNTPWFS-PQPEKSLCSDTKASSTLGKHQR  297

Query  1406  DDNNKEGEPQPPKDSNPEK---CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG  1576
             D    + +    K+   +K    +  PKTLR DDP +AAKSSIWATLGI++   +SI GG
Sbjct  298   DHEMSKEDAISSKEEGIKKRNGHVLTPKTLRIDDPSEAAKSSIWATLGIKN---ESITGG  354

Query  1577  A--FKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                FK F+ K  E  H ++   V L+ANPAALSRSL FHESS
Sbjct  355   KNLFKTFQPKGHEKVHVAETSSV-LQANPAALSRSLVFHESS  395



>ref|XP_009758869.1| PREDICTED: cyclic dof factor 1-like [Nicotiana sylvestris]
Length=380

 Score =   270 bits (691),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 185/495 (37%), Positives = 248/495 (50%), Gaps = 130/495 (26%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              +DP IKLFG TI                      ++   L    S S +      + + 
Sbjct  4     VRDPEIKLFGQTI--------------------GLTQERGLWNRKSSSYSTSTASNEDKI  43

Query  425   NENGERMDESKEDEGTVLMEGEGIMD-QTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
                GE   +SK+D   V    + +++ +T   I D LK    D++  S +  + +EE+  
Sbjct  44    TSKGE-FTQSKQDNELVDPTADSLVEPETSSGISDELKINDADKETLSPK--SAEEED--  98

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              S+ ++KTLKKPDK++PCPRC+SM+TKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+P
Sbjct  99    -SSDQEKTLKKPDKLVPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVP  157

Query  782   VGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIA  961
             VG+GRRK K+S          S  N  +  P      AL+ANG VLT  SD       + 
Sbjct  158   VGSGRRKNKSS----------STSNYGMHLP------ALRANGTVLTFGSDEP-----LC  196

Query  962   EKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQ  1141
             +  AGN   NG                                     VC        K+
Sbjct  197   DSMAGNDQSNG-------------------------------------VCSTSSVLTEKE  219

Query  1142  N---------YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
             N         +  F PQ+P FQ  PWPY                   GFP  FYP   Y 
Sbjct  220   NNSSTHDLKIFQAFHPQVPYFQGAPWPYS------------------GFPGSFYPAQPYW  261

Query  1295  GYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWV  1474
             G T+   WN PW+S   + Q   ++GP+SPTLGKHSR++   EGE          +C+ +
Sbjct  262   GCTLASPWNVPWLS---SDQSVHNTGPSSPTLGKHSREN---EGE----------RCVLI  305

Query  1475  PKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGG-AFKAFKMKDDENSHASKNCRVLLEA  1651
             PKTLR DDP +AAKSSIW+TLGI+++++DS+RG   FKAF  K D  +  S +   +L+A
Sbjct  306   PKTLRIDDPNEAAKSSIWSTLGIKNEKIDSVRGARLFKAFNTKADHRNRES-DASFILQA  364

Query  1652  NPAALSRSLNFHESS  1696
             NPAALSRSLNF ES+
Sbjct  365   NPAALSRSLNFREST  379



>ref|XP_003607748.1| Dof zinc finger protein DOF1.10 [Medicago truncatula]
 gb|AES89945.1| DOF-type zinc finger DNA-binding family protein [Medicago truncatula]
Length=465

 Score =   273 bits (697),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 195/508 (38%), Positives = 271/508 (53%), Gaps = 70/508 (14%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IKLFG TI             + +    ++  ++S  + +S  + E  E  +++ 
Sbjct  4     VKDPAIKLFGRTIPL---------LPLIIPANDSSFPSSSPPEFTSAIQHETEEPSRKE-  53

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDED-----CGSTE----IS  577
                   +  +++DE +          +T +++R    +  V E+        TE     S
Sbjct  54    ------LITAQDDEAS---------QKTTEDLRALTTSSVVHENPPKTPSAETENSLLKS  98

Query  578   TTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
             +T+ E+ + S  ++KTLKKPDKI+PCPRC+SMDTKFCYFNNYN NQPRHFCKKCQRYWT+
Sbjct  99    STNVEQSETSVSEEKTLKKPDKIIPCPRCNSMDTKFCYFNNYNVNQPRHFCKKCQRYWTA  158

Query  758   GGMTRNLPVGAGRRKTKN-SAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-  931
             GG  RN+PVGAGRRK KN S +HY    +   + A ++ P  I  H+L     VLT  S 
Sbjct  159   GGTMRNVPVGAGRRKNKNLSTSHYRHLIIP--EGAKLNSPNGI--HSLGNGAAVLTFDSN  214

Query  932   ----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                 +++AS LNIAE+T  N   NGF+     G +  +  G +    +S          K
Sbjct  215   PPLCNTMASVLNIAERTQ-NCVSNGFHHASSYGGENDHSIGVSVTASNSSER-------K  266

Query  1100  DDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYP  1279
                  NGL D   +   GF PQL    +P  PY      W+SA+PPP    P +P+ FY 
Sbjct  267   SHTSTNGLVD---KGVEGFPPQLQHIPSPFLPY-----TWNSAMPPPTFCPPNYPLAFYT  318

Query  1280  PAMYLGY--TIPCSWNAPWVSRPVAPQHHTSSGPNS-PTLGKHSRDDN-----NKEGEPQ  1435
             P     Y   +P  WN P +S   A  + + S  +S PTLGKHSRD N     N   E  
Sbjct  319   PVTPPAYWGCMPPPWNIPCISPGSASVNESDSAHSSVPTLGKHSRDGNIITSVNSPKEKP  378

Query  1436  PPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDEN  1612
               + ++ E  + +PKTLRFDDP +AAKSS+W+ LGI +D+ +S+ GG  F  F+ K  + 
Sbjct  379   ETEHNSTESSVLIPKTLRFDDPSEAAKSSLWSKLGINNDKANSLNGGGMFNGFQSKGKDM  438

Query  1613  SHASKNCRVLLEANPAALSRSLNFHESS  1696
             +H S     L+ ANPAALSRS  FHE +
Sbjct  439   NH-SVGTSPLMYANPAALSRSRTFHEET  465



>ref|XP_006573116.1| PREDICTED: cyclic dof factor 3-like [Glycine max]
 gb|KHN01242.1| Dof zinc finger protein DOF3.3 [Glycine soja]
Length=479

 Score =   273 bits (697),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 201/512 (39%), Positives = 266/512 (52%), Gaps = 72/512 (14%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KD  IKLFG TI  P        T+ +V P   A   +S       S + P E     + 
Sbjct  7     KDSAIKLFGRTISLP------RNTKNEVSPDEPAPPEDS-------SSSFPREVSSTTEY  53

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIR---------DGLKAPHVDEDCGSTEIST  580
             + G++    KE   T   E      QT++E +         +  K P  + +    +   
Sbjct  54    DAGDKKPSRKELTST--QEDVEASHQTLEETKSPTSSSCNLENPKTPSTERETSILKSFK  111

Query  581   TDEEEGKMSN--GKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWT  754
                +    +    +DKT KKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT
Sbjct  112   NGHQSDTTTTCPSQDKTPKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKHCQRYWT  171

Query  755   SGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-  931
             +GG  RN+PVGAGRRK KN+ +  H   +          PE +Q+ +L  +G VLT  S 
Sbjct  172   AGGTMRNVPVGAGRRKNKNTPSVSHFRQIMV--------PEGLQNGSL--HGAVLTFGSD  221

Query  932   ----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTK  1099
                 DS+AS L++AEKT  NG LNGF+ P    I  + G         S  S     +T 
Sbjct  222   SPLCDSMASVLSLAEKTTQNGVLNGFHSPNTNTITSNKGDEYYDTVMGSTLSEKRHNATT  281

Query  1100  DDVCKNGLPDMLKQNYH-GFAPQLPCF----QAPPWPYPSSAVQWSSAVPPPGCFSPGFP  1264
                      D  K  +H GF PQL CF     + PWPYP +  +  SA     C     P
Sbjct  282   STNSHEKSLDNHKSYHHQGFTPQL-CFPGSSSSSPWPYPWNPTKTPSAF----C----NP  332

Query  1265  MPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQP--  1438
             +PFY    + G   P SW+  + S P       SSGPNSPTLGKHSRD +    +P    
Sbjct  333   VPFYTTQAFWGCMPPPSWSVNYQSAP-------SSGPNSPTLGKHSRDGDILFQKPSTDM  385

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK----D  1603
              +++N    + +PKTLR DDP +AAKSSIW+TLGI++++ +S+ GG  FKAF  K    +
Sbjct  386   AENNNNNNTVLIPKTLRIDDPTEAAKSSIWSTLGIKNEKGNSLNGGGLFKAFASKGSSDE  445

Query  1604  DENSH---ASKNCRVLLEANPAALSRSLNFHE  1690
              +N+H      +   +L+ANPAALSRSL FHE
Sbjct  446   KKNNHVMMVEASLSPVLQANPAALSRSLVFHE  477



>dbj|BAA08094.1| AOBP (ascorbate oxidase promoter-binding protein) [Cucurbita 
maxima]
Length=380

 Score =   269 bits (687),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 224/391 (57%), Gaps = 48/391 (12%)
 Frame = +2

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
             T++E+    N K+K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT G
Sbjct  19    TEKEQNDAPNSKEK-LKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTEG  77

Query  761   GMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA---  928
             G  RN+PVGAGRRK KNSA+HY H+   ++ + A +D P  + H A K NG+VL  +   
Sbjct  78    GTIRNVPVGAGRRKNKNSASHYRHITISEALRAAQIDVPIEVNHLASKGNGRVLNFSVSP  137

Query  929   --SDSVASELNIAEKTAGNGSLNGF---YKPVELGIQVSYgagdngadhssgsssvtaas  1093
                +S+ +  + AE+   NG+ N F     P E G              +    S  ++ 
Sbjct  138   PVCESMVNVSHPAERKVLNGTRNEFEGAKGPCEGG-------------ETGDDCSSASSV  184

Query  1094  TKDDVCKNGL------PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP  1255
             T     KNG       P M  QN +GF  Q+PC    PWP       W++ +PPP    P
Sbjct  185   TMSSSMKNGARRFPQEPHM--QNINGFPSQIPCLPGVPWP-----CSWTAPIPPPALCPP  237

Query  1256  GFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGE--  1429
             G P+ FY PA Y   +   SWN PWV+           GPNSPTLGKHSRD +  + +  
Sbjct  238   GVPLSFY-PATYWSCSASGSWNIPWVT---PQPCPPIPGPNSPTLGKHSRDGDELQADNS  293

Query  1430  --PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD  1603
                 PPK  N    + VPKTLR DDP +AAKSSIW TLGI++D + ++       F+ K 
Sbjct  294   EMKDPPKQKN--GSVLVPKTLRIDDPNEAAKSSIWETLGIKNDSIKAV--DLSNVFQSKG  349

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             D  S+ S+    +L+ANPAALSRSL FHE S
Sbjct  350   DLKSNVSEVLSPVLQANPAALSRSLTFHERS  380



>gb|AAL10495.1| AT5g39660/MIJ24_130 [Arabidopsis thaliana]
Length=457

 Score =   270 bits (690),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 192/510 (38%), Positives = 257/510 (50%), Gaps = 83/510 (16%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPD-------AppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED  409
             DP IKLFG TI  P+       +      TE  + P   +        D    ++  G +
Sbjct  3     DPAIKLFGKTIPLPELGVVDSSSSYTGFLTETQI-PVRLSDSCTGDDDDEEMGDSGLGRE  61

Query  410   EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE  589
             E     + G   +  K++E     + E + +++ D          + E   +T+ + T+E
Sbjct  62    EGDDVGDGGGESETDKKEEKDSECQEESLRNESNDVT---TTTSGITEKTETTKAAKTNE  118

Query  590   EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMT  769
             E G  +  ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  
Sbjct  119   ESGGTACSQEGKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTM  178

Query  770   RNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV---  940
             RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN  +LT  SDSV   
Sbjct  179   RNVPVGAGRRKNKSPASHYNRHVSITSAEAMQKVARTDLQHPNGAN--LLTFGSDSVLCE  236

Query  941   --ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
               AS LN+ EK+    +     +P E G++++                       ++  +
Sbjct  237   SMASGLNLVEKSLLK-TQTVLQEPNE-GLKITVPLNQT-----------------NEEAR  277

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
                P           P++PCF  PP  WPY  + V W+              +PFYPP  
Sbjct  278   TVSP----------LPKVPCFPGPPPTWPYAWNGVSWTI-------------LPFYPPPA  314

Query  1289  YLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNK-------EGEPQP  1438
             Y       P +WN+  W+ +P +P   + S PNSPTLGKHSRD+N         E E   
Sbjct  315   YWSCPGVSPGAWNSFTWMPQPNSP---SGSNPNSPTLGKHSRDENAAEPGTAFDETESLG  371

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSH  1618
              + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F AF+    E S 
Sbjct  372   REKSKPERCLWVPKTLRIDDPEEAAKSSIWETLGIKKDE----NADTFGAFRSSTKEKSS  427

Query  1619  ASK----NCRVLLEANPAALSRSLNFHESS  1696
              S+      R  L+ANPAALSRS NFHESS
Sbjct  428   LSEGRLPGRRPELQANPAALSRSANFHESS  457



>ref|XP_006355111.1| PREDICTED: cyclic dof factor 2-like [Solanum tuberosum]
Length=442

 Score =   269 bits (688),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 185/498 (37%), Positives = 256/498 (51%), Gaps = 74/498 (15%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              +DP IKLFG TI                  G    E N +      + + P   +  + 
Sbjct  4     VRDPAIKLFGKTI------------------GMTQQETNCVYLHDDHTTSSPLSIDDDKI  45

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
                GE     ++DE         I  +T   I D +K    D++      + + +   + 
Sbjct  46    TLEGEFTQSKQDDELVDPTADSSIEPETSSGISDDIKMQDADKE------TLSSKSIEEE  99

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              + ++K LKKPDK++PCPRC+SM+TKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PV
Sbjct  100   DSSEEKALKKPDKLIPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPV  159

Query  785   GAGRRKTKNSA-AHYHLNAVKSFQNACVDHPERIQHH-ALKANGKVLTLAS-----DSVA  943
             G+GRRK K+S+ ++Y L A +      V+      H  AL+ NG VLT  S     DS+ 
Sbjct  160   GSGRRKNKSSSISNYPLQAGR------VEAAAHGMHLPALRTNGTVLTFGSDKPLCDSMV  213

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+AE +  N + N F+         S        +  S  +  TA+S  D     G 
Sbjct  214   SALNLAENSH-NMNRNEFHG--------SERRMPAIGNDQSNGTCSTASSVTDKESSAGT  264

Query  1124  PDMLK-QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGY  1300
              D+    N+  F PQ+P FQ  PWPY                   GFP+ FYP   Y G 
Sbjct  265   HDLANWNNFQPFPPQVPYFQGAPWPY------------------SGFPVSFYPATPYWGC  306

Query  1301  TIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSN-----PEKC  1465
             T+   WN PW+S   +   + S  P SPTLGKHSRD++  +      +D+N      E+C
Sbjct  307   TVANPWNVPWLSSDQSSVQNNS--PTSPTLGKHSRDESKIDPSQSRRRDANLQNREGERC  364

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVL  1642
             + +PKTLR  DP +AAKSSIW+TLGI+++++DS RG   F AF  K D  +    +    
Sbjct  365   VLIPKTLRIHDPNEAAKSSIWSTLGIRNEKIDSARGTMLFSAFNPKADHRNR-EHDTSFA  423

Query  1643  LEANPAALSRSLNFHESS  1696
             L+ANPAALSRSL+F ES+
Sbjct  424   LQANPAALSRSLHFREST  441



>ref|NP_568567.1| cycling DOF factor 2 [Arabidopsis thaliana]
 ref|NP_851106.1| cycling DOF factor 2 [Arabidopsis thaliana]
 sp|Q93ZL5.2|CDF2_ARATH RecName: Full=Cyclic dof factor 2; AltName: Full=Dof zinc finger 
protein DOF5.2; Short=AtDOF5.2 [Arabidopsis thaliana]
 gb|AAU90081.1| At5g39660 [Arabidopsis thaliana]
 gb|AED94460.1| cycling DOF factor 2 [Arabidopsis thaliana]
 gb|AED94461.1| cycling DOF factor 2 [Arabidopsis thaliana]
Length=457

 Score =   270 bits (689),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 192/510 (38%), Positives = 256/510 (50%), Gaps = 83/510 (16%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPD-------AppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED  409
             DP IKLFG TI  P+       +      TE  + P   +        D    ++  G +
Sbjct  3     DPAIKLFGKTIPLPELGVVDSSSSYTGFLTETQI-PVRLSDSCTGDDDDEEMGDSGLGRE  61

Query  410   EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE  589
             E     + G   +  K++E     + E + +++ D          + E   +T+ + T+E
Sbjct  62    EGDDVGDGGGESETDKKEEKDSECQEESLRNESNDVT---TTTSGITEKTETTKAAKTNE  118

Query  590   EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMT  769
             E G  +  ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  
Sbjct  119   ESGGTACSQEGKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTM  178

Query  770   RNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV---  940
             RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN  +LT  SDSV   
Sbjct  179   RNVPVGAGRRKNKSPASHYNRHVSITSAEAMQKVARTDLQHPNGAN--LLTFGSDSVLCE  236

Query  941   --ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
               AS LN+ EK+    +     +P E G++++        +  + S              
Sbjct  237   SMASGLNLVEKSLLK-TQTVLQEPNE-GLKITVPLNQTNEEAGTVSP-------------  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
                            P++PCF  PP  WPY  + V W+              +PFYPP  
Sbjct  282   --------------LPKVPCFPGPPPTWPYAWNGVSWTI-------------LPFYPPPA  314

Query  1289  YLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNK-------EGEPQP  1438
             Y       P +WN+  W+ +P +P   + S PNSPTLGKHSRD+N         E E   
Sbjct  315   YWSCPGVSPGAWNSFTWMPQPNSP---SGSNPNSPTLGKHSRDENAAEPGTAFDETESLG  371

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSH  1618
              + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F AF+    E S 
Sbjct  372   REKSKPERCLWVPKTLRIDDPEEAAKSSIWETLGIKKDE----NADTFGAFRSSTKEKSS  427

Query  1619  ASK----NCRVLLEANPAALSRSLNFHESS  1696
              S+      R  L+ANPAALSRS NFHESS
Sbjct  428   LSEGRLPGRRPELQANPAALSRSANFHESS  457



>ref|XP_006829835.1| hypothetical protein AMTR_s00119p00099150 [Amborella trichopoda]
 gb|ERM97251.1| hypothetical protein AMTR_s00119p00099150 [Amborella trichopoda]
Length=515

 Score =   271 bits (693),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 209/551 (38%), Positives = 268/551 (49%), Gaps = 107/551 (19%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IKLFG TI   +        +   D    + E  +  +++  S  + G + +   
Sbjct  4     VKDPAIKLFGKTIPLLENNFLSDSIDKSDDIQATSDEKETCQENNEASGDKAGANTEDPA  63

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             + N   + E KE+              +  EI      P  D    STE   T+ E G  
Sbjct  64    SPN--DLKECKEEP-----------QNSNHEINKATPNPK-DSKPLSTEEDQTEIEGG--  107

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
                ++KTLKKPDK+LPCPRC+S+DTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  108   -GSQEKTLKKPDKVLPCPRCNSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  166

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHA------------LKANGKVLTL  925
             GAGRRK K+SA+HY H+   ++     ++ P+   HH             LK  G VL  
Sbjct  167   GAGRRKNKHSASHYRHIMMSENLAKPLIE-PQETNHHKVISCGVPPHTRPLKTGGTVLKF  225

Query  926   ASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
               D+   E        G  ++    K  E G ++S G+    A  S           K  
Sbjct  226   GPDAPLCESMETVLNLGEQAVPKREKVSENGEELSCGSSTVTAPTSVERELQENMVEKGG  285

Query  1106  V---CKNGLPDMLKQNYHGFAPQLPCF--QAPPWPYP-----------------------  1201
             +   CK G+           AP L CF   A PWPYP                       
Sbjct  286   LVGCCKGGV----------GAPHLQCFPGGASPWPYPWAPNWTGVAAMAATSPGGRCSSE  335

Query  1202  ------------SSAVQWSS-----AVPPPGCFSPGFPMPFYPPAMYLGYTIPC----SW  1318
                         S  VQW++     A PPP C  P  P PF  P  Y G  +P     +W
Sbjct  336   VVYGGPEHGGGSSGPVQWTTHPAIVAPPPPFC-GPTVPFPFV-PGSYWG-CVPTWAGGTW  392

Query  1319  NAPWVSRP----VAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTL  1486
               PWV+      ++P   TSSG NSPTLGKHSRD  ++  E        PEK LWVPKTL
Sbjct  393   PIPWVNSSYGNGLSPS-STSSGNNSPTLGKHSRDAPSQGEE-------KPEKSLWVPKTL  444

Query  1487  RFDDPEDAAKSSIWATLGIQHDRVDSIR-GGAFKAFKMKDDENSHASKNCRVLLEANPAA  1663
             R DDP++AAKSSIWATLGI+HD ++ IR GG FKAF+ K +    +S+  +V L+ANPAA
Sbjct  445   RIDDPDEAAKSSIWATLGIKHDSLEPIRKGGIFKAFQPKVEGKDRSSETVQV-LQANPAA  503

Query  1664  LSRSLNFHESS  1696
             LSRS  F ESS
Sbjct  504   LSRSHTFQESS  514



>emb|CBI31946.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   265 bits (678),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 182/484 (38%), Positives = 233/484 (48%), Gaps = 123/484 (25%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI  P      P       P    S   S   D+S     P +D   QK 
Sbjct  5     KDPAIKLFGKTISLP----LNPHLSPTSPPPPPLSSTTSFPDDTSQGLQPPSQD---QKP  57

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDC---GSTEISTTDEEEG  598
               G+   E KE++GT          QT +E++D   +P V E+     + + ++ D E+ 
Sbjct  58    LEGQEF-EGKEEDGTSR--------QTSEELKDPTASPGVSENPETPSADKETSKDGEQS  108

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             ++S  ++KTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  109   EISGSQEKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNV  168

Query  779   PVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNI  958
             PVGAGRRK KNS+A  + + +                                V+  L  
Sbjct  169   PVGAGRRKNKNSSASQYRHIM--------------------------------VSEALQT  196

Query  959   AEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLK  1138
             A  +A NG     + P  LG                             V   G  + + 
Sbjct  197   ARASAANG----IHHPA-LG-------------------------NNGTVLNFGSDEPVV  226

Query  1139  QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSW  1318
             +N+  F+P +PCF    W YP +  QWSS +PPP    PGFP+ FYP   Y         
Sbjct  227   KNFQAFSPHVPCFPGASWSYPWNPAQWSSKIPPPAFCPPGFPISFYPAPAY---------  277

Query  1319  NAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
                W S P    H                            K++NPE+ +W+PKTLR DD
Sbjct  278   ---WGSNPGKEDHQ---------------------------KENNPERGVWIPKTLRIDD  307

Query  1499  PEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
             P +AAKSSIW TLGI++D   S  G   KAF+ K DE    ++   V L+ANPAALSRSL
Sbjct  308   PNEAAKSSIWTTLGIKND--GSNGGSLLKAFQSKGDEKKRIAEMSPV-LQANPAALSRSL  364

Query  1679  NFHE  1690
             NFHE
Sbjct  365   NFHE  368



>ref|XP_006827283.1| hypothetical protein AMTR_s00010p00264070 [Amborella trichopoda]
 gb|ERM94520.1| hypothetical protein AMTR_s00010p00264070 [Amborella trichopoda]
Length=476

 Score =   268 bits (686),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 196/516 (38%), Positives = 263/516 (51%), Gaps = 70/516 (14%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEA----NSLAKDSSCSEAEP  400
             MP    DP IKLFG TIQ           + DV   GAA++     NS +KD+S ++   
Sbjct  1     MPAEISDPAIKLFGKTIQV--LTKKEIQAKEDVRSEGAANDKEFSHNSNSKDNSSTKERT  58

Query  401   GEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIST  580
              + E + + E G+    S+        +             D  ++P  ++     E+  
Sbjct  59    HDHEHEDQEEPGDTGSSSEPKNNPTTNQ-------------DTTESPEQEDPINPQEVGG  105

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
              +EE  ++  G+++T KKP K+LPC RC+S++TKFCY+NNYN NQPRHFCK CQRYWT+G
Sbjct  106   GEEENQELGIGQERTNKKPSKLLPCARCNSLETKFCYYNNYNVNQPRHFCKSCQRYWTAG  165

Query  761   GMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQ-----NACVDHPER---IQHHALKANGKV  916
             G  RN+PVGAGRRK K+S++  H   + S        +C ++ E    IQ+   K  G V
Sbjct  166   GTMRNVPVGAGRRKNKHSSSS-HYRQIPSLTPDGLPTSCSNNYESSHIIQNGVAKPTGTV  224

Query  917   LTLASD-----SVASELNIAEKTAGNGSLNGFY-----KPVELGIQVSYgagdngadhss  1066
             L+  SD     SVAS LN+AE        NG       KP E G  +S G+    + +S 
Sbjct  225   LSFGSDIPLCESVASVLNLAEHRVAATRRNGLIKAEEEKPQENGEDISCGSSSLTSTNSM  284

Query  1067  gsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-AVPPPG  1243
                         D  +N +         GFA     +   PWPYP S VQWS+  +  P 
Sbjct  285   ------------DKEQNRVQFQDPNYATGFASG---YSGAPWPYPWSPVQWSTPTIGSPA  329

Query  1244  CFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRP----VAP-QHHTSSGPNSPTLGKHSRD  1408
               +P  P+ FY    Y G  IP  W  PWV+       +P     +S  NSPTLGKH RD
Sbjct  330   FCAPSIPLSFY-HGSYWG-CIPGGWPVPWVANGDGGLTSPTSLSNNSSLNSPTLGKHPRD  387

Query  1409  DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FK  1585
              N           S  + CLWVPKTLR +D  +A  SSIWATL    ++VD+I GG  FK
Sbjct  388   RNLD-------NQSKTDSCLWVPKTLRIEDSGEAVNSSIWATLKANKEKVDTISGGGIFK  440

Query  1586  AFKMKDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             AF  K D+ + +S+  +V L ANPAALSRS NFHE+
Sbjct  441   AFHSKGDDKNRSSEASQV-LHANPAALSRSHNFHEN  475



>ref|XP_004238821.1| PREDICTED: cyclic dof factor 1 [Solanum lycopersicum]
Length=441

 Score =   267 bits (682),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 185/497 (37%), Positives = 256/497 (52%), Gaps = 73/497 (15%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              +DP+IKLFG TI                  G    E N +      + + P   + ++ 
Sbjct  4     VRDPSIKLFGKTI------------------GMTQQETNCVYLHDDHTTSSPLSIDDEKI  45

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             N  GE     + DE         I  +T   I D +K    D++      + + +   + 
Sbjct  46    NLEGEVTQSKQVDELVDPAADSSIEPETSSGISDDIKMQDADKE------TLSSKSVEEE  99

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              + ++K LKKPDK++PCPRC+SM+TKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PV
Sbjct  100   DSSEEKALKKPDKLIPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPV  159

Query  785   GAGRRKTKNSA-AHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-----DSVAS  946
             G+GRRK K+S+ ++Y L A +    A   H       A + NG VLT  S     DS+ S
Sbjct  160   GSGRRKNKSSSISNYPLQAGRVEAAAHGMHLP-----ASRTNGTVLTFGSDKPLCDSMVS  214

Query  947   ELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLP  1126
              LN+AE  + N   N ++         S        +  S  S  TA+S  D     G  
Sbjct  215   ALNLAEN-SHNMHRNEYHG--------SEQRMPTIGNDQSNGSCSTASSVTDKESSAGTH  265

Query  1127  DMLK-QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYT  1303
             D+    N+  F PQ+P FQ  PWPY                   GFP+ FYP A Y G T
Sbjct  266   DLANWSNFQPFPPQVPYFQGAPWPY------------------SGFPVSFYPAAPYWGCT  307

Query  1304  IPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNP-----EKCL  1468
             +   WN PW+S   + Q   ++ P SPTLGKHSRD++  +      +D+       E+C+
Sbjct  308   VSNPWNVPWLS---SNQSVHNNSPTSPTLGKHSRDESKLDPSQSRRRDTTLQDREGERCV  364

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVLL  1645
              +PKTLR  DP +AAKSSIW+TLGI+++++DS RG   F AF  K D  +    +    L
Sbjct  365   LIPKTLRIHDPNEAAKSSIWSTLGIRNEKIDSTRGTMLFSAFNPKADHRNR-ELDTSFAL  423

Query  1646  EANPAALSRSLNFHESS  1696
             +ANPAALSRSL+F ES+
Sbjct  424   QANPAALSRSLHFREST  440



>gb|KFK26911.1| hypothetical protein AALP_AA8G309800 [Arabis alpina]
Length=422

 Score =   265 bits (676),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 192/499 (38%), Positives = 256/499 (51%), Gaps = 96/499 (19%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASE---ANSLAKDSSC--SEAEPGEDEQ  415
             DP IKLFG TI  P+              GG  +E    N +    SC   + E  +   
Sbjct  3     DPAIKLFGKTIPLPEL-------------GGVLTEPQNQNLVLLSDSCIVDDEEIADSGL  49

Query  416   QQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEE  595
                        E K++E        G+ +   +E  +   A  + E   +T+ +  +E+ 
Sbjct  50    GDDGGGDLSEKEEKDNEC-------GVEESLSNESNNVATASSITEKPETTKAAKANEDG  102

Query  596   GKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
                +  ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  RN
Sbjct  103   ---TCAQEAKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRN  159

Query  776   LPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALK-ANG-KVLTLASDSV---  940
             +PVGAGRRK KN A+HY+ + V       V   E +Q  A+   NG  +LT  SDSV   
Sbjct  160   VPVGAGRRKNKNPASHYNRHQVS------VTSAEAMQKAAITDPNGTNLLTFGSDSVLCE  213

Query  941   --ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
               AS LNIA+K+    +  G  +P E G++++                            
Sbjct  214   SMASGLNIADKSMLK-TQTGLQEPNE-GLKITVPLN------------------------  247

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
                P   +       P++PCF  PP  WPY  + V W+              +PFYPP  
Sbjct  248   ---PSSEEAGTINPLPKVPCFPGPPPTWPYAWNGVSWTV-------------LPFYPPPA  291

Query  1289  YLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
             Y       P +WN+  W+ +P +P   + +   SPTLGKHSRD++  E E +  + S PE
Sbjct  292   YWSCPGVSPGAWNSFAWMPQPNSPSGSSPN---SPTLGKHSRDESIAEPEAEETEKSKPE  348

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRV  1639
             +CLWVPKTLR DDPE+AAKSSIW TLGI+ D     +   F AF+  + E S      R+
Sbjct  349   RCLWVPKTLRIDDPEEAAKSSIWETLGIKKDE----KADTFGAFRSTNKEKSSLPGR-RM  403

Query  1640  LLEANPAALSRSLNFHESS  1696
              L+ANPAALSRS NFHESS
Sbjct  404   DLQANPAALSRSANFHESS  422



>ref|XP_003520081.1| PREDICTED: cyclic dof factor 2-like [Glycine max]
Length=485

 Score =   266 bits (680),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 192/506 (38%), Positives = 264/506 (52%), Gaps = 52/506 (10%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP-DAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             TKD  IKLFG TI    +        E+     G +S+  +  +DSS S   P E     
Sbjct  6     TKDSAIKLFGRTISLSRNNNNNNNNNEVSSSANGFSSDEPAPPEDSSSSF--PREVSSTT  63

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIR---------DGLKAPHVDEDCGSTEI  574
             ++E G   + S+++  +   E E    QT++E +         +  K P  + +    + 
Sbjct  64    EHEAGRDKEPSRKELTSAQEEDEEASHQTIEEPKSPTSSSCNLENPKTPSTERETSILKS  123

Query  575   STTDEEEGKMSNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRY  748
             S   ++    +    +DKTLKKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRY
Sbjct  124   SKNGDQSDATTTSPSQDKTLKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRY  183

Query  749   WTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLA  928
             WT+GG  RN+PVGAGRRK KN+ +     ++  F+   V  PE +Q+ +L     VLT  
Sbjct  184   WTAGGTMRNVPVGAGRRKNKNTPS-----SLSHFRQIMV--PEGLQNGSLHG-AAVLTFG  235

Query  929   S-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaas  1093
             S     DS+AS L++AEKT    + NGF+ P       +  A        + ++S  +  
Sbjct  236   SDPPLCDSMASVLSLAEKT----TQNGFHSPNGDEYYDTVMASTLSERRDNATTSTNSRQ  291

Query  1094  TKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPF  1273
                D  K+        ++ GF PQL CF                  P   C     P+PF
Sbjct  292   ESLDNHKSYHHHHHHHHHQGFTPQL-CFPGSSSSPWPYPSNNPIMTPSAFC----HPVPF  346

Query  1274  YPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSN  1453
             YP   + G   P SW+  + S P        SGPNSPTLGKHSRD +          ++N
Sbjct  347   YPTQAFWGSMPPPSWSVNYQSAP-------GSGPNSPTLGKHSRDGDILFSTDMAANNNN  399

Query  1454  PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK---DDENSHA  1621
                 + +PKTLR DDP +AAKSSIW+TLGI++++ +S+ GG  FKAF  K   DD+ +HA
Sbjct  400   --NTVLIPKTLRIDDPTEAAKSSIWSTLGIKNEKGNSLNGGGLFKAFASKGNSDDKKNHA  457

Query  1622  ---SKNCRVLLEANPAALSRSLNFHE  1690
                  +   +L+ANPAALSRSL FHE
Sbjct  458   VMVEASPSPVLQANPAALSRSLVFHE  483



>gb|KHN12198.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=489

 Score =   264 bits (675),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 194/509 (38%), Positives = 265/509 (52%), Gaps = 54/509 (11%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFP----DAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             TKD  IKLFG TI       +        E+     G +S+  +  +DSS S   P E  
Sbjct  6     TKDSAIKLFGRTISLSRNNNNNNNNNNNNEVSSSANGFSSDEPAPPEDSSSSF--PREVS  63

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIR---------DGLKAPHVDEDCGS  565
                ++E G   + S+++  +   E E    QT++E +         +  K P  + +   
Sbjct  64    STTEHEAGRDKEPSRKELTSAQEEDEEASHQTIEEPKSPTSSSCNLENPKTPSTERETSI  123

Query  566   TEISTTDEEEGKMSNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKC  739
              + S T ++    +    +DKTLKKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK C
Sbjct  124   LKSSKTGDQSDATTTSPSQDKTLKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNC  183

Query  740   QRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVL  919
             QRYWT+GG  RN+PVGAGRRK KN+ +     ++  F+   V  PE +Q+ +L     VL
Sbjct  184   QRYWTAGGTMRNVPVGAGRRKNKNTPS-----SLSHFRQIMV--PEGLQNGSLHG-AAVL  235

Query  920   TLAS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvt  1084
             T  S     DS+AS L++AEKT    + NGF+ P       +  A        + ++S  
Sbjct  236   TFGSDPPLCDSMASVLSLAEKT----TQNGFHSPNGDEYYDTVMASTLSERRDNATTSTN  291

Query  1085  aasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFP  1264
             +     D  K+        ++ GF PQL CF                  P   C     P
Sbjct  292   SRQESLDNHKSYHHHHHHHHHQGFTPQL-CFPGSSSSPWPYPSNNPIMTPSAFC----HP  346

Query  1265  MPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
             +PFYP   + G   P SW+  + S P        SGPNSPTLGKHSRD +          
Sbjct  347   VPFYPTQAFWGSMPPPSWSVNYQSAP-------GSGPNSPTLGKHSRDGDILFSTDMAAN  399

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMK---DDEN  1612
             ++N    L +PKTLR DDP +AAKSSIW+TLGI++++ +S+ GG  FKAF  K   DD+ 
Sbjct  400   NNNNNTVL-IPKTLRIDDPTEAAKSSIWSTLGIKNEKGNSLNGGGLFKAFASKGNSDDKK  458

Query  1613  SHA---SKNCRVLLEANPAALSRSLNFHE  1690
             +HA     +   +L+ANPAALSRSL FHE
Sbjct  459   NHAVMVEASPSPVLQANPAALSRSLVFHE  487



>ref|XP_011075514.1| PREDICTED: cyclic dof factor 1 [Sesamum indicum]
Length=430

 Score =   261 bits (666),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 185/497 (37%), Positives = 248/497 (50%), Gaps = 87/497 (18%)
 Frame = +2

Query  248   KDPTIKLFGMTI-QFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +D  IKLFG TI   PD          D     A S +   +KD S  E    + E +  
Sbjct  7     RDCEIKLFGKTICLMPDKVVSDSKVPEDRQSSSATSTSED-SKDVSEEELTGSKHEHESI  65

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             N   E + E+                 T  EI D      ++++  S E  T  EEE   
Sbjct  66    NPTEETLTEA----------------ATSSEITDDPGTADLEKEPLSPE--TPKEEEPSE  107

Query  605   SNG-KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
             SN  ++KTLKKPDKILPCPRC+S DTKFCY+NNYN NQPRHFCK CQRYWTSGG  RN+P
Sbjct  108   SNAPQEKTLKKPDKILPCPRCNSTDTKFCYYNNYNVNQPRHFCKNCQRYWTSGGTMRNVP  167

Query  782   VGAGRRKTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASE--  949
             VG+GRRK KN+    + H+  + +   A   +  R+   +LK NG  L   SD+   E  
Sbjct  168   VGSGRRKNKNAVVPNYRHITFLDTLTRADAINGSRLS--SLKPNG-FLVFGSDTQLCESM  224

Query  950   ---LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNG  1120
                LN+ E++  N   N FY+   +                       +  T +   K+G
Sbjct  225   NCTLNLGERSQ-NCVPNEFYEHSSIS----------------------STRTSNSTEKDG  261

Query  1121  LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGY  1300
                M + + H                  + +QW+S+ PP      GFP+ FYP   Y G 
Sbjct  262   HAAMQESDLH---------------ISQNRMQWTSSKPPTTFGQSGFPVTFYPATPYWGS  306

Query  1301  TIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDD----NNKEGEPQPPKDSNPEKCL  1468
              +   WN P VS              S  LGKHSR++    ++  G+    +    E+ +
Sbjct  307   AVTSPWNVPLVS------------STSSILGKHSREETMVRSSNLGKENLSEKVGRERSV  354

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA-FKAFKMKDDENSHASKNCRVLL  1645
              VPKTLR DDP++AAKSSIW+TLGI+ +++ SI G + FKAF+ K D NS+   N  V+L
Sbjct  355   LVPKTLRIDDPDEAAKSSIWSTLGIKKEKIGSINGKSLFKAFETKGDRNSNID-NTAVVL  413

Query  1646  EANPAALSRSLNFHESS  1696
             +ANPAAL RSLNFHES+
Sbjct  414   QANPAALCRSLNFHEST  430



>ref|XP_010678507.1| PREDICTED: cyclic dof factor 3 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   259 bits (662),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 230/406 (57%), Gaps = 48/406 (12%)
 Frame = +2

Query  509   VDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             V    D  K+P  ++D  S E+   + ++ K  N + KTLKKPDKI+PCPRC+SMDTKFC
Sbjct  23    VSNTSDNEKSPDSEKD--SEEMDEKESDDPK--NSQQKTLKKPDKIIPCPRCNSMDTKFC  78

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACV  865
             Y+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K+SA+ Y H+   ++ Q A +
Sbjct  79    YYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKSSASRYCHITVSEALQAARL  138

Query  866   DHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVS  1030
             D    + H  LK NG VLT   D     S++  LNI +    NG+      P      V 
Sbjct  139   DVSNGVHHPGLKTNGTVLTFGPDNPLCESMSPVLNIGDTKVLNGT------PTRNDFHV-  191

Query  1031  YgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSA  1210
                  +  D  S  S+VT  S+ D+  K G       N +GF  Q+PCFQ   WPY    
Sbjct  192   ----IDQVDDRSSGSTVTTTSSMDENAKAGP---QGHNLNGFPNQMPCFQ---WPY----  237

Query  1211  VQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTL  1390
               W+ AVP     +  FPM +YPP  Y    +P  WN PW+  P +P     S P SPTL
Sbjct  238   -MWNPAVPVQPFCATTFPMSYYPPPPYWNGAMP--WNFPWIP-PCSPS--PGSNPTSPTL  291

Query  1391  GKHSRD----DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             GKHSRD    + N+ G       S+  + + VPKTLR DDP++AAKSSIW TLGI+    
Sbjct  292   GKHSRDGEMLNQNENGR------SSGTRTVLVPKTLRIDDPDEAAKSSIWTTLGIKKGDS  345

Query  1559  DSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              S RGG F   + K  E      +  + L+ANPAALSRS+NF ES+
Sbjct  346   QS-RGGFFNNLQSKKGEEKIHMMDAPLALQANPAALSRSMNFQESA  390



>emb|CDX67434.1| BnaA07g14740D [Brassica napus]
Length=423

 Score =   260 bits (664),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 191/505 (38%), Positives = 254/505 (50%), Gaps = 107/505 (21%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASE---ANSLAKDSSCSEAEPGEDEQQQ  421
             DP +KLFG TI  P+         + VD   + +E    N +    SC+    G+DE+  
Sbjct  3     DPAMKLFGKTIPLPEL--------VCVDSSSSYTEHQHQNPVRLSDSCT----GDDEEM-  49

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
               ++G   D+     G    E E   +Q  +E  +   A            + TDEE   
Sbjct  50    -GDSGLAGDDVWFHGGDSESEKEEKANQCGEESSNVTMASS----------TKTDEESSS  98

Query  602   MSN---GKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
              +N    ++  LKKPDKILPCPRC SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  R
Sbjct  99    QNNETCSREGKLKKPDKILPCPRCSSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMR  158

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV----  940
             N+PVGAGRRK K+ A+HY+       +   +   E +   A + +  ++T+ SDSV    
Sbjct  159   NVPVGAGRRKNKSLASHYN-------RYVGITSAEDMHKAAARTDPNLMTIGSDSVLCES  211

Query  941   -ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKN  1117
              AS L++AEK+  N       +P E G++++                      K+ V  +
Sbjct  212   MASGLSLAEKSMLNTETGLQEEPNE-GLKITV-----------------PLKNKETVAIS  253

Query  1118  GLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLG  1297
              LP           P         W YP + V W+              +PFYPP  Y  
Sbjct  254   PLPKAPCFAGPPPPPAA-------WSYPWNGVSWTV-------------LPFYPPPAYWS  293

Query  1298  Y--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCL  1468
                  P +WN+  W+S+P++P     SGPNSPTLGKHSRD++  E    P       +CL
Sbjct  294   CPGVSPGTWNSFTWMSQPISPS--GGSGPNSPTLGKHSRDESIAE----PGTKRISGRCL  347

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNC-----  1633
             WVPKTLR DDPE+AAKSSIW TLGI+ D     +   F+AF+     +SH  K+C     
Sbjct  348   WVPKTLRIDDPEEAAKSSIWETLGIKKDE----KTDTFRAFR-----SSHKVKSCLSDGK  398

Query  1634  ----RVLLEANPAALSRSLNFHESS  1696
                 R  L ANPAALSRS NFHESS
Sbjct  399   HPGRRPELLANPAALSRSANFHESS  423



>ref|XP_010678506.1| PREDICTED: cyclic dof factor 3 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=438

 Score =   259 bits (663),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 230/406 (57%), Gaps = 48/406 (12%)
 Frame = +2

Query  509   VDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             V    D  K+P  ++D  S E+   + ++ K  N + KTLKKPDKI+PCPRC+SMDTKFC
Sbjct  71    VSNTSDNEKSPDSEKD--SEEMDEKESDDPK--NSQQKTLKKPDKIIPCPRCNSMDTKFC  126

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACV  865
             Y+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K+SA+ Y H+   ++ Q A +
Sbjct  127   YYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKSSASRYCHITVSEALQAARL  186

Query  866   DHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVS  1030
             D    + H  LK NG VLT   D     S++  LNI +    NG+      P      V 
Sbjct  187   DVSNGVHHPGLKTNGTVLTFGPDNPLCESMSPVLNIGDTKVLNGT------PTRNDFHV-  239

Query  1031  YgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSA  1210
                  +  D  S  S+VT  S+ D+  K G       N +GF  Q+PCFQ   WPY    
Sbjct  240   ----IDQVDDRSSGSTVTTTSSMDENAKAGP---QGHNLNGFPNQMPCFQ---WPY----  285

Query  1211  VQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTL  1390
               W+ AVP     +  FPM +YPP  Y    +P  WN PW+  P +P     S P SPTL
Sbjct  286   -MWNPAVPVQPFCATTFPMSYYPPPPYWNGAMP--WNFPWIP-PCSPS--PGSNPTSPTL  339

Query  1391  GKHSRD----DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             GKHSRD    + N+ G       S+  + + VPKTLR DDP++AAKSSIW TLGI+    
Sbjct  340   GKHSRDGEMLNQNENGR------SSGTRTVLVPKTLRIDDPDEAAKSSIWTTLGIKKGDS  393

Query  1559  DSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              S RGG F   + K  E      +  + L+ANPAALSRS+NF ES+
Sbjct  394   QS-RGGFFNNLQSKKGEEKIHMMDAPLALQANPAALSRSMNFQESA  438



>ref|XP_006405606.1| hypothetical protein EUTSA_v10027747mg [Eutrema salsugineum]
 dbj|BAJ34025.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47059.1| hypothetical protein EUTSA_v10027747mg [Eutrema salsugineum]
Length=461

 Score =   260 bits (664),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 196/514 (38%), Positives = 257/514 (50%), Gaps = 87/514 (17%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE------  412
             DP IKLFG TI  P+       +   V       + N +    SC+    G+DE      
Sbjct  3     DPAIKLFGKTIPLPELGGDSSISYTGVS--TEHQDQNLVRLSDSCT----GDDEGMGDSG  56

Query  413   -----QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIS  577
                         G   +  KE++     E     +   DE  +      + E   +T+ +
Sbjct  57    LAGGGGDDGGFRGRDSESEKEEKDNECQEEHREEESLRDESSNVATTSGITEKTETTKAA  116

Query  578   TTDEEEGKMSNGKDKT-LKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWT  754
              T+EE  +      +T LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT
Sbjct  117   KTEEESSQNGTCSQETKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWT  176

Query  755   SGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANG-KVLTLAS  931
             +GG  RN+PVGAGRRK KN A+HY+ +   +   A +     I+      NG  +LT  S
Sbjct  177   AGGTMRNVPVGAGRRKNKNPASHYNRHVSVTSAEATMQK-AAIRTDLQHPNGTNLLTFGS  235

Query  932   DSV-----ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasT  1096
             DSV     AS LN+A+K+    +     +P E G++++                      
Sbjct  236   DSVICESMASGLNLADKSMMK-TQTVLQEPNEGGLKITVPIN------------------  276

Query  1097  KDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSPGFPMP  1270
                      P   +       P++PC   PP  WPY  + V W+              +P
Sbjct  277   ---------PSNEEIGTISSLPKIPCVPGPPPTWPYAWNGVSWTV-------------VP  314

Query  1271  FYPPAMYLGYTIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKE-----GEP  1432
             FYPP  Y G + P +WN+  W+  P      + SGPNSPTLGKHSRD+N  E      E 
Sbjct  315   FYPPPAYWGVS-PGTWNSFTWM--PQPNSPSSGSGPNSPTLGKHSRDENAAEPGTGFEET  371

Query  1433  QPP--KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDD  1606
             + P  + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D     +   F AF+  + 
Sbjct  372   ESPGREKSKPERCLWVPKTLRVDDPEEAAKSSIWETLGIKKDE----KADTFGAFRSPNK  427

Query  1607  ENSHASK----NCRVLLEANPAALSRSLNFHESS  1696
             E S  S+      R  L+ANPAALSRS NFHESS
Sbjct  428   EKSCLSEGKLPGRRPELQANPAALSRSANFHESS  461



>ref|XP_010678503.1| PREDICTED: cyclic dof factor 1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678504.1| PREDICTED: cyclic dof factor 1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678505.1| PREDICTED: cyclic dof factor 1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=441

 Score =   259 bits (663),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 230/406 (57%), Gaps = 48/406 (12%)
 Frame = +2

Query  509   VDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             V    D  K+P  ++D  S E+   + ++ K  N + KTLKKPDKI+PCPRC+SMDTKFC
Sbjct  74    VSNTSDNEKSPDSEKD--SEEMDEKESDDPK--NSQQKTLKKPDKIIPCPRCNSMDTKFC  129

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACV  865
             Y+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K+SA+ Y H+   ++ Q A +
Sbjct  130   YYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKSSASRYCHITVSEALQAARL  189

Query  866   DHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVS  1030
             D    + H  LK NG VLT   D     S++  LNI +    NG+      P      V 
Sbjct  190   DVSNGVHHPGLKTNGTVLTFGPDNPLCESMSPVLNIGDTKVLNGT------PTRNDFHV-  242

Query  1031  YgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSA  1210
                  +  D  S  S+VT  S+ D+  K G       N +GF  Q+PCFQ   WPY    
Sbjct  243   ----IDQVDDRSSGSTVTTTSSMDENAKAGP---QGHNLNGFPNQMPCFQ---WPY----  288

Query  1211  VQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTL  1390
               W+ AVP     +  FPM +YPP  Y    +P  WN PW+  P +P     S P SPTL
Sbjct  289   -MWNPAVPVQPFCATTFPMSYYPPPPYWNGAMP--WNFPWIP-PCSPS--PGSNPTSPTL  342

Query  1391  GKHSRD----DNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV  1558
             GKHSRD    + N+ G       S+  + + VPKTLR DDP++AAKSSIW TLGI+    
Sbjct  343   GKHSRDGEMLNQNENGR------SSGTRTVLVPKTLRIDDPDEAAKSSIWTTLGIKKGDS  396

Query  1559  DSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
              S RGG F   + K  E      +  + L+ANPAALSRS+NF ES+
Sbjct  397   QS-RGGFFNNLQSKKGEEKIHMMDAPLALQANPAALSRSMNFQESA  441



>gb|AFO84079.1| Dof zinc finger protein [Actinidia chinensis]
Length=435

 Score =   258 bits (660),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 198/503 (39%), Positives = 266/503 (53%), Gaps = 96/503 (19%)
 Frame = +2

Query  248   KDPTIKLFGMTIQF-PDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGE------  406
             +DP IKLFG TI   P+         +      +AS+ N ++  +S S +  G+      
Sbjct  5     RDPAIKLFGKTISVQPNKEASSFTATIPPPHVASASDLNLVSSTTSSSSSSHGDLICISV  64

Query  407   DEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGL-KAPHVDEDCGSTEISTT  583
             D+Q+         D  K  E    +E           I  G  K P V+ +  S ++S  
Sbjct  65    DDQE---------DNQKPSEYVKYLE-----------ISSGNPKTPSVNNEPTSPKVSKN  104

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             DE+  + S  ++ T KKPDKILPCPRC S +TKFCYFNNYN NQPR+FCK CQRYWT+GG
Sbjct  105   DEQ-SETSITQETTPKKPDKILPCPRCSSTETKFCYFNNYNVNQPRYFCKNCQRYWTAGG  163

Query  764   MTRNLPVGAGRRKTKNS-AAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-  934
               RN+PVG+GRRK K+S A+HY H+   +S  N                N  VL   SD 
Sbjct  164   SMRNVPVGSGRRKHKSSPASHYGHIMVSESLHNG---------------NATVLAFGSDL  208

Query  935   ----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKD  1102
                 S+AS L++AE+     S N F K      +VS   GD+ +  SS + S +    + 
Sbjct  209   PLCESIASALSLAEE-----SRNCFQKQ-----KVSVSCGDDNSSRSSVTVSNSTDHQRG  258

Query  1103  DVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSP-GFPMPFYP  1279
             D   + L + +  N+   APQ+ CF  PPW              PPG FSP  FP+ FYP
Sbjct  259   D---SALQETVVTNFQTLAPQVQCFAGPPW------------ACPPG-FSPSAFPVTFYP  302

Query  1280  PAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPK  1444
                Y G T+P     P+     +P+      PNS  LGKHSRD +     N E      K
Sbjct  303   APAYWGCTLP----GPYWGTCTSPEPALCPSPNSQNLGKHSRDGDMIRPSNSE------K  352

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG-GAFKAFKMKDDENSHA  1621
             DS   + +W+PKTLR DDP +AAKSSIW+TLGI++++ +S  G   FKAF+ K DE +H 
Sbjct  353   DSERSR-VWIPKTLRIDDPSEAAKSSIWSTLGIKNEKHNSTNGRSMFKAFESKVDEKNHR  411

Query  1622  SKNCRVLLEANPAALSRSLNFHE  1690
             S+   ++L+ANPAAL+RSLNFHE
Sbjct  412   SER-PLVLQANPAALARSLNFHE  433



>ref|XP_002316165.2| hypothetical protein POPTR_0010s17480g [Populus trichocarpa]
 gb|EEF02336.2| hypothetical protein POPTR_0010s17480g [Populus trichocarpa]
Length=318

 Score =   254 bits (648),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 205/355 (58%), Gaps = 54/355 (15%)
 Frame = +2

Query  671   MDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAA-HY-HLNAVK  844
             MDTKFCY+NNYN NQPRHFCKKCQRYWT+GG  RN+PVGAGRRK K+S+A HY HL   +
Sbjct  1     MDTKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSSSASHYRHLMVSE  60

Query  845   SFQNACVDHPERIQHHALKANGKVLTLASDS-----VASELNIAEKTAGNGSLNGFYKPV  1009
             + +   V     + + +   N  VL   SDS     VAS LN++EKT  N   N +++P 
Sbjct  61    ALRTVQVHAMNGVHNPSFGNNTTVLAFGSDSPLCDSVASVLNLSEKTQ-NSVRNEYHRP-  118

Query  1010  ELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP  1189
             E  I V                           C       + ++Y  F PQ+PCF  PP
Sbjct  119   EHRIFVP--------------------------CGGA---GINKDYQSFPPQVPCFPGPP  149

Query  1190  WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAP-WVSRPVAPQHHTS  1366
             WPY     QW+SA+PPP  + PGFP+ FYP   Y G T+P  WN P  VS P     H +
Sbjct  150   WPY-----QWNSALPPPTFYPPGFPVSFYPAPTYWGCTVPSPWNVPPCVSPPSTSLKHCT  204

Query  1367  --SGPNSPTLGKHSRDDN--NKEGEPQPPKDSNPE-KCLWVPKTLRFDDPEDAAKSSIWA  1531
               S P S TLGKHSRD +  +     +P ++     K + VPKT R DDP +AAKSSIWA
Sbjct  205   LDSSPTS-TLGKHSRDGSILHPAYLKEPSREGTKSVKGVLVPKTSRIDDPSEAAKSSIWA  263

Query  1532  TLGIQHDRVDSIRGGA-FKAFKMK-DDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             TLGI  ++ +SI GG  FK F+ K +D+N  A +    +L+ANPAALSRSLNFHE
Sbjct  264   TLGIMSEKSNSINGGGLFKGFQSKNEDKNDMAGRTS--VLQANPAALSRSLNFHE  316



>ref|XP_010435867.1| PREDICTED: cyclic dof factor 2-like [Camelina sativa]
Length=460

 Score =   257 bits (657),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 196/521 (38%), Positives = 262/521 (50%), Gaps = 102/521 (20%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDS-SCSEAEPGEDE-----  412
             DP IKLFG TI  P+       +   +       + N L + S SC+  +   DE     
Sbjct  3     DPAIKLFGKTIPLPELGVVVVDSSCSI--FTENQDQNPLVRLSDSCTGDDDDNDEMGDSG  60

Query  413   -------------QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDE  553
                          + Q+ ++ E  +ES + E   +    G+ D+T     +  KA   +E
Sbjct  61    LGEGGGESESDKKEIQEEKDNECQEESLKHESNAVTATSGVTDKT-----ETTKAAKTNE  115

Query  554   DCGSTEISTTDEEEGKMSNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHF  727
             +      S+ +E  G  +    ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHF
Sbjct  116   E------SSPNETGGGTTTACSQEAKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHF  169

Query  728   CKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKAN  907
             CKKCQRYWT+GG  RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN
Sbjct  170   CKKCQRYWTAGGTMRNVPVGAGRRKNKSPASHYNRHVSITSAEALQKAARTDLQHPNGAN  229

Query  908   GKVLTLASDSV-----ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
               +LT  SDSV     AS LN+ EK+    +     +P E G++++              
Sbjct  230   --LLTFGSDSVLCESMASGLNLVEKSMLK-TQTTLQEPNE-GLKIT--------------  271

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGC  1246
                        V  N LP+          P++PCF  PP  WPY  + V W+        
Sbjct  272   -----------VPLNPLPNEEAGTISPL-PKVPCFPGPPPAWPYAWNGVSWTV-------  312

Query  1247  FSPGFPMPFYPPAMYLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNN  1417
                   +PFYPP  Y       P +WN+  W+ +P +P   + +   SPTLGKHSRD+N 
Sbjct  313   ------VPFYPPPAYWSCPGVSPGAWNSFTWMPQPNSPSGSSPN---SPTLGKHSRDENA  363

Query  1418  ----KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFK  1585
                 KE E    + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F 
Sbjct  364   AEACKETESLGREKSKPERCLWVPKTLRVDDPEEAAKSSIWETLGIKKDE----NADTFG  419

Query  1586  AFKMKDDENSHASK----NCRVLLEANPAALSRSLNFHESS  1696
             AF+    E S  S+      R+ L+ANPAALSRS NFHE+S
Sbjct  420   AFRSSTKEKSSLSEGKLPGRRLELQANPAALSRSTNFHETS  460



>gb|AFH68179.1| CDF3 Dof zinc finger protein 3.3, partial [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   253 bits (646),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 215/373 (58%), Gaps = 44/373 (12%)
 Frame = +2

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             N + KTLKKPDKI+PCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVG
Sbjct  1     NSQQKTLKKPDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVG  60

Query  788   AGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASE  949
             AGRRK K+SA+ Y H+   ++ Q A +D    + H  LK NG VLT   D     S++  
Sbjct  61    AGRRKNKSSASRYCHITVSEALQAARLDVSNGVHHPGLKTNGTVLTFGPDNPLCESMSPV  120

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNI +    NG+      P      V      +  D  S  S+VT  S+ D+  K G   
Sbjct  121   LNIGDTKVLNGT------PTRNDFHV-----IDQVDDRSSGSTVTTTSSMDENAKAGPQG  169

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
                 N +GF  Q+PCFQ   WPY      W+ AVP     +  FPM +YPP  Y    +P
Sbjct  170   ---HNLNGFPNQMPCFQ---WPY-----MWNPAVPVQPFCATTFPMSYYPPPPYWNGAMP  218

Query  1310  CSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRD----DNNKEGEPQPPKDSNPEKCLWVP  1477
               WN PW+  P +P     S P SPTLGKHSRD    + N+ G       S+  + + VP
Sbjct  219   --WNFPWMP-PCSPS--PGSNPTSPTLGKHSRDGEMLNQNENGR------SSGTRTVLVP  267

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             KTLR DDP++AAKSSIW TLGI+     S RGG F   + K  E      +  + L+ANP
Sbjct  268   KTLRIDDPDEAAKSSIWTTLGIKKGDSQS-RGGFFNNLQSKKGEEKIHMMDAPLALQANP  326

Query  1658  AALSRSLNFHESS  1696
             AALSRS+NF ES+
Sbjct  327   AALSRSMNFQESA  339



>ref|XP_009390304.1| PREDICTED: cyclic dof factor 2-like [Musa acuminata subsp. malaccensis]
Length=378

 Score =   253 bits (646),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 157/387 (41%), Positives = 204/387 (53%), Gaps = 73/387 (19%)
 Frame = +2

Query  545   VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRH  724
              D +  ST+ S  +E        KDK +KKPDKILPCPRC S+DTKFCY+NNYN NQPRH
Sbjct  62    ADREDASTKNSVAEEHS------KDKAVKKPDKILPCPRCKSLDTKFCYYNNYNVNQPRH  115

Query  725   FCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVK-SFQNACVDHPERIQHHALK  901
             FCK CQRYWT+GG  RN+PVGAGRRK+K+++   H+   + S Q+   + PE +++   K
Sbjct  116   FCKNCQRYWTAGGTMRNVPVGAGRRKSKSTSHFRHIAVSESSLQSVRCNAPESVRYPP-K  174

Query  902   ANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
              NG VL+  +D+ A    +        S      P E G                     
Sbjct  175   PNGTVLSFGTDAPAKAKPLPS------SETSMLSPNENG---------------------  207

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGF  1261
                                QNY G A  +PCF   PWPYP     W+ A P        F
Sbjct  208   ------------------GQNYQGSAAPIPCFGGSPWPYP-----WTPAAP------LSF  238

Query  1262  PMPFYPPAMYLGYTIPC-SWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQP  1438
             P+PFYP A Y    +P  +W+ PW+S P+A   H ++ PN+  LGKHSRD +N       
Sbjct  239   PIPFYPAAAYWSCAVPSGAWSVPWLS-PLA-SSHPAAAPNTGNLGKHSRDGSNLNNS---  293

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENS  1615
                S  E     P TLR DDPE+AA+SSIW  +G++  + +++  GG  +AF  K D  +
Sbjct  294   -SLSTEEDGGLAPTTLRIDDPEEAARSSIWTMVGVKRSKNNAVSNGGLLRAFHPKVDVKN  352

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
             H       LL ANPAALSRSLNFHE+S
Sbjct  353   HVLV-APSLLHANPAALSRSLNFHETS  378



>dbj|BAB08898.1| unnamed protein product [Arabidopsis thaliana]
Length=515

 Score =   256 bits (654),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 185/502 (37%), Positives = 249/502 (50%), Gaps = 83/502 (17%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPD-------AppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGED  409
             DP IKLFG TI  P+       +      TE  + P   +        D    ++  G +
Sbjct  3     DPAIKLFGKTIPLPELGVVDSSSSYTGFLTETQI-PVRLSDSCTGDDDDEEMGDSGLGRE  61

Query  410   EQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE  589
             E     + G   +  K++E     + E + +++ D          + E   +T+ + T+E
Sbjct  62    EGDDVGDGGGESETDKKEEKDSECQEESLRNESNDVT---TTTSGITEKTETTKAAKTNE  118

Query  590   EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMT  769
             E G  +  ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  
Sbjct  119   ESGGTACSQEGKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTM  178

Query  770   RNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV---  940
             RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN  +LT  SDSV   
Sbjct  179   RNVPVGAGRRKNKSPASHYNRHVSITSAEAMQKVARTDLQHPNGAN--LLTFGSDSVLCE  236

Query  941   --ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
               AS LN+ EK+    +     +P E G++++        +  + S              
Sbjct  237   SMASGLNLVEKSLLK-TQTVLQEPNE-GLKITVPLNQTNEEAGTVSP-------------  281

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAM  1288
                            P++PCF  PP  WPY  + V W+              +PFYPP  
Sbjct  282   --------------LPKVPCFPGPPPTWPYAWNGVSWTI-------------LPFYPPPA  314

Query  1289  YLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNK-------EGEPQP  1438
             Y       P +WN+  W+ +P +P   + S PNSPTLGKHSRD+N         E E   
Sbjct  315   YWSCPGVSPGAWNSFTWMPQPNSP---SGSNPNSPTLGKHSRDENAAEPGTAFDETESLG  371

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSH  1618
              + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F AF+    E S 
Sbjct  372   REKSKPERCLWVPKTLRIDDPEEAAKSSIWETLGIKKDE----NADTFGAFRSSTKEKSS  427

Query  1619  ASK----NCRVLLEANPAALSR  1672
              S+      R  L+ANPAALSR
Sbjct  428   LSEGRLPGRRPELQANPAALSR  449



>ref|XP_003556733.1| PREDICTED: cyclic dof factor 2-like [Glycine max]
 gb|KHN28800.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=482

 Score =   254 bits (649),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 199/501 (40%), Positives = 272/501 (54%), Gaps = 45/501 (9%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI  P        T ++     A++   + A  SS S  E      QQ++
Sbjct  5     KDPAIKLFGRTISLPH-------THINDSFSSASASGPACAPSSSSSPREVTSSATQQQH  57

Query  428   ENGE----RMDESKEDEGTVLMEGEGIMDQTVDE-IRDGLKAPHVDEDCGSTEISTTDEE  592
             E  E     +  S++D+       E +   T    I +  K P  + +  S   S+T+ E
Sbjct  58    EPEEPSRKVLTSSQDDDDASHQTTEDLKSSTTSSGIFENPKTPSAETET-SIPKSSTNGE  116

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             + + S  ++KTLKKPDK+LPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  117   KSEKSASEEKTLKKPDKVLPCPRCNSMETKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  176

Query  773   NLPVGAGRRKTKNSAA---HY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV  940
             N+P GAGRRK KNS+A   HY H+   +  Q A ++ P  + H+A+   G    L  D++
Sbjct  177   NVPAGAGRRKNKNSSATVSHYRHIMFSEGLQGATLNAPNGL-HNAVMTFGPDSPLC-DTM  234

Query  941   ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngad-hssgsssvtaasTKDDVCKN  1117
             AS LNIAE+ A +   NGF+   E    VSY   +   D  S  S+ V + +T   +  +
Sbjct  235   ASMLNIAER-AQSCVPNGFHV-TEPNSFVSYRKEEEEEDGTSGHSTGVNSVATTSTLSHS  292

Query  1118  GLPDML-KQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
             G  + L K+   GF PQ P F + PWPYP     +         F  G+P+  Y    Y 
Sbjct  293   GSHESLDKKVVEGFTPQFPYFPSAPWPYPIPPPTF---------FPQGYPLSLYTTPAYW  343

Query  1295  GYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNPE  1459
              Y +P SWN    +  ++PQ   ++  ++PTLGKHSRD N     N + E    + ++ E
Sbjct  344   SY-MPPSWNNNISA--ISPQSSVNNSVSNPTLGKHSRDGNIIASSNSQREMHDMEHNSSE  400

Query  1460  KCLWVPKTLRFDDPEDAAKSSI--WATLGIQHDRVDSIRGGAFKAF--KMKDDENSHASK  1627
                 +PKTLR DDP +AAKSSI  W+ LGI++D   S  GG FKAF     +D N    +
Sbjct  401   HNALIPKTLRIDDPREAAKSSISMWSKLGIKNDDKAS-SGGLFKAFPSSKGNDINHQMVE  459

Query  1628  NCRVLLEANPAALSRSLNFHE  1690
                 +L+ANPAALSRSL F E
Sbjct  460   ASSPVLQANPAALSRSLTFRE  480



>ref|XP_007158648.1| hypothetical protein PHAVU_002G170600g [Phaseolus vulgaris]
 gb|ESW30642.1| hypothetical protein PHAVU_002G170600g [Phaseolus vulgaris]
Length=464

 Score =   252 bits (644),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 185/506 (37%), Positives = 259/506 (51%), Gaps = 67/506 (13%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              K   IKLFG TI  P                  +S    L+  SS S  +      QQ+
Sbjct  4     VKGSEIKLFGRTISLPH---------------NDSSSPACLSCPSSSSSPQQATSATQQR  48

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIR-------DGLKAPHVDEDCGSTEISTT  583
              E+ E +      E T L + +    QT ++++       D  K P  + +    + S  
Sbjct  49    QEDQEPI----RKELTSLQDDDASSHQTTEDLKSPASGILDNPKTPSAETETSLQKSSAN  104

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
              E+    S  +DKT KKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  105   GEQSETTSASEDKTPKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  164

Query  764   MTRNLPVGAGRRKTKN----SAAHYHLNAV-KSFQNACVDHPERIQHHALKANGKVLTLA  928
               RN+PVGAGRRK KN    +A+HY    + ++ Q A ++    + +  L+    VLT  
Sbjct  165   TMRNVPVGAGRRKNKNISAAAASHYRQIMIPEALQGATLNASNGLHNALLRNRAGVLTFG  224

Query  929   -----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaas  1093
                   D+++S L+IAE+ A +   NGF+   E    VSY      ++  S S++  ++ 
Sbjct  225   PDTPLCDTMSSVLSIAER-AQSCVSNGFHG-TEPNSCVSYSKEGGHSNGVSVSTTSASSH  282

Query  1094  TKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPF  1273
             T      +       +   GF+PQL  F   PWPYP         +P      P +P+ F
Sbjct  283   TSSHESVD-------ERVEGFSPQLSYFPGAPWPYP---------MPRHTVCPPSYPLSF  326

Query  1274  YPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQP  1438
             Y    Y G  +P SWN P +S    PQ   ++  ++P LGKHSR+ N     N + E + 
Sbjct  327   YTTPAYWG-CMPPSWNMPCMS----PQSSVTNPVSAPILGKHSRNGNIITPSNSQKEMRG  381

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSH  1618
              + S  E    +PKTLR DDP + A+SS+W+ LG ++DR  S  GG F+AF  K ++ + 
Sbjct  382   VEHSTSEHNFLIPKTLRIDDPGETARSSMWSKLGTKNDRASS--GGLFQAFPPKGNDMNR  439

Query  1619  ASKNCRVLLEANPAALSRSLNFHESS  1696
               +     L+ANPAALSRSL FHE +
Sbjct  440   MVE-ASPELQANPAALSRSLTFHEQT  464



>ref|XP_008442918.1| PREDICTED: cyclic dof factor 3-like [Cucumis melo]
Length=438

 Score =   251 bits (641),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 192/499 (38%), Positives = 259/499 (52%), Gaps = 79/499 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAE-PGEDEQQQ  421
             +KDPTIKLFG  I   D    P     D     ++ +     KD++  E E P +D    
Sbjct  4     SKDPTIKLFGRQIPLSDDAETPAVLSHDF----SSHKHPEPRKDAAIDEPEKPVDDSDDL  59

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             +N       E +E+  +V                   K P +DE+  +T ++   E E  
Sbjct  60    RN------IEREEEAASV-----------------NPKTPSIDEETTTTPVNGEPESEKS  96

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              S   +KTLKKPDK+LPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  97    NS---EKTLKKPDKLLPCPRCKSMETKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVP  153

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQH-HALKANGKVLTLASDSVASE--  949
             VGAGRRK+KNSA++Y H+   ++ + A ++ P   Q    +  NG+VL+   D+ +S+  
Sbjct  154   VGAGRRKSKNSASYYRHITISEALEAARIESPNGTQKPKFINNNGRVLSFNLDAPSSDPV  213

Query  950   ----LNIAE-KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
                 LN+ E +   NG      K V+ G + +          SS                
Sbjct  214   MGSILNLGENRVLSNGVKKFEEKAVDQGCEKNSSLSSMPVQSSSE---------------  258

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYL  1294
                   LK N  GF  Q+ C    PWP+      W+S+VPPP    PGFP+ F+P A + 
Sbjct  259   ------LKIN--GFPSQISCLSGVPWPF-----VWNSSVPPPTFTPPGFPLSFFPAAAW-  304

Query  1295  GYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK---C  1465
                +P  WN PW S P   +   S    S TLGKH RD    + +    K+   ++    
Sbjct  305   NSGVPGPWNTPWFS-PQPEKSLCSDTKASSTLGKHQRDHEMAKEDAISSKEEVFKQRNGH  363

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA--FKAFKMKDDENSHASKNCRV  1639
             +  PKTLR DDP +AAKSSIWATLGI++   +S+ GG   FK F+ K  +  H ++   V
Sbjct  364   VLTPKTLRIDDPSEAAKSSIWATLGIKN---ESLTGGKNLFKTFQPKGHQKVHVAETSSV  420

Query  1640  LLEANPAALSRSLNFHESS  1696
              L+ANPAALSRSL FHESS
Sbjct  421   -LQANPAALSRSLVFHESS  438



>ref|XP_008793337.1| PREDICTED: cyclic dof factor 3-like [Phoenix dactylifera]
Length=512

 Score =   253 bits (646),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 197/559 (35%), Positives = 267/559 (48%), Gaps = 127/559 (23%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE-----  412
             +DP IKLFG TI  P+  P P   E          +      D++ +   P +DE     
Sbjct  5     RDPAIKLFGKTIPLPENLPSPATVE----------DKEECPPDTAPAPEMPEDDEKDICK  54

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
             ++   E  + M ++ E+       G G+   + D+     +AP+ D +  +   +  D+ 
Sbjct  55    EKTDMEVNDPMPDALEELNQDDPNGSGLNIGSEDDN----QAPNQDMEVATDSKAEHDKT  110

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             E   S+G++K LKKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  111   ETD-SSGQEKVLKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  169

Query  773   NLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHAL-----------KANGK  913
             N+PVGAGRRK K+S + Y   + +     +  +D  + I H AL           K NG 
Sbjct  170   NVPVGAGRRKNKHSTSQYRHIMMSSDGLASGRIDASDLIPHQALPCGPSVPMRSMKGNGT  229

Query  914   VLTLA-----SDSVASELNIAE--KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             VL         +S+AS LN+ E  K AG GS+       E     S              
Sbjct  230   VLKFGPEVPLCESMASVLNLGEQKKNAGLGSIACGENREEPSCASSV-------------  276

Query  1073  ssvtaasTKDDVCKNGLPD----MLKQNYHGFA------PQLPCFQAPPWPYP-------  1201
                    T  +  +NGLP+    M +    G+       P L C+   PW YP       
Sbjct  277   -------TASNCVENGLPENVAHMEQNGTQGYCNGLTPMPHLQCYPGAPWAYPWGPGWNN  329

Query  1202  ---------------------SSAVQWSSAVPPP-----GCFSPGFPMPFYPPAMY--LG  1297
                                   S + WS   PPP        +P  P PF PP+ +  + 
Sbjct  330   IAAMAAGRCSSEVVYGPENGSPSLIPWS---PPPMMSALAFCAPTIPFPFMPPSFWGCMS  386

Query  1298  YTIPCSWNAPWV------SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
                  +WNAPWV      S   + +++   G  SPTLGKHSRD N +  E         E
Sbjct  387   SWPNGAWNAPWVGSNGSTSPSSSTRNNGCLGNGSPTLGKHSRDANLQGEEKM-------E  439

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRV  1639
             K LWVPKTLR DDP++AAKSSIWATLGI+ +      GG FK F+ K +     S + ++
Sbjct  440   KYLWVPKTLRIDDPDEAAKSSIWATLGIKPE-----EGGIFKPFQSKAESKRRTSDDAQI  494

Query  1640  LLEANPAALSRSLNFHESS  1696
              L ANPAALSRS +F E++
Sbjct  495   -LHANPAALSRSQSFQENT  512



>gb|KHN45505.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=385

 Score =   248 bits (633),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 159/388 (41%), Positives = 209/388 (54%), Gaps = 25/388 (6%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KD T+KLFG TI  P+     P         G A     +    S S    GE+ + ++
Sbjct  4     SKDSTMKLFGKTIPAPEISAGAPALS-----SGDADAVGVVQNHGSSSVNGDGEEHEIEQ  58

Query  425   NENGERMDES-KEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
             +  GE   ES KEDE T L       D         +      ED        T++E+G+
Sbjct  59    DIMGEETTESEKEDEVTNL-------DTVSRPGEVSINPSTKKEDLTLKTSKKTEQEQGE  111

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
               N +DKTL+KPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG+ RN+P
Sbjct  112   --NSQDKTLRKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGVMRNVP  169

Query  782   VGAGRRKTKNSAAHYHLNAV--KSFQNACVDHPERIQHHALKANGKVLTLASD-----SV  940
             VGAGRRK KN  + Y    V   +  ++  D P  + H +L  N  +L   SD     S+
Sbjct  170   VGAGRRKNKNFTSQYRQITVPEAALLSSQPDLPNGVSHPSLNCNATLLAFGSDTPLCESM  229

Query  941   ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNG  1120
              S LN+AEK   N + NGF    EL I  +Y AG+   D S+ SS ++    + +   N 
Sbjct  230   TSVLNLAEKAVNNSTTNGFNGSEELEIPFAYVAGEKVNDDSNKSSDMSTKPMEGETT-NR  288

Query  1121  LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP-PPGCFSPGFPMPFYPPAMYLG  1297
               + + +N H F P  P F   PWP+P +   W+S VP PP  F  GF MP YP A Y G
Sbjct  289   SQEQVIENCHPFPPHAPYFPGAPWPFPWNPALWNSPVPSPPAFFPQGFTMPLYPAAAYWG  348

Query  1298  YTIPCSWNAPWVSRPVAPQHHTS-SGPN  1378
              TIP +W+ PW+++P  P    S SGP+
Sbjct  349   LTIPGAWSIPWLAQPSLPNSTVSNSGPD  376



>ref|XP_010441080.1| PREDICTED: cyclic dof factor 2-like [Camelina sativa]
Length=460

 Score =   250 bits (639),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 190/520 (37%), Positives = 256/520 (49%), Gaps = 100/520 (19%)
 Frame = +2

Query  251   DPTIKLFGMTIQFP-------DAppppppTEMDVDPGGAASEA-----------NSLAKD  376
             DP IKLFG TI  P       D+         D +P    S++                 
Sbjct  3     DPAIKLFGKTIPLPELGIVVVDSSCSSFTENHDQNPLVRLSDSCTGDDDDEDEMGDSGSG  62

Query  377   SSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDED  556
                      + ++ Q+ ++ E  +ES + E   +    G+ D+T     +  KA   +E+
Sbjct  63    EGGGGESESDKKEIQEGKDNECQEESLKHESNEVTATSGVNDKT-----ETTKAAKTNEE  117

Query  557   CGSTEISTTDEEEGKMSNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
                   S+ +E  G  +    ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFC
Sbjct  118   ------SSPNETGGGTTTACSQEAKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFC  171

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANG  910
             KKCQRYWT+GG  RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN 
Sbjct  172   KKCQRYWTAGGTMRNVPVGAGRRKNKSPASHYNRHVSITSAEALQKVARTDLQHPNGAN-  230

Query  911   KVLTLASDSV-----ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgss  1075
              +LT  SDSV     AS LN+AEK+    +     +P E G++++               
Sbjct  231   -LLTFGSDSVLCESMASGLNLAEKSMLK-TQTTLQEPNE-GLKITVPLN-----------  276

Query  1076  svtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCF  1249
                             P   +       P++PCF  PP  WPY  + V W+         
Sbjct  277   ----------------PPNEEAGTISPLPKVPCFPGPPPAWPYAWNGVSWTV--------  312

Query  1250  SPGFPMPFYPPAMYLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNN-  1417
                  +PFYPP  Y       P +WN+  W+ +P +P   + +   SPTLGKHSRD+N  
Sbjct  313   -----LPFYPPPAYWSCPGVSPGAWNSFTWMPQPNSPSGSSPN---SPTLGKHSRDENAD  364

Query  1418  ---KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKA  1588
                +E E    + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F A
Sbjct  365   EACEETESLGRERSKPERCLWVPKTLRVDDPEEAAKSSIWETLGIKKDE----NADTFGA  420

Query  1589  FKMKDDENSHASK----NCRVLLEANPAALSRSLNFHESS  1696
             F+    E S  S+      R+ L+ANPAALSRS NFHE+S
Sbjct  421   FRSSTKEKSSLSEGKLPGRRLELQANPAALSRSTNFHETS  460



>ref|XP_010550597.1| PREDICTED: cyclic dof factor 3 [Tarenaya hassleriana]
Length=454

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 198/507 (39%), Positives = 258/507 (51%), Gaps = 83/507 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +++P IKLFG  I FP                 AA+E           E   G+ E+++ 
Sbjct  4     SRNPAIKLFGKKIPFP-----------------AATEE---------KEKVAGDGEEEKS  37

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTE-ISTTDEEEGK  601
              E G   D+  E  G  L E      +   E  DG  +    +  G  E  S+ D+ E  
Sbjct  38    PEKGNTRDKPIEAAGQGLPESSEKKKKNNSE--DGHNSWQDSKSKGGDEDESSKDQSEST  95

Query  602   MSNGKD-KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
              S   D K LKKP KILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  96    NSQENDEKPLKKPSKILPCPRCNSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNV  155

Query  779   PVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHH-ALKANGKVLTLA--------  928
             PVGAGRRK KNS++HY H+   ++ Q A +D      HH  LK NG+VL+          
Sbjct  156   PVGAGRRKNKNSSSHYSHMTISEALQAARID---STHHHPGLKTNGRVLSFGLQPHHTPI  212

Query  929   SDSVASELNIA-EKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
              DS+AS LN+  +K A NG+ NGF+    LG Q      ++  D+S+GSS   + +   D
Sbjct  213   CDSMASVLNLGDQKKALNGTRNGFHG---LGDQRLVARTEHRDDYSNGSSVTVSNNHSTD  269

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPA  1285
               +         N +GFA    C  + PWPY  +         PP    P    P+    
Sbjct  270   EARASKCMRKSNNMNGFA----CIPSIPWPYTWNPSMPPPGFFPPPPGFPMPFYPY----  321

Query  1286  MYLGYTIPCSWNAPWVSRPVAPQHHTS-------SGPNSPTLGKHSRDDNN-KEGEPQPP  1441
                       W+ P +S    PQ   S       SG NSPTLGK SR++   K  EP+  
Sbjct  322   ----------WSIPMLS----PQSSPSSEKGSSLSGQNSPTLGKRSREEGTAKTEEPENA  367

Query  1442  KDSNPEK--CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF--KMKDDE  1609
              D    +   + +PKTLRFDDP DAAKSSIW TLGI++D V   RGG FK F  +M+   
Sbjct  368   TDMTKHRNGTVLIPKTLRFDDPNDAAKSSIWTTLGIKNDLVS--RGGMFKGFDHQMEKKT  425

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHE  1690
              ++ +     +L ANPAALSR ++FHE
Sbjct  426   KNNGTAETSPVLRANPAALSRLIDFHE  452



>gb|AGR67388.1| ascorbate oxidase, partial [Citrus reshni]
Length=224

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 152/224 (68%), Gaps = 7/224 (3%)
 Frame = +2

Query  638   DKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSA  817
             DKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK KNSA
Sbjct  1     DKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA  60

Query  818   AHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEKTAGN  979
             +HY H+   ++ QN   D P  + H ALK NG VLT  SD     S+AS LNIA+KT  N
Sbjct  61    SHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLTFGSDAPLCESMASVLNIADKTMRN  120

Query  980   GSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFA  1159
              + NGF+KP EL I+++Y  G    D+ +  S V  +++KD+  K    + + QN  GF 
Sbjct  121   CTRNGFHKPEELRIRLTY-RGGENGDNYAHGSPVPVSNSKDEAGKTTSQEAVVQNCQGFP  179

Query  1160  PQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMY  1291
             P + CF   PWPYP ++ QWS  V PP    PGFPMPFYPPA Y
Sbjct  180   PHVACFPGAPWPYPWNSAQWSPPVTPPAILPPGFPMPFYPPAAY  223



>ref|XP_010451812.1| PREDICTED: cyclic dof factor 2-like [Camelina sativa]
Length=453

 Score =   248 bits (632),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 188/518 (36%), Positives = 250/518 (48%), Gaps = 103/518 (20%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPD-------AppppppTEMDVDPGGAAS-----------EANSLAKD  376
             DP IKLFG TI  P+       +         D +P    S           E       
Sbjct  3     DPAIKLFGKTIPLPELGVVVVDSSCSSFTENQDQNPLVRLSDSCTGDDDDIDEMGDSGLG  62

Query  377   SSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDED  556
                      + ++ Q+ ++ +  DE  + E   +    G+ D+T     +  KA   +E+
Sbjct  63    EGGGGESESDKKEIQEEKDNDCQDELLKHESNEVTATSGVTDKT-----ETTKAAKTNEE  117

Query  557   CGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKK  736
                 E  +           ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKK
Sbjct  118   SSPNETCS-----------QEAKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKK  166

Query  737   CQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKV  916
             CQRYWT+GG  RN+PVGAGRRK K+ A+HY+ +   +   A          H   AN  +
Sbjct  167   CQRYWTAGGTMRNVPVGAGRRKNKSPASHYNRHVSITSAEAMQKAARTDLQHPNGAN--L  224

Query  917   LTLASDSV-----ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssv  1081
             LT  SDSV     AS LN+AEK+    +     +P E G++V+                 
Sbjct  225   LTFGSDSVLCESMASGLNLAEKSMLK-TQTTLQEPNE-GLKVTVPLN-------------  269

Query  1082  taasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP--WPYPSSAVQWSSAVPPPGCFSP  1255
                           P   +       P++PCF  PP  WPY  + V W+           
Sbjct  270   --------------PPNEEAGTVSPLPKVPCFPGPPPAWPYAWNGVSWTV----------  305

Query  1256  GFPMPFYPPAMYLGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNN---  1417
                +PFYPP  Y       P +WN+  W+ +P +P   + +   SPTLGKHSRD+N    
Sbjct  306   ---LPFYPPPAYWSCPGVSPGAWNSFTWMPQPNSPSGSSPN---SPTLGKHSRDENADEA  359

Query  1418  -KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFK  1594
              +E E    + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F AF+
Sbjct  360   CEETESLGREKSKPERCLWVPKTLRVDDPEEAAKSSIWETLGIKKDE----NADTFGAFR  415

Query  1595  MKDDENSHASK----NCRVLLEANPAALSRSLNFHESS  1696
                 E S  S+      R+ L+ANPAALSRS NFHE+S
Sbjct  416   SSTKEKSSLSEGKLPGRRLELQANPAALSRSTNFHETS  453



>ref|XP_003528583.1| PREDICTED: cyclic dof factor 2-like isoform X1 [Glycine max]
 gb|KHN28145.1| Dof zinc finger protein DOF5.2 [Glycine soja]
Length=479

 Score =   248 bits (632),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 194/503 (39%), Positives = 266/503 (53%), Gaps = 46/503 (9%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IKLFG TI           T ++ D   +++ A + +  SS  E      +QQ +
Sbjct  4     VKDPAIKLFGRTISL-------THTHIN-DSSSSSAPARAPSSSSSPREVTSSATQQQHE  55

Query  425   NENGER--MDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEG  598
              E   R  +  S++D+G+     +     T   I +  K P  + +  S   S+T+ E+ 
Sbjct  56    PEEPSRKELTSSQDDDGSHQTTEDLKSPTTSSGIFENPKTPSPETET-SVPKSSTNGEQS  114

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             + S   +KT KKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  115   ETSASDEKTPKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNV  174

Query  779   PVGAGRRKTKN---SAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS---  937
             PVGAGRRK KN   +A+HY HL   +  Q A ++ P  + +  L     VLT   DS   
Sbjct  175   PVGAGRRKNKNFPATASHYRHLMFPEGLQGATLNAPNGLHNAVLGNGAAVLTFGPDSPLC  234

Query  938   --VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVC  1111
               +AS LNIAE+ A +   NGF +  E    VSY   ++G+     +    A ++     
Sbjct  235   DTMASMLNIAER-AQSCVPNGF-QATEPNSFVSYRKEEDGSTSGHSTGVSVATTSTSSHS  292

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMY  1291
              +   + + +   GF PQLP F       PS    +      P    PG+P+ FY    Y
Sbjct  293   GSH--ESVDKRVEGFTPQLPYF-------PSGPWPYPMPP--PTFCPPGYPLSFYTTPAY  341

Query  1292  LGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNP  1456
              G  +P SWN    S  ++PQ   ++  +  TLGKHSRD N     N + E    +  + 
Sbjct  342   WG-CMPPSWNNNISS--ISPQSSVNNSVSVLTLGKHSRDGNIIAPSNSQREMHDMEHKSS  398

Query  1457  EKCLWVPKTLRFDDPEDAAKSSI--WATLGIQHDRVDSIRGGAFKAF-KMKDDENSHASK  1627
             E  + +PKTLR DDP +AAKSSI  W+ LGI+ D+  S  GG FKAF   K ++ +H   
Sbjct  399   EHNVLIPKTLRIDDPSEAAKSSISMWSKLGIKDDKAGS--GGLFKAFPSSKGNDMNHHMV  456

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                 LL+ANPAALSRSL F E +
Sbjct  457   EASPLLQANPAALSRSLTFREQT  479



>ref|XP_007046067.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY01899.1| F-box family protein, putative [Theobroma cacao]
Length=499

 Score =   247 bits (631),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 190/507 (37%), Positives = 251/507 (50%), Gaps = 45/507 (9%)
 Frame = +2

Query  260   IKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGE  439
             IKLFG TI            + ++   GA  E        S S    G +          
Sbjct  10    IKLFGKTIPLSTLNQDEALADQEIPFRGATREDRGDGNLVSSSSPLGGVNSNDGVQAQVI  69

Query  440   RMD-ESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPH---------VDEDCGSTEISTTDE  589
             R D ES E E    +  +   D T D+IRD LK P          + E   S+  S+ +E
Sbjct  70    REDQESTEKE----LPKDKQKDSTSDQIRDDLKDPTALSGNDRSPLAERNTSSLKSSKNE  125

Query  590   EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMT  769
                + ++ ++KTLKKPDKILPCPRC+S +TKFCY+NNYN NQPRHFCK CQRYWT+GG  
Sbjct  126   GTSETTSSQEKTLKKPDKILPCPRCNSKETKFCYYNNYNVNQPRHFCKNCQRYWTAGGTM  185

Query  770   RNLPVGAGRRKTKNSAA-HYHLNAVKSFQNACVDHPERIQHH---ALKANGKVLTLASDS  937
             RN+PVGAGRRKTK+S+A HYH   +     A         +        NG VLT  SDS
Sbjct  186   RNVPVGAGRRKTKSSSALHYHQIMISEAIRAAKASAANGMYRNPSCENNNGHVLTFGSDS  245

Query  938   ---VASELNIAEKTAGNGSLNGFYKPVE-LGIQVSYgagdngadhssgsssvtaasTKDD  1105
                VAS  N++ KT  N   NGF K  +   ++ ++          S      A+  + +
Sbjct  246   SVPVASVFNLSGKTQINVQ-NGFRKTEQRYLVEDNHSGESLITASYSLEKEGNASLNQAE  304

Query  1106  VCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFY-PP  1282
             V          +N H F    PCF  P WPY   ++  +   PPP    P FP+  +  P
Sbjct  305   V----------KNRHWFTSTAPCFSRPSWPYSWDSIP-AMLPPPPALCPPSFPVSVHRAP  353

Query  1283  AMYLGYTIPCSWNAPWVSRP---VAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQP  1438
               Y G ++P  W+ P V+ P      Q   SS P SPTLGKHSRD+N     N E E   
Sbjct  354   LTYSGCSVPSPWDVP-VASPSPSSVNQCAPSSSPTSPTLGKHSRDENFLSPANLEKEKPS  412

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR-GGAFKAFKMKDDENS  1615
              +    E    + KTL+ DDP + AKSS+ AT+ I+  + +SI  GG F  F+ K  +  
Sbjct  413   GEGDKSEGRALISKTLKIDDPGETAKSSMLATIVIKGKKTNSINPGGLFDGFQSKSRDEK  472

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
             +       +L ANPAALSRSL FHE++
Sbjct  473   NYRLETFSVLRANPAALSRSLKFHENT  499



>ref|XP_010266732.1| PREDICTED: cyclic dof factor 3-like [Nelumbo nucifera]
 ref|XP_010266733.1| PREDICTED: cyclic dof factor 3-like [Nelumbo nucifera]
 ref|XP_010266734.1| PREDICTED: cyclic dof factor 3-like [Nelumbo nucifera]
Length=509

 Score =   248 bits (632),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 203/560 (36%), Positives = 261/560 (47%), Gaps = 132/560 (24%)
 Frame = +2

Query  248   KDPTIKLFGMTI-----QFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             KDP IKLFG  I     Q P         E  V     A E     K+++  E E     
Sbjct  5     KDPAIKLFGKRIPLMESQIPAESCDKSDPECLVA--PEAEEEAGECKETTKVEDEELSPR  62

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
             +  K +    ++ SKED+            QT  E       P  +ED   +++ +    
Sbjct  63    ESCKPDKSYNLNNSKEDD-----------HQTSSEGNKATTVPKPEEDHAESDVPS----  107

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
                    +DK LKKPDK+LPCPRC+S+DTKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  108   -------QDKVLKKPDKVLPCPRCNSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMR  160

Query  773   NLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHA------------LKANG  910
             N+PVGAGRRK K+SA+ Y   + +        VD+P+   H              LK NG
Sbjct  161   NVPVGAGRRKNKHSASQYRQAMMSADGIPTTRVDNPDSPTHQVLACGGLSTSSKPLKGNG  220

Query  911   KVLTLASD-----SVASELNIAE--KTAGNGSL----NGFYKPVELGIQVSYgagdngad  1057
              VL    D     S+A+ LN+ +  + A  GS     NG   P    +  S         
Sbjct  221   TVLKFGLDAPVCESMATVLNLVDQKRKADIGSAACEENGVEPPSVSSMAAS---------  271

Query  1058  hssgsssvtaasTKDDVCKNGLPDMLKQN----YHGF-APQ-LPCFQAPPWPYP------  1201
                          +++     +P M + N     +GF +P  LP +  PPW  P      
Sbjct  272   ------------CQENELPENVPKMEQTNILGSVNGFTSPHPLPYYPVPPWTCPWNPSWN  319

Query  1202  ----------------------SSAVQWSS--AVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
                                    + VQW S   V  P   +P  P PF  PA Y G  +P
Sbjct  320   NIAVMAVNRCSSEVFYGPDSSIPNPVQWGSPPMVAAPAFCTPRIPFPFV-PASYWG-CVP  377

Query  1310  C----SWNAPWV------SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
                   WN PW+      S   +  +   SG  SPTLGKH RD N       P  +   E
Sbjct  378   SWAARPWNVPWLGSNGSLSPSSSTSNSGCSGNGSPTLGKHCRDAN-------PQVEEKSE  430

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCR  1636
             K LWVPKTLR DDP++AAKSSIWATLGI+ D+ +SI +GG FKAF+ K + N H S   +
Sbjct  431   KSLWVPKTLRIDDPDEAAKSSIWATLGIKTDQNESIAKGGMFKAFQPKTESNIHDSDATQ  490

Query  1637  VLLEANPAALSRSLNFHESS  1696
             V L+ANPAALSRS  F ES+
Sbjct  491   V-LQANPAALSRSQTFQEST  509



>gb|ACJ13916.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 186/340 (55%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDVII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C +PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-TPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                    SW+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGSWSMQWVPHPSS--YHPAPPVTYAASPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>ref|XP_006354775.1| PREDICTED: cyclic dof factor 3-like [Solanum tuberosum]
Length=492

 Score =   246 bits (627),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 179/473 (38%), Positives = 249/473 (53%), Gaps = 37/473 (8%)
 Frame = +2

Query  326   DVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQ  505
             D+D     S+A+S+ KD    E    E ++ +K++    + E+K +EG      E   + 
Sbjct  41    DLDRCLEGSKASSVEKD----EGIEYEKQEAEKDDISGELSEAKSEEGDQNQMMEESENT  96

Query  506   TVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKF  685
                   +       +ED  + + S T  E   +SN +   LKKPDKILPCPRC+S DTKF
Sbjct  97    KTPSESESSPKSSTEEDPQAVKSSETGNEPTNVSNSEQNNLKKPDKILPCPRCNSSDTKF  156

Query  686   CYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNAC  862
             CY+NN N NQPRHFC+ CQRYWT+GG  RNLPVGAGRRK KN A+ Y H++  +    A 
Sbjct  157   CYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNLASQYRHISIPEGLLAAG  216

Query  863   VDHPERIQHHAL-KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQ  1024
             ++ P  + HH + K NG +L+   D      +AS LN AEK   NG  NG +K       
Sbjct  217   IESPNGLIHHPIFKPNGTILSFGPDIPLCEPMASALNQAEKRVSNGIQNGSHK------S  270

Query  1025  VSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFA---PQLPCFQAPPWP  1195
                 +   G D        +   T + + + G  +  K   HG       +PC    PWP
Sbjct  271   EVNNSSCKGGDTGDECYRGSNIPTPNMMVEEGKGEAHKAVMHGINGIPSPVPCLHGVPWP  330

Query  1196  YPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSG-  1372
             +P     W++AV P     P      + P  Y   ++P  W+ PW+S P+   +  +SG 
Sbjct  331   FP-----WNAAV-PMSAICPIPFPMPFFPTPYWNCSVP-PWSNPWLSPPLRAANEKTSGS  383

Query  1373  -PNSPTLGKHSRD-DNNKEGEPQPPKDSN---PEKCLWVPKTLRFDDPEDAAKSSIWATL  1537
              P SP LGKHSR+ D  K   P   + S+    E  + VPKTLR DDP++AAKSSIW+TL
Sbjct  384   DPTSP-LGKHSREGDLLKPSNPGGKEQSDQKYSEGSILVPKTLRIDDPDEAAKSSIWSTL  442

Query  1538  GIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             GI++D  +  RG  FKA + K ++  H   N   +L  NPAALSRS+ F +S+
Sbjct  443   GIKYDSAN--RGEFFKALQPKSND-KHNKANTSPVLHTNPAALSRSITFQQSA  492



>gb|ACJ13941.1| cycling DOF factor 2 [Helianthus petiolaris]
Length=339

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 184/338 (54%), Gaps = 69/338 (20%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVS-----RPVAPQHHTS--SGPNSPTLGKHSRDDNNKEGEPQPPKDS  1450
                     W+  WV       PV P  + +  S P SPTLGKHSR +N   GE +  K++
Sbjct  244   GPGLSPGPWSMQWVPHPSSYHPVPPVTYAASPSSPISPTLGKHSRAEN---GEDEIIKEN  300

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
               EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  301   ESEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>ref|XP_006283563.1| hypothetical protein CARUB_v10004614mg, partial [Capsella rubella]
 gb|EOA16461.1| hypothetical protein CARUB_v10004614mg, partial [Capsella rubella]
Length=509

 Score =   246 bits (627),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 187/505 (37%), Positives = 250/505 (50%), Gaps = 80/505 (16%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDVDPGGAA-----SEANSLAKDSSCSEAEPGEDEQ  415
             DP IKLFG TI  P+       +       G        + N L    SC+ A+  +D++
Sbjct  62    DPAIKLFGKTIPLPELGGVVVDSSCSSSFTGVLLTTEDQDQNPLRLSDSCTGADEDDDDE  121

Query  416   QQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIS--TTDE  589
                       D+ +E +       EG + Q   E  D      + +   +T+ +  T +E
Sbjct  122   DMGGGGESESDKKEEKDNEC---KEGSLKQ---ESNDVTTTSGITDKTETTKAAKKTNEE  175

Query  590   EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMT  769
               G  +  ++  LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCKKCQRYWT+GG  
Sbjct  176   SSGGTACSQEAKLKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTM  235

Query  770   RNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV---  940
             RN+PVGAGRRK K+ A+HY+ +   +              H   AN  +LT  SDSV   
Sbjct  236   RNVPVGAGRRKNKSPASHYNRHVSITSGEGMQKAVRSDLQHPNGAN--LLTFGSDSVLCE  293

Query  941   --ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
               AS LN+AEK+    +     +P E G++++     +  +  +  S             
Sbjct  294   SMASGLNLAEKSMLK-TQTVLQEPNE-GLKITVPLNPSNEEAGTVISP------------  339

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMY  1291
                            P++PCF  PP WPY  + V W+              +PFYPP  Y
Sbjct  340   --------------LPKVPCFPGPPTWPYAWNGVSWTV-------------LPFYPPPAY  372

Query  1292  LGY--TIPCSWNA-PWVSRPVAPQHHTSSGPNSPTLGKHSRDDNN-------KEGEPQPP  1441
                    P +WN   W+ +P +P     +   SPTLGKHSRD++        +E E    
Sbjct  373   WSCPGVSPGAWNNFTWMPQPNSPSSSGPN---SPTLGKHSRDESAAEPGTAFEETESLGR  429

Query  1442  KDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHA  1621
             + S PE+CLWVPKTLR DDPE+AAKSSIW TLGI+ D         F AF+    E S  
Sbjct  430   EKSKPERCLWVPKTLRVDDPEEAAKSSIWETLGIKKDE----NADTFGAFRSSTKEKSSL  485

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
                 R  L+ANPAALSRS NFHE+S
Sbjct  486   PGR-RPELQANPAALSRSTNFHETS  509



>gb|ACJ13919.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   239 bits (610),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEITK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13923.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13913.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13915.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13917.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13918.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13921.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   238 bits (608),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13926.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   238 bits (608),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13910.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   238 bits (608),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|KDP41212.1| hypothetical protein JCGZ_15619 [Jatropha curcas]
Length=465

 Score =   243 bits (619),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 176/494 (36%), Positives = 255/494 (52%), Gaps = 49/494 (10%)
 Frame = +2

Query  260   IKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGE  439
             IKLFG TI  P         ++      ++ E    +  +S  E +  +++QQ +  N E
Sbjct  6     IKLFGKTIPLP----LYHHKDLSSSSSSSSDEDCPDSDSTSSLENKTAKEQQQHQELNKE  61

Query  440   R-MDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGK  616
             R   E+  D+       +    +T     +  K      +      +  + E+ + S+ +
Sbjct  62    RSAKETTNDKQENSTADDSKQKETTTSSDNNEKPKTSTAETEKESSNNKNGEQSETSDSQ  121

Query  617   DKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGR  796
             +K LKKPDKILPCPRC+SMDTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PVGAGR
Sbjct  122   EKPLKKPDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGR  181

Query  797   RKTKNSAA--HYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS-------DSVASE  949
             RK KN++A  + H+   ++F+ A V +           N  VL   S       +SVAS 
Sbjct  182   RKNKNTSASNYRHIMVSEAFKLAQVGNS--------TTNSTVLNFGSSADSTLYESVASV  233

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LN++++T+ N  L   YKP     ++      +     S  +  T +      C      
Sbjct  234   LNLSDQTSNN--LRNGYKPNRTEHRIHGSENGDDRLSGSSITVSTPSEKVISNCN-----  286

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIP  1309
              +++     + Q+ CF  P WP P     W+S    P C S GFP+ FYP   Y G ++P
Sbjct  287   -MQETVPYASGQVACFPGPQWPCP-----WNST---PYCHS-GFPVSFYPAPPYWGCSVP  336

Query  1310  CSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN---NKEGEPQPPKDSN-PEKCLWVP  1477
               WN   ++    P    SS P S  LGKHSR+ N   N        ++S+  E+   VP
Sbjct  337   NPWNLASLNPCATP----SSNPGS-ALGKHSREGNIILNSNNVEDGSRESDCSERNALVP  391

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD-DENSHASKNCRVLLEAN  1654
             KTLR D   +AA+SSIW TLGI+ ++ +   GG F+ F+ K+ +E ++ + +   +L+AN
Sbjct  392   KTLRIDHLNEAAESSIWTTLGIKSEKSNFNGGGLFQGFQSKNIEERNYINADKSSVLQAN  451

Query  1655  PAALSRSLNFHESS  1696
             PAALSRSL F ES+
Sbjct  452   PAALSRSLKFQEST  465



>gb|ACJ13927.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   238 bits (608),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 183/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P    +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPST--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>ref|XP_010938141.1| PREDICTED: cyclic dof factor 3-like [Elaeis guineensis]
Length=518

 Score =   244 bits (622),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 199/567 (35%), Positives = 266/567 (47%), Gaps = 128/567 (23%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSE---AEPG  403
             M EP +DP IKLFG TI   +           + P   A+ A        C       P 
Sbjct  1     MSEP-RDPAIKLFGKTIPLLER----------LPPPATAAAAVEAEDKEECPNDPAPAPE  49

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCG---STEI  574
               E  +K+   E+ D    D    +++    ++Q  D    GL     DE+      TE+
Sbjct  50    LPEDGEKDTCKEKTDMENNDP---MLDAPEELNQD-DPNSSGLNIGSEDENKAHNQDTEV  105

Query  575   STTDEEEGKM----SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
             ST  + E       S+G++K LKKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQ
Sbjct  106   STDSKAEHDKTEADSSGQEKVLKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQ  165

Query  743   RYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHAL------  898
             RYWT+GG  RN+PVGAGRRK K+SA+HY   + +     +  +D  + I H AL      
Sbjct  166   RYWTAGGTMRNVPVGAGRRKNKHSASHYRHIMMSSDGLASGRIDASDLIPHQALPCGPSV  225

Query  899   -----KANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdn  1048
                  K NG VL         +S+AS LN+ E+           K  +LG          
Sbjct  226   PMRSVKGNGTVLKFGPEVPLCESMASVLNLGEQK----------KNSDLG--------SI  267

Query  1049  gadhssgsssvtaasTKDDVCKNGLPD----MLKQNYHGFA------PQLPCFQAPPWPY  1198
                 +    S   + T  +  +NG P+    M +    G+       P L C+   PW Y
Sbjct  268   ACGENREEPSCAPSVTASNCVENGFPENAPHMEQNGMQGYCNGLTPMPHLQCYPGAPWAY  327

Query  1199  P----------------------------SSAVQWSSAVPPP-----GCFSPGFPMPFYP  1279
             P                             S + WS   PPP        +P  P PF P
Sbjct  328   PWGPGWNNIAAMAAGRCSSELVYGPENGSPSLIPWS---PPPMMTALAFCAPTIPFPFMP  384

Query  1280  PAMY--LGYTIPCSWNAPWVSRPVAPQHHTSS------GPNSPTLGKHSRDDNNKEGEPQ  1435
             P+ +  +      +WNAPW+    +    +S+      G +SPTLGKHSRD + +  E  
Sbjct  385   PSFWGCMSSWPNGAWNAPWIGSNGSISPSSSTRSNGCLGNSSPTLGKHSRDASLQGEEKM  444

Query  1436  PPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENS  1615
                    EK LWVPKTLR DDP++AAKSSIWATLGI+ +      GG FK F+ K +   
Sbjct  445   -------EKSLWVPKTLRIDDPDEAAKSSIWATLGIKPE-----EGGIFKPFQSKAESKR  492

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
               S + +V L ANPAALSRS +F E++
Sbjct  493   QTSDDTQV-LHANPAALSRSQSFQENT  518



>emb|CDY47405.1| BnaCnng15140D [Brassica napus]
Length=429

 Score =   240 bits (612),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 180/496 (36%), Positives = 249/496 (50%), Gaps = 87/496 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVD-PGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             ++DP IKLFGM I FP    P     ++ D  GG       +  + +  E +   + +  
Sbjct  5     SRDPAIKLFGMKIPFPAVFEPTTAVTLEEDYSGGDDKSPEKVTTEQATPEKKNNCNNKSL  64

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              N N  + +   ++E T           + D+I                      +E  +
Sbjct  65    NNSNDSKPETGDKEEAT-----------STDQIES--------------------DETNQ  93

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  94    QTTADGKTLKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  153

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNI  958
             VGAGRRK K+S++HY H+   ++ Q A +D         L++N +VL+    +   + ++
Sbjct  154   VGAGRRKHKSSSSHYRHITISEALQAARLD-------PGLQSNTRVLSFGLQAPPHQQHV  206

Query  959   A----------EKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDV  1108
             A          ++   NG+ NG    VE G   S          S  S + +   T+   
Sbjct  207   APMTPVMKLQGDQKVSNGARNGLAARVENGDDCS----------SGSSVTTSVDETRAQS  256

Query  1109  CKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP-PPGCFSPGFPMPFYPPA  1285
             C+   P  +  N +G+A    C    PWPY      W+ A+P P     PG+PMPFYP  
Sbjct  257   CRVVEP-QVNNNMNGYA----CIPGVPWPY-----TWNPAMPQPGFYPPPGYPMPFYP--  304

Query  1286  MYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKC  1465
                 +TIP    AP  ++  +P     S  NSPTLGKHSRD+++     Q         C
Sbjct  305   ---YWTIPM---AP-PNQSSSPMSQKGSSSNSPTLGKHSRDEDSSTERKQ------RNGC  351

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQHD-RVDSIRGGAFKAFKMKDDENSHASKNCRVL  1642
             + VPKTLR DDP +AAKSSIW TLGI+++      +GG FK F  K ++++    +   +
Sbjct  352   VIVPKTLRIDDPNEAAKSSIWTTLGIKNEGSTLGSKGGMFKGFDQKTNKSNKDQTDNSPV  411

Query  1643  LEANPAALSRSLNFHE  1690
               ANPAALSRSLNF E
Sbjct  412   RSANPAALSRSLNFQE  427



>gb|KFK34049.1| h-protein promoter binding factor-2a [Arabis alpina]
Length=434

 Score =   239 bits (610),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 192/501 (38%), Positives = 258/501 (51%), Gaps = 92/501 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP +KLFGM I FP     P   E D +   +  +      D S  +  P   E   K
Sbjct  5     SRDPAVKLFGMKIPFPTVFNSPVTVEDDEEDDWSGGD------DKSPHKVTP---ELSDK  55

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             N N    +ESK + G    + E  +  T D+I                    + E   + 
Sbjct  56    NNNNNNSNESKPESG----DKEETITLTDDQIE-------------------SSESPEQT  92

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             ++GK   LKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  93    ADGK-LILKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPV  151

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIA  961
             GAGRRK K S++HY H+   ++ + A +D         L+AN +VL+   ++       A
Sbjct  152   GAGRRKNKTSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGMEAHQQHAAPA  204

Query  962   --------EKTAGNGSLNGFYKPVE--LGIQVSYgagdngadhssgsssvtaasTKDDVC  1111
                     ++   NG+ NGF+  V+  L  +V  G   +     + S++ +   ++  + 
Sbjct  205   TPVMKLPGDQKVSNGARNGFHGLVDQRLVARVENGDDCSSGSSVTTSNNHSVDESRAQIV  264

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFPMPFYPPAM  1288
             +   P M   N +G+A    C    PWPY      W+SA+ PP     PG+PMPFYP   
Sbjct  265   E---PQM--NNMNGYA----CIPGVPWPY-----TWNSAMPPPGFYPPPGYPMPFYP---  307

Query  1289  YLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK  1462
                      W  P VS  +  +P    SS PNSPTLGKHSRD+ +        KD+  E+
Sbjct  308   --------YWTIPMVSPHQSSSPMSQKSSSPNSPTLGKHSRDEESAR------KDNETER  353

Query  1463  -----CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASK  1627
                  C+ VPKTLR DDP +AAKSSIW TLGI H+ +   +GG FK F  K  ++++   
Sbjct  354   KQRNGCVLVPKTLRIDDPSEAAKSSIWTTLGINHEGIS--KGGMFKGFDQKTKKSNNDKV  411

Query  1628  NCRVLLEANPAALSRSLNFHE  1690
                  L ANPAALSRSLNFHE
Sbjct  412   EESPALSANPAALSRSLNFHE  432



>gb|ACJ13911.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   236 bits (602),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 185/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAP  1327
              G A   P F + PWPYP     W   + P  C +PGFPMPFYP A Y G  IP    + 
Sbjct  190   TGPAFCPPGFPSAPWPYP-----WPPQMGPAFC-TPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1328  ------------WVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                         WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSSGSWSMQWVPHPSS--YHPAPPVTYAASPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>ref|XP_004241585.1| PREDICTED: cyclic dof factor 1 [Solanum lycopersicum]
Length=492

 Score =   241 bits (614),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 175/485 (36%), Positives = 255/485 (53%), Gaps = 61/485 (13%)
 Frame = +2

Query  326   DVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQ  505
             D+D     S+A+S+ KD   SE E  + E ++ N  GE + E+K +EG      E   + 
Sbjct  41    DLDRCLEGSKASSVEKDEG-SEYE--KQEAEKDNITGE-LSEAKSEEGDQNQMIEESENP  96

Query  506   TVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKF  685
                   +       +ED  + + S T+ E   ++N +   LKKPDKILPCPRC+S+DTKF
Sbjct  97    KTPSESESSPKSSTEEDPQAVKSSKTENEPTNVTNSEQNNLKKPDKILPCPRCNSLDTKF  156

Query  686   CYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNAC  862
             CY+NN N NQPRHFC+ CQRYWT+GG  RNLPVGAGRRK KN A+ Y +++  +    A 
Sbjct  157   CYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNLASQYRNISIPEGLLAAG  216

Query  863   VDHPERIQHHAL-KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQ  1024
             ++ P  + HH L K NG +L+   D      +AS LN AEK    G  NG +K       
Sbjct  217   IESPNGLIHHPLFKPNGTILSFGPDLPLCEPMASALNQAEKRVSTGIQNGSHK-------  269

Query  1025  VSYgagdngadhssgsssvtaasTKDDVCKNGL----PDMLKQ------------NYHGF  1156
                            +SS     + D+ C+ G+    P+M+ +            + +G 
Sbjct  270   -----------SEVKNSSCKGGDSGDECCR-GINIPTPNMMVEEGKGEPHKAVMHSINGI  317

Query  1157  APQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS  1336
                +PC    PWP+P     W++AV P     P      + P  Y   ++P  W+ PW+S
Sbjct  318   PSPVPCLHGVPWPFP-----WNAAV-PVSAICPIPFPMPFFPTPYWNCSVP-PWSNPWLS  370

Query  1337  RPVAPQHHTSSGPN-SPTLGKHSRDDN----NKEGEPQPPKDSNPEKCLWVPKTLRFDDP  1501
              P+   +  +SG + + +LGKHSR+ +    +  G  +  +    E  + VPKTLR DDP
Sbjct  371   PPLRAANEKTSGSDPTSSLGKHSREGDLLKPSNPGGKEQSEQKYSEGSILVPKTLRIDDP  430

Query  1502  EDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLN  1681
             ++AAKSSIW+TLGI++D  +  RG  FKA + K ++  H   N   +L  NPAALSRS+ 
Sbjct  431   DEAAKSSIWSTLGIKYDSTN--RGEFFKALQPKSND-KHNKANTFPVLHTNPAALSRSIT  487

Query  1682  FHESS  1696
             F + +
Sbjct  488   FQQGA  492



>tpg|DAA34018.1| TPA_inf: Dof-type zinc finger protein 15 [Sorghum bicolor]
Length=530

 Score =   242 bits (617),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 173/412 (42%), Positives = 220/412 (53%), Gaps = 64/412 (16%)
 Frame = +2

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ED  +++    +E+     +G+DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  153   EDKAASDPKGENEKTSNEESGQDKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  212

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHALKA  904
             K CQRYWT+GG  RN+PVGAGRRK+KNS+ HY   L A      + VD  + +   AL +
Sbjct  213   KNCQRYWTAGGTMRNVPVGAGRRKSKNSSLHYRQLLMAPDCMLGSRVDISKSVLPEALVS  272

Query  905   ----------NGKVLTLAS-----DSVASELNIAEKTAGN--GSLNGFYKPVELGIQVSY  1033
                       N  VL         +S+ S LNI E+   N   +  G  +    G   SY
Sbjct  273   PPAPIQPTSRNETVLKFGPEVPLCESMVSALNIDEQNVNNSGSAPRGENREDNPGPGTSY  332

Query  1034  gagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAV  1213
                     H               V KNG P     + +G AP    +   P+ YP + V
Sbjct  333   NGVPENMVH---------------VDKNGAP----VHCNGVAPVPQYYLGTPFMYPWN-V  372

Query  1214  QWSS--AVPPPGCF-SPGFPMPFYPPAMY---LGYTIPCSWNAPWVS-----RPVAPQHH  1360
              W++   + P   F SP FP P  PPA++    G+ +  +WN PW+       P +  + 
Sbjct  373   GWNNVPVMAPASRFPSPAFPYPLVPPALWGCLSGWPV-TTWNIPWIRANGCVSPSSSSNS  431

Query  1361  TSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLG  1540
             + SG  SPTLGKHSRD N       P K+   EK LWVPKTLR DDP++AAKSSIWATLG
Sbjct  432   SCSGNGSPTLGKHSRDSN-------PMKEEKREKSLWVPKTLRIDDPDEAAKSSIWATLG  484

Query  1541  IQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             I+         G FK F+ K +     S   +V L+ANPAALSRS  F ESS
Sbjct  485   IKPG-----DPGTFKPFQSKVESKGQRSDAAQV-LQANPAALSRSQTFQESS  530



>gb|ACJ13922.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   235 bits (600),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 182/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIII--------------------PGPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP       +  P      PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYPWPPQMGHAFCP------PGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAASPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEAEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>ref|XP_006291025.1| hypothetical protein CARUB_v10017140mg, partial [Capsella rubella]
 gb|EOA23923.1| hypothetical protein CARUB_v10017140mg, partial [Capsella rubella]
Length=476

 Score =   239 bits (610),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 196/503 (39%), Positives = 261/503 (52%), Gaps = 70/503 (14%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP IKLFGM I FP A    PP  +D +       +     D   SE      E   K
Sbjct  21    SRDPAIKLFGMKIPFP-AVFESPPVTVDEEEEEEDDWSGGDGGDDKSSEDNKVTPELPDK  79

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
             N N   ++ S E +      G+   + T  +  +   +P    D GS + +T D      
Sbjct  80    NCNDNSLNNSNESKPET---GDKEEETTSTDQIESSDSP----DDGSNQQTTAD------  126

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
                  K LKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  127   ----GKVLKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPV  182

Query  785   GAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS--------  937
             GAGRRK K+S++HY H+   ++ + A +D         L+AN +VL+   D+        
Sbjct  183   GAGRRKNKSSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGLDAHQQHAAAP  235

Query  938   VASELNI-AEKTAGNGSLNGFYKPVE--LGIQVSYgagdngadhssgsssvtaasTKDDV  1108
             +A  +N+   +   NG+ N F+   +  L  +V  G   +     + S++ +   ++   
Sbjct  236   MAPVMNLQGNQKVSNGAQNVFHGVADQRLVARVENGDDCSSGSSVTTSNNHSVDESRPQS  295

Query  1109  CKNGLPD-MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWS-SAVPPPGCFSPGFPMPFYPP  1282
             C+ G P      N +G+A    C    PWPY      W+ S  PP     PGFPMPFYP 
Sbjct  296   CRVGEPQMNNNNNMNGYA----CIPGVPWPY-----TWNPSMPPPGFYPPPGFPMPFYP-  345

Query  1283  AMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDDNN--KEGEPQPPKDS  1450
                        W  P VS  +  +P    +S PNSPTLGKH RD+ +  K+ E +  K  
Sbjct  346   ----------YWTIPMVSPHQSSSPMSQKASNPNSPTLGKHPRDEESARKDNETEQRKQR  395

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF---KMKDDENSHA  1621
             N    + VPKTLR DDP +AAKSSIW TLGI++D + S  GG FK F   K K + N+  
Sbjct  396   N---GVLVPKTLRIDDPNEAAKSSIWTTLGIKNDGMMSKGGGMFKGFDDQKTKMNNNNDK  452

Query  1622  SKNCRVLLEANPAALSRSLNFHE  1690
             ++N   L  ANPAALSRS NFHE
Sbjct  453   TENS-PLRSANPAALSRSHNFHE  474



>gb|ADD25169.1| putative dof zinc finger protein [Brassica napus]
Length=427

 Score =   235 bits (600),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 184/496 (37%), Positives = 249/496 (50%), Gaps = 89/496 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVD-PGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             ++DP IKLFGM I FP    P     ++ D  GG  +    +  + +  E +   + +  
Sbjct  5     SRDPAIKLFGMKIPFPAVFEPTTAVALEEDHSGGDDTSPEKVTTEQATPEKKNNCNNKSL  64

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              N N  + +   ++E T           + D+I                      +E  +
Sbjct  65    NNSNDSKPETGDKEEAT-----------STDQIES--------------------DETNQ  93

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  94    QTTADGKTLKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  153

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS----VAS  946
             VGAGRRK K+S++ Y H+   ++ Q A +D         L+AN +VL+    +     A+
Sbjct  154   VGAGRRKHKSSSSQYRHITVSEALQAARLD-------PGLQANTRVLSFGLQAPHQQHAA  206

Query  947   ELNIAEKTAG-----NGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVC  1111
              +    K  G     NG+ N     VE G   S          S  S + +   T+   C
Sbjct  207   PMTPVMKLQGDQKVSNGARNAR---VENGDDCS----------SGSSVTTSVDETRAQSC  253

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFPMPFYPPAM  1288
             +   P +   N +G+A    C    PWPY      W+ A+ PP     PG+PMPFYP   
Sbjct  254   RVVEPQVNNNNMNGYA----CIPGVPWPY-----TWNPAMPPPGFYPPPGYPMPFYP---  301

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCL  1468
                +TIP    AP  ++  +P     S PNSPTLGKH RD+++     Q         C+
Sbjct  302   --YWTIPM---AP-PNQSSSPMSQKGSSPNSPTLGKHYRDEDSSTERKQ------RNGCV  349

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHD--RVDSIRGGAFKAFKMKDDENSHASKNCRVL  1642
              VPKTLR DDP +AAKSSIW TLGI+++   + S  GG FK F  K ++++    N   +
Sbjct  350   IVPKTLRIDDPNEAAKSSIWTTLGIKNEGSTLGSKGGGMFKGFDQKTNKSNKDQTNNSHV  409

Query  1643  LEANPAALSRSLNFHE  1690
             L ANPAALSRSLNF E
Sbjct  410   LSANPAALSRSLNFQE  425



>ref|XP_009149907.1| PREDICTED: cyclic dof factor 3 [Brassica rapa]
 emb|CDY66672.1| BnaAnng22720D [Brassica napus]
Length=427

 Score =   235 bits (599),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 184/496 (37%), Positives = 249/496 (50%), Gaps = 89/496 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVD-PGGAASEANSLAKDSSCSEAEPGEDEQQQ  421
             ++DP IKLFGM I FP    P     ++ D  GG  +    +  + +  E +   + +  
Sbjct  5     SRDPAIKLFGMKIPFPAVFEPTTAVALEEDYSGGDDTSPEKVTTEQATPEKKNNCNNKSL  64

Query  422   KNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
              N N  + +   ++E T           + D+I                      +E  +
Sbjct  65    NNSNDSKPETGDKEEAT-----------STDQIES--------------------DETNQ  93

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  94    QTTADGKTLKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  153

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS----VAS  946
             VGAGRRK K+S++ Y H+   ++ Q A +D         L+AN +VL+    +     A+
Sbjct  154   VGAGRRKHKSSSSQYRHITISEALQAARLD-------PGLQANTRVLSFGLQAPHQQHAA  206

Query  947   ELNIAEKTAG-----NGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVC  1111
              +    K  G     NG+ N     VE G   S          S  S + +   T+   C
Sbjct  207   PMTPVMKLQGDQKVSNGARNAR---VENGDDCS----------SGSSVTTSVDETRAQSC  253

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFPMPFYPPAM  1288
             +   P +   N +G+A    C    PWPY      W+ A+ PP     PG+PMPFYP   
Sbjct  254   RVVEPQVNNNNMNGYA----CIPGVPWPY-----TWNPAMPPPGFYPPPGYPMPFYP---  301

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCL  1468
                +TIP    AP  ++  +P     S PNSPTLGKH RD+++     Q         C+
Sbjct  302   --YWTIPM---AP-PNQSSSPMSQKGSSPNSPTLGKHYRDEDSSTERKQ------RNGCV  349

Query  1469  WVPKTLRFDDPEDAAKSSIWATLGIQHD--RVDSIRGGAFKAFKMKDDENSHASKNCRVL  1642
              VPKTLR DDP +AAKSSIW TLGI+++   + S  GG FK F  K ++++    N   +
Sbjct  350   IVPKTLRIDDPNEAAKSSIWTTLGIKNEGSTLGSKGGGMFKGFDQKTNKSNKDQTNNSHV  409

Query  1643  LEANPAALSRSLNFHE  1690
             L ANPAALSRSLNF E
Sbjct  410   LSANPAALSRSLNFQE  425



>ref|XP_010922885.1| PREDICTED: cyclic dof factor 1-like [Elaeis guineensis]
Length=512

 Score =   236 bits (603),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 197/544 (36%), Positives = 262/544 (48%), Gaps = 99/544 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP IKLFG TI   +              G AA   NS    +S +E  P  DE+++ 
Sbjct  4     SRDPAIKLFGRTIPLTEGQ------------GQAADGENS--GPASATEEPPAVDEKEES  49

Query  425   NENGER------MDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTD  586
                 +        D ++E + T L    G+     D   D   + H D+     +    D
Sbjct  50    RVVTDAEVKDSVSDAAEELDRTKLSSCSGLDSGKED---DHQMSAHEDKAVADPK-PEKD  105

Query  587   EEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGM  766
             + E   SN ++K LKKPDKILPCPRC+S+DTKFCY+NNYN NQPRHFC+ CQRYWT+GG 
Sbjct  106   QTEANASN-QEKVLKKPDKILPCPRCNSLDTKFCYYNNYNVNQPRHFCRNCQRYWTAGGT  164

Query  767   TRNLPVGAGRRKTKNSAAHYHLNAVKSFQNAC--VDHPERIQHHA-----------LKAN  907
              RN+PVG+GRRK+K+SA+HY    + S    C  VD  +   H A           LK N
Sbjct  165   MRNVPVGSGRRKSKHSASHYRHIMMTSDGMPCNQVDASDSSSHQALPAGLSSPTRPLKGN  224

Query  908   GKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
             G VL        SE ++ E  A         +  E+G        +  +  S   +S   
Sbjct  225   GTVLKF-----GSEASLCESMASVLGDREQKRNAEVGSSAGGENREEPSCASFVMASNCV  279

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAP--QLPCFQAPPWPYP----------SSAVQWSSAV  1231
              +    +  +   + L+   +G  P   L CF  PPW YP           +A + SS +
Sbjct  280   ENDHSKIAFHKEQNGLQSGCNGLTPMHHLQCFPGPPWIYPWHPGWNNVSSMAAGRCSSEL  339

Query  1232  ---------------PP----PGCFSPGFPMPFYPPAMYLGYTIPCSW-----NAPWV--  1333
                            PP    P   +P  P PF P + +    +P SW     + PWV  
Sbjct  340   VYRPENGSPNPVPWCPPMMATPAFCAPTIPFPFVPASFW--GCMP-SWANGTLSMPWVGS  396

Query  1334  ----SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDP  1501
                 S   +    + SG  SPTLGKHSRD  ++  E         EK LWVPKTLR DDP
Sbjct  397   NGGLSPSSSASSSSGSGNGSPTLGKHSRDATSQSEE-------KTEKSLWVPKTLRIDDP  449

Query  1502  EDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
             ++AAKSSIWATLGI+ D  +SI +GG FKAF  K +   H +   +V L+ANPAALSRS 
Sbjct  450   DEAAKSSIWATLGIKPD--ESIKKGGIFKAFHSKTESKDHTADAAQV-LQANPAALSRSQ  506

Query  1679  NFHE  1690
              F E
Sbjct  507   TFQE  510



>ref|XP_004985552.1| PREDICTED: cyclic dof factor 3-like [Setaria italica]
Length=428

 Score =   234 bits (597),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 172/493 (35%), Positives = 239/493 (48%), Gaps = 93/493 (19%)
 Frame = +2

Query  260   IKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKNENGE  439
             IKLFG TI  P+A       + D+                                ++G 
Sbjct  15    IKLFGKTIPVPEAAAAVGEADKDI-------------------------------QQSGS  43

Query  440   RMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGKD  619
                E K  E T L +  G   Q   E+ D        ED  +T+ S+ D+++G+ +N K+
Sbjct  44    STTELKGQENT-LQDSTGSPPQ--QEVAD-------TEDSSATKKSSGDQQQGETTNQKE  93

Query  620   KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRR  799
             K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRR
Sbjct  94    K-LKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRR  152

Query  800   KTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAEKTAGN  979
             K+K+++A  H       Q      P      A K NG VL+  SD   S L++ E+    
Sbjct  153   KSKSASATSHF-----LQRVRAALPIDALCAAAKTNGTVLSFGSD--MSSLDLTEQMK--  203

Query  980   GSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFA  1159
               L     P+    ++      +    + GS+ V  ++ K+ V  +   +++        
Sbjct  204   -HLKEKLVPI---TRIKSSDDRSAGSCTEGSAKVEDSNQKEKVTADKSANVVPH------  253

Query  1160  PQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPGFPMPFYP-PAMYLGYTIPCSWNAPW-  1330
                PC      WP+        S  PPP C++ G  +PFYP  A Y G  +P +WN PW 
Sbjct  254   ---PCMNGVTMWPF--------SCAPPPACYTSGIAIPFYPAAAAYWGCMVPGAWNTPWP  302

Query  1331  ------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRF  1492
                    + P++     S+  N  T GK SR D ++EG      D+     +WVPKT+R 
Sbjct  303   PHSQSESASPLSTASPASTKSNCFTPGKRSR-DCDEEG------DTKGHGKVWVPKTIRI  355

Query  1493  DDPEDAAKSSIWATLGIQHDRVDSIRGGA--FKAFKMKDDE---NSHASKNCRVLLEANP  1657
             DD ++ A+SSI + +GI  D+      G    K F+ + +E    +HA  N    L+ NP
Sbjct  356   DDADEVARSSILSLIGINGDKAGKDGRGCKLAKVFEQQKEEAKTATHAVINSLPFLQGNP  415

Query  1658  AALSRSLNFHESS  1696
             AALSRSL F E S
Sbjct  416   AALSRSLTFQEGS  428



>gb|ACJ13914.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   229 bits (585),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIIIP--------------------GPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13912.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13924.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13925.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13928.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13929.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13930.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13932.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13934.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13935.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13936.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13937.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13938.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13940.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   229 bits (584),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIIIP--------------------GPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13920.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13931.1| cycling DOF factor 2 [Helianthus annuus]
 gb|ACJ13939.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   229 bits (584),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIIIP--------------------GPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAVSPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|ACJ13933.1| cycling DOF factor 2 [Helianthus annuus]
Length=339

 Score =   229 bits (584),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 184/340 (54%), Gaps = 73/340 (21%)
 Frame = +2

Query  623   TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRK  802
             TLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK
Sbjct  46    TLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRK  105

Query  803   TKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVASELNIAEK  967
              K S + Y    V          P  + +  LK NG VLT  SD     S+AS L IA+K
Sbjct  106   NKTSQSQYRQITVTE------PVPGDLNNTLLKPNGTVLTFGSDAPLCESMASVLKIADK  159

Query  968   TAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNY  1147
             T    S   F KP ++ I                       S+ DD       +  + + 
Sbjct  160   TMRQDS---FRKPEDIIIP--------------------GPSSNDD-------NTNRPSA  189

Query  1148  HGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPC-----  1312
              G A   P F   PWPYP     W   + P  C  PGFPMPFYP A Y G  IP      
Sbjct  190   TGPAFCPPGFPGAPWPYP-----WPPQMGPAFC-PPGFPMPFYPAAPYWGCAIPVPGPSS  243

Query  1313  -------SWNAPWVSRPVAPQHH---------TSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                     W+  WV  P +  +H         + S P SPTLGKHSR +N   GE +  K
Sbjct  244   GPGLSPGPWSMQWVPHPSS--YHPAPPVTYAASPSSPISPTLGKHSRAEN---GEDEIIK  298

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDS  1564
             ++  EK LWVPKTLR DDPE+AAKSSIWATLGI++DR  S
Sbjct  299   ENEEEKSLWVPKTLRIDDPEEAAKSSIWATLGIKNDRTTS  338



>gb|AGF33077.1| chromosome 5 cycling DOF factor-like protein [Solanum tuberosum]
Length=394

 Score =   229 bits (585),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 160/448 (36%), Positives = 223/448 (50%), Gaps = 72/448 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              +DP IKLFG TI                  G    E N +      + + P   +  + 
Sbjct  4     VRDPAIKLFGKTI------------------GMTQQETNCVYLHDDHTTSSPLSIDDDKI  45

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
                GE     ++DE         I  +T   I D +K    D++      + + +   + 
Sbjct  46    TLEGEFTQSKQDDELVDPTADSSIEPETSSGISDDIKMQDADKE------TLSSKSIEEE  99

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              + ++K LKKPDK++PCPRC+SM+TKFCY+NNYN NQPR+FCK CQRYWT+GG  RN+PV
Sbjct  100   DSSEEKALKKPDKLIPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPV  159

Query  785   GAGRRKTKNSA-AHYHLNAVKSFQNACVDHPERIQHH-ALKANGKVLTLAS-----DSVA  943
             G+GRRK K+S+ ++Y L A +      V+      H  AL+ NG VLT  S     DS+ 
Sbjct  160   GSGRRKNKSSSISNYPLQAGR------VEAAAHGMHLPALRTNGTVLTFGSDKPLCDSMV  213

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+AE +  N + N F+         S        +  S  +  TA+S  D     G 
Sbjct  214   SALNLAENSH-NMNRNEFHG--------SERRMPAIGNDQSNGTCSTASSVTDKESSAGT  264

Query  1124  PDMLK-QNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGY  1300
              D+    N+  F PQ+P FQ  PWPY                   GFP+ FYP   Y G 
Sbjct  265   HDLANWNNFQPFPPQVPYFQGAPWPY------------------SGFPVSFYPATPYWGC  306

Query  1301  TIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNP-----EKC  1465
             T+   WN PW+S   +   + S  P SPTLGKHSRD++  +      +D+N      E+C
Sbjct  307   TVANPWNVPWLSSDQSSVQNNS--PTSPTLGKHSRDESKIDPSQSRRRDANLQNREGERC  364

Query  1466  LWVPKTLRFDDPEDAAKSSIWATLGIQH  1549
             + +PKTLR  DP +AAKSSIW+TL  ++
Sbjct  365   VLIPKTLRIHDPNEAAKSSIWSTLVTRY  392



>ref|NP_001236866.1| Dof27 [Glycine max]
 gb|ABI16029.1| Dof27 [Glycine max]
Length=322

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 183/327 (56%), Gaps = 27/327 (8%)
 Frame = +2

Query  434   GERMDESKEDEG-----TVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEG  598
             GE   ES++++G     TV   GE  ++ +  +           ED        T++E+G
Sbjct  2     GEETTESEKEDGVTNLDTVSRPGEVSINPSTKK-----------EDLTLKTSKKTEQEQG  50

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +  N +DKTL+KPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG+ RN+
Sbjct  51    E--NSQDKTLRKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGVMRNV  108

Query  779   PVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD-----SVA  943
             PVGAGRRK KN  + Y    V          P+     +L  N  +L   SD     S+ 
Sbjct  109   PVGAGRRKNKNFTSQYRQITVPEAA-LLSSQPDLPNGPSLNCNATLLAFGSDTPLCESMT  167

Query  944   SELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGL  1123
             S LN+AEK   N + NGF    EL I  +Y AG+   D S+ SS ++    + +   N  
Sbjct  168   SVLNLAEKAVNNSTTNGFNGSEELEIPFAYVAGEKVNDDSNKSSDMSTKPMEGET-TNRS  226

Query  1124  PDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVP-PPGCFSPGFPMPFYPPAMYLGY  1300
              + + +N H F P  P F   PWP+P +   W+S VP PP  F  GF MP YP A Y G 
Sbjct  227   QEQVIENCHPFPPHAPYFPGAPWPFPWNPALWNSPVPSPPAFFPQGFTMPLYPAAAYWGL  286

Query  1301  TIPCSWNAPWVSRPVAPQHHTS-SGPN  1378
             TIP +W+ PW+++P  P    S SGP+
Sbjct  287   TIPGAWSIPWLAQPSLPNSTVSNSGPD  313



>ref|XP_008781227.1| PREDICTED: cyclic dof factor 3-like [Phoenix dactylifera]
Length=511

 Score =   232 bits (591),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 203/567 (36%), Positives = 265/567 (47%), Gaps = 135/567 (24%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M EP +DP IKLFG TI  P++ P P P     D                  EA P +  
Sbjct  1     MSEP-RDPAIKLFGKTIPLPESLPLPLPPAEAED-----------------KEARPTDPA  42

Query  413   QQ-QKNENGERMDESKEDEGTVLMEGEGIMDQTVDEI--RD----GL--------KAPHV  547
              Q    E+GE+ D  KE+     ME    M    DE+  RD    GL        +AP+ 
Sbjct  43    PQPDPAEDGEK-DTCKEN---TDMEVNNPMPDVPDEVNQRDPNNSGLHNGNGDDNEAPNQ  98

Query  548   DEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHF  727
             DE       +  D+ E   S+G++K LKKPDK+LPCPRC+SM+TKFCY+NNYN NQPRHF
Sbjct  99    DEKVAMDSKADHDKTEAD-SSGQEKVLKKPDKVLPCPRCNSMETKFCYYNNYNVNQPRHF  157

Query  728   CKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHAL-  898
             CK CQRYWT+GG  RN+PVGAGRRK K+SA+HY    + S    +  V   +   H AL 
Sbjct  158   CKNCQRYWTAGGTMRNVPVGAGRRKNKHSASHYRHMMMSSDGLASGRVVAADLTPHQALP  217

Query  899   ----------KANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSY  1033
                       K NG VL    +     S+AS LN+ E+       N  +  +  G     
Sbjct  218   CGPSVPMRSMKGNGNVLKFGQEVPLCESMASVLNLGEQKK-----NADFDSIACG-----  267

Query  1034  gagdngadhssgsssvtaasTKDDVCKNGLPD----MLKQNYHGFA------PQLPCFQA  1183
                      +    S  ++ T  +  +NG P+    M +    G+       P L C+  
Sbjct  268   --------ENKEDPSCASSVTASNCVENGFPENAVPMEQNGMQGYCNGMTPMPHLQCYPG  319

Query  1184  PPWPYP----------------SSAVQWS--------------SAVPPPGCFSPGFPMPF  1273
               W YP                SS + +                 +P P   +P  P PF
Sbjct  320   AHWAYPWGPGWNNVAAMAGGRCSSELVYGPENGSPTPIPWSPPPMMPGPAFCAPTIPFPF  379

Query  1274  YPPAMYLGYTIPCSWNAPW------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQ  1435
               PA + G+    +WN  W      +S   +  +   SG  SPTLGKHSRD + +  E  
Sbjct  380   M-PASFWGWPN-GAWNVAWFGANGGISPSSSTSNSGCSGNGSPTLGKHSRDASLQGEETM  437

Query  1436  PPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENS  1615
                    EK LWVPKTLR DDP++AAKSSIWATLGI+ +      GG FK F+ K +   
Sbjct  438   -------EKSLWVPKTLRIDDPDEAAKSSIWATLGIKPE-----EGGIFKPFQSKAESKG  485

Query  1616  HASKNCRVLLEANPAALSRSLNFHESS  1696
               S   +V L ANPAALSR  +F ES+
Sbjct  486   QTSDASQV-LHANPAALSRFRSFQEST  511



>ref|XP_006583963.1| PREDICTED: cyclic dof factor 2-like isoform X2 [Glycine max]
Length=450

 Score =   228 bits (582),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 186/503 (37%), Positives = 252/503 (50%), Gaps = 75/503 (15%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IKLFG TI           T ++ D   +++ A + +  SS  E      +QQ +
Sbjct  4     VKDPAIKLFGRTISL-------THTHIN-DSSSSSAPARAPSSSSSPREVTSSATQQQHE  55

Query  425   NENGER--MDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEG  598
              E   R  +  S++D+G+     +     T   I +  K P  + +  S   S+T+ E+ 
Sbjct  56    PEEPSRKELTSSQDDDGSHQTTEDLKSPTTSSGIFENPKTPSPETET-SVPKSSTNGEQS  114

Query  599   KMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             + S   +KT KKPDK+LPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  115   ETSASDEKTPKKPDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNV  174

Query  779   PVGAGRRKTKN---SAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS---  937
             PVGAGRRK KN   +A+HY HL   +  Q A ++ P  + +  L     VLT   DS   
Sbjct  175   PVGAGRRKNKNFPATASHYRHLMFPEGLQGATLNAPNGLHNAVLGNGAAVLTFGPDSPLC  234

Query  938   --VASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVC  1111
               +AS LNIAE+ A +   NGF +  E    VSY   ++G+     +    A ++     
Sbjct  235   DTMASMLNIAER-AQSCVPNGF-QATEPNSFVSYRKEEDGSTSGHSTGVSVATTSTSSHS  292

Query  1112  KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMY  1291
              +   + + +   GF PQLP F       PS    +      P    PG+P+ F      
Sbjct  293   GSH--ESVDKRVEGFTPQLPYF-------PSGPWPYPMPP--PTFCPPGYPLSF------  335

Query  1292  LGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN-----NKEGEPQPPKDSNP  1456
               YT P  W                        GKHSRD N     N + E    +  + 
Sbjct  336   --YTTPAYW------------------------GKHSRDGNIIAPSNSQREMHDMEHKSS  369

Query  1457  EKCLWVPKTLRFDDPEDAAKSSI--WATLGIQHDRVDSIRGGAFKAF-KMKDDENSHASK  1627
             E  + +PKTLR DDP +AAKSSI  W+ LGI+ D+  S  GG FKAF   K ++ +H   
Sbjct  370   EHNVLIPKTLRIDDPSEAAKSSISMWSKLGIKDDKAGS--GGLFKAFPSSKGNDMNHHMV  427

Query  1628  NCRVLLEANPAALSRSLNFHESS  1696
                 LL+ANPAALSRSL F E +
Sbjct  428   EASPLLQANPAALSRSLTFREQT  450



>ref|XP_002457611.1| hypothetical protein SORBIDRAFT_03g010280 [Sorghum bicolor]
 gb|EES02731.1| hypothetical protein SORBIDRAFT_03g010280 [Sorghum bicolor]
Length=560

 Score =   231 bits (589),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 218/442 (49%), Gaps = 94/442 (21%)
 Frame = +2

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ED  +++    +E+     +G+DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  153   EDKAASDPKGENEKTSNEESGQDKALKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFC  212

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHALKA  904
             K CQRYWT+GG  RN+PVGAGRRK+KNS+ HY   L A      + VD  + +   AL +
Sbjct  213   KNCQRYWTAGGTMRNVPVGAGRRKSKNSSLHYRQLLMAPDCMLGSRVDISKSVLPEALVS  272

Query  905   ----------NGKVLTLAS-----DSVASELNIAEKTAGN--GSLNGFYKPVELGIQVSY  1033
                       N  VL         +S+ S LNI E+   N   +  G  +    G   SY
Sbjct  273   PPAPIQPTSRNETVLKFGPEVPLCESMVSALNIDEQNVNNSGSAPRGENREDNPGPGTSY  332

Query  1034  gagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAV  1213
                     H               V KNG P     + +G AP    +   P+ YP + V
Sbjct  333   NGVPENMVH---------------VDKNGAP----VHCNGVAPVPQYYLGTPFMYPWN-V  372

Query  1214  QW---------------------------------SSAVPPPGCFSPGFPMPFYPPAMY-  1291
              W                                 S  +P     SP FP P  PPA++ 
Sbjct  373   GWNNVPVMAPGKSMPESAPASASESCSTSSALWMNSPMIPASRFPSPAFPYPLVPPALWG  432

Query  1292  --LGYTIPCSWNAPWVS-----RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDS  1450
                G+ +  +WN PW+       P +  + + SG  SPTLGKHSRD N       P K+ 
Sbjct  433   CLSGWPV-TTWNIPWIRANGCVSPSSSSNSSCSGNGSPTLGKHSRDSN-------PMKEE  484

Query  1451  NPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKN  1630
               EK LWVPKTLR DDP++AAKSSIWATLGI+         G FK F+ K +     S  
Sbjct  485   KREKSLWVPKTLRIDDPDEAAKSSIWATLGIKPG-----DPGTFKPFQSKVESKGQRSDA  539

Query  1631  CRVLLEANPAALSRSLNFHESS  1696
              +V L+ANPAALSRS  F ESS
Sbjct  540   AQV-LQANPAALSRSQTFQESS  560



>ref|XP_008446369.1| PREDICTED: cyclic dof factor 1 [Cucumis melo]
Length=425

 Score =   227 bits (579),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 180/497 (36%), Positives = 233/497 (47%), Gaps = 96/497 (19%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP IKLFG TI  P             D    +SE  +  K++SC              
Sbjct  7     RDPIIKLFGKTISLPS------------DSKFLSSE--TTEKETSC--------------  38

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
                        +E  +  EG    +Q  D+   G+    ++E   S+  ++ +EE+ + S
Sbjct  39    -----------EELGLEKEGNSSGNQITDQTTSGVSENPLEEREISSPKASKNEEQSETS  87

Query  608   NGKD-KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             N  D KT KKPDKILPCPRC+SMDTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  88    NSPDNKTSKKPDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  147

Query  785   GAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAE  964
             GAGRRK KNS++ +       F+   +       H  L  NG  LT ASDS  S      
Sbjct  148   GAGRRKNKNSSSSH-------FRQLIIPDGGIHPHQFLDNNGTFLTFASDSSISNSQSCN  200

Query  965   KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQN  1144
                     NGF    E G   S     +    S+ S      +++  + KN  P      
Sbjct  201   P-------NGFLINTENGDDHS---SKSSITVSNSSEKGAKMASQQSIAKNVFP------  244

Query  1145  YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFS-PGFPMPFYPPAMYLGYTIPCSWN  1321
                F PQL  F     PY       SS  PP   F  PG P+ +YP   Y GY  P S  
Sbjct  245   ---FLPQLQSFTGLSLPY-------SSITPPSAPFYPPGIPVSYYPSQPYWGYLAPPSLT  294

Query  1322  APWVSRPVAPQHHTSSGPNSPTLGKHSRDD------NNKEGEPQPPKDSNPEKCLWVPKT  1483
                    +   +  +S  NS  LGK SRD       +N E E    K+S  E  L +PKT
Sbjct  295   -------IINPNSQNSSTNSSVLGKRSRDGKLVKSPSNTESEIVKQKNSE-EPSLGIPKT  346

Query  1484  LRFDDPEDAAKSSIWATLGIQHDR-------VDSIRGGA-FKAFKMKDDENSHASKNCRV  1639
             ++ DDP +AAKSSIW+TLGI++D+         +I GG+ F + +               
Sbjct  347   MKVDDPNEAAKSSIWSTLGIKNDKKAGGGSTSTTINGGSLFVSLQRSTKGKEETQIESWS  406

Query  1640  LLEANPAALSRSLNFHE  1690
             LL+ANPAA SR+L F E
Sbjct  407   LLQANPAAFSRALKFRE  423



>ref|XP_002468428.1| hypothetical protein SORBIDRAFT_01g045840 [Sorghum bicolor]
 gb|EER95426.1| hypothetical protein SORBIDRAFT_01g045840 [Sorghum bicolor]
 tpg|DAA34026.1| TPA_inf: Dof-type zinc finger protein 23 [Sorghum bicolor]
 gb|AEF32404.1| Dof-type zinc finger protein [Sorghum bicolor]
Length=424

 Score =   226 bits (577),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 151/396 (38%), Positives = 209/396 (53%), Gaps = 52/396 (13%)
 Frame = +2

Query  551   EDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             ED  + + S+ D+++G+ +N K+K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFC
Sbjct  67    EDSSAAKNSSADKQQGEAANQKEK-LKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFC  125

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANG  910
             K CQRYWT+GG  RN+PVGAGRRK+K+++A  H       Q      P      A K NG
Sbjct  126   KNCQRYWTAGGAMRNVPVGAGRRKSKSASAASHF-----LQRVRAALPMDPLCTAAKTNG  180

Query  911   KVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
              VL+  SD   S L++ E+      L     P+     +  G   +    + G +    +
Sbjct  181   TVLSFGSD--MSSLDLTEQMK---HLKEKLIPI---AGIKNGDERSVGSCTEGPAKAEDS  232

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPG-FP  1264
             + K++V       ++         Q PC      WP+        S  PPP C++PG   
Sbjct  233   NQKENVTAEKSAKLV---------QHPCMNGVAMWPF--------SCAPPPACYTPGSIA  275

Query  1265  MPFYP-PAMYLGYTIPCSWNAPW-------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNK  1420
             +PFYP PA Y G  +P +WNAPW           ++     S+  N  T GK  R D N+
Sbjct  276   IPFYPAPAAYWGCMVPGAWNAPWPPQSPSETGSTLSTASPASTKSNCFTPGKRPR-DCNE  334

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGA--FKAFK  1594
             EG      D+     +WVPKT+R DD ++ A+SSI + +GI  D+      G    + F+
Sbjct  335   EG------DTKGNGKVWVPKTIRIDDVDEVARSSILSLIGINGDKAGKDGKGCKLARVFE  388

Query  1595  MKDDEN--SHASKNCRVLLEANPAALSRSLNFHESS  1696
              K++    +H+  N    L+ NPAALSRSL F E S
Sbjct  389   QKEEARTATHSVINGLPFLQGNPAALSRSLTFQEGS  424



>ref|XP_003565622.2| PREDICTED: cyclic dof factor 2-like [Brachypodium distachyon]
Length=548

 Score =   229 bits (584),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 244/511 (48%), Gaps = 114/511 (22%)
 Frame = +2

Query  404   EDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT  583
             E E ++ +E    +   KE+ G   +EG+   ++  +E+   + AP V+E+      ST 
Sbjct  72    ETEDKEDSEMKVDVPPEKENRG---IEGDAPREKEGNEME--VDAPQVNENAEPDSSSTL  126

Query  584   D----------------------EEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFN  697
             D                      E+     + +DK LKKPDKI+PCPRC+SMDTKFCY+N
Sbjct  127   DHKKDTQDQINSAEDKADPKELNEKTANEESDQDKVLKKPDKIIPCPRCNSMDTKFCYYN  186

Query  698   NYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDH  871
             NYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK+KNS+ HY   L A      + VD 
Sbjct  187   NYNINQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNSSLHYRQLLMAPDCMMGSRVDI  246

Query  872   PERIQHHALKA-----------NGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYK  1003
                +    L +           N  VL         +S+AS LNI E+      +N    
Sbjct  247   SNTVNPEVLASLPTTPTKSTSRNETVLKFGPEVPLCESMASVLNIEEQNV----INAGSV  302

Query  1004  PVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQA  1183
             P+    +V+  A    + +    ++V        V KNG P        G  P  P +  
Sbjct  303   PIGEAREVNSCASSMTSHNGLPENAVH-------VDKNGAPVYCG----GVGPMPPYYLG  351

Query  1184  PPWPYPSSAVQWSS--AVPPPGCFS-----------------------------PGFPMP  1270
              P+ YP S + W++   + P G  S                             P FP P
Sbjct  352   APFMYPWS-IGWNNLPVMVPGGSMSESASPSESCSTSSAPWMNSPMMPGSRLPAPAFPYP  410

Query  1271  FYPPAMY--LGYTIPCSWNAPWVS-----RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGE  1429
               PP ++  L      +WNAPW+       P    + + SG  SPTLGKHSRD N     
Sbjct  411   LVPPTLWGCLPSWPATAWNAPWIGTNGCISPSTSSNSSCSGNGSPTLGKHSRDSN-----  465

Query  1430  PQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDE  1609
               P KD   EK LWVPKTLR DDP++AAKSSIWATLGI+         G FK F+ K  E
Sbjct  466   --PLKDDKEEKSLWVPKTLRIDDPDEAAKSSIWATLGIKPG-----DPGVFKPFQFK-SE  517

Query  1610  NSHASKNCR--VLLEANPAALSRSLNFHESS  1696
             N   + + R   +L+ANPAA SRS +F ESS
Sbjct  518   NKGQTTDVRPACVLQANPAAFSRSQSFQESS  548



>ref|XP_002877565.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53824.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   226 bits (576),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 179/501 (36%), Positives = 248/501 (50%), Gaps = 77/501 (15%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP IKLFGM I                 P  A  E++   +D    +   G+D+   K
Sbjct  5     SRDPAIKLFGMKI-----------------PLTAVFESSVTVEDEEEDDWSGGDDKSPDK  47

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE-EEGK  601
                      +K               +TVD+          +E   + +I +++  E+ +
Sbjct  48    VALEISDKNNKNCNNNSFNNSNDSKPETVDK----------EEATSADQIESSESPEDNQ  97

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  98    QTTADGKTLKKPTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  157

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTL---ASDSVASE  949
             VGAGRRK K+S++HY H+   ++ + A +D         L+AN +VL+    A    A+ 
Sbjct  158   VGAGRRKNKSSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGLEAHQQHAAP  210

Query  950   LNIAEKTAGN-----GSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             +    K  G+     G+ NGF+   +  + V+     +     S  ++    S  +   +
Sbjct  211   MTPVMKLQGDQKVSTGARNGFHGLADQRL-VARVENGDDCSSGSSVTTSNNHSVDESRAQ  269

Query  1115  NG-LPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFPMPFYPPAM  1288
             NG + D    N +       C    PWPY      W+ A+ PP     PG+PMPFYP   
Sbjct  270   NGRVVDPQMNNNNNNMNGYACIPGVPWPY-----TWNPAMPPPGFYPPPGYPMPFYP---  321

Query  1289  YLGYTIPCSWNAPWVSRPVAPQHHTSSG--PNSPTLGKHSRDDNNKEGEPQPPKDSNPEK  1462
                      W  P +S   +    +  G  PN PTLGKHSRD+ + +      KD+  E+
Sbjct  322   --------YWTIPMLSPHQSSSSMSQKGPNPNPPTLGKHSRDEESAK------KDNETER  367

Query  1463  -----CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASK  1627
                  C+ VPKTLR DDP +AAKSSIW TLGI+++ +    GG FK F  K   N++   
Sbjct  368   KQRNGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNEAM-CKAGGMFKGFDQKTKMNNNDKA  426

Query  1628  NCRVLLEANPAALSRSLNFHE  1690
                 +L ANPAALSRS NFHE
Sbjct  427   ENSPVLSANPAALSRSHNFHE  447



>ref|XP_008792513.1| PREDICTED: cyclic dof factor 2-like [Phoenix dactylifera]
Length=512

 Score =   228 bits (581),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 201/542 (37%), Positives = 261/542 (48%), Gaps = 97/542 (18%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP IKLFG TI              +  P  A  E  ++ +     E    E  +   +
Sbjct  5     RDPAIKLFGRTIPL-AEGGGQAAGGENSGPASATEELPAVDEKEESREVTDTE-VKDSVS  62

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
             +  E +D++K    + L  G+    Q        +  P  ++D          + E K S
Sbjct  63    DAAEELDQTKPASSSGLDNGKEDDPQISTNDDKAVADPKPEKD----------QTEAKAS  112

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
             + ++K LKKPDKILPCPRC S+DTKFCY+NNYN NQPRHFC+ CQRYWT+GG  RN+PVG
Sbjct  113   S-QEKVLKKPDKILPCPRCSSLDTKFCYYNNYNVNQPRHFCRNCQRYWTAGGTMRNVPVG  171

Query  788   AGRRKTKNSAAHYHLNAVKSFQNAC--VDHPERIQHHA-----------LKANGKVLTLA  928
             +GRRKTK+SA++Y    + S    C  VD  +   H A           LK N  VL   
Sbjct  172   SGRRKTKHSASNYRHIMMASDGMPCNRVDASDSSSHQAHPVGLSSPTRPLKGNDTVLKFG  231

Query  929   S-----DSVASELNIAE--KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvta  1087
             S     +S+AS L+  E  + A  GSL G  +  E     S+    N  ++     +V  
Sbjct  232   SEAPLCESMASVLSHGEQKRNAEIGSLAG-GEDRENPSCASFVMASNCVENDHSKIAVHN  290

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYP----------SSAVQWSSAV--  1231
                    C NGL  M    +H     L CF  PPW YP           +A + SS +  
Sbjct  291   EQNGLQSCCNGLTPM----HH-----LHCFPGPPWIYPWPPGWNNVSSMAAGRCSSELVY  341

Query  1232  --------PPPGC---------FSPGFPMPFYPPAMYLGYTIPCSW-----NAPWV----  1333
                     P P C          +P  P PF P + +    +P SW     N PWV    
Sbjct  342   RPENGSPNPVPWCPLMMTSPAFCAPTIPFPFLPASFW--GCMP-SWANGTLNIPWVGSNG  398

Query  1334  --SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPED  1507
               S P +    + SG  SPTLGKHSRD   +  E         EK LWVPKTLR DDP++
Sbjct  399   GLSPPSSASSSSCSGNCSPTLGKHSRDATLQSEE-------KTEKSLWVPKTLRIDDPDE  451

Query  1508  AAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNF  1684
             AAKSSIWATLGI+ D  +SI +GG FKAF  K +   H +   +V L+ANPAALSRS  F
Sbjct  452   AAKSSIWATLGIKPD--ESIKKGGIFKAFHSKTEGKDHTAGAAQV-LQANPAALSRSQTF  508

Query  1685  HE  1690
              E
Sbjct  509   QE  510



>ref|XP_006404373.1| hypothetical protein EUTSA_v10010412mg [Eutrema salsugineum]
 dbj|BAJ34128.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45826.1| hypothetical protein EUTSA_v10010412mg [Eutrema salsugineum]
Length=418

 Score =   225 bits (573),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 161/394 (41%), Positives = 212/394 (54%), Gaps = 52/394 (13%)
 Frame = +2

Query  542   HVDEDCGST---EISTTDEEEGKMSNGKD-KTLKKPDKILPCPRCDSMDTKFCYFNNYNT  709
             H  E+  ST   EIS + E+  +     D K LKKP KILPCPRC SM+TKFCY+NNYN 
Sbjct  64    HDKEEATSTDQIEISDSPEDNHQQQTTTDGKILKKPTKILPCPRCKSMETKFCYYNNYNI  123

Query  710   NQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERI  883
             NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K +S++HY H+   ++ + A +D     
Sbjct  124   NQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKSSSSSHYRHITISEALEAARLD-----  178

Query  884   QHHALKANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhs  1063
                 L+AN +VL+   ++        ++   NG  NG    VE G   S       +  +
Sbjct  179   --PGLQANTRVLSFGLEAPVKLQ--GDQKVSNGVRNGLVARVENGDDCS----TGSSVTT  230

Query  1064  sgsssvtaasTKDDVCKNGLPDM--LKQNYHGFAPQLPCFQAPPWPYPSSAVQWS-SAVP  1234
             S ++  +   T+   C+   P       N  G+A    C    PWPY      W+    P
Sbjct  231   SNNNHHSVDETRAQSCRVVEPQTNNNNNNMSGYA----CIPGVPWPY-----TWNPPMPP  281

Query  1235  PPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDN  1414
             P     PG+PMPFYP            W  P +S P+      S   +SPTLGKHSRD+ 
Sbjct  282   PGFYPPPGYPMPFYP-----------YWTIPMLSSPM------SQKGSSPTLGKHSRDEE  324

Query  1415  NKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF-  1591
             +   E +  +      C+ VPKTLR DDP +AAKSSIW TLGI+++ +   +GG FK F 
Sbjct  325   SAREENETERKQQRNGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNEAMS--KGGMFKGFD  382

Query  1592  -KMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
              K K + N++       +L ANPAALSRSLNF E
Sbjct  383   QKTKKNHNNNDKAENSPVLSANPAALSRSLNFQE  416



>ref|XP_010546061.1| PREDICTED: cyclic dof factor 3-like [Tarenaya hassleriana]
Length=430

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 191/512 (37%), Positives = 250/512 (49%), Gaps = 118/512 (23%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP IKLFGM I FP                 AA E      D        GEDE+   
Sbjct  5     SKDPGIKLFGMEIPFP-----------------AAEEKGKRGGD--------GEDEKSA-  38

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGL------KAPHVDEDCGSTEISTTD  586
              E G   DES E       E +   +   +E           KA   DE+    +  + D
Sbjct  39    -EEGTTTDESTESSEQESPEKKKKKNDEEEEDHQNSWQDSKSKAGDEDENSKDHQGESID  97

Query  587   EEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGM  766
               + + S+   KTLKKP KILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG 
Sbjct  98    SHDHQDSS---KTLKKPTKILPCPRCNSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGT  154

Query  767   TRNLPVGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLA-----  928
              RN+PVGAGRRK KNS+ HY H+   ++ Q A +D      H  LK NG+VL+       
Sbjct  155   MRNVPVGAGRRKNKNSSPHYRHITISEALQAARIDSAH--HHPGLKTNGRVLSFGLESQQ  212

Query  929   ----SDSVASELNIAEKTAGNGSL----NGFYKPVELGIQVSYgagdngadhssgsssvt  1084
                  +S+AS L + ++   NG+     NG+        + S                  
Sbjct  213   QAPICESMASVLKLGDQKIPNGARNDCPNGYLTDESRARKNS------------------  254

Query  1085  aasTKDDVCKNGLPDM---LKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFS  1252
                        G P++      N +GFA    C  + PWPY      W+ ++ PP     
Sbjct  255   -----------GFPEVNMAKNSNMNGFA----CVPSIPWPY-----TWNPSIPPPGFFPP  294

Query  1253  PGFPMPFYPPAMYLGYTIPCSWNAPWV----SRPVAPQHHTSSGPNSPTLGKHSRDDNNK  1420
             PGF MPFYP            W+ P +    S   + +  +SSG NSPTLGKHSRD  + 
Sbjct  295   PGFAMPFYP-----------YWSIPMLSPQSSSSSSQKGSSSSGQNSPTLGKHSRDRTDN  343

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF--K  1594
               +    ++ +    ++VPKTLR DDP++AAKSSIW TLGI   R + +  G FK F  K
Sbjct  344   TADTTGRRNGS----VFVPKTLRIDDPDEAAKSSIWKTLGI---RNEVMSKGVFKGFDQK  396

Query  1595  MKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
              K  +N+  +     +L ANPAALSRS++FHE
Sbjct  397   GKKTKNNEETGEISPVLLANPAALSRSIDFHE  428



>ref|XP_009383868.1| PREDICTED: cyclic dof factor 3-like [Musa acuminata subsp. malaccensis]
Length=535

 Score =   228 bits (581),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 193/556 (35%), Positives = 258/556 (46%), Gaps = 119/556 (21%)
 Frame = +2

Query  221   SATVMPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEP  400
             SA VM +  +DP IKLFG+TI   D        +   +P G +S  +   +  +C+E   
Sbjct  35    SAHVMSQ-ARDPAIKLFGLTIPPQDG-------QGTAEPPGESSSPSERDEKDTCTEVRE  86

Query  401   GEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEIST  580
              E E        E +D  K    + L  G G      DE+     +   DE+  S +   
Sbjct  87    SEVETSAS----EMVDLQKPSTSSGLNNGNG------DEV-----STQNDEE-SSGQKHE  130

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
              D  E   S G++KTLKKPDKILPCPRC+S++TKFCY+NNYN NQPRHFCKKCQRYWT+G
Sbjct  131   KDNSEANTS-GQEKTLKKPDKILPCPRCNSLNTKFCYYNNYNVNQPRHFCKKCQRYWTAG  189

Query  761   GMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNAC---VDHPE-------------RIQHH  892
             G  RNLPVG+G+RK+KN+A H+H +     Q      VD P+              +   
Sbjct  190   GTMRNLPVGSGKRKSKNAAVHHHSHIGVPSQGMIGNRVDVPQPGIYQVETAALSVSVTME  249

Query  893   ALKANGKVLTLAS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngad  1057
              LK N  V    S     +S+A+ LN+ ++      +N  ++  E G   +     N  +
Sbjct  250   VLKRNETVSKFDSEGPLCESMAAVLNLEDQ------MNSCHENSEEGSCTTSVTPSNCME  303

Query  1058  hssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQW------  1219
             +     +            NG+  M           LPCF    WP  +  + W      
Sbjct  304   NDPLKVASGMEKNHIQSYSNGVTHM---------SNLPCFPRLTWPC-TWPLGWNNMALV  353

Query  1220  ------SSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGP--  1375
                   S  V  P   SP +P+P+ P  M    ++ C    P+   P +   H SS P  
Sbjct  354   MTGQCSSELVHRPETGSP-YPVPWPPQVM--ASSLQCQPVIPFPFFPASHWGHMSSWPKD  410

Query  1376  ---------------------------NSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWV  1474
                                        N PTLGKHSRD  ++  E         EK LWV
Sbjct  411   TWNVTCVRPSCDLLSSSSISNNGCPSNNPPTLGKHSRDAISESVE-------KTEKTLWV  463

Query  1475  PKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDEN--SHASKNCRVLLE  1648
             PKTLR DDP++AAKSSIWATLGI   +     GG F+AF+ K D N  S A+K    +L 
Sbjct  464   PKTLRIDDPDEAAKSSIWATLGISPGKKIKRGGGIFEAFQSKSDNNQPSDATK----VLH  519

Query  1649  ANPAALSRSLNFHESS  1696
             ANPAA+SRS    ES+
Sbjct  520   ANPAAMSRSQTLQEST  535



>gb|AGV07544.1| Dof10 [Pinus pinaster]
Length=542

 Score =   227 bits (579),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 174/553 (31%), Positives = 248/553 (45%), Gaps = 82/553 (15%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP  KLFG TI   D       +   +      +   + A+ +  S+ + G++      
Sbjct  2     KDPGFKLFGKTIPMRDGEKNEGLSGSKLGHENTDNITETPARVAQVSDKDVGKEISPDLG  61

Query  428   ENGERMDESKEDEGTVLME--GEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGK  601
               G      +E     ++   GE    ++ +++     +  ++ D  S  +   +E+E K
Sbjct  62    REGPHNSNPEETRSVTVISDCGEDECKKSDEDLEREGGSTAIESDLKSENL---EEKEAK  118

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              S  ++K LKKPDK+LPCPRCDS+DTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  119   ASENEEKMLKKPDKLLPCPRCDSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVP  178

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLT--LASDSVASEL  952
             VGAGRRK K+S +HY H+        A  D P+   HH +  N    +  +   S    L
Sbjct  179   VGAGRRKNKHSTSHYRHMMMADGLATARADAPDAAAHHQVTPNAHSSSSRVLKGSQIQLL  238

Query  953   NIAEKTAGNGSLN---------GFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
              +  ++AG   LN              + L  Q                  +   +  D 
Sbjct  239   PLEVESAGGSILNFGPDFRLCESMSTGLNLADQTVVTRKAFKIKDDEKGPLMRGENRDDT  298

Query  1106  VCKNGLP---DMLKQNYH---------------GFAPQLPCFQAPPWPYP----------  1201
              C++      D+  +N+H                  PQ   +   PW Y           
Sbjct  299   SCESSTTTEKDVASKNFHTIPQMDQGSMVGWPSSVPPQQHYYGGAPWAYGWNFCWGGRSA  358

Query  1202  ---------------SSAVQW---SSAVPPPGCFSPGFPMPFYPPAMYLGYT--IPCSWN  1321
                            +SA  W   +S   PPG ++ G P PF P   +   T     +WN
Sbjct  359   TGCPSGIAYAAESGNTSAGPWNNGTSGAGPPGMWAAGIPWPFVPGPYWASPTGWGAGTWN  418

Query  1322  APW--VSRPVA------PQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVP  1477
              P+  V+ PV       P   ++    S TLGKHSRD         P  +  P+ CLWVP
Sbjct  419   MPFSTVASPVTGGLSSCPPSSSAGSSGSATLGKHSRD--------IPQSEDKPDGCLWVP  470

Query  1478  KTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             KT+R DDP++AA+SSIW TLGI +       GG FKAF+ K +E      + +  L +NP
Sbjct  471   KTIRIDDPDEAARSSIWTTLGIGNKPESITTGGIFKAFQPKTEEKDSVKASTQG-LRSNP  529

Query  1658  AALSRSLNFHESS  1696
             AA SRS+ F ES+
Sbjct  530   AAFSRSMAFQEST  542



>gb|KGN51929.1| hypothetical protein Csa_5G605720 [Cucumis sativus]
Length=432

 Score =   223 bits (569),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 172/496 (35%), Positives = 231/496 (47%), Gaps = 87/496 (18%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP IKLFG TI  P          +D+        + +  K++SC E       +++ N
Sbjct  7     RDPIIKLFGKTISLP-------LNHLDLPSDSKFPSSETTEKETSCEEL----GLEKRGN  55

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
              +G                     +Q  D+   G+    ++E   S+  ++ +EE+ + S
Sbjct  56    SSG---------------------NQITDQTTSGVSENPLEEREISSPKASKNEEQSETS  94

Query  608   NGKD-KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             N  D KT KKPDKILPCPRC+SMDTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  95    NSPDNKTSKKPDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  154

Query  785   GAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAE  964
             GAGRRK KNS++ +       F+   +      +H  L  NG  LT ASDS  S      
Sbjct  155   GAGRRKNKNSSSSH-------FRQLIIPDGGNHRHQFLDNNGTFLTFASDSSISNSQSCN  207

Query  965   KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQN  1144
                     NGF    E G   S     +    S+ S      +++  + KN  P      
Sbjct  208   P-------NGFLVNTENGDDHS---SKSSITASNSSEKGAKMASQQSIAKNVFP------  251

Query  1145  YHGFAPQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNA  1324
                F PQL  F     PY S     +          PG P+ +YP   Y GY  P S   
Sbjct  252   ---FLPQLQSFTGLSLPYSSIPPPSAPFY------PPGIPVSYYPSQPYWGYLAPPSLTL  302

Query  1325  PWVSRPVAPQHHTSSGPNSPTLGKHSRDD------NNKEGEPQPPKDSNPEKCLWVPKTL  1486
                   + P    SS  NS  LGK  RD       +N E E    ++   E CL +P+T+
Sbjct  303   ------INPNGQNSS-TNSCVLGKRLRDGKLVKSPSNTESEIGKQRNYE-ELCLGIPRTM  354

Query  1487  RFDDPEDAAKSSIWATLGIQHDR-------VDSIRGGA-FKAFKMKDDENSHASKNCRVL  1642
             + DDP +AAKS IW+TLGI++D+         +I GG+ F + +               L
Sbjct  355   KVDDPNEAAKSCIWSTLGIKNDKKAGGGSTSTTINGGSLFVSLQQSTKGKEETQIESWSL  414

Query  1643  LEANPAALSRSLNFHE  1690
             L+ANPAA SR+L F E
Sbjct  415   LQANPAAFSRALKFRE  430



>ref|XP_009399927.1| PREDICTED: cyclic dof factor 2-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   225 bits (573),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 197/550 (36%), Positives = 261/550 (47%), Gaps = 122/550 (22%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI            E    P    +E  ++   +  +EA+ G+ +  ++ 
Sbjct  5     KDPAIKLFGRTIP---------LPESLPPPPEEEAEQTAIPDATPATEADDGDPDASKEV  55

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHV-DEDCGSTEISTTDEEEGKM  604
              N E       +  T +   E   D     I  GL + +  D D  S E     + EG  
Sbjct  56    TNME------VNNITAVASSERNEDGPTCSI--GLNSSNENDHDKDSREEHNKSDAEG--  105

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
              + + K L+KPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG TRN+PV
Sbjct  106   -SAQAKVLRKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGTTRNVPV  164

Query  785   GAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKA-----------NGKVLTL  925
             GAGRRK+K+SA+      + S   Q+A ++  +   H  L             NG VL  
Sbjct  165   GAGRRKSKHSASQVRQIMLPSDGLQSAGLETSDLPHHLTLPCGFSAPTRPLIRNGTVLKF  224

Query  926   AS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaa  1090
              +     +S+AS LNI EK   NG ++        G   +                  ++
Sbjct  225   GTEVPLCESMASALNIREKNR-NGDISSILYGENEGPSCA------------------SS  265

Query  1091  sTKDDVCKNGL---PDMLKQN-YHGFA------PQLPCFQAPPWPYPSSAVQWSSAVPPP  1240
                 +  +NGL   P  ++QN   G+       PQ  C+   PW YP S   W++  P  
Sbjct  266   VNGSNFVENGLAGNPTQIEQNGMQGYCNGVTTMPQFSCYPVAPWAYPWSP-GWTNVAPIV  324

Query  1241  GCFSPGF----------PMPFYPPAMYLGYT----------IPCS------------WNA  1324
              C SP F          P+P+ PP M  G            +P S            WN 
Sbjct  325   RC-SPEFVQRPENGNPSPVPWNPPLMVGGPAFCPPSLPFPFMPASSWGCISSWPNGAWNV  383

Query  1325  PW------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTL  1486
             PW      + R  +  +  SSG  SPTLGKHSRD    +GE +        K LWVPKTL
Sbjct  384   PWLGFNSGIHRSSSTSNSGSSGNGSPTLGKHSRDA-TLQGEEK------TGKSLWVPKTL  436

Query  1487  RFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAAL  1666
             R DDP++AAKSSIWATLGI+ +       G F+  K K +  +  S     LL+ANPAAL
Sbjct  437   RIDDPDEAAKSSIWATLGIKPEV------GIFEPLKSKAESKARTSDAAH-LLQANPAAL  489

Query  1667  SRSLNFHESS  1696
             SRS +F ES+
Sbjct  490   SRSHSFQEST  499



>gb|AAM61191.1| H-protein promoter binding factor-2a [Arabidopsis thaliana]
Length=447

 Score =   223 bits (569),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 178/498 (36%), Positives = 252/498 (51%), Gaps = 73/498 (15%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             T+DP IKLFGM I FP         E D +   +  +      D S  +  P   ++   
Sbjct  5     TRDPAIKLFGMKIPFPSVFESAVTVEDDEEDDWSGGD------DKSPEKVTPELSDKNNN  58

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE-EEGK  601
             N N    + SK               +T+D+          +E   + +I +++  E+ +
Sbjct  59    NCNDNSFNNSKP--------------ETLDK----------EEATSTDQIESSETPEDNQ  94

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  95    QTTPDGKTLKKPTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  154

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS-------  937
             VGAGRRK K+S++HY H+   ++ + A +D         L+AN +VL+   ++       
Sbjct  155   VGAGRRKNKSSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGLEAHQQHVAP  207

Query  938   VASELNI-AEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
             +A  + +  ++   NG+ NGF+   +  + V+     +     S  ++    S  +   +
Sbjct  208   MAPVMKLQGDQKVSNGARNGFHGLADQRL-VARVENGDDCSSGSSVTTSNNHSVDESRAQ  266

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFPMPFYPPAMY  1291
             +G     + N +       C    PWPY      W+ A+ PP     PG+PMPFYP    
Sbjct  267   SGRIVEPQMNNNNNMNGYACIPGVPWPY-----TWNPAMPPPGFYPPPGYPMPFYP----  317

Query  1292  LGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEK---  1462
               +TIP    +P  S     Q    S  NSPTLGK SRD+ + +      +DS  E+   
Sbjct  318   -YWTIPMISPSPHQSSSPISQK--DSNTNSPTLGKRSRDEESSK------RDSETERKQR  368

Query  1463  --CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCR  1636
               C+ VPKTLR DDP +AAKSSIW TLGI+++ +    GG FK F  K    ++      
Sbjct  369   TGCILVPKTLRIDDPNEAAKSSIWTTLGIKNEAMCKA-GGMFKGFDHKTKMYNNDKAENS  427

Query  1637  VLLEANPAALSRSLNFHE  1690
              +L ANPAALSRS NFHE
Sbjct  428   PVLSANPAALSRSHNFHE  445



>ref|XP_010921318.1| PREDICTED: cyclic dof factor 2-like [Elaeis guineensis]
Length=530

 Score =   225 bits (574),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 194/575 (34%), Positives = 265/575 (46%), Gaps = 120/575 (21%)
 Frame = +2

Query  194   FAVILISQFSATVMPEPTKDPTIKLFGMTIQFPDAppppppT-----EMDVDPGGAASEA  358
              A I   +     M EP +DP IKLFG TI  P++ PPPPP      E          + 
Sbjct  2     VAGIWKRRLDGAEMSEP-RDPAIKLFGKTIPLPESLPPPPPAEAEDKEARPTDPAPPPDP  60

Query  359   NSLAKDSSCSEAEPGEDEQQQKNENGERMDESKEDE--GTVLMEGEGIMDQTVDEIRDGL  532
                 +  +C E      E +  N N +  +E  + +   + L  G G          D  
Sbjct  61    AEDGEKDTCKE----NTEMEVNNPNPDVPEEVNQCDPHNSGLHNGNG----------DDN  106

Query  533   KAPHVDEDCGSTEISTTDEEEGKM-SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNT  709
             + P+ DE   +   +  + ++ +  S+G++K LKKPDK+LPCPRC+SMDTKFCY+NNYN 
Sbjct  107   EGPNQDEKVATDSKAEHEHDKTEADSSGQEKVLKKPDKVLPCPRCNSMDTKFCYYNNYNV  166

Query  710   NQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERI  883
             NQPRHFCK CQRYWT+GG  RN+PVGAGRRK K+SA+HY   + +     +  V  P+  
Sbjct  167   NQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHSASHYRHIMMSSDGLASGRVVAPDLT  226

Query  884   QHHAL-----------KANGKVLTLA-----SDSVASELNIAEKTAGNGSLNGFYKPVEL  1015
              H AL           K NG VL         +S+AS LN+ E+           K  + 
Sbjct  227   PHQALPCGPSVSMRPMKGNGSVLKFGPEVPLCESMASGLNLEEQK----------KNPDF  276

Query  1016  GIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD----MLKQNYHGFA------PQ  1165
             G   S          +    S  ++ T  +  +NG P+    M +    G+       P 
Sbjct  277   GSIAS--------GENKEDPSCASSVTASNCVENGFPENAVPMEQNGTQGYCNGLTPMPH  328

Query  1166  LPCFQAPPWPYP----------SSAVQWSS--------------------AVPPPGCFSP  1255
             L C+   PW YP           +A + SS                     +  P   +P
Sbjct  329   LQCYPGAPWAYPWGPGWNNVAAMAASRCSSELVYGPENGTPSPIPWSPPSMMAAPAFCAP  388

Query  1256  GFPMPFYPPAMY--LGYTIPCSWNAPWVSRPVAPQHHTSSGP------NSPTLGKHSRDD  1411
               P PF P + +  +      +WN  W+         +S+         SPTLGKHSRD 
Sbjct  389   TIPFPFMPASFWGCMSSWPNGAWNVTWLGSNGGISSSSSTSNSGCSGNGSPTLGKHSRDA  448

Query  1412  NNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF  1591
             + +  E         EK LWVPKTLR DDP++AAKSSIWATLGI+ +      GG FK F
Sbjct  449   SLQGEEKM-------EKSLWVPKTLRIDDPDEAAKSSIWATLGIKPE-----EGGIFKPF  496

Query  1592  KMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + K +     S   +V L ANPAA SRS +F ES+
Sbjct  497   QSKAESKDQRSDAAQV-LHANPAAFSRSRSFQEST  530



>ref|NP_190334.1| cyclic DOF factor 3 [Arabidopsis thaliana]
 sp|Q8LFV3.2|CDF3_ARATH RecName: Full=Cyclic dof factor 3; AltName: Full=Dof zinc finger 
protein DOF3.3; Short=AtDOF3.3; AltName: Full=H-protein 
promoter-binding factor 2a [Arabidopsis thaliana]
 gb|AAC28390.1| H-protein promoter binding factor-2a [Arabidopsis thaliana]
 emb|CAB61976.1| H-protein promoter binding factor-2a [Arabidopsis thaliana]
 gb|AAL38328.1| H-protein promoter binding factor-2a [Arabidopsis thaliana]
 gb|AAM91157.1| H-protein promoter binding factor-2a [Arabidopsis thaliana]
 gb|AEE78290.1| cyclic DOF factor 3 [Arabidopsis thaliana]
Length=448

 Score =   222 bits (566),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 183/509 (36%), Positives = 254/509 (50%), Gaps = 94/509 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             T+DP IKLFGM I FP         E D +   +  +      D S  +  P   ++   
Sbjct  5     TRDPAIKLFGMKIPFPSVFESAVTVEDDEEDDWSGGD------DKSPEKVTPELSDKNNN  58

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDE-EEGK  601
             N N    + SK               +T+D+          +E   + +I ++D  E+ +
Sbjct  59    NCNDNSFNNSKP--------------ETLDK----------EEATSTDQIESSDTPEDNQ  94

Query  602   MSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLP  781
              +    KTLKKP KILPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+P
Sbjct  95    QTTPDGKTLKKPTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVP  154

Query  782   VGAGRRKTKNSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDS----VAS  946
             VGAGRRK K+S++HY H+   ++ + A +D         L+AN +VL+   ++    VA+
Sbjct  155   VGAGRRKNKSSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGLEAQQQHVAA  207

Query  947   ELNIAEKT-----AGNGSLNGFY--------KPVELGIQVSYgagdngadhssgsssvta  1087
              +    K        NG+ N F+          VE G   S G+    +++ S   S   
Sbjct  208   PMTPVMKLQEDQKVSNGARNRFHGLADQRLVARVENGDDCSSGSSVTTSNNHSVDESRAQ  267

Query  1088  asTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGFP  1264
             + +   V +  + +    N +G+A    C    PWPY      W+ A+ PP     PG+P
Sbjct  268   SGS---VVEAQMNNNNNNNMNGYA----CIPGVPWPY-----TWNPAMPPPGFYPPPGYP  315

Query  1265  MPFYPPAMYLGYTIPCSWNAPWV--SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQP  1438
             MPFYP            W  P +   +  +P     S  NSPTLGKH RD+ + +     
Sbjct  316   MPFYP-----------YWTIPMLPPHQSSSPISQKCSNTNSPTLGKHPRDEGSSK-----  359

Query  1439  PKDSNPEK-----CLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKD  1603
              KD+  E+     C+ VPKTLR DDP +AAKSSIW TLGI+++ +    GG FK F  K 
Sbjct  360   -KDNETERKQKAGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNEAM-CKAGGMFKGFDHKT  417

Query  1604  DENSHASKNCRVLLEANPAALSRSLNFHE  1690
                ++       +L ANPAALSRS NFHE
Sbjct  418   KMYNNDKAENSPVLSANPAALSRSHNFHE  446



>ref|XP_006658977.1| PREDICTED: cyclic dof factor 1-like [Oryza brachyantha]
Length=473

 Score =   223 bits (567),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 159/436 (36%), Positives = 214/436 (49%), Gaps = 77/436 (18%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             + P  DE  GS   S   + EG  S+G +K LKKPDKILPCPRC+SMDTKFCY+NNYN N
Sbjct  67    QTPSNDEMAGSESKSEAAKTEGDGSSG-EKVLKKPDKILPCPRCNSMDTKFCYYNNYNIN  125

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHH  892
             QPRHFCK CQRYWT+GG  RN+PVGAGRRK+K+S A+     +     A       +   
Sbjct  126   QPRHFCKSCQRYWTAGGSMRNIPVGAGRRKSKSSTANCRSILIPGSSLAAPAGDASVYQV  185

Query  893   ALKANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
             ++  N K         A+ +     +    S+    K  E G      + +     +  +
Sbjct  186   SINGNQK---------ATSVKFGPDSPLCNSMTSVLKIGEQGKNAKPTSTEEPETQTCKA  236

Query  1073  ssvtaasTKDDVC---KNGLPDMLKQNYHGFAPQ--LPCFQAPPWPYP------------  1201
              + T+ S +++     +NGL       + G  P   +PCF  PP+ YP            
Sbjct  237   PATTSDSPRNETVSGHQNGL-----VGHSGVTPMHPIPCFPGPPFVYPWTPGWNGIPAMA  291

Query  1202  ------------------SSAVQWS--SAVPPPGCFSPGFPMPFYPPAMYLGYT--IPCS  1315
                               +  VQWS    +P PG   P  P P  P +++  ++     +
Sbjct  292   APVCPAPTDPANSSDGGSTGNVQWSMPPVMPVPGYCGPPIPFPVMPSSVWPFFSPWPNGA  351

Query  1316  WNAPWV--------SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLW  1471
             W++PW+        S P +     S    SP LGKHSRD        +P  D   EK LW
Sbjct  352   WSSPWLGPSCSVPASSPTSTSTACSDNNGSPVLGKHSRDS-------KPQGDDKVEKNLW  404

Query  1472  VPKTLRFDDPEDAAKSSIWATLGIQ-HDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLE  1648
             +PKTLR DDP++AAKSSIW TLGI+  DR      G F+ F+ K       S   RV L+
Sbjct  405   IPKTLRIDDPDEAAKSSIWTTLGIEPGDR------GMFRPFQSKAGTREQISGAARV-LQ  457

Query  1649  ANPAALSRSLNFHESS  1696
             ANPAALSRS +F E++
Sbjct  458   ANPAALSRSHSFQETT  473



>ref|XP_009416342.1| PREDICTED: cyclic dof factor 3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   223 bits (568),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 202/546 (37%), Positives = 258/546 (47%), Gaps = 101/546 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
              KDP IKLFG TI    A   PP     VD     ++A S A  +       G+ +  ++
Sbjct  4     VKDPAIKLFGATIPV-AAAALPPAEADAVDVEDEEADAESAASTAM------GQKDTTKE  56

Query  425   NENGERMDESK---EDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEE  595
               N E  D+S    ++E  V       +  T +   D  K    DE   ST+    D + 
Sbjct  57    MTNMEVNDDSATAPDEENEVAPISSSRLTGTNE---DDNKTSIADEK-ESTKHKAEDTKT  112

Query  596   GKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRN  775
                 +  +K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN
Sbjct  113   EADCSVPEKVLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRN  172

Query  776   LPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALK-----------ANGKV  916
             +PVGAGRRK+K+SA+      + S   Q+A +D      H AL             NG V
Sbjct  173   VPVGAGRRKSKHSASQCRNLVIPSDGLQSAQLDALNLTHHRALPCVPSTPSQPPIGNGTV  232

Query  917   LTLAS-----DSVASELNIAE--KTAGNGSLNGFYKPVELGIQVSYgagdngadhssgss  1075
             L         +S+ S LNI E  K + +GS+    K  E     S  A +   + S+ + 
Sbjct  233   LKFGQEVPLCESMVSVLNIQEQGKDSDSGSMIHGEKREEPSCASSATASNFVENGSAKTV  292

Query  1076  svtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYP------------------  1201
                  S     C NGL  +         P L C+   PW YP                  
Sbjct  293   VHVEQSGMQVYC-NGLAPL---------PHLQCYPGAPWAYPWRPAWNNVAVMEAGKCSS  342

Query  1202  ----------SSAVQWS---SAVPPPGCFSPGFPMPFYPPAMYLGYTI--PCSWNAPWV-  1333
                       SS V WS       PP C +   P PF  PA + G+T     +WN P V 
Sbjct  343   EYICRPGNANSSPVPWSPRAIMAAPPVCAA-AHPFPFM-PAPFWGFTTWPNGAWNLPCVG  400

Query  1334  -----SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
                  S   +  +   SG  SPTLGKHSRD + +  E         EK LWVPKTLR DD
Sbjct  401   SSGCISPSSSTSNSNCSGNGSPTLGKHSRDASLQSEEKM-------EKSLWVPKTLRIDD  453

Query  1499  PEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
             PE+AAKSSIWATLGI+ D      GG F++      + S A++    +L ANPAA+SRS 
Sbjct  454   PEEAAKSSIWATLGIKPD-----IGGIFQSKAESKVDESDAAQ----VLHANPAAVSRSH  504

Query  1679  NFHESS  1696
             +F ES+
Sbjct  505   SFQEST  510



>ref|XP_004967772.1| PREDICTED: cyclic dof factor 2-like isoform X2 [Setaria italica]
Length=560

 Score =   224 bits (571),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 212/585 (36%), Positives = 275/585 (47%), Gaps = 131/585 (22%)
 Frame = +2

Query  248   KDPTIKLFGMTIQF-PDAppppppTE---------MDVDPGGAASEANSLAKDSSCSEAE  397
             KDP IKLFG  I   P+  P    TE          ++ P     EA ++A +   +E E
Sbjct  5     KDPGIKLFGRVIPLAPEPAPEATETEDPLGHDQPPEELQPRAPEEEAAAVADEGQHNEKE  64

Query  398   PGEDEQQQKN---ENGERM--DESKEDEGTVL--------MEGEGIMDQTVDEIRDGLK-  535
               ED + + +   E G  M  D  +E++G  +         +GE  +D   ++  + +K 
Sbjct  65    DTEDSEMEVDTPQEKGSEMKIDTPQEEKGNEMKFDASKKEQDGEMKVDAQQEKKDEQMKV  124

Query  536   -AP---------------HVDEDCG---STEISTTDEEEGKMS-----NGKDKTLKKPDK  643
              AP               H  ED G   STE     + +G+       +G+DKTLKKPDK
Sbjct  125   DAPPRAENIQPGTSPRSDHKKEDQGQMNSTEDKAASDPKGESEKANDESGQDKTLKKPDK  184

Query  644   ILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAH  823
             ILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK+KN+  H
Sbjct  185   ILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNAPLH  244

Query  824   YH--LNAVKSFQNACVDHPERIQHHALKA-----------NGKVLTLAS-----DSVASE  949
             Y   L A      + VD  + +   AL +           N  VL         +S+ S 
Sbjct  245   YRQLLMAPDCMLGSRVDISKSVLPEALVSPPSAPVQPTSRNETVLKFGPEVPLCESLVSA  304

Query  950   LNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPD  1129
             LNI E+ A N            G        ++ +  S+ +S          V KNG P 
Sbjct  305   LNIDEQNAKNP-----------GSAPRGENREDNSCASAVTSYNGLPENTVHVDKNGAPV  353

Query  1130  MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS---AVP------------------PPGC  1246
                   +G AP    +   P+ YP S V W++    VP                   P  
Sbjct  354   YC----NGVAPVPQYYLGTPFMYPWS-VGWNNLPVMVPGKSMPEAASASESCSTSSAPWM  408

Query  1247  FSPGFP--------MPFYPPAMY--LGYTIPCSWNAPWVS-----RPVAPQHHTSSGPNS  1381
              SP  P         P  PPA++  L      +WN PWV       P +  + + SG  S
Sbjct  409   TSPMMPASTSPAFPYPLVPPALWGCLSGWPATTWNIPWVRTNGCVSPSSSSNSSCSGNGS  468

Query  1382  PTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVD  1561
             PTLGKHSRD N       P KD   EK LWVPKTLR DDP++AAKSSIWATLGI+     
Sbjct  469   PTLGKHSRDSN-------PLKDEKQEKSLWVPKTLRIDDPDEAAKSSIWATLGIKPGDP-  520

Query  1562  SIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                 G FK F+ K +     +   +V L+ANPAALSRS +F ESS
Sbjct  521   ----GTFKPFQSKVESKGQKADAAQV-LQANPAALSRSQSFQESS  560



>ref|XP_004967771.1| PREDICTED: cyclic dof factor 2-like isoform X1 [Setaria italica]
Length=584

 Score =   224 bits (571),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 214/425 (50%), Gaps = 83/425 (20%)
 Frame = +2

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             + E+    +G+DKTLKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  189   ESEKANDESGQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  248

Query  764   MTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHALKA-----------  904
               RN+PVGAGRRK+KN+  HY   L A      + VD  + +   AL +           
Sbjct  249   TMRNVPVGAGRRKSKNAPLHYRQLLMAPDCMLGSRVDISKSVLPEALVSPPSAPVQPTSR  308

Query  905   NGKVLTLAS-----DSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssg  1069
             N  VL         +S+ S LNI E+ A N            G        ++ +  S+ 
Sbjct  309   NETVLKFGPEVPLCESLVSALNIDEQNAKNP-----------GSAPRGENREDNSCASAV  357

Query  1070  sssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS---AVP--  1234
             +S          V KNG P       +G AP    +   P+ YP S V W++    VP  
Sbjct  358   TSYNGLPENTVHVDKNGAPVYC----NGVAPVPQYYLGTPFMYPWS-VGWNNLPVMVPGK  412

Query  1235  ----------------PPGCFSPGFP--------MPFYPPAMY--LGYTIPCSWNAPWVS  1336
                              P   SP  P         P  PPA++  L      +WN PWV 
Sbjct  413   SMPEAASASESCSTSSAPWMTSPMMPASTSPAFPYPLVPPALWGCLSGWPATTWNIPWVR  472

Query  1337  -----RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDP  1501
                   P +  + + SG  SPTLGKHSRD N       P KD   EK LWVPKTLR DDP
Sbjct  473   TNGCVSPSSSSNSSCSGNGSPTLGKHSRDSN-------PLKDEKQEKSLWVPKTLRIDDP  525

Query  1502  EDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLN  1681
             ++AAKSSIWATLGI+         G FK F+ K +     +   +V L+ANPAALSRS +
Sbjct  526   DEAAKSSIWATLGIKPGDP-----GTFKPFQSKVESKGQKADAAQV-LQANPAALSRSQS  579

Query  1682  FHESS  1696
             F ESS
Sbjct  580   FQESS  584



>gb|EEC82706.1| hypothetical protein OsI_27376 [Oryza sativa Indica Group]
Length=476

 Score =   221 bits (562),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 167/432 (39%), Positives = 219/432 (51%), Gaps = 70/432 (16%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             + P  DE  GS   S   + EG  S+ ++K LKKPDKILPCPRC+SMDTKFCY+NNYN N
Sbjct  71    QTPSNDEMTGSESKSEAAQTEGGGSS-EEKVLKKPDKILPCPRCNSMDTKFCYYNNYNIN  129

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHH  892
             QPRHFCK CQRYWT+GG  RNLPVGAGRRK+K+S A+Y    +     A       +   
Sbjct  130   QPRHFCKSCQRYWTAGGSMRNLPVGAGRRKSKSSTANYRSILITGSNLAAPAGDAPLYQL  189

Query  893   ALKAN--GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdng  1051
             ++K +     +  A D     S+AS L I E++  N       +P     Q    +G   
Sbjct  190   SIKGDQTATAVKFAPDSPLCNSMASVLKIGEQSK-NAKPTSTAQPRNGETQTCPASGTTS  248

Query  1052  adhssgsssvtaasTKDDVC-KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-  1225
                 +   +V  +  ++ +   +G+P M           +PCF  PP+ YP S   W+  
Sbjct  249   DSPRNEPVNVAVSGHQNGIVGHSGVPPMHP---------IPCFPGPPFVYPWSPA-WNGI  298

Query  1226  -AVPPPGCFSPGFPMP------------FYPPAMYL-GY--TIPCS------------WN  1321
              A+ PP C +P  P                PP M + GY   IP S            W+
Sbjct  299   PAMAPPVCTAPAEPANSSDNGSTASVQWSMPPVMPVPGYFPVIPSSVWPFISPWPNGAWS  358

Query  1322  APWV------SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKT  1483
             +PW+      S        T S   SP LGKHSRD        +P  D   EK LW+PKT
Sbjct  359   SPWIQPNCSVSASSPTSTSTCSDNGSPVLGKHSRDS-------KPQGDDKAEKNLWIPKT  411

Query  1484  LRFDDPEDAAKSSIWATLGIQ-HDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPA  1660
             LR DDP++AAKSSIW TLGI+  DR        F++F+ K +     S   RV L+ANPA
Sbjct  412   LRIDDPDEAAKSSIWTTLGIEPGDR------SMFRSFQSKPESREQISGAARV-LQANPA  464

Query  1661  ALSRSLNFHESS  1696
             ALSRS +F E++
Sbjct  465   ALSRSQSFQETT  476



>ref|NP_001060673.1| Os07g0685000 [Oryza sativa Japonica Group]
 gb|AAO72549.1| AOBP-like protein [Oryza sativa Japonica Group]
 dbj|BAC83814.1| putative ascorbate oxidase promoter-binding protein AOBP [Oryza 
sativa Japonica Group]
 dbj|BAF22587.1| Os07g0685000 [Oryza sativa Japonica Group]
 dbj|BAG96409.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67837.1| hypothetical protein OsJ_25624 [Oryza sativa Japonica Group]
Length=476

 Score =   221 bits (562),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 166/432 (38%), Positives = 218/432 (50%), Gaps = 70/432 (16%)
 Frame = +2

Query  533   KAPHVDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTN  712
             + P  DE  GS   S   + EG  S+ ++K LKKPDKILPCPRC+SMDTKFCY+NNYN N
Sbjct  71    QTPSNDEMTGSESKSEAAQTEGGGSS-EEKVLKKPDKILPCPRCNSMDTKFCYYNNYNIN  129

Query  713   QPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHH  892
             QPRHFCK CQRYWT+GG  RNLPVGAGRRK+K+S A+Y    +     A       +   
Sbjct  130   QPRHFCKSCQRYWTAGGSMRNLPVGAGRRKSKSSTANYRSILITGSNLAAPAGDAPLYQL  189

Query  893   ALKAN--GKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdng  1051
             ++K +     +  A D     S+AS L I E++  N       +P     Q    +G   
Sbjct  190   SIKGDQTATAVKFAPDSPLCNSMASVLKIGEQSK-NAKPTSTAQPRNGETQTCPASGTTS  248

Query  1052  adhssgsssvtaasTKDDVC-KNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS-  1225
                 +   +   +  ++ +   +G+P M           +PCF  PP+ YP S   W+  
Sbjct  249   DSPRNEPVNGAVSGHQNGIVGHSGVPPMHP---------IPCFPGPPFVYPWSPA-WNGI  298

Query  1226  -AVPPPGCFSPGFPMP------------FYPPAMYL-GY--TIPCS------------WN  1321
              A+ PP C +P  P                PP M + GY   IP S            W+
Sbjct  299   PAMAPPVCTAPAEPANSSDNGSTASVQWSMPPVMPVPGYFPVIPSSVWPFISPWPNGAWS  358

Query  1322  APWV------SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKT  1483
             +PW+      S        T S   SP LGKHSRD        +P  D   EK LW+PKT
Sbjct  359   SPWIQPNCSVSASSPTSTSTCSDNGSPVLGKHSRDS-------KPQGDDKAEKNLWIPKT  411

Query  1484  LRFDDPEDAAKSSIWATLGIQ-HDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPA  1660
             LR DDP++AAKSSIW TLGI+  DR        F++F+ K +     S   RV L+ANPA
Sbjct  412   LRIDDPDEAAKSSIWTTLGIEPGDR------SMFRSFQSKPESREQISGAARV-LQANPA  464

Query  1661  ALSRSLNFHESS  1696
             ALSRS +F E++
Sbjct  465   ALSRSQSFQETT  476



>ref|XP_010503351.1| PREDICTED: cyclic dof factor 3-like [Camelina sativa]
Length=458

 Score =   219 bits (559),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 180/507 (36%), Positives = 258/507 (51%), Gaps = 80/507 (16%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVD----PGGAASEANSLAKDSSCSEAEPGEDE  412
             ++DP IKLFG  I FP     P   + + +     GG   E  S+    +   +    D 
Sbjct  5     SRDPAIKLFGTKIPFPAVVQLPVTVDEEEEEDDWSGGDGGEDKSVYNKVTPELS----DN  60

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
             ++ KN N   ++ S E +            +T D+          +E+  + +I  +D  
Sbjct  61    KKNKNCNDRSLNSSNESK-----------PETGDK----------EEETSTDQIENSDSP  99

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             E + +    KTLKKP KILPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  100   E-EQTTADGKTLKKPTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMR  158

Query  773   NLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV--  940
             N+PVGAGRRK K +S++HY H+   ++ +   +D         L+AN +VL+   D+   
Sbjct  159   NVPVGAGRRKNKSSSSSHYRHITITEALEATRLD-------PGLQANTRVLSFGLDARQQ  211

Query  941   -ASELNIAEKTAG-----NGSLNGFYKPVE---LGIQVSYgagdngadhssgsssvtaas  1093
              A+ +    K  G     NG+ NGF+   +   +  +V  G   +     + S++ +   
Sbjct  212   HAAPMTPVMKLQGNQKVLNGAQNGFHGVPDQRLVARRVENGDDCSSGSSVTTSNNHSVDE  271

Query  1094  TKDDVCKNGLPD---MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGCFSPGF  1261
             ++   C+   P        + +G+A    C    PWPY      W+ A+ PP     PG+
Sbjct  272   SRAQSCRVVEPQMNNNNNNSMNGYA----CIPGVPWPY-----TWNPAMPPPGFYPPPGY  322

Query  1262  PMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQ  1435
             PMPFYP            W  P +S  +  +P     S  NSPTLGKH RD+ +   + +
Sbjct  323   PMPFYP-----------YWTIPMLSPHQTSSPMSQKGSNTNSPTLGKHPRDEESARLDNE  371

Query  1436  PPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF--KMKDDE  1609
               +      C+ VPKTLR DDP +AAKSSIW TLGI+++R+ S  GG F+ F  K K ++
Sbjct  372   TERKQR-NGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNERM-SKGGGMFEGFDHKAKMNK  429

Query  1610  NSHASKNCRVLLEANPAALSRSLNFHE  1690
             N+        +  ANPAALSRS NFHE
Sbjct  430   NNDNKVENSPVRSANPAALSRSHNFHE  456



>ref|XP_002275127.1| PREDICTED: cyclic dof factor 3-like [Vitis vinifera]
Length=494

 Score =   220 bits (560),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 182/542 (34%), Positives = 251/542 (46%), Gaps = 114/542 (21%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             ++DP IKLFG TIQ           +  +D   A SE      +  C+E           
Sbjct  9     SRDPAIKLFGTTIQ---TQICSNSPQKSLD---APSEITKAEAEDPCAE-----------  51

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
                     +S++ +G+ + E +G  +Q       GL+   V +D G T            
Sbjct  52    --------DSRKPDGSSVSE-DGKEEQQTQVQMSGLQ---VHKDQGETN-----------  88

Query  605   SNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPV  784
             S+ ++K LKKPDKILPCPRC+S++TKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+PV
Sbjct  89    SSAQEKVLKKPDKILPCPRCNSLETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPV  148

Query  785   GAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAE  964
             GAGRRK K+ A+ Y    V S        P  +   +  +N ++L+    S     + A 
Sbjct  149   GAGRRKNKHLASQYRQIMVSSD-----GVPTTVIEASDSSNQQILSCGETSTTFRPSTAS  203

Query  965   KTAGN-GSLNGFYKPVELGIQVSYgagdngadhs------sgsssvtaasTKDDVCKNGL  1123
              T    G      K +E  + +                     SS  ++ +     +N  
Sbjct  204   GTVLKFGPEAPLCKSMETVLSIREQKRCAEMRTVNCGGNGEEPSSCASSVSAPSFPENEF  263

Query  1124  PD--------MLKQNYHGFAPQL--PCFQAPPWPYP------------------------  1201
             P+         L  +     PQL  PC+  PPW +P                        
Sbjct  264   PENVGHKDRPSLPASRSEIHPQLHQPCYPVPPWAFPWNPGWTNVAPVAPPQCSSDTVYAP  323

Query  1202  ----SSAVQWSS--AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQH--  1357
                  ++VQW S   +  PG  +P  P+   PP+ +    I   W A   +  +A  +  
Sbjct  324   NNSNPNSVQWCSRPMLAVPGFCAPTIPLQLVPPSYWGCMPI---WGAGTGNISLAGSNDC  380

Query  1358  --------HTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAA  1513
                     ++ SG  SPTLGKHSRD        QP ++   EKC+ VPKTLR  DP++A+
Sbjct  381   LSPSSSTSNSCSGNASPTLGKHSRDA-------QPAEEQKLEKCVLVPKTLRIIDPDEAS  433

Query  1514  KSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             KSSIWATLGI+ D+   I +GG FKAF+ K    +  S   +V LEANPAALSRS  F E
Sbjct  434   KSSIWATLGIKPDQKAPISKGGIFKAFEPKSGAKTDLSDATQV-LEANPAALSRSQTFKE  492

Query  1691  SS  1696
             S+
Sbjct  493   ST  494



>ref|XP_009406839.1| PREDICTED: cyclic dof factor 1-like [Musa acuminata subsp. malaccensis]
Length=464

 Score =   219 bits (557),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 185/521 (36%), Positives = 243/521 (47%), Gaps = 99/521 (19%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             KDP IKLFG TI                     AS    +A D+  SE E  + E     
Sbjct  5     KDPAIKLFGTTIPV------------------VASSPTRIA-DAEDSEVEAADTEPVVSA  45

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDE-------IRDGLKAPHVDEDCGSTEISTTD  586
               G++       EG   +E + ++    DE          GL + H DE   ++      
Sbjct  46    AEGQK----DASEGVTNVEVDNVLATETDEEDEGAPISSSGLTSSHKDEVNKTSIADEKI  101

Query  587   EEEGKMSNGK--------DKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQ  742
              E+GK  + K        +K LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQ
Sbjct  102   AEKGKSEDTKTETDCSTQEKVLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQ  161

Query  743   RYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAV---KSFQNACVDHPERIQHHALKANGK  913
             RYWT+GG  RN+PVGAGRRK+K+S A    + V      Q+   D P    H       +
Sbjct  162   RYWTAGGTMRNVPVGAGRRKSKHSVALQCRSLVIPSTGLQSTQPDTPNSTHHQ------R  215

Query  914   VLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQV-SYgagdngadhssgsssvtaa  1090
              L     S A  L       GNG++  F + V L   V S          ++ S S    
Sbjct  216   ALPCVPTSPAGPL------IGNGTVLRFGQEVPLCESVASVLGIRGEQGETADSGSTIRG  269

Query  1091  sTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYP-------SSAVQWSSAVPPPG--  1243
               +++ C+    DM + +      Q+ C     W YP        +A++  S  P  G  
Sbjct  270   DNREEPCR-ASSDMERSSV-----QVHCNGLATWAYPWRPTWNDVAAMEAHSCRPENGDW  323

Query  1244  ---------CFSPGFPMPFYPPAMYLGYTIPCSW-NAPWVSRPVAPQHHTSSGPNSPTLG  1393
                        +   P P    A + G+T   +W N  W     +  +   SG +SPTLG
Sbjct  324   RSVPWGAGAVMAATLPFPLM-AAPFWGFT---AWPNGTW--NVSSTSNRGCSGNDSPTLG  377

Query  1394  KHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG  1573
             KHSR D+N E E +       EK LWVPKTLR DDPE+AAKSSIW  LGI+ D      G
Sbjct  378   KHSR-DSNLESEAE-----TMEKSLWVPKTLRIDDPEEAAKSSIWTALGIKPD-----MG  426

Query  1574  GAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             G    F+ K ++ ++ S   R+ L ANPAALSR  +F ES+
Sbjct  427   GII--FQSKAEKRANKSDVARI-LHANPAALSRFESFQEST  464



>ref|XP_011047035.1| PREDICTED: cyclic dof factor 3-like [Populus euphratica]
 ref|XP_011047036.1| PREDICTED: cyclic dof factor 3-like [Populus euphratica]
Length=494

 Score =   218 bits (556),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 253/540 (47%), Gaps = 108/540 (20%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP  KLFG  I  PD       T+   +P         LAK  SCSE    E +    
Sbjct  5     SKDPAFKLFGRKIPVPD-------TQFPAEP---------LAK-GSCSEIARVETK----  43

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
                G   D S+E E   +  G G   Q  +E +  ++   V+E     ++    +E    
Sbjct  44    ---GPSEDSSEEPE---MFSGSG---QGKEESQAAMR---VNE----AQVIAKPKEGPLE  87

Query  605   SNGKD--KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +NG D  K LKKPDKILPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  88    TNGTDQEKVLKKPDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGSMRNV  147

Query  779   PVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKANGKVLTLASDSVASEL  952
             P+GAGRRK K+ A  Y    V S     A +++ + I H  L+++ +  T+ S SVA+ +
Sbjct  148   PIGAGRRKNKHLATQYRQILVSSDGMPIARMENSDSISHQ-LQSSVESGTILSPSVANGM  206

Query  953   NIAEKTAGNGSL-NGFYKPVELGIQVSYgagdngadhssgsssvt--aasTKDDVCKNGL  1123
              +  K      L +     + LG Q  Y    +     +     +  ++ T  +   N L
Sbjct  207   VL--KFGHEAPLCDSMENVLNLGDQKRYVEISSVNHQDNVEEPSSCGSSKTASNAWANEL  264

Query  1124  PDMLKQNYHGFAP----------QLPCFQAPPWPYP----------SSAVQWSSA-----  1228
              + + Q      P           LPC+  P W +P           +A Q S+      
Sbjct  265   RENVMQKEQVDVPVSSNELSSPNSLPCYSVPSWVFPWNPGWNNVASMTAAQHSTGQACVT  324

Query  1229  -------------VPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNA-----------PWVS  1336
                          +  P    P  P+ F  PA Y G  +P SW A             +S
Sbjct  325   NTPNQVQLCPTPMLAVPSICPPNIPLQFV-PASYWG-CMP-SWTAGTRNVSLSGSNGCLS  381

Query  1337  RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAK  1516
                +      SG  SPTLGKHSRD    E E         EKC+ VPKTLR DDP +A+K
Sbjct  382   LSTSTNTSCCSGNGSPTLGKHSRDSKFMEEE-------KAEKCILVPKTLRIDDPSEASK  434

Query  1517  SSIWATLGIQHDRVD-SIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             S +WA LG++ D+ D + +G  FK F+ K +   H S    V +EANPAALSRS  F ES
Sbjct  435   SPLWAALGLKPDQKDPASKGTIFKNFETKAECYRHVSDITHV-MEANPAALSRSHTFQES  493



>ref|NP_001143209.1| uncharacterized protein LOC100275712 [Zea mays]
 gb|ACG29745.1| hypothetical protein [Zea mays]
Length=556

 Score =   219 bits (559),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 203/581 (35%), Positives = 263/581 (45%), Gaps = 127/581 (22%)
 Frame = +2

Query  248   KDPTIKLFGMTIQF-PDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             KDP IKLFG  I + P+  P     E   DP     +  +    ++  E E  E E++  
Sbjct  5     KDPGIKLFGRVIPWGPETAPGTTEVE---DPPQDELQPRAPEVAAAVDEDEHNEKEEKNA  61

Query  425   NE---------NGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVD---------  550
             NE            ++D  +E++G   ME +    +  DE++   +    D         
Sbjct  62    NEVVVMPQEKGKETKVDTPQEEKGNE-MEVDAPQKEHDDEMKIDAQREEKDEQTDANASP  120

Query  551   -------------------EDCGSTEISTTDEEEGKMSNGKDKTL-KKPDKILPCPRCDS  670
                                ED  +++    +E+     +G+DK L KKPDKILPCPRC+S
Sbjct  121   THGNIEPANLPPSGLMDSAEDKAASDAKGENEKTSNEESGQDKALNKKPDKILPCPRCNS  180

Query  671   MDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVK  844
             MDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK+KN++ HY   L A  
Sbjct  181   MDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNASLHYRQLLMAPD  240

Query  845   SFQNACVDHPERIQHHALKA-----------NGKVLTLAS-----DSVASELNIAEKTAG  976
                   VD  + +   AL +           NG VL         +S+ S LNI E+   
Sbjct  241   CMLGPRVDISKPVLPEALASSPPAPTQPASRNGTVLKFGPEVPFCESMVSALNIDEQ---  297

Query  977   NGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGF  1156
               ++N    P   G                     T A     V KNG P     + +G 
Sbjct  298   --NVNSPGGPTARGENREDNNNPGSGTPPYNGVPETMAPV---VGKNGAP----VHCNGV  348

Query  1157  APQLPCFQAPPWPYPSSAVQW------------------------SSAV---PP--PGCF  1249
             AP    +   P+ YP S V W                        SSAV   PP  PG  
Sbjct  349   APVPQYYLGTPFMYPWS-VGWSNVPVMVPGKSMPEPAPAPESCSTSSAVWMNPPMMPGSR  407

Query  1250  --SPGFPMPFYPPAMYLGYT--IPCSWNAPWV--------SRPVAPQHHTSSGPNSPTLG  1393
               SP FP P  PP ++  ++   P +WN PW             +    + SG  SPTLG
Sbjct  408   PPSPAFPYPLVPPGLWGCFSGWPPTAWNVPWTRTNVSVSPPPSPSSNSSSCSGNGSPTLG  467

Query  1394  KHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRG  1573
             KHSRD N       P ++   EK LWVPKTLR DDP+DAAKSSIWATLGI+        G
Sbjct  468   KHSRDTN-------PLREEKREKSLWVPKTLRIDDPDDAAKSSIWATLGIKPGDP----G  516

Query  1574  GAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                K F+ K +     S   +V L+ANPAALSR  +F ESS
Sbjct  517   TFIKPFQSKVESKGQRSDAAQV-LQANPAALSRLQSFQESS  556



>ref|XP_010515057.1| PREDICTED: cyclic dof factor 3-like [Camelina sativa]
Length=458

 Score =   216 bits (550),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 183/514 (36%), Positives = 261/514 (51%), Gaps = 94/514 (18%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDV--------DPGGAASEANSLAKDSSCSEAEP  400
             ++DP IKLFG  I FP     P   + +         D G   SE N + ++ S ++   
Sbjct  5     SRDPAIKLFGTKIPFPAVVQLPVTVDEEEEEDDWSCGDGGEDKSEYNKVTRELSDNKKNK  64

Query  401   GEDEQQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGST-EIS  577
               +++   + N     ESK + G                           ED   T +I 
Sbjct  65    NCNDKSLNSSN-----ESKPETGD-------------------------KEDTTPTDQIE  94

Query  578   TTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTS  757
             ++D  E + +    KTLKKP KILPCPRC SM+TKFCY+NNYN NQPRHFCK CQRYWT+
Sbjct  95    SSDSPE-EQTTADGKTLKKPTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTA  153

Query  758   GGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHALKANGKVLTLAS  931
             GG  RN+PVGAGRRK K +S++HY H+   ++ + A +D         L+AN +VL+   
Sbjct  154   GGTMRNVPVGAGRRKNKSSSSSHYRHVTITEALEAARLD-------PGLQANTRVLSFGL  206

Query  932   DSV---ASELNIAEKTAG-----NGSLNGFYKPVE---LGIQVSYgagdngadhssgsss  1078
             D+    A+ +    K  G     NG+ NGF+   +   +  +V  G   +     + S++
Sbjct  207   DARQQHAAPMTPVMKLQGNQKVSNGAQNGFHGVPDQRLVARRVENGDDCSSGSSVTTSNN  266

Query  1079  vtaasTKDDVCKNGLPD---MLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSSAV-PPPGC  1246
              +   ++   C+   P    +   + +G+A    C    PWPY      W+ A+ PP   
Sbjct  267   HSVDESRAQGCRVVEPQMNNINNNSMNGYA----CIPGVPWPY-----TWNPALPPPGFY  317

Query  1247  FSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTLGKHSRDDNNK  1420
               PG+PMPFYP            W  P +S  +  +P     S  NSPTLGKH RD+ + 
Sbjct  318   PPPGYPMPFYP-----------YWTIPMLSPHQTASPVSQKGSNTNSPTLGKHPRDEESA  366

Query  1421  EGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAF---  1591
               + +  +      C+ VPKTLR DDP +AAKSSIW TLGI+++R+ S  GG F+ F   
Sbjct  367   RLDNETERKQR-NGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNERM-SKGGGMFEGFDHK  424

Query  1592  -KMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
              KMK++ ++ A  +   +  ANPAALSRS NFHE
Sbjct  425   AKMKNNNDNKAENS--PVRSANPAALSRSHNFHE  456



>ref|XP_003558722.1| PREDICTED: cyclic dof factor 1-like [Brachypodium distachyon]
Length=434

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 217/451 (48%), Gaps = 70/451 (16%)
 Frame = +2

Query  425   NENGERMDESKEDEGTVLME--------GEGIMDQTVDEIRDGLKAPHVDEDCGSTEIST  580
             + +G  +D+ ++  G+   E        G+     T+ E+ D       D+ C   + S 
Sbjct  27    DSSGSVVDKDQQHSGSSTAEPKVQENIPGDSTGSPTLPEVVD------TDDSCAVKKSSA  80

Query  581   TDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSG  760
               EEE   +  + + LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCKKCQRYWT+G
Sbjct  81    DQEEEQSDTANQKEKLKKPDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKKCQRYWTAG  140

Query  761   GMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSV  940
             G  RN+PVGAGRRK+K+ +A  H       Q      P       +K N  VL+  SD+ 
Sbjct  141   GAMRNVPVGAGRRKSKSISAASHF-----LQRIRATLPGDPLCTPIKTNATVLSFGSDT-  194

Query  941   ASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNG  1120
              S L++ E+      L     PV         +  + A+  +        +++++V  + 
Sbjct  195   -STLDLTEQMK---HLKDKLIPVTQIKNTDDPSVGSCAEGWAKGEEQNQMNSREEVTADK  250

Query  1121  LPDMLKQNYHGFAPQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPGFPMPFYP---PAM  1288
               ++          Q PC      WP+        S  P P  F+    +PFYP    A 
Sbjct  251   STNVA---------QHPCMNGGTMWPF--------SCAPSPAYFTSSVAIPFYPAAAAAA  293

Query  1289  YLGYTIPCSWNAPW----------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQP  1438
             Y GY +P +WN PW               +P    SS   S    KH RD + +      
Sbjct  294   YWGYMVPGAWNTPWPPQSQSQSSSSPNAASPVSTMSSCFQS---RKHPRDGDEE------  344

Query  1439  PKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV--DSIRGGAF-KAFKMKDD-  1606
              +D+N    +WVPKT+R DD ++ A+SSIW+ +GI  D+V  D  RG    + F  KD+ 
Sbjct  345   -RDTNRNGKVWVPKTIRIDDADEVARSSIWSLIGINGDKVGTDDGRGCKITRVFYPKDEA  403

Query  1607  -ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                +H   N    L+ NPAALSRS+ F E S
Sbjct  404   KTTTHRVNNSLPFLKGNPAALSRSVTFQERS  434



>ref|XP_009404080.1| PREDICTED: cyclic dof factor 1-like [Musa acuminata subsp. malaccensis]
Length=355

 Score =   211 bits (536),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 177/358 (49%), Gaps = 91/358 (25%)
 Frame = +2

Query  629   KKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTK  808
             KKPDKILPCPRC S+DTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGRRK+K
Sbjct  87    KKPDKILPCPRCKSLDTKFCYYNNYNVNQPRHFCKHCQRYWTAGGTMRNVPVGAGRRKSK  146

Query  809   NSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAEKTAGNGSL  988
               A  +H   +  F++      + + H +LK NG VL+  SDS             NG  
Sbjct  147   KGA--WHQRRLPEFESVL----QTLHHPSLKPNGTVLSFGSDSAPRPAEKTTSCNKNGVR  200

Query  989   NGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQL  1168
             +   +P E                                                A  +
Sbjct  201   DNSGRPSE------------------------------------------------ASPV  212

Query  1169  PCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVA  1348
             PCF   PWPYP     W+             P+PFYP A          W+ PW+S PVA
Sbjct  213   PCFSRSPWPYP-----WTP------------PVPFYPAA--------ACWSIPWLS-PVA  246

Query  1349  PQHHTSSGPNSPTLGKHSRDDNN-KEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSI  1525
                  S+  +SP L +HSR+ +  K G  Q       E  + VP+T+R DDPE+AAKS I
Sbjct  247   --CLPSAESSSPALDEHSREGHMVKNGSLQ------KEDSILVPRTMRIDDPEEAAKSCI  298

Query  1526  WATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             W  +GI+  +  +I  GG    F+ K D  + A +    LL ANPAALSRSLNF E+S
Sbjct  299   WTMVGIKSSKNSAIGSGGLLGYFQPKGDIKNRAGEAAS-LLHANPAALSRSLNFQETS  355



>ref|XP_010426193.1| PREDICTED: cyclic dof factor 3-like [Camelina sativa]
Length=455

 Score =   213 bits (543),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 160/402 (40%), Positives = 222/402 (55%), Gaps = 54/402 (13%)
 Frame = +2

Query  548   DEDCGSTEISTTDE-EEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRH  724
             +E+  + +I + D  +E   ++GK  TLKKP KILPCPRC SM+TKFCY+NNYN NQPRH
Sbjct  85    EEETSTDQIESNDSPDEQTTADGK--TLKKPTKILPCPRCKSMETKFCYYNNYNINQPRH  142

Query  725   FCKKCQRYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPERIQHHAL  898
             FCK CQRYWT+GG  RN+PVGAGRRK K +S++HY H+   ++ + A +D         L
Sbjct  143   FCKACQRYWTAGGTMRNVPVGAGRRKNKSSSSSHYRHITITEALEAARLD-------PGL  195

Query  899   KANGKVLTLASDSV---ASELNIAEKTAGNGSL-NGFY---------KPVELGIQVSYga  1039
             +AN +VL+   D+    A+ +    K  GN  + NGF+         + VE G   S G+
Sbjct  196   QANTRVLSFGLDARQQHAAPMTPVMKLQGNQKVSNGFHGVPDQRLVARRVENGDDCSSGS  255

Query  1040  gdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQW  1219
                 +++        A S +  V +  + +    + +G+A    C    PWPY      W
Sbjct  256   SVTTSNNHHSVDESRAQSCR--VVEPQMNNNNNNSMNGYA----CIPGVPWPY-----TW  304

Query  1220  SSAV-PPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVS--RPVAPQHHTSSGPNSPTL  1390
             + A+ PP     PG+PMPFYP            W  P +S  +  +P     S  NSP L
Sbjct  305   NPAMPPPGFYPPPGYPMPFYP-----------YWTIPMLSPHQTSSPMSQKGSNTNSPAL  353

Query  1391  GKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             GKH RD+ +   + +  +      C+ VPKTLR DDP +AAKSSIW TLGI+++R+ S  
Sbjct  354   GKHPRDEESARMDNETERKQR-NGCVLVPKTLRIDDPNEAAKSSIWTTLGIKNERM-SKG  411

Query  1571  GGAFKAF--KMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
             GG F+ F  K K ++N+        +  ANPAALSRS NFHE
Sbjct  412   GGMFEGFDHKAKMNKNNDNKAENSPVRSANPAALSRSHNFHE  453



>ref|XP_002525674.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36657.1| conserved hypothetical protein [Ricinus communis]
Length=506

 Score =   214 bits (546),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 185/547 (34%), Positives = 247/547 (45%), Gaps = 111/547 (20%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             MP+ +KDP  KLFG  I  PD       T++   P             +SC+++  GE +
Sbjct  12    MPQ-SKDPAFKLFGRKIPVPD-------TQIPAKP----------EFKNSCNDSIKGETD  53

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
                ++  GE+   S   +     E      Q  +E + G K   V       E ++TD+E
Sbjct  54    IYDEDNTGEQDKLSATGQ---TKEERQTPKQVNEEAQSGPKDDQV-------ETNSTDQE  103

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
                      K  KKPDKILPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  R
Sbjct  104   ---------KVFKKPDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMR  154

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKANGKVLTLASDSVAS  946
             N+P+GAGRRK K+ A+ Y    V S       +++ E   H  + +     TL   +  +
Sbjct  155   NVPIGAGRRKNKHLASQYRQILVSSDGVPITRIENSESTNHQLISSVESATTLRPSTTGN  214

Query  947   ELNIAEKTAGNGSL-NGFYKPVELGIQVSYgagdnga-dhssgsssvtaasTKDDVCK-N  1117
             E  +  K      L       + LG Q  Y    +     +    S   +S     C+ N
Sbjct  215   E--VVLKFGSEAPLCESMETVLNLGDQKRYAEMSSANCRDNGEEPSSCGSSMTSSSCRGN  272

Query  1118  GLPDMLKQ----------NYHGFAPQLPCFQAPPWPYP----------------------  1201
              LP+ + Q          N       L C+  PPW +P                      
Sbjct  273   ELPETVTQKELVGMPGSTNELNVPHSLHCYPVPPWVFPWNPNWNNATSITTAQHSTGQPC  332

Query  1202  ------SSAVQWSSAVPPPGCFSPGFPMPFYP----PAMYLGYTIPCSWNAPWVSRPV--  1345
                   S+ VQW    P P    P F  P  P    PA YLG  +P  W A   +  V  
Sbjct  333   MPNSNNSNQVQW---CPTPILAVPSFCPPSIPLQLVPASYLG-CMPV-WGAGAGNISVNG  387

Query  1346  ---------APQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
                      +      SG  SP LGKHSRD  N  GE Q       E C+ VPKTLR DD
Sbjct  388   SNGCSSPSSSTSTSCCSGNGSPKLGKHSRDA-NLMGEEQ------VENCVLVPKTLRIDD  440

Query  1499  PEDAAKSSIWATLGIQHDRVD-SIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRS  1675
             P +A+KS +WATLG++ D+ + + +G  FK  + K++   H  ++  + LEANPAALSRS
Sbjct  441   PNEASKSPLWATLGLKLDQKNPASKGTIFKTSETKEEGKGHVPESAHI-LEANPAALSRS  499

Query  1676  LNFHESS  1696
               F ESS
Sbjct  500   TTFQESS  506



>ref|XP_006644026.1| PREDICTED: cyclic dof factor 2-like [Oryza brachyantha]
Length=483

 Score =   214 bits (544),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 161/423 (38%), Positives = 211/423 (50%), Gaps = 66/423 (16%)
 Frame = +2

Query  575   STTDEEEGKMSN---GKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQR  745
             S + EE  K +N   G+DK LKKPDKILPCPRC+SMDTKFCY+NNYN NQPRHFCK CQR
Sbjct  78    SDSKEENEKTANDESGQDKVLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR  137

Query  746   YWTSGGMTRNLPVGAGRRKTKNSAAHYH--LNAVKSFQNACVDHPERIQHHALKA-----  904
             YWT+GG  RN+PVGAGRRK+K+S+ HY   L A      + VD    +   A  +     
Sbjct  138   YWTAGGTMRNVPVGAGRRKSKSSSLHYRHLLMAPDCMMGSRVDISRSVNPEAFGSSHSTP  197

Query  905   ------NGKVLTLA-----SDSVASELNIAEKTAGN-GSLNGFYKPVELGIQVSYgagdn  1048
                   N  VL         +S+AS L+I E+   N G++     P     + +  A   
Sbjct  198   IQPIGRNEAVLKFGPEVPLCESMASVLSIKEQNVTNTGAV-----PASENQEDNSCASSI  252

Query  1049  gadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPC---FQAPPWPYPSSAVQW  1219
              + +    ++V        V  NG+   + Q Y G     P    +   P   P+  +  
Sbjct  253   TSYNMLPENAVPVDKNGAPVYCNGVNSPMPQYYLGAPYMYPWGIGWNNLPMMVPAKGMSE  312

Query  1220  S-------SAVPPPGCFS----------PGFPMPFYPPAMY--LGYTIPCSWNAPWVS--  1336
             S       S +P P   S          P FP P  PPA++  L      +WN PW+   
Sbjct  313   SASPSESCSTIPAPWMNSPLMPPSRLPAPAFPYPLVPPALWGCLSSWPATTWNIPWIRTN  372

Query  1337  --RPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDA  1510
                  +   ++S   N   LGKHSRD         P ++   EK LW+PKTLR DDP+DA
Sbjct  373   DCMSPSSSSNSSCSGNGSPLGKHSRDS-------HPLREEKEEKSLWIPKTLRIDDPDDA  425

Query  1511  AKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRV-LLEANPAALSRSLNFH  1687
             AKSSIWATLGI+         G FK F+ K +     S +     L+ANPAA+SRS +F 
Sbjct  426   AKSSIWATLGIKPG-----DPGIFKPFQSKGESKVQTSDSRPARALQANPAAMSRSQSFQ  480

Query  1688  ESS  1696
             E+S
Sbjct  481   ETS  483



>ref|NP_001049101.1| Os03g0169600 [Oryza sativa Japonica Group]
 gb|AAL84292.1|AC073556_9 putative zinc finger DNA-binding protein [Oryza sativa Japonica 
Group]
 gb|AAO72548.1| putative H-protein promoter binding factor-2a [Oryza sativa Japonica 
Group]
 gb|ABF94195.1| Dof domain, zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11015.1| Os03g0169600 [Oryza sativa Japonica Group]
 gb|EAZ25737.1| hypothetical protein OsJ_09572 [Oryza sativa Japonica Group]
 dbj|BAG87605.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96752.1| unnamed protein product [Oryza sativa Japonica Group]
Length=440

 Score =   211 bits (538),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 201/392 (51%), Gaps = 52/392 (13%)
 Frame = +2

Query  575   STTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWT  754
             S   +++G  +N K+K LKKPDKILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT
Sbjct  83    SENQQQQGDTANQKEK-LKKPDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWT  141

Query  755   SGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASD  934
             +GG  RN+PVGAGRRK+K+ +A  H   ++  + A    P    +  +K NG VL+  SD
Sbjct  142   AGGAMRNVPVGAGRRKSKSVSAASHF--LQRVRAALPGDPPL--YAPVKTNGTVLSFGSD  197

Query  935   SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCK  1114
                S L++ E+      L   + P               A+  S +      + K+ V  
Sbjct  198   --LSTLDLTEQMK---HLKDKFIPTTGIKNTDEMPVGLCAEGLSKTEESNQTNLKEKVSA  252

Query  1115  NGLPDMLKQNYHGFAPQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPGFPMPFYP----  1279
             +  P++          Q PC      WP+           PPP  ++    +PFYP    
Sbjct  253   DRSPNVA---------QHPCMNGGAMWPF--------GVAPPPAYYTSSIAIPFYPAAAA  295

Query  1280  -PAMYLGYTIPCSWNAPW-------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQ  1435
               A Y G  +P +WNAPW            +     S+  N   LGKH RD + +     
Sbjct  296   AVAAYWGCMVPGAWNAPWPPQSQSQSVSSSSAASPVSTMTNCFRLGKHPRDGDEE-----  350

Query  1436  PPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRV--DSIRGGAF-KAFKMKDD  1606
                DS     +WVPKT+R DD ++ A+SSIW+ +GI+ D+V  D  RG    K F+ KD+
Sbjct  351   --LDSKGNGKVWVPKTVRIDDVDEVARSSIWSLIGIKGDKVGADHGRGCKLAKVFESKDE  408

Query  1607  --ENSHASKNCRVLLEANPAALSRSLNFHESS  1696
                ++H + +    ++ NPAAL+RS+ F E S
Sbjct  409   AKASTHTAISSLPFMQGNPAALTRSVTFQEGS  440



>ref|XP_010086689.1| Dof zinc finger protein [Morus notabilis]
 gb|EXB22882.1| Dof zinc finger protein [Morus notabilis]
Length=424

 Score =   211 bits (537),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 169/419 (40%), Positives = 222/419 (53%), Gaps = 81/419 (19%)
 Frame = +2

Query  581   TDEEEGKMSNG--KDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWT  754
             ++E++G  ++   K+K LKKPDK+LPCPRC+SM+TKFCYFNNYN NQPRHFCK C RYWT
Sbjct  40    SEEDQGAETDKTRKEKALKKPDKVLPCPRCNSMETKFCYFNNYNVNQPRHFCKNCHRYWT  99

Query  755   SGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNA---------------CVDHPERIQH  889
             +GG  RN+PVGAGRR+ K+S++ YH  A  S   A               C+    RI  
Sbjct  100   AGGTIRNVPVGAGRRRNKHSSSQYHQGATNSDATAVTQGGTNGGDSQSLSCLPASPRI--  157

Query  890   HALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdnga  1054
               +  N +++ L SD     S+ ++LN+ ++   N     +    E              
Sbjct  158   --VSGNQEMVKLVSDTPLYESMETKLNLRDQKRTNTWSAAYGDGCE--------------  201

Query  1055  dhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCF--QAPPWPYPSS------A  1210
                S SS   A +T  D    G  D    + +      PC+    P W YP +       
Sbjct  202   -EPSSSSCSMATTTSQDNGYLGKDDSSAVHTN----PTPCYPVTVPHWAYPWNPGWSIMM  256

Query  1211  VQWSSAVPPPGCFS-------PGF-----PMPFYPPAMYLGYTIPCSWNA-PWV---SRP  1342
             V  +S+ P P   S       PGF     P PF  PA Y G  +P SW++  W+   S  
Sbjct  257   VGANSSNPGPSVMSSMPAMTAPGFCAPNIPFPFV-PAPYWG-CVP-SWDSRKWISPVSPS  313

Query  1343  VAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSS  1522
              +  +   SG  SPTLGKHSRD N +  E         E+CLWVPKTLR DDP++AAKSS
Sbjct  314   SSTSNSGCSGSGSPTLGKHSRDTNMQAEE-------KTEQCLWVPKTLRIDDPDEAAKSS  366

Query  1523  IWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             IW+TLGI+ D    + RGG FKAFK K D  S A  +  V L++NPAALSRS +F ES+
Sbjct  367   IWSTLGIEPDTNQPVGRGGIFKAFKPKSDAKSDAKDDDHV-LQSNPAALSRSRSFQEST  424



>ref|XP_002319195.2| hypothetical protein POPTR_0013s06290g [Populus trichocarpa]
 gb|EEE95118.2| hypothetical protein POPTR_0013s06290g [Populus trichocarpa]
Length=540

 Score =   214 bits (545),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 186/538 (35%), Positives = 251/538 (47%), Gaps = 104/538 (19%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP  KLFG  I  PD       T+   +P         LAK  +CSE    E +    
Sbjct  51    SKDPAFKLFGRKIPVPD-------TQFPAEP---------LAK-GTCSEITRVETK----  89

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
                G   D S+E E   +  G G   Q  +E +  ++   V+E     ++    +E    
Sbjct  90    ---GPSEDISEEPE---MFSGSG---QGKEESQAAMR---VNE----AQVIAKHKEGPLE  133

Query  605   SNGKD--KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +NG D  K LKKPDKILPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  134   TNGTDQEKVLKKPDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGSMRNV  193

Query  779   PVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKANGKVLTLASDSVASEL  952
             P+GAGRRK K+ A  Y    V S     A +++ + I H  L+++ +  T  S SVA+ +
Sbjct  194   PIGAGRRKNKHLATQYRQILVSSDGMPIARMENSDSIGHQ-LQSSVESGTTLSPSVANGM  252

Query  953   NIAEKTAGNGSL-NGFYKPVELGIQVSYgagdngadhssgsssvt--aasTKDDVCKNGL  1123
              +  K      L +     + LG Q  Y    +     +     +  ++ T  +   N L
Sbjct  253   VL--KFGHEAPLCDSMENVLNLGDQKRYVEISSVNRQDNVEEPSSCGSSKTASNAWANEL  310

Query  1124  PDMLKQNYHGFAP----------QLPCFQAPPWPYP----------SSAVQWSSA-----  1228
              + + Q      P           LP +  P W +P           +A Q S+      
Sbjct  311   RENIMQKEQVDVPASSNELSAPNSLPYYSVPSWVFPWNPGWNNVASMTAAQHSTGQACVT  370

Query  1229  -------------VPPPGCFSPGFPMPFYPPAMYLG---------YTIPCSWNAPWVSRP  1342
                          +  P    P  P+ F  PA Y G           +  S +   +S  
Sbjct  371   NIPNQVQLCSTPMLAVPSICPPNIPLQFV-PASYWGCMPTWAAGTRNVSLSGSNGCLSLS  429

Query  1343  VAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSS  1522
              +    + SG  SPTLGKHSRD    E E         EKC+ VPKTLR DDP +A+KS 
Sbjct  430   TSANTSSCSGNGSPTLGKHSRDSKFMEEE-------KAEKCILVPKTLRIDDPSEASKSP  482

Query  1523  IWATLGIQHDRVD-SIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHES  1693
             +WATLG++ D+ D + +G  FK F+ K +   H S    V LEANPAALSRS  F ES
Sbjct  483   LWATLGLKPDQKDPASKGTIFKNFETKAECYGHVSDITHV-LEANPAALSRSHTFQES  539



>ref|XP_006651081.1| PREDICTED: cyclic dof factor 2-like [Oryza brachyantha]
Length=444

 Score =   211 bits (536),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 232/496 (47%), Gaps = 83/496 (17%)
 Frame = +2

Query  260   IKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKD-SSCSEAEPGEDEQQQKNENG  436
             IKLFG TI  PDA              G A +     KD S+C          Q+   +G
Sbjct  15    IKLFGKTIPVPDA--------------GDADKFKRTKKDFSTCF---------QETQYSG  51

Query  437   ERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMSNGK  616
                 E K  E              V +  D   A +  E+          +++G  +N K
Sbjct  52    SSTTEPKIQEAIPQDSTSPPPQPEVVDTEDSSAAKNSSEN---------QQQQGDTANQK  102

Query  617   DKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGR  796
             +K LKKPDKILPCPRC SMDTKFCY+NNYN NQPRHFCK CQRYWT+GG  RN+PVGAGR
Sbjct  103   EK-LKKPDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGR  161

Query  797   RKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAEKTAG  976
             RK+K+++A  H   ++  + A    P    +  +K NG VL+  SD   S L++ E+   
Sbjct  162   RKSKSTSAASHF--LQRVRAALPGDPPL--YSPVKTNGTVLSFGSD--LSTLDLTEQMK-  214

Query  977   NGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGF  1156
                L   + P   GI+          D  S  S     +  DD  +  L + +  +    
Sbjct  215   --HLKDKFIPTT-GIK--------NTDDLSVGSCAEGLAKTDDSNRMDLKEKVSGDKSAS  263

Query  1157  APQLPCFQAPP-WPYPSSAVQWSSAVPPPGCFSPGFPMPFYP---PAMYLGYTIPCSWNA  1324
               Q PC      WP+           PPP  ++    +PFYP    A Y G  +P + N 
Sbjct  264   VAQHPCMNGGTMWPF--------GVAPPPAYYTSSIAIPFYPAAAAAAYWGCMVPGASNT  315

Query  1325  PW-------VSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKT  1483
             PW        +   +     S+  N   LGKH RD + +        DS     +WVPKT
Sbjct  316   PWPPQSQSQSASSSSAASPVSTMTNCFKLGKHRRDGDEE-------LDSKGNGKVWVPKT  368

Query  1484  LRFDDPEDAAKSSIWATLGIQHDRV--DSIRGGAF-KAFKMKDDEN--SHASKNCRVLLE  1648
             +R DD ++ A+SSIW+ +GI+ D+V  D  RG    K F+ KD+    +H   +    ++
Sbjct  369   IRMDDVDNVARSSIWSIIGIKGDKVGTDHGRGCKLAKVFETKDEAKTATHTVISSLPFMQ  428

Query  1649  ANPAALSRSLNFHESS  1696
              NP+ALSRS+ F E S
Sbjct  429   GNPSALSRSVTFQEGS  444



>ref|XP_008787992.1| PREDICTED: cyclic dof factor 2-like [Phoenix dactylifera]
Length=497

 Score =   212 bits (540),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 183/513 (36%), Positives = 234/513 (46%), Gaps = 105/513 (20%)
 Frame = +2

Query  248   KDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             +DP IKLFG TI  P+              G A  EA  ++  +  +E  P  +E   K+
Sbjct  5     RDPAIKLFGRTIPLPE--------------GQAQVEAGEISVPAPATEEAPAVEE---KD  47

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTT--------  583
             E  E +D   +D    + +    +DQT      G  +   D+   S+             
Sbjct  48    ERREVIDTEVKDS---ISDAAEELDQTKPVSCSGSNSGKEDDHHMSSRDDNAVADPKPEK  104

Query  584   DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGG  763
             D+ E   S  ++K LKKPDKILPCPRCDS+DTKFCY+NNYN NQPRHFCK CQRYWT+GG
Sbjct  105   DQTEAHASI-QEKVLKKPDKILPCPRCDSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGG  163

Query  764   MTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHA-----------LKANG  910
               RN+PVG+GRRK K+SA+H H           VD  +   H A           LK NG
Sbjct  164   TMRNVPVGSGRRKNKHSASHCHYVTSDGMPCNRVDASDSCSHQALPAGLSAPMRPLKGNG  223

Query  911   KVLTLAS-----DSVASELNIAE--KTAGNGSLNGFYKPVELGIQVSYgagdngadhssg  1069
              VL   S     +S+AS L++ E  + A      G     E   + S    +   +    
Sbjct  224   TVLKFGSEAPLCESMASVLSLGEQKRNAETDFSAGGENREEASCKSSVTPSNCVENDHHE  283

Query  1070  sssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYP----------SSAVQW  1219
                    +     C NGL  M    +H     L  F  PPW YP           +A Q 
Sbjct  284   IPVHIEQNGLQGYC-NGLTLM----HH-----LQSFPGPPWIYPLHPGWNSVSSIAAGQC  333

Query  1220  SSA------------VP--PPGCFSPGF---PMPF-YPPAMYLGYTIPC---SWNAPWV-  1333
             SS             VP  PP   +P F    +PF Y P+ + G    C     N PWV 
Sbjct  334   SSELVYRPENGSPNPVPWCPPMMTTPAFCAPTIPFQYVPSSFWGCMSSCPSGILNIPWVG  393

Query  1334  -----SRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDD  1498
                  S   +      SG +SP LGKHSRD   +         S  EK LWVPKTLR DD
Sbjct  394   SNGGLSPSSSASSRGCSGNSSPNLGKHSRDAALQ---------SETEKSLWVPKTLRIDD  444

Query  1499  PEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKM  1597
             P++AAKSSIWATLGI+  +  SI+ GAF    +
Sbjct  445   PDEAAKSSIWATLGIRPHK--SIKKGAFLKLSI  475



>ref|XP_009380153.1| PREDICTED: cyclic dof factor 1-like [Musa acuminata subsp. malaccensis]
Length=385

 Score =   204 bits (520),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 181/364 (50%), Gaps = 76/364 (21%)
 Frame = +2

Query  620   KTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRR  799
             +++KKPDK LPCPRC S+DTKFCY+NNY+ NQPR+ C+ CQRYWT+GG  RN+PVGAGRR
Sbjct  93    RSVKKPDKTLPCPRCKSLDTKFCYYNNYSVNQPRYLCRNCQRYWTAGGTMRNVPVGAGRR  152

Query  800   KTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASELNIAEKTAGN  979
             K KNS    H+  +   ++A       +Q  A      VL    DS+AS L + E T  +
Sbjct  153   KNKNSC---HIRRIALSESAI----RALQSDARYPQSTVLNF--DSMASALVLPENTV-S  202

Query  980   GSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFA  1159
              + NG +  +                 +  +    ++   D +   G      QNY    
Sbjct  203   CNRNGIHGEM------------APPPSTMNNGDEKSSRPSDTLNAKG-----SQNYQRTI  245

Query  1160  PQLPCFQAPPWPYPSSAVQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSR  1339
               +PCF   PW YP     W+ A+    C S   P+PFYP A Y        W+ PW+S 
Sbjct  246   APIPCFSGSPWRYP-----WNPAL--SFCAS-SLPVPFYPAAAY--------WSGPWLS-  288

Query  1340  PVAPQHHTSSGPNS-----PTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPE  1504
             P A        P S     PTLGKHSRDD                 C+ +PKT R DDPE
Sbjct  289   PAASSSPDGCLPRSGSSTTPTLGKHSRDDT----------------CILIPKTPRIDDPE  332

Query  1505  DAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNF  1684
             +AAKSS+W  +GI +       G   KAF+ K +  +        LL  NPAAL RSLNF
Sbjct  333   EAAKSSLWTMVGISN-------GELLKAFQPKREIKNQVP----TLLHVNPAALCRSLNF  381

Query  1685  HESS  1696
              E+S
Sbjct  382   QEAS  385



>ref|XP_002522451.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39943.1| conserved hypothetical protein [Ricinus communis]
Length=389

 Score =   204 bits (520),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 203/348 (58%), Gaps = 34/348 (10%)
 Frame = +2

Query  704   NTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTK-NSAAHY-HLNAVKSFQNACVDHPE  877
             +TN+PRHFCK CQRYWT+GG  RN+PVGAGRRK K +SA+HY H+   ++ + A      
Sbjct  59    DTNRPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSSASHYRHIIVSEALRTAQGHALN  118

Query  878   RIQHHALKANGKVLTLASD-----SVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgag  1042
              + + +  ++  VLT  +D     SVAS LN++EK       NG+++P E  I V  G  
Sbjct  119   GVHNPSFGSSSTVLTFGADSPLCESVASVLNLSEK-------NGYHRP-EQRILVPCGRT  170

Query  1043  dngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWS  1222
              +  D     +SVTA++  +   K    + + +NY G APQ+PCF     P P     WS
Sbjct  171   ADNGDDRLSRNSVTASNALEKGGKRVSQETVTKNYQGIAPQIPCF-----PGPPWPYPWS  225

Query  1223  SAVPPPGCFSP-GFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQ-HHTSSGPNSPT--L  1390
             S +P P  F P GFP+ FYP   Y G T+P  WN P    P +P  +H ++   SPT  L
Sbjct  226   SPLPTPPTFCPSGFPVSFYPAPAYWGCTVPNPWNVPPCLSPQSPSVNHRAAASLSPTSPL  285

Query  1391  GKHSRDDN-----NKEGEPQPPKDSN-PEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHD  1552
             GKHSR+ N     N E   +P  +SN  E+ +  PK LR DDP +A  SSIWATLGI+ +
Sbjct  286   GKHSREGNILKPVNSE---EPSGESNCTERSVLAPKALRIDDPTEAVTSSIWATLGIKCE  342

Query  1553  RVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSLNFHESS  1696
             + + + GG F+ F+ K++  ++ ++    +L+ NPAALS SLNFHES+
Sbjct  343   KTN-LNGGLFEGFQSKNENRNYIAERKSSVLQVNPAALSWSLNFHEST  389



>ref|XP_009384962.1| PREDICTED: cyclic dof factor 3-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   207 bits (526),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 194/548 (35%), Positives = 258/548 (47%), Gaps = 112/548 (20%)
 Frame = +2

Query  233   MPEPTKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDE  412
             M EP  DP IKLFG TI    A       E DV+   A ++ NS            G   
Sbjct  1     MSEP-GDPAIKLFGTTIPMAAAADE----EPDVEEAEAETQQNS----------SKGVTN  45

Query  413   QQQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
              +  N++    +E  E +   L    G+     D+ +  ++A        +    +  E 
Sbjct  46    MEVNNDSSISTEEENEGDPISL---SGLTSGNEDDHKTSVEAEKEAAKAKTEHAKS--EA  100

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
             +G +    +K LKKPDKILPCPRC+SM+TKFCY+NNYN NQPRHFCK CQRYWT+GG  R
Sbjct  101   DGSV---PEKVLKKPDKILPCPRCNSMETKFCYYNNYNFNQPRHFCKNCQRYWTAGGTMR  157

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALKANG---------KVL  919
              +PVGAGRRK+K+S + Y    + S  FQ+   D  + I H  L             K  
Sbjct  158   YVPVGAGRRKSKHSNSPYRNVVILSDGFQSFQSDALKSIHHRPLPCASSTPSQPLIRKGT  217

Query  920   TLASD-------SVASELNIAEK--TAGNGSLNGFYKPVELGIQVSYgagdngadhssgs  1072
              L SD       SV    NI E+   A + S+   YK  E     S  A +   + S+  
Sbjct  218   ILKSDQEDPLYESVTCAFNIREQGNNAASDSMICGYKREEPSCSSSATASNFVKNVSAEK  277

Query  1073  ssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYP-----------------  1201
             +    +S     C NGL  +         P L  +   PW +P                 
Sbjct  278   AVHVRSSGMRVYC-NGLAPL---------PHLQYYPGVPWAHPWSLAWNSVAAMEAGRCS  327

Query  1202  -----------SSAVQWSSAV---PPPGCFSPGFPMPF-YPPAMYLGYTI--PCSWNAPW  1330
                        SS+V WS  V     P C S    +PF + PA +LGY+I    +WN P 
Sbjct  328   SEYSCTVENGNSSSVSWSPRVLMAASPFCAS---TLPFSFMPAPFLGYSILPNGTWNVPC  384

Query  1331  VSRP--VAPQHHTS----SGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRF  1492
                    +P   TS    SG  SPTLGKHSR D++ +GE      +N +K LWVPKTLR 
Sbjct  385   AGSNGCKSPSPSTSDSGCSGNGSPTLGKHSR-DSSIQGE------NNTKKPLWVPKTLRM  437

Query  1493  DDPEDAAKSSIWATLGIQHDRVDSIRGGAFKAFKMKDDENSHASKNCRVLLEANPAALSR  1672
             DDPE+A+KSSIWATLGI+ + + SI       F+ K +  +      ++L E NPAA+SR
Sbjct  438   DDPEEASKSSIWATLGIKPE-MGSI-------FQFKSEHKAKKLDGAQLLHE-NPAAVSR  488

Query  1673  SLNFHESS  1696
             S  F ES+
Sbjct  489   SHCFQEST  496



>ref|XP_007029942.1| Cycling DOF factor 2, putative isoform 1 [Theobroma cacao]
 gb|EOY10444.1| Cycling DOF factor 2, putative isoform 1 [Theobroma cacao]
Length=487

 Score =   206 bits (524),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 178/546 (33%), Positives = 238/546 (44%), Gaps = 127/546 (23%)
 Frame = +2

Query  251   DPTIKLFGMTIQFPDAppppppTEMDV-DPGGAASEANSLAKDSSCSEAEPGEDEQQQKN  427
             DP  KLFG  I  P+       T  ++ +P    S  N+          E  ++E Q   
Sbjct  5     DPAFKLFGRKIAVPEPQIHAGDTSSEITNPETETSYTNTSGDPDKSITVENDKEEHQTSM  64

Query  428   ENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKMS  607
             ++ E    SK  E                                  E S TD      S
Sbjct  65    KSNEIQTNSKLKE----------------------------------EQSETD------S  84

Query  608   NGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVG  787
               ++K  KKPDK+LPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+P+G
Sbjct  85    ADQEKVFKKPDKVLPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIG  144

Query  788   AGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHAL------------KANGKVLTL  925
             AGRRK K+ A+ Y    V S       ++ P+      L              NG VL  
Sbjct  145   AGRRKNKHLASQYRQIIVSSDGVPMTRIETPDSANQQLLPPGESTTAFRPSMGNGTVLKF  204

Query  926   ASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdngadhssgsssvtaasTKDD  1105
                   +E  + E      SL    + VE+G         +  +     SS  +++T   
Sbjct  205   -----GAEAPLCESMETVLSLGDQKRSVEMGT-------VSCGEIREEPSSCGSSATPCS  252

Query  1106  VCKNGLP-DMLKQNYHGFA----------PQLPCFQAPPWPYP-----------------  1201
             +  N LP +++++   G A          PQ  C+  PPW +P                 
Sbjct  253   IPGNHLPGNVMQKERVGLAGPNEQITQHPPQ--CYPIPPWIFPWNPGMNNVAPMAVGQSS  310

Query  1202  -----------SSAVQW--SSAVPPPGCFSPGFPMPFYPP---AMYL----GYTIPCSWN  1321
                        S+AVQW  +  +  PG   P  P+ F P     M L    G  +  S +
Sbjct  311   SERIGALNSSTSNAVQWCPTPMMAVPGFCPPNVPLQFVPAYWGCMPLWAASGGNVSFSGS  370

Query  1322  APWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDP  1501
                +S   +  +   SG  SP LGKHSR+ N  E +         EKC+ VPKTLR DDP
Sbjct  371   NGCLSPSSSTSNSCCSGNGSPRLGKHSRETNFVEEQ--------SEKCVLVPKTLRIDDP  422

Query  1502  EDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANPAALSRSL  1678
              +A++S IWATLGI+ D+ D + RG  F AF  K +   H      + LEANPAALSRS 
Sbjct  423   NEASRSPIWATLGIKPDQKDPLRRGKIFNAFDSKAEGKDHLLDGSHI-LEANPAALSRSH  481

Query  1679  NFHESS  1696
              F ES+
Sbjct  482   TFQEST  487



>ref|XP_007029943.1| Cycling DOF factor 2, putative isoform 2 [Theobroma cacao]
 gb|EOY10445.1| Cycling DOF factor 2, putative isoform 2 [Theobroma cacao]
Length=472

 Score =   205 bits (522),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 160/445 (36%), Positives = 213/445 (48%), Gaps = 90/445 (20%)
 Frame = +2

Query  563   STEISTT----DEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFC  730
             S EI T     +E+    S  ++K  KKPDK+LPCPRC+S+DTKFCYFNNYN NQPRHFC
Sbjct  51    SNEIQTNSKLKEEQSETDSADQEKVFKKPDKVLPCPRCNSLDTKFCYFNNYNVNQPRHFC  110

Query  731   KKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHAL--  898
             K CQRYWT+GG  RN+P+GAGRRK K+ A+ Y    V S       ++ P+      L  
Sbjct  111   KNCQRYWTAGGTMRNVPIGAGRRKNKHLASQYRQIIVSSDGVPMTRIETPDSANQQLLPP  170

Query  899   ----------KANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagdn  1048
                         NG VL        +E  + E      SL    + VE+G         +
Sbjct  171   GESTTAFRPSMGNGTVLKF-----GAEAPLCESMETVLSLGDQKRSVEMGT-------VS  218

Query  1049  gadhssgsssvtaasTKDDVCKNGLP-DMLKQNYHGFA----------PQLPCFQAPPWP  1195
               +     SS  +++T   +  N LP +++++   G A          PQ  C+  PPW 
Sbjct  219   CGEIREEPSSCGSSATPCSIPGNHLPGNVMQKERVGLAGPNEQITQHPPQ--CYPIPPWI  276

Query  1196  YP----------------------------SSAVQW--SSAVPPPGCFSPGFPMPFYPP-  1282
             +P                            S+AVQW  +  +  PG   P  P+ F P  
Sbjct  277   FPWNPGMNNVAPMAVGQSSSERIGALNSSTSNAVQWCPTPMMAVPGFCPPNVPLQFVPAY  336

Query  1283  --AMYL----GYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPK  1444
                M L    G  +  S +   +S   +  +   SG  SP LGKHSR+ N  E +     
Sbjct  337   WGCMPLWAASGGNVSFSGSNGCLSPSSSTSNSCCSGNGSPRLGKHSRETNFVEEQ-----  391

Query  1445  DSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHA  1621
                 EKC+ VPKTLR DDP +A++S IWATLGI+ D+ D + RG  F AF  K +   H 
Sbjct  392   ---SEKCVLVPKTLRIDDPNEASRSPIWATLGIKPDQKDPLRRGKIFNAFDSKAEGKDHL  448

Query  1622  SKNCRVLLEANPAALSRSLNFHESS  1696
                  + LEANPAALSRS  F ES+
Sbjct  449   LDGSHI-LEANPAALSRSHTFQEST  472



>ref|XP_002325441.1| hypothetical protein POPTR_0019s05720g [Populus trichocarpa]
 gb|EEE99822.1| hypothetical protein POPTR_0019s05720g [Populus trichocarpa]
Length=493

 Score =   206 bits (524),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 189/559 (34%), Positives = 249/559 (45%), Gaps = 147/559 (26%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPGGAASEANSLAKDSSCSEAEPGEDEQQQK  424
             +KDP  KLFG  I  PD       T+   +P         LAK  SCS      D  + +
Sbjct  5     SKDPAFKLFGRKIPVPD-------TQFPAEP---------LAK-GSCS------DITKLE  41

Query  425   NENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEEEGKM  604
              +     +  + +  + L +GE       +EI+  ++   V+E    TE+    +E    
Sbjct  42    TKGPSEENSEEPEMFSALGQGE-------EEIQAAMQ---VNE----TEVIAKPKEGQLE  87

Query  605   SNGKDK--TLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTRNL  778
             +NG DK    KKPDKILPCPRC+ +DTKFCYFNNYN NQPRHFCK CQRYWT+GG  RN+
Sbjct  88    TNGTDKERVFKKPDKILPCPRCNCLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNV  147

Query  779   PVGAGRRKTKNSAAHYHLNAVKS--FQNACVDHPERIQHHALK------------ANGKV  916
             P+GAGRRK K+ A  Y    V S     A +++ +   H                ANG V
Sbjct  148   PIGAGRRKNKHLATQYRQILVSSDGMPIARMENSDSAGHQLSSSVESATTLSPSTANGTV  207

Query  917   LTLA-----SDSVASELNI------AEKTAGNGSLNGFYKPVELGIQVSYgagdngadhs  1063
             L         DS+ + LN+       E ++ N   NG   P     + S+          
Sbjct  208   LKFGPEAPLCDSMETVLNLGDPKRYVEMSSVNYQDNGEEPPSCGSSKASFI---------  258

Query  1064  sgsssvtaasTKDDVCKNGLP--------DMLKQNYHGFAPQ-LPCFQAPPWPYP-----  1201
                           VC+N LP        DM   + +  AP  L C+  P W +P     
Sbjct  259   --------------VCENELPENIMQEQVDMPASSNNLSAPHSLLCYSVPSWVFPWNPAW  304

Query  1202  -----SSAVQWSSA------VPP------------PGCFSPGFPMPFYPPAMYLGYTIPC  1312
                   +A Q+SS       VP             P    P  P+ F  PA Y G  +P 
Sbjct  305   NNETSMAAAQYSSGQACITNVPTQVQLCPTPMLAVPSICPPNIPLQFV-PASYWG-CMP-  361

Query  1313  SWNAPWVSRPVAPQHHT-----------SSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPE  1459
             +W A   + P+   +              SG  SP LGKHSRD    + E         E
Sbjct  362   TWTAGTGNVPLCGSNGCLTPSSSTTTSYCSGNGSPKLGKHSRDSKFMDEE-------KTE  414

Query  1460  KCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVD-SIRGGAFKAFKMKDDENSHASKNCR  1636
             KC+ VPKTLR DDP +A+KS +WAT G+   + D + +G  FK F+ K +   H S    
Sbjct  415   KCILVPKTLRIDDPSEASKSPLWATFGLPPAQKDPTSKGTIFKNFETKAEGCGHVSDATN  474

Query  1637  VLLEANPAALSRSLNFHES  1693
             V LEANPAALSRS  F ES
Sbjct  475   V-LEANPAALSRSQTFQES  492



>gb|KDP39636.1| hypothetical protein JCGZ_02656 [Jatropha curcas]
Length=497

 Score =   204 bits (520),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 176/553 (32%), Positives = 238/553 (43%), Gaps = 133/553 (24%)
 Frame = +2

Query  245   TKDPTIKLFGMTIQFPDAppppppTEMDVDPG--GAASEANSLAKDSSCSEAEPGEDEQ-  415
             +KDP IKLFG  I  PD   P   +   +  G      E NS   D S +  +  ED++ 
Sbjct  9     SKDPAIKLFGRKIPVPDTQIPSKNSCSGITKGENDTIHEDNSRELDKSTASGQSQEDKRT  68

Query  416   -QQKNENGERMDESKEDEGTVLMEGEGIMDQTVDEIRDGLKAPHVDEDCGSTEISTTDEE  592
               Q NE  ++  +SKED+                                  E ++ D+E
Sbjct  69    PMQVNE-PQKTSKSKEDQ---------------------------------VETNSVDQE  94

Query  593   EGKMSNGKDKTLKKPDKILPCPRCDSMDTKFCYFNNYNTNQPRHFCKKCQRYWTSGGMTR  772
                      K  KKPDKILPCPRC+S+DTKFCYFNNYN NQPRHFCK CQRYWT+GG  R
Sbjct  95    ---------KIFKKPDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMR  145

Query  773   NLPVGAGRRKTKNSAAHYHLNAVKSFQNACVDHPERIQHHALKANGKVLTLASDSVASEL  952
             N+P+GAGRRK K+ A+ Y    V S         E +    ++ +         SV S  
Sbjct  146   NVPIGAGRRKNKHLASQYRQILVSS---------EGVPISRMENSDSGSQQLISSVESAT  196

Query  953   NIAEKTAGNGSLNGF----------YKPVELGIQVSYgagdngadhssgsssvt--aasT  1096
              +   T GNG +  F             + LG Q  Y    +     +     +  ++ T
Sbjct  197   TLKPSTTGNGMVLKFGPEAPLCESMETVLNLGDQKRYAEMSSVKCLDNVEEPSSCGSSMT  256

Query  1097  KDDVCKNGLPDMLKQNYH----------GFAPQLPCFQAPPWPYP----------SSAVQ  1216
                   N L + + Q               A  + C+  PPW  P          ++A Q
Sbjct  257   ASSSRGNELSETVAQKEQVGLVGSSTDLNVAHPVHCYPVPPWVLPWNPGWNNATSTTAAQ  316

Query  1217  WSSAVP----------PPGCFSPGFPMP-FYPPAMYLGYTIPCSWNAPWVSRPV------  1345
              S+  P             C +P   +P F PP++ L + +P S+   W   PV      
Sbjct  317   SSAGQPCTPNSNTSNQVQWCPTPILAVPGFCPPSIPLHF-VPASY---WGCMPVWTAGKG  372

Query  1346  ---------------APQHHTSSGPNSPTLGKHSRDDNNKEGEPQPPKDSNPEKCLWVPK  1480
                            +      SG  SP LGKHSRD +  +       +   EKC+ VPK
Sbjct  373   NLSLSGSKGCSSPSSSANPSCCSGNGSPNLGKHSRDSDLMD-------EDKAEKCILVPK  425

Query  1481  TLRFDDPEDAAKSSIWATLGIQHDRVDSI-RGGAFKAFKMKDDENSHASKNCRVLLEANP  1657
             TLR DDP +A KS +WATLG+  D+ + + +G  FK  + K     H   +   +LEANP
Sbjct  426   TLRIDDPNEALKSPLWATLGLSLDQKNHVSKGTVFKTCEAKAQGKGHG-PDANHILEANP  484

Query  1658  AALSRSLNFHESS  1696
             AALSRS  F ESS
Sbjct  485   AALSRSHTFQESS  497



>ref|XP_006280864.1| hypothetical protein CARUB_v10026854mg [Capsella rubella]
 gb|EOA13762.1| hypothetical protein CARUB_v10026854mg [Capsella rubella]
Length=303

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 191/406 (47%), Gaps = 135/406 (33%)
 Frame = +2

Query  527   GLKAPH------VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             G+K P        DED  +   + TD+ E      KDKTLKKP KILPCPRC+SM+TKFC
Sbjct  13    GMKIPFPTVLDVTDEDEKNQNETLTDQSE------KDKTLKKPTKILPCPRCNSMETKFC  66

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTK------NSAAHYHLNAVKSF  850
             Y+NNYN NQPRHFCK CQRYWTSGG  R++PVGAGRRK+K      +S+ HYH   +   
Sbjct  67    YYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKSKTTNNSTSSSPHYHHVTIS--  124

Query  851   QNACVDHPERIQHHALKANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVS  1030
                             + NG VL+    S+  +  ++    GN       KP    I+  
Sbjct  125   ----------------ETNGPVLSF---SLGDDQKVSNHMFGNP------KPAVSRIE--  157

Query  1031  YgagdngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSA  1210
                                    +D C N             +  L CF    WPY    
Sbjct  158   ---------------------NINDDCSNNTT----------SNGLDCFPGVSWPY----  182

Query  1211  VQWSSAVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTL  1390
                         ++PGF  P YP            WN P +S PV      +S PNS TL
Sbjct  183   -----------AWNPGF-YPVYP-----------YWNVPMLSSPV-----NNSSPNS-TL  213

Query  1391  GKHSRDDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIR  1570
             GKH RD+     + +        + + VPKTLR DDP +AAKSSIW TLGI++D +    
Sbjct  214   GKHLRDEEETMKQQK-------NRSVLVPKTLRIDDPNEAAKSSIWTTLGIKNDVL----  262

Query  1571  GGAFKAF------KMKDDENSHASKNCRVLLEANPAALSRSLNFHE  1690
                FK F      K+ + E +  S    ++L ANPAALSRS+NFHE
Sbjct  263   ---FKGFDSKKEAKVMNKEETETS----LVLCANPAALSRSVNFHE  301



>ref|XP_010483955.1| PREDICTED: cyclic dof factor 1-like [Camelina sativa]
Length=300

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 146/397 (37%), Positives = 189/397 (48%), Gaps = 120/397 (30%)
 Frame = +2

Query  527   GLKAPH------VDEDCGSTEISTTDEEEGKMSNGKDKTLKKPDKILPCPRCDSMDTKFC  688
             G+K P        DE+  +   + TD+ E      KDKTLKKP KILPCPRC+SM+TKFC
Sbjct  13    GMKIPFPTVLEVADEEAKNQNEALTDQSE------KDKTLKKPTKILPCPRCNSMETKFC  66

Query  689   YFNNYNTNQPRHFCKKCQRYWTSGGMTRNLPVGAGRRKTKNSAAHYHLNAVKSFQNACVD  868
             Y+NNYN NQPRHFCK CQRYWTSGG  R++P+GAGRRK+KN++                 
Sbjct  67    YYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKSKNNST---------------S  111

Query  869   HPERIQHHAL-KANGKVLTLASDSVASELNIAEKTAGNGSLNGFYKPVELGIQVSYgagd  1045
              P    H  + + NG VL+    S+  +  ++         N  ++  +L  ++      
Sbjct  112   SPSHYHHVTISETNGPVLSF---SLGDDQKVS---------NHMFRSPKLVSRIQ-----  154

Query  1046  ngadhssgsssvtaasTKDDVCKNGLPDMLKQNYHGFAPQLPCFQAPPWPYPSSAVQWSS  1225
                          +    ++   NGL +              CF    WPY         
Sbjct  155   ------------NSDECSNNSTSNGLDN--------------CFPGLSWPY---------  179

Query  1226  AVPPPGCFSPGFPMPFYPPAMYLGYTIPCSWNAPWVSRPVAPQHHTSSGPNSPTLGKHSR  1405
                    ++PGF  P YP            WN P +  PV      +S PNS TLGKH R
Sbjct  180   ------AWNPGF-YPVYP-----------YWNIPTLPSPV------NSSPNS-TLGKHLR  214

Query  1406  DDNNKEGEPQPPKDSNPEKCLWVPKTLRFDDPEDAAKSSIWATLGIQHDRVDSIRGGAFK  1585
             D    E E   PK  N    + VPKTLR DDP +AAKSSIW TLGI++D +       FK
Sbjct  215   D----EDETMKPKQKN--GSVLVPKTLRIDDPNEAAKSSIWTTLGIKNDVL-------FK  261

Query  1586  AFKMKDDEN--SHASKNCRVLLEANPAALSRSLNFHE  1690
              F  K +    S       ++L ANPAALSRSL+FHE
Sbjct  262   GFDSKKEVKNISKEETETSLVLCANPAALSRSLSFHE  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8806309877442