BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21535_g1_i1 len=431 path=[409:0-12 422:13-144 554:145-150
560:151-430]

Length=431
                                                                      Score     E

ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        145   5e-40   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                142   4e-39   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    141   1e-38   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    140   2e-38   
gb|EYU43092.1|  hypothetical protein MIMGU_mgv1a020152mg                136   2e-38   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                140   2e-38   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                140   3e-38   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    140   3e-38   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    140   4e-38   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                140   4e-38   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                140   4e-38   
emb|CDP22064.1|  unnamed protein product                                140   5e-38   
emb|CDP16787.1|  unnamed protein product                                140   5e-38   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                140   5e-38   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                140   5e-38   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        139   6e-38   
emb|CDP16790.1|  unnamed protein product                                139   8e-38   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                139   8e-38   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    139   1e-37   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                139   1e-37   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    139   1e-37   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     139   1e-37   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                139   2e-37   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        138   2e-37   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                138   2e-37   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        138   2e-37   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    138   2e-37   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                138   2e-37   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    138   2e-37   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    138   3e-37   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    138   3e-37   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                137   3e-37   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                137   3e-37   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                137   4e-37   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                137   5e-37   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        136   9e-37   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        136   9e-37   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    136   1e-36   
gb|KCW64216.1|  hypothetical protein EUGRSUZ_G018672                    131   2e-36   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    136   2e-36   
ref|XP_009620876.1|  PREDICTED: putative germin-like protein 2-1        135   2e-36   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                135   2e-36   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    135   2e-36   
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative              135   2e-36   Ricinus communis
emb|CDP16788.1|  unnamed protein product                                135   3e-36   
emb|CDP21353.1|  unnamed protein product                                139   3e-36   
emb|CAN74480.1|  hypothetical protein VITISV_042844                     134   4e-36   Vitis vinifera
ref|NP_001268198.1|  germin-like protein 3 precursor                    134   5e-36   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    134   5e-36   
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           133   6e-36   Ricinus communis
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        134   6e-36   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        134   8e-36   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               134   8e-36   
emb|CAN74828.1|  hypothetical protein VITISV_002139                     133   9e-36   Vitis vinifera
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               134   9e-36   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     134   1e-35   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     134   1e-35   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    134   1e-35   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    134   1e-35   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        134   1e-35   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    133   2e-35   
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        132   2e-35   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    133   2e-35   
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     133   2e-35   
emb|CDP16789.1|  unnamed protein product                                137   2e-35   
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     133   2e-35   
ref|XP_004301229.1|  PREDICTED: germin-like protein subfamily 1 m...    132   2e-35   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    133   2e-35   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    133   2e-35   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    133   2e-35   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    133   2e-35   
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg             131   2e-35   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    132   2e-35   
emb|CBI36791.3|  unnamed protein product                                132   3e-35   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    132   3e-35   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    132   3e-35   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               132   3e-35   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    132   3e-35   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    132   3e-35   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     132   4e-35   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    132   4e-35   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     132   4e-35   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             132   4e-35   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    132   4e-35   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    132   5e-35   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             132   5e-35   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    132   5e-35   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    132   6e-35   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    132   6e-35   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    132   6e-35   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        131   7e-35   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             131   8e-35   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    131   8e-35   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             131   8e-35   
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           130   8e-35   Ricinus communis
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        131   9e-35   Vitis vinifera
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    131   1e-34   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    130   1e-34   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             130   1e-34   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    130   1e-34   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           130   1e-34   Ricinus communis
gb|KCW61441.1|  hypothetical protein EUGRSUZ_H04171                     130   2e-34   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             130   2e-34   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    130   2e-34   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    130   2e-34   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    130   2e-34   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    130   2e-34   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             130   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...    130   3e-34   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          136   3e-34   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    130   3e-34   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    130   3e-34   
emb|CAN80134.1|  hypothetical protein VITISV_012033                     130   3e-34   Vitis vinifera
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        130   3e-34   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    130   3e-34   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     130   3e-34   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               129   4e-34   
ref|XP_002319656.2|  hypothetical protein POPTR_0013s04860g             126   4e-34   Populus trichocarpa [western balsam poplar]
emb|CDP16786.1|  unnamed protein product                                135   5e-34   
ref|XP_007140903.1|  hypothetical protein PHAVU_008G1509000g            125   5e-34   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    129   6e-34   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    129   6e-34   
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          133   7e-34   
ref|XP_006375870.1|  germin-like protein 1                              129   8e-34   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        129   8e-34   Vitis vinifera
gb|ADD71877.1|  germin-like protein subfamily 1 member 1 precursor      129   8e-34   Arachis hypogaea [goober]
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    129   9e-34   
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...    129   9e-34   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     128   1e-33   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    129   1e-33   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    128   1e-33   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          129   1e-33   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        128   1e-33   Vitis vinifera
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             128   1e-33   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 132   2e-33   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    132   2e-33   
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...    128   2e-33   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    132   2e-33   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    127   2e-33   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    127   2e-33   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        127   2e-33   
ref|XP_007030283.1|  RmlC-like cupins superfamily protein               126   3e-33   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             127   3e-33   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-33   
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...    126   3e-33   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-33   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             127   3e-33   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     127   3e-33   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    131   3e-33   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-33   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             127   3e-33   
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    127   4e-33   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    127   4e-33   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             127   4e-33   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        127   4e-33   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        127   4e-33   
emb|CBI36815.3|  unnamed protein product                                127   5e-33   
emb|CAN79051.1|  hypothetical protein VITISV_025926                     126   5e-33   Vitis vinifera
ref|XP_008358299.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    125   5e-33   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    127   5e-33   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    126   6e-33   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             126   6e-33   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    126   6e-33   
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g             126   7e-33   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             126   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        125   7e-33   
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    126   7e-33   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    126   7e-33   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    130   8e-33   
gb|KHN14793.1|  Germin-like protein subfamily 1 member 16               125   8e-33   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             126   8e-33   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    126   1e-32   
emb|CAN61141.1|  hypothetical protein VITISV_024669                     125   1e-32   Vitis vinifera
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    126   1e-32   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             125   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    126   1e-32   
emb|CBI36811.3|  unnamed protein product                                125   1e-32   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        125   1e-32   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        125   1e-32   Vitis vinifera
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    125   1e-32   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        125   1e-32   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    125   1e-32   
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    126   1e-32   
emb|CDP16791.1|  unnamed protein product                                125   1e-32   
emb|CBI33612.3|  unnamed protein product                                125   1e-32   
emb|CAN62429.1|  hypothetical protein VITISV_005171                     124   2e-32   Vitis vinifera
emb|CAN70189.1|  hypothetical protein VITISV_016562                     125   2e-32   Vitis vinifera
emb|CAN63888.1|  hypothetical protein VITISV_027217                     123   2e-32   Vitis vinifera
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             125   2e-32   Populus trichocarpa [western balsam poplar]
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                125   2e-32   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-32   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587    129   2e-32   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    125   2e-32   
gb|AFK49577.1|  unknown                                                 125   2e-32   
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        125   3e-32   Vitis vinifera
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg             125   3e-32   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    124   3e-32   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     124   3e-32   Vitis vinifera
emb|CBI33610.3|  unnamed protein product                                127   3e-32   
ref|XP_008381865.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    123   4e-32   
ref|XP_008779597.1|  PREDICTED: putative germin-like protein 2-1        120   4e-32   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     124   4e-32   
emb|CAN71631.1|  hypothetical protein VITISV_015711                     124   4e-32   Vitis vinifera
emb|CAN82524.1|  hypothetical protein VITISV_028056                     124   4e-32   Vitis vinifera
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    124   4e-32   
ref|XP_006375874.1|  germin-like protein 1                              124   5e-32   
ref|NP_001267943.1|  germin-like protein 4 precursor                    124   5e-32   
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...    124   5e-32   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    124   6e-32   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    124   6e-32   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    124   6e-32   
emb|CDP10692.1|  unnamed protein product                                120   7e-32   
emb|CAN63889.1|  hypothetical protein VITISV_027218                     123   7e-32   Vitis vinifera
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             124   7e-32   
emb|CAN70904.1|  hypothetical protein VITISV_032927                     123   7e-32   Vitis vinifera
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    124   7e-32   
ref|XP_009758327.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    122   8e-32   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    123   8e-32   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    127   8e-32   Vitis vinifera
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        123   9e-32   
ref|XP_010660483.1|  PREDICTED: germin-like protein 8-2                 120   9e-32   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    123   9e-32   Vitis vinifera
emb|CBI36810.3|  unnamed protein product                                125   1e-31   
emb|CBI33611.3|  unnamed protein product                                124   1e-31   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    123   1e-31   
emb|CAN72994.1|  hypothetical protein VITISV_000563                     122   2e-31   Vitis vinifera
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    123   2e-31   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        122   2e-31   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    122   2e-31   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     122   2e-31   
emb|CAB65370.1|  germin-like protein                                    122   2e-31   Pisum sativum [garden pea]
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    126   2e-31   Vitis vinifera
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7                123   2e-31   
gb|ACG69479.1|  germin-like protein 3                                   122   2e-31   Glycine max [soybeans]
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         122   2e-31   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...    122   3e-31   
emb|CBI36812.3|  unnamed protein product                                125   3e-31   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         122   3e-31   
emb|CBI36816.3|  unnamed protein product                                122   3e-31   
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor     122   3e-31   
ref|XP_007140910.1|  hypothetical protein PHAVU_008G1514001g            119   3e-31   
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    122   3e-31   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    125   4e-31   Vitis vinifera
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    125   4e-31   Vitis vinifera
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          120   4e-31   
gb|KHN10835.1|  Germin-like protein 12-1                                120   4e-31   
emb|CBI39473.3|  unnamed protein product                                121   4e-31   
gb|KDP23774.1|  hypothetical protein JCGZ_23607                         124   4e-31   
gb|KHN04147.1|  Germin-like protein 12-1                                120   5e-31   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    121   5e-31   
ref|XP_008243693.1|  PREDICTED: germin-like protein subfamily 1 m...    120   5e-31   
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308    125   5e-31   Vitis vinifera
gb|KCW82833.1|  hypothetical protein EUGRSUZ_C04204                     120   5e-31   
ref|XP_008780761.1|  PREDICTED: germin-like protein 8-5                 119   6e-31   
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    122   6e-31   Vitis vinifera
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             121   7e-31   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             121   7e-31   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     121   7e-31   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          121   7e-31   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        121   8e-31   
emb|CDP10701.1|  unnamed protein product                                121   8e-31   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     121   9e-31   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     120   9e-31   
ref|XP_002280455.1|  PREDICTED: germin-like protein subfamily 1 m...    119   9e-31   Vitis vinifera
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    120   1e-30   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          120   1e-30   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         120   1e-30   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          122   1e-30   
gb|KDP23765.1|  hypothetical protein JCGZ_23598                         123   1e-30   
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...    120   1e-30   
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor     120   1e-30   
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    120   1e-30   
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    120   1e-30   
gb|ACG69478.1|  germin-like protein 2                                   120   1e-30   Glycine max [soybeans]
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    120   1e-30   
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               120   2e-30   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     120   2e-30   
emb|CBI36814.3|  unnamed protein product                                120   2e-30   
emb|CAN74366.1|  hypothetical protein VITISV_015882                     119   2e-30   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    120   2e-30   
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...    120   2e-30   
ref|XP_007140905.1|  hypothetical protein PHAVU_008G1510000g            117   2e-30   
ref|XP_003618167.1|  Germin-like protein                                120   2e-30   
ref|XP_007030265.1|  Germin-like protein 2                              119   3e-30   
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             119   3e-30   
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1        119   3e-30   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             119   3e-30   
ref|XP_008780704.1|  PREDICTED: germin-like protein 8-5                 117   3e-30   
gb|EYU38445.1|  hypothetical protein MIMGU_mgv11b021105mg               117   3e-30   
emb|CDP10694.1|  unnamed protein product                                119   4e-30   
emb|CDP10693.1|  unnamed protein product                                119   4e-30   
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        119   4e-30   
ref|XP_010907049.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    119   5e-30   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             119   5e-30   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             119   5e-30   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                         119   5e-30   
gb|AFK39387.1|  unknown                                                 119   5e-30   
gb|EPS67173.1|  hypothetical protein M569_07603                         119   6e-30   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737    124   6e-30   
ref|XP_010549631.1|  PREDICTED: germin-like protein subfamily 1 m...    116   7e-30   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     118   7e-30   
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    118   7e-30   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...    118   7e-30   
gb|ACT22756.1|  GER4a                                                   118   8e-30   
ref|XP_002525480.1|  Rhicadhesin receptor precursor, putative           117   8e-30   
gb|KHN28992.1|  Germin-like protein 12-1                                117   9e-30   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        118   9e-30   
ref|XP_002522034.1|  Rhicadhesin receptor precursor, putative           117   9e-30   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    119   1e-29   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        118   1e-29   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    122   1e-29   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        118   1e-29   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             118   1e-29   
gb|EMT00501.1|  Germin-like protein 8-5                                 118   1e-29   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    118   1e-29   
gb|KHN28993.1|  Germin-like protein 12-1                                117   1e-29   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          117   1e-29   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    117   2e-29   
emb|CDP10696.1|  unnamed protein product                                113   2e-29   
ref|XP_008678215.1|  PREDICTED: germin-like protein 8-11                115   2e-29   
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2                117   2e-29   
gb|EMS56244.1|  Germin-like protein 8-5                                 117   2e-29   
emb|CAB55559.1|  germin-like protein                                    117   2e-29   
ref|XP_010549630.1|  PREDICTED: germin-like protein subfamily 1 m...    116   2e-29   
gb|AAL15887.1|AF417299_1  putative germin                               115   2e-29   
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...    117   3e-29   
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1        117   3e-29   
ref|XP_002488986.1|  hypothetical protein SORBIDRAFT_0737s002010        115   3e-29   
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...    117   3e-29   
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7                117   3e-29   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          118   3e-29   
emb|CAN63434.1|  hypothetical protein VITISV_033830                     116   3e-29   
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1        116   3e-29   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    116   4e-29   
gb|ACT22757.1|  GER4h                                                   117   4e-29   
ref|XP_008662705.1|  PREDICTED: putative germin-like protein 12-4       116   4e-29   
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...    116   4e-29   
gb|AAG00425.1|AF250933_1  germin A                                      117   4e-29   
emb|CAB65371.1|  germin-like protein                                    115   4e-29   
ref|XP_004972676.1|  PREDICTED: germin-like protein 8-7-like            116   4e-29   
emb|CAN73848.1|  hypothetical protein VITISV_021639                     114   4e-29   
ref|XP_008780786.1|  PREDICTED: germin-like protein 8-5                 114   4e-29   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     116   4e-29   
gb|EMT15740.1|  Germin-like protein 8-5                                 116   5e-29   
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    116   5e-29   
gb|AFW56909.1|  hypothetical protein ZEAMMB73_144179                    117   5e-29   
emb|CBI36790.3|  unnamed protein product                                115   5e-29   
gb|EMS48827.1|  Germin-like protein 8-5                                 116   5e-29   
ref|XP_008678221.1|  PREDICTED: putative germin-like protein 12-4       116   6e-29   
gb|EMT10611.1|  Germin-like protein 8-11                                114   6e-29   
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358    119   6e-29   
ref|XP_008678211.1|  PREDICTED: putative germin-like protein 12-4       116   6e-29   
gb|AFW61077.1|  hypothetical protein ZEAMMB73_005804                    115   6e-29   
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2                115   6e-29   
emb|CBI39477.3|  unnamed protein product                                116   6e-29   
gb|AFW61073.1|  hypothetical protein ZEAMMB73_930166                    115   7e-29   
emb|CAN80133.1|  hypothetical protein VITISV_012032                     115   7e-29   
gb|EMS56245.1|  Germin-like protein 8-5                                 115   8e-29   
emb|CBI36783.3|  unnamed protein product                                117   8e-29   
ref|NP_001066188.1|  Os12g0154700                                       115   9e-29   
emb|CAN73846.1|  hypothetical protein VITISV_021637                     114   9e-29   
ref|NP_001066191.1|  Os12g0155000                                       115   1e-28   
gb|KCW76698.1|  hypothetical protein EUGRSUZ_D01058                     114   1e-28   
ref|XP_008678208.1|  PREDICTED: putative germin-like protein 12-4       115   1e-28   
ref|XP_004972675.1|  PREDICTED: putative germin-like protein 12-4...    115   1e-28   
sp|Q2QXJ0.2|GL124_ORYSJ  RecName: Full=Putative germin-like prote...    115   1e-28   
ref|XP_008678207.1|  PREDICTED: germin-like protein 8-5                 115   1e-28   
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807    118   1e-28   
ref|XP_006659187.1|  PREDICTED: germin-like protein 12-2-like           115   1e-28   
ref|XP_008662706.1|  PREDICTED: germin-like protein 12-2                115   1e-28   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        115   1e-28   
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...    115   1e-28   
ref|XP_008678218.1|  PREDICTED: putative germin-like protein 12-4...    115   1e-28   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     115   1e-28   
ref|XP_002443972.1|  hypothetical protein SORBIDRAFT_07g005260          115   1e-28   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     115   1e-28   
ref|XP_004972680.1|  PREDICTED: germin-like protein 8-7-like            115   2e-28   
gb|EAY82306.1|  hypothetical protein OsI_37516                          115   2e-28   
ref|XP_007140901.1|  hypothetical protein PHAVU_008G1508000g            113   2e-28   
ref|XP_008678222.1|  PREDICTED: putative germin-like protein 12-4       115   2e-28   
ref|XP_008678212.1|  PREDICTED: putative germin-like protein 12-4       115   2e-28   
emb|CAN74481.1|  hypothetical protein VITISV_042845                     114   2e-28   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    115   2e-28   
ref|XP_008678209.1|  PREDICTED: putative germin-like protein 12-4       115   2e-28   
emb|CAN73847.1|  hypothetical protein VITISV_021638                     115   2e-28   
ref|XP_008678216.1|  PREDICTED: putative germin-like protein 12-4       115   2e-28   
ref|XP_008678213.1|  PREDICTED: putative germin-like protein 12-4       115   2e-28   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    114   2e-28   
ref|XP_008678214.1|  PREDICTED: putative germin-like protein 12-4       114   2e-28   
ref|NP_001152592.1|  LOC100286232 precursor                             114   2e-28   
ref|XP_008662708.1|  PREDICTED: putative germin-like protein 12-4       114   2e-28   
ref|XP_006845853.1|  hypothetical protein AMTR_s00154p00039580          113   3e-28   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          114   3e-28   
ref|XP_002862402.1|  hypothetical protein ARALYDRAFT_497466             114   3e-28   
ref|NP_001066190.2|  Os12g0154900                                       114   3e-28   
ref|NP_001268128.1|  germin-like protein 5                              114   3e-28   
ref|NP_001152473.1|  germin-like protein subfamily 1 member 11 pr...    114   3e-28   
ref|XP_010689305.1|  PREDICTED: germin-like protein                     114   3e-28   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    114   3e-28   
ref|XP_002443979.1|  hypothetical protein SORBIDRAFT_07g005310          114   3e-28   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    114   3e-28   
ref|XP_008662711.1|  PREDICTED: putative germin-like protein 12-4       114   3e-28   
ref|XP_002443971.1|  hypothetical protein SORBIDRAFT_07g005250          114   3e-28   
sp|Q2QXJ1.1|GL123_ORYSJ  RecName: Full=Putative germin-like prote...    114   3e-28   
gb|EMS64312.1|  Germin-like protein 8-5                                 114   4e-28   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    114   4e-28   
gb|ACJ64505.1|  germin-like protein                                     114   4e-28   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          114   4e-28   
gb|ACG69489.1|  germin-like protein 13                                  114   4e-28   
ref|XP_002443973.1|  hypothetical protein SORBIDRAFT_07g005270          114   4e-28   
gb|KDP34916.1|  hypothetical protein JCGZ_09204                         114   4e-28   
emb|CDX95190.1|  BnaC09g16800D                                          113   4e-28   
ref|NP_001061161.1|  Os08g0189600                                       114   4e-28   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                114   4e-28   
ref|XP_006659192.1|  PREDICTED: germin-like protein 8-5-like            114   4e-28   
gb|ACT22751.1|  GER4b                                                   114   4e-28   
ref|XP_002443974.1|  hypothetical protein SORBIDRAFT_07g005280          114   4e-28   
ref|XP_006659188.1|  PREDICTED: germin-like protein 12-2-like           114   5e-28   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    114   5e-28   
ref|XP_006371121.1|  hypothetical protein POPTR_0019s04320g             112   5e-28   
ref|NP_001267940.1|  germin-like protein 1                              113   5e-28   
ref|NP_001061162.2|  Os08g0189700                                       114   5e-28   
emb|CDP22258.1|  unnamed protein product                                110   5e-28   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        113   5e-28   
ref|XP_006659191.1|  PREDICTED: germin-like protein 8-5-like            114   5e-28   
ref|NP_001061303.1|  Os08g0231400                                       113   6e-28   
ref|XP_006659186.1|  PREDICTED: germin-like protein 12-2-like           114   6e-28   
gb|AAG00426.1|AF250934_1  germin B                                      113   6e-28   
gb|ABG46236.1|  germin-like protein 4d                                  114   6e-28   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        113   6e-28   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              113   6e-28   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             113   6e-28   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    113   7e-28   
ref|XP_008678220.1|  PREDICTED: putative germin-like protein 12-4       113   7e-28   
dbj|BAJ85090.1|  predicted protein                                      113   7e-28   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...    113   7e-28   
ref|XP_006659190.1|  PREDICTED: germin-like protein 8-5-like            113   7e-28   
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             113   7e-28   
dbj|BAK03371.1|  predicted protein                                      113   8e-28   
gb|ABG46235.1|  germin-like protein 4c                                  113   8e-28   
gb|AAG00427.1|AF250935_1  germin F                                      113   8e-28   
ref|XP_002443981.1|  hypothetical protein SORBIDRAFT_07g005330          113   9e-28   
emb|CAA63659.1|  oxalate oxidase-like protein or germin-like protein    113   9e-28   
gb|AAG00428.1|AF250936_1  germin D                                      113   9e-28   
ref|XP_002443983.1|  hypothetical protein SORBIDRAFT_07g005350          113   9e-28   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             113   1e-27   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    113   1e-27   
ref|NP_001066189.1|  Os12g0154800                                       113   1e-27   
ref|XP_002443982.1|  hypothetical protein SORBIDRAFT_07g005340          112   1e-27   
emb|CDP10695.1|  unnamed protein product                                112   1e-27   
ref|XP_002443969.1|  hypothetical protein SORBIDRAFT_07g005240          113   1e-27   
emb|CAB55558.1|  germin-like protein                                    113   1e-27   
ref|XP_004972688.1|  PREDICTED: putative germin-like protein 12-4...    112   1e-27   
gb|EEC83018.1|  hypothetical protein OsI_28085                          112   1e-27   
ref|XP_004972686.1|  PREDICTED: putative germin-like protein 12-4...    112   1e-27   
gb|EMT00456.1|  Germin-like protein 8-5                                 112   1e-27   
ref|NP_001061159.2|  Os08g0189400                                       112   1e-27   
gb|AAT67049.1|  germin-like protein 4                                   112   1e-27   
emb|CDM81151.1|  unnamed protein product                                112   1e-27   
ref|XP_004972685.1|  PREDICTED: putative germin-like protein 12-4...    112   1e-27   
emb|CAN71140.1|  hypothetical protein VITISV_005471                     112   2e-27   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     112   2e-27   
ref|XP_002443980.1|  hypothetical protein SORBIDRAFT_07g005320          112   2e-27   
sp|Q6YZA6.1|GL85_ORYSJ  RecName: Full=Germin-like protein 8-5; Fl...    112   2e-27   
gb|KCW61434.1|  hypothetical protein EUGRSUZ_H04164                     112   2e-27   
ref|XP_004972687.1|  PREDICTED: germin-like protein 12-2-like           112   2e-27   
ref|XP_010024910.1|  PREDICTED: germin-like protein subfamily 1 m...    112   2e-27   
ref|XP_006659194.1|  PREDICTED: germin-like protein 8-5-like            112   2e-27   
ref|XP_004972683.1|  PREDICTED: germin-like protein 8-5-like            112   2e-27   
ref|NP_001061163.1|  Os08g0189900                                       112   2e-27   
ref|XP_004972684.1|  PREDICTED: germin-like protein 8-5-like            112   2e-27   
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        112   2e-27   
ref|XP_004972678.1|  PREDICTED: germin-like protein 12-2-like iso...    111   2e-27   
dbj|BAJ98952.1|  predicted protein                                      112   2e-27   
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g             112   3e-27   
gb|EMS52045.1|  Germin-like protein 12-2                                112   3e-27   
ref|XP_003573393.1|  PREDICTED: germin-like protein 8-6                 112   3e-27   
gb|EMT01744.1|  Germin-like protein 8-5                                 111   3e-27   
ref|XP_003573395.1|  PREDICTED: germin-like protein 8-11                111   3e-27   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...    114   3e-27   
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...    111   3e-27   
ref|XP_002443976.1|  hypothetical protein SORBIDRAFT_07g005300          111   4e-27   
ref|XP_003568179.1|  PREDICTED: germin-like protein 8-4                 111   4e-27   
gb|EMT32553.1|  Putative germin-like protein 2-2                        111   4e-27   
ref|XP_009414514.1|  PREDICTED: putative germin-like protein 2-1        111   4e-27   
gb|AAX84674.1|  germin-like protein GLP                                 111   4e-27   
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8                 111   4e-27   
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1        111   4e-27   
ref|XP_002445171.1|  hypothetical protein SORBIDRAFT_07g005230          111   4e-27   
ref|XP_004972677.1|  PREDICTED: germin-like protein 12-2-like iso...    111   4e-27   
gb|AAG00429.1|AF250937_1  germin E                                      110   4e-27   
ref|XP_009402555.1|  PREDICTED: putative germin-like protein 2-2 ...    110   5e-27   
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg             111   5e-27   
gb|KHN38130.1|  Germin-like protein 12-1                                107   5e-27   
ref|XP_009402552.1|  PREDICTED: germin-like protein 12-2 isoform X1     110   5e-27   



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   145 bits (365),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G++ A+AFAGLSSQNPGVITIANAVFGSDPPIS +VLT+A
Sbjct  149  LYPGDVFVFPEGLIHFQFNVGNTNAVAFAGLSSQNPGVITIANAVFGSDPPISSDVLTRA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVI YLQ QFW++NN
Sbjct  209  FQVDKNVIKYLQGQFWWDNN  228



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVIT+ANAVFGSDPPI+P VLTKA
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPPINPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  211  FQVEKNVIDYLQAQFWWN  228



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VLTKA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V++YLQSQFW++NN
Sbjct  209  FQLDKKVVDYLQSQFWWDNN  228



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VLTKA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+K V++YLQSQFW++NN
Sbjct  209  FQVEKKVVDYLQSQFWWDNN  228



>gb|EYU43092.1| hypothetical protein MIMGU_mgv1a020152mg, partial [Erythranthe 
guttata]
Length=85

 Score =   136 bits (343),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P VLTKA
Sbjct  6    LHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKA  65

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+K+VI YLQ+QFW+N
Sbjct  66   FQVEKDVIEYLQAQFWWN  83



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNP VITIANAVFGSDPPI+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPSVITIANAVFGSDPPINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ QFW+N
Sbjct  212  FQVEKNVIDYLQKQFWWN  229



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFA LSSQNPGVIT+ANAVFGSDPPI+P VLTKA
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITVANAVFGSDPPINPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  211  FQVEKNVIDYLQAQFWWN  228



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P+VLTKA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P+VLTKA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFG DPPI+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGLDPPINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW N
Sbjct  212  FQVEKNVIDYLQAQFWTN  229



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G +KA+AFA LSSQNPGVIT+ANAVFGSDPPI+  VLTKA
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTKAVAFAALSSQNPGVITVANAVFGSDPPINRAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  211  FQVEKNVIDYLQAQFWWN  228



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN GHS A+AFAGLSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  148  LNPGDVFVFPEGLIHFQFNKGHSSAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+ YLQSQFW +N+
Sbjct  208  FQVDKNVVKYLQSQFWRDNH  227



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN GHS A+AFAGLSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  148  LNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+ YLQSQFW++N+
Sbjct  208  FQVDKNVVKYLQSQFWWDNH  227



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDP I+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KN+I+YLQ+QFW+N
Sbjct  212  FQVEKNIIDYLQAQFWWN  229



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFA LSSQNPGVITIANAVFGSDPPI+P VLTK 
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPPINPAVLTKG  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  211  FQVEKNVIDYLQAQFWWN  228



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANA+FGSDPPI+ +VLTKA
Sbjct  149  LKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAIFGSDPPINEDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQSQFW++NN
Sbjct  209  FQVDKKVIDYLQSQFWWDNN  228



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN GHS A+AFA LSSQNPGVITIANAVFGS+PPI P+VLTKA
Sbjct  150  LNPGDVFVFPEGLIHFQFNQGHSNAVAFAALSSQNPGVITIANAVFGSNPPIYPDVLTKA  209

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVI YLQSQFW++N+
Sbjct  210  FQVDKNVIKYLQSQFWWDNH  229



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN G + A+AFAGLSSQNPGVITIANAVFGSDP I+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNAGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  212  FQVEKNVIDYLQAQFWWN  229



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VLTKA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D  V++YLQSQFW++NN
Sbjct  209  FQLDNKVVDYLQSQFWWDNN  228



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFA LSSQNPGVITIAN VFGSDPPI+P VLTKA
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANTVFGSDPPINPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV KNVI+YLQ+QFW+N
Sbjct  211  FQVKKNVIDYLQAQFWWN  228



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+ ++L KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+ ++L KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVIT+ANAVFGSDP I+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPQINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW N
Sbjct  212  FQVEKNVIDYLQAQFWTN  229



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVHYLQSQFWWDNN  228



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P VLTKA
Sbjct  151  LHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+K+VI+YLQ+QFW+N
Sbjct  211  FQVEKDVIDYLQAQFWWN  228



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG +KA+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LKPGDVFVFPIGLIHFQFNIGKNKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQSQFW++NN
Sbjct  209  FQVDKKVIDYLQSQFWWDNN  228



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  150  LYPGDVFVFPQGLIHFQFNVGKTNALAFAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  209

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+KNVI+YLQ+QFW+N N
Sbjct  210  FQVEKNVIDYLQAQFWWNIN  229



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVIT+ANAVFGSDP I+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+KNVI+YLQ+QFW + N
Sbjct  212  FQVEKNVIDYLQAQFWTDIN  231



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVIT+ANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITVANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG + A+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VINYLQSQFW++NN
Sbjct  209  FQVDKKVINYLQSQFWWDNN  228



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPIS +VL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPISDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V++YLQSQFW++NN
Sbjct  209  FQIDKKVVDYLQSQFWWDNN  228



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P VLTKA
Sbjct  151  LHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+K+VI YLQ+QFW+N
Sbjct  211  FQVEKDVIEYLQAQFWWN  228



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P VLTKA
Sbjct  151  LHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+K+VI YLQ+QFW+N
Sbjct  211  FQVEKDVIEYLQAQFWWN  228



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFAGLSSQNPGVIT+ANAVFGSDP I+P VLTKA
Sbjct  152  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLTKA  211

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+KNVI+YLQ+QFW + N
Sbjct  212  FQVEKNVIDYLQAQFWTDIN  231



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP+GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P VLTKA
Sbjct  151  LHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPVVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+K+VI YLQ+QFW+N
Sbjct  211  FQVEKDVIEYLQAQFWWN  228



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   136 bits (343),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG + A+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINVDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQSQFW++NN
Sbjct  209  FQVDKKVIDYLQSQFWWDNN  228



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   136 bits (343),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTDAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V++YLQSQFW++NN
Sbjct  209  FQIDKKVVDYLQSQFWWDNN  228



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V++YLQSQFW++NN
Sbjct  209  FQIDKKVVDYLQSQFWWDNN  228



>gb|KCW64216.1| hypothetical protein EUGRSUZ_G018672, partial [Eucalyptus grandis]
Length=79

 Score =   131 bits (330),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  1    LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  60

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDK V++YLQ+QFWY+N
Sbjct  61   FQVDKKVVDYLQAQFWYDN  79



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  149  LNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQSQFW++NN
Sbjct  209  FQVDNKVVDYLQSQFWWDNN  228



>ref|XP_009620876.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=211

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  132  LNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  191

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQSQFW++NN
Sbjct  192  FQVDNKVVDYLQSQFWWDNN  211



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFPEGLIHFQFN+G + A+AFA LSSQNPGVITIANAVFGSDP I+  VLTKA
Sbjct  151  LYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPTINTAVLTKA  210

Query  182  FQVDKNVINYLQSQFWYN  235
            FQV+KNVI+YLQ+QFW+N
Sbjct  211  FQVEKNVIDYLQAQFWWN  228



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDP I+ +VL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPSINNDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+K V+NYLQSQFW++NN
Sbjct  209  FQVEKKVVNYLQSQFWWDNN  228



>ref|XP_002530595.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31775.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
Length=209

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIGH+ A+AFAGLSSQNPGVITIANAVFGS+P I+P+VLTKA
Sbjct  130  LKPGDVFVFPVGLIHFQFNIGHNNAVAFAGLSSQNPGVITIANAVFGSNPSINPDVLTKA  189

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V+NYLQ QFW NN+
Sbjct  190  FQVDKIVVNYLQEQFWTNNH  209



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN GHS A+AFAGL SQNPGVITIANAVFGSDPPISP+VLTKA
Sbjct  148  LNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV  +VI  LQSQFW++NN
Sbjct  208  FQVGNDVIKKLQSQFWWDNN  227



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN GHS A+AFAGLSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  377  LNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKA  436

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+ YLQSQFW++N+
Sbjct  437  FQVDKNVVKYLQSQFWWDNH  456


 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN GHS A+AFAGL SQNPGVITIANAVFGSDPPISP+VLTKA
Sbjct  148  LNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV  +VI  LQSQFW++NN
Sbjct  208  FQVGNDVIKKLQSQFWWDNN  227



>emb|CAN74480.1| hypothetical protein VITISV_042844 [Vitis vinifera]
Length=192

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI P+VLT+A
Sbjct  113  LYKGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  172

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D++V+  LQS+FW++NN
Sbjct  173  FQLDEDVVKDLQSRFWWDNN  192



>ref|NP_001268198.1| germin-like protein 3 precursor [Vitis vinifera]
 gb|AAQ63185.2| germin-like protein 3 [Vitis vinifera]
Length=225

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI P+VLT+A
Sbjct  146  LYKGDVFVFPIGLIHFQFNVGKAKAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D++V+  LQS+FW++NN
Sbjct  206  FQLDEDVVKDLQSRFWWDNN  225



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNP VITIANA+FGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPVVITIANAIFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>ref|XP_002531991.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30390.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=194

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP G+IHFQFN G + A+AFAGLSSQNPG ITIANAVFGS+PPI+P+VLTKA
Sbjct  115  LKPGDVFVFPIGMIHFQFNTGSTNAVAFAGLSSQNPGAITIANAVFGSNPPINPDVLTKA  174

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK+V+NYLQ QFW NN+
Sbjct  175  FQVDKSVVNYLQKQFWMNNH  194



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG + A+AFAGLSSQNPGVITIANAVFGSDP I+ +VL KA
Sbjct  149  LKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPSINADVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQSQFW++NN
Sbjct  209  FQVDKKVIDYLQSQFWWDNN  228



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVFGS PPI  +VL KA
Sbjct  143  LNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+QFW +NN
Sbjct  203  FQVDKKVIDYLQAQFWMDNN  222



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   134 bits (337),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQFNIG ++A+AFAGLSSQN GVITIANAVFGSDPPI+P+VLTKA
Sbjct  147  LYPGDVFVFPIGLIHFQFNIGKTEAVAFAGLSSQNAGVITIANAVFGSDPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFW  229
            FQ+DKN++ YLQS+FW
Sbjct  207  FQLDKNMVAYLQSRFW  222



>emb|CAN74828.1| hypothetical protein VITISV_002139 [Vitis vinifera]
Length=186

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P+VLT+A
Sbjct  107  LYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  166

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D++V+  LQS+FW++NN
Sbjct  167  FQLDEDVVKDLQSRFWWDNN  186



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFAGLSSQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  147  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKN++  LQS+FW++NN
Sbjct  207  FQLDKNIVTSLQSRFWWDNN  226



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFAGLSSQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  147  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKN++  LQS+FW++NN
Sbjct  207  FQLDKNIVTSLQSRFWWDNN  226



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFAGLSSQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  147  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKN++  LQS+FW++NN
Sbjct  207  FQLDKNIVTSLQSRFWWDNN  226



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVFGS PPI  +VL KA
Sbjct  143  LNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+QFW +NN
Sbjct  203  FQVDKKVIDYLQAQFWMDNN  222



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQFNIG  KA+A AGLSSQNPG ITIANAVFGS PPI  +VLTKA
Sbjct  151  LYPGDVFVFPVGLIHFQFNIGKVKAVAIAGLSSQNPGAITIANAVFGSKPPIKFDVLTKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV+ YLQ+QFWY+NN
Sbjct  211  FQVDNNVVQYLQNQFWYDNN  230



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIAN VFGSDP I+ +VL KA
Sbjct  149  LKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLSSQNPGVITIANTVFGSDPQINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQSQFW++NN
Sbjct  209  FQVDKKVIDYLQSQFWWDNN  228



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVFGS PPI  +VL KA
Sbjct  143  LNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+QFW +NN
Sbjct  203  FQVDKKVIDYLQAQFWMDNN  222



>ref|XP_010659820.1| PREDICTED: germin-like protein 3 isoform X1 [Vitis vinifera]
Length=190

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P+VLT+A
Sbjct  111  LYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  170

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D++V+  LQS+FW++NN
Sbjct  171  FQLDEDVVKDLQSRFWWDNN  190



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 77/104 (74%), Gaps = 18/104 (17%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN GHS A+AFAGL SQNPGVITIANAVFGS+PPISP+VLTKA
Sbjct  148  LNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSNPPISPDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN**SKLRMDFP*LHNWIRNTYSFRQ  313
            FQVDK VI YLQSQFW                   IR T+S RQ
Sbjct  208  FQVDKKVIKYLQSQFWE------------------IRTTFSVRQ  233


 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN G + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  406  LNPGDVFVFPEGLIHFQFNQGQTNAVAFAALSSQNPGVITIANAVFGSKPPISRDVLTKA  465

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVI YLQSQFW++N+
Sbjct  466  FQVDKNVIKYLQSQFWWDNH  485



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_004301229.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQFNIG   A+A AGLSSQNPGVITIANAVFGS PPI  +VLTKA
Sbjct  130  LYPGDVFVFPVGLIHFQFNIGKVNAVAIAGLSSQNPGVITIANAVFGSKPPIKLDVLTKA  189

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+ NV+ YLQ+QFWY+NN
Sbjct  190  FQVESNVVEYLQNQFWYDNN  209



>ref|XP_010024923.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61463.1| hypothetical protein EUGRSUZ_H04199 [Eucalyptus grandis]
Length=223

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AFAGLSSQNPG+ITIANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  204  FQVDKKVVDYLQAQFWYDNN  223



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AFAGLSSQNPG+ITIANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  204  FQVDKKVVDYLQAQFWYDNN  223



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AFAGLSSQNPG+ITIANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  204  FQVDKKVVDYLQAQFWYDNN  223



>ref|XP_007201690.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
 gb|EMJ02889.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
Length=183

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  104  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  163

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQ QFWY+NN
Sbjct  164  FQVDNKVVDYLQKQFWYDNN  183



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AFAGLSSQNPG+ITIANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  204  FQVDKKVVDYLQAQFWYDNN  223



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI P+VLT+A
Sbjct  146  LYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D++V+  LQS+FW++NN
Sbjct  206  FQLDEDVVKDLQSRFWWDNN  225



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ++  V++YLQSQFW++NN
Sbjct  209  FQIENKVVDYLQSQFWWDNN  228



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPG+ITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFA   SQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  146  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLTKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKNV+ YLQSQFW++NN
Sbjct  206  FQLDKNVVKYLQSQFWWDNN  225



>ref|XP_011034308.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GL+HFQ N+G + A+AFA LSSQNPGVITIANAVFG+DPPI+PNVLTKA
Sbjct  148  LNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ QFW +NN
Sbjct  208  FQVDKKLVDYLQKQFWTDNN  227



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD+ V++YLQ+QFWY+NN
Sbjct  202  FQVDRKVVDYLQAQFWYDNN  221



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GL+HFQ N+G + A+AFA LSSQNPGVITIANAVFG+DPPI+PNVLTKA
Sbjct  148  LNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ QFW +NN
Sbjct  208  FQVDKKLVDYLQKQFWTDNN  227



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQ QFWY+NN
Sbjct  207  FQVDNKVVDYLQKQFWYDNN  226



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AFAGLSSQ+PGVITIANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQSPGVITIANAVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  204  FQVDKKVVDYLQAQFWYDNN  223



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA+AFAG +SQN GVITIANAVFGSDPPI+ ++L KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNVGKTKAVAFAGFNSQNQGVITIANAVFGSDPPINDDILAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW++NN
Sbjct  209  FQVDKKVVDYLQSQFWWDNN  228



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQ QFWY+NN
Sbjct  207  FQVDNKVVDYLQKQFWYDNN  226



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  149  LYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  209  FQVDBNVVDYLQKQFWYNNS  228



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  149  LYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  209  FQVDBNVVDYLQKQFWYNNS  228



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  149  LYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  209  FQVDDNVVDYLQKQFWYNNS  228



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  149  LYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  209  FQVDDNVVDYLQKQFWYNNS  228



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVFG+ PPI  +VL KA
Sbjct  143  LNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGAKPPIKDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+QFW +NN
Sbjct  203  FQVDKKVIDYLQAQFWMDNN  222



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+ +AIA AGLSSQNPGVITIANAVFGS PPIS  VLTKA
Sbjct  143  LNKGDVFVFPIGLIHFQLNVGYGEAIAIAGLSSQNPGVITIANAVFGSKPPISLEVLTKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVI+YLQ QFWYNN+
Sbjct  203  FQVDKNVIDYLQKQFWYNNS  222



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG +  +AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPTLAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  202  FQVDKKVVDYLQAQFWYDNN  221



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  147  LNEGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD N+++YLQ QFWY+NN
Sbjct  207  FQVDNNLVDYLQKQFWYDNN  226



>ref|XP_002530594.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF31774.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=190

 Score =   130 bits (327),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP G+IHFQFN G++ A+AFAGLSSQNPG ITIANAVFGS+PPI+ +VLTKA
Sbjct  111  LKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTKA  170

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDKNV+ YLQ QFW NN
Sbjct  171  FQVDKNVVKYLQQQFWTNN  189



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVINYLQSQFW +N+
Sbjct  207  FQVDKNVINYLQSQFWTDNH  226



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  149  LYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  209  FQVDDNVVDYLQKQFWYNNS  228



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDK V++YLQ+QFWY+N
Sbjct  202  FQVDKKVVDYLQAQFWYDN  220



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ Q WY+NN
Sbjct  207  FQVDDNVVDYLQKQLWYDNN  226



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGARPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ+QFWY+NN
Sbjct  204  FQVDKKIVDYLQAQFWYDNN  223



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP G+IHFQFN G++ A+AFAGLSSQNPG ITIANAVFGS+PPI+ +VLTKA
Sbjct  144  LKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+ YLQ QFW NN+
Sbjct  204  FQVDKNVVKYLQKQFWTNNH  223



>gb|KCW61441.1| hypothetical protein EUGRSUZ_H04171 [Eucalyptus grandis]
Length=217

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  138  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  197

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  198  FQVDKKAVDYLQAQFWYDNN  217



>ref|XP_006387364.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
 gb|ERP46278.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
Length=228

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQ N+G + A+AFA LSSQNPGVITIA AVFG+DPPI+PNVLTKA
Sbjct  148  LNPGDVFVFPVGLIHFQLNVGRTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ Q W +NN
Sbjct  208  FQVDKKVVDYLQKQLWTDNN  227



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+GH  A+AFAGLSSQNPGVITIANAVFGS P I+P+VL KA
Sbjct  155  LNKGDVFVFPIGLIHFQFNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  214

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWY+NN
Sbjct  215  FQVDNNVVDYLQKQFWYDNN  234



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G + A+AFAGLSSQNPGVI IANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLSSQNPGVIIIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ++  V++YLQSQFW++NN
Sbjct  209  FQIENKVVDYLQSQFWWDNN  228



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  204  FQVDKKTVDYLQAQFWYDNN  223



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN G +K +AFAGLSSQNPGVITIANAVFGSDPPI+ +VL KA
Sbjct  149  LHPGDVFVFPIGLIHFQFNPGKTKTVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ++  V++YLQSQFW++NN
Sbjct  209  FQIENKVVDYLQSQFWWDNN  228



>ref|XP_002319184.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 ref|XP_002319673.2| germin-like protein 1 [Populus trichocarpa]
 ref|XP_006375916.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 ref|XP_002319185.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
 gb|EEE95107.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 gb|EEE95596.2| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53713.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 gb|EEE95108.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
Length=228

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQ N+G + A+AFA LSSQNPGVITIA AVFG+DPPI+PNVLTKA
Sbjct  148  LNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ Q W +NN
Sbjct  208  FQVDKKVVDYLQKQLWTDNN  227



>ref|XP_010024912.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=229

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  150  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  209

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  210  FQVDKKAVDYLQAQFWYDNN  229



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  596  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  655

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKN++  LQS+FW++NN
Sbjct  656  FQLDKNIVTSLQSRFWWDNN  675


 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG + A+AFAGLSSQN GVITIA AVFGS+PPI P+VLTKA
Sbjct  374  LNPGDVFVFPIGLIHFQFNIGKTAAVAFAGLSSQNAGVITIAKAVFGSNPPIKPDVLTKA  433

Query  182  FQVDKNV  202
            FQ+DKNV
Sbjct  434  FQLDKNV  440


 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGD F+FP GLIHFQFN+G + A+AFA LSSQNP VITI NAVFGS+P I+P+VL K 
Sbjct  83   LNPGDGFLFPVGLIHFQFNVGKTNAVAFAALSSQNPDVITIVNAVFGSNPAINPDVLVKD  142

Query  182  FQVDKNVIN  208
            FQ+D N+I+
Sbjct  143  FQLDINMIS  151



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  204  FQVDKKTVDYLQAQFWYDNN  223



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  204  FQVDKKTVDYLQAQFWYDNN  223



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+GH+  +A A LSSQNPGVITIANAVFGSDPPIS +VLTKA
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGHTNTVAIAALSSQNPGVITIANAVFGSDPPISIDVLTKA  205

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQ+DK+V+NYLQS FW++N
Sbjct  206  FQLDKDVVNYLQSSFWWDN  224



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVFGS PPI  +VL KA
Sbjct  143  LNKGDVFVFPVGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSXPPIKDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+QFW +NN
Sbjct  203  FQVDKKVIDYLQAQFWMDNN  222



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  155  LNKGDVFVFPIGLIHFQLNVGYVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  214

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWY+NN
Sbjct  215  FQVDNNVVDYLQKQFWYDNN  234



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS + LTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADALTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I+YLQ+QFWY+NN
Sbjct  204  FQVDKKTIDYLQAQFWYDNN  223



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQFN+G + A+AFA LSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  146  LYPGDVFVFPIGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGANPPINPDVLVKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKNV+  LQS+FW+ NN
Sbjct  206  FQLDKNVVKNLQSKFWWANN  225



>ref|XP_002319656.2| hypothetical protein POPTR_0013s04860g, partial [Populus trichocarpa]
 gb|EEE95579.2| hypothetical protein POPTR_0013s04860g, partial [Populus trichocarpa]
Length=101

 Score =   126 bits (316),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  27   LKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  86

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQ  F
Sbjct  87   FQLDKKVVDYLQKAF  101



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN GHS A+AFAGL SQNPGVITIANAVFGSDPPISP+VLTKA
Sbjct  609  LNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKA  668

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV  +VI  LQSQFW++NN
Sbjct  669  FQVGNDVIKKLQSQFWWDNN  688


 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN G + A+AFAGL SQNPGVITIANAVFGSDPPISP+VLTKA
Sbjct  148  LNPGDVFVFPQGLIHFQFNQGETDAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV  +VI  LQ Q  ++ +
Sbjct  208  FQVGNDVIKKLQVQLIFDTS  227


 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN GHS A+AFAGL SQNPGVITIANAVFGSDPPISP+VLTKA
Sbjct  379  LNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKA  438

Query  182  FQVDKNVI  205
            FQV  +V+
Sbjct  439  FQVGNDVL  446



>ref|XP_007140903.1| hypothetical protein PHAVU_008G1509000g, partial [Phaseolus vulgaris]
 gb|ESW12897.1| hypothetical protein PHAVU_008G1509000g, partial [Phaseolus vulgaris]
Length=88

 Score =   125 bits (314),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPG ITIANA+F SDPPISP VLTKA
Sbjct  9    LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKSDPPISPEVLTKA  68

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK+ I+YLQ Q WY+NN
Sbjct  69   FQVDKSTIDYLQKQSWYDNN  88



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G++ A+AFAGLSSQNPGVITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNCGNTYALAFAGLSSQNPGVITIANAVFGAKSPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YL++QFWY+NN
Sbjct  204  FQVDKKVVDYLEAQFWYDNN  223



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS P I+P+VL KA
Sbjct  149  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWY+NN
Sbjct  209  FQVDNNVVDYLQKQFWYDNN  228



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFA   SQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  397  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLTKA  456

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKNV+ YLQSQFW++NN
Sbjct  457  FQLDKNVVKYLQSQFWWDNN  476


 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NIG + A+AFAGLSSQNPGVITIA AVFGS+PPI+P+VLTKA
Sbjct  147  LYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQ+DKN++  LQS+ 
Sbjct  207  FQLDKNIVTSLQSRL  221



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA A   LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN++++LQ QFWY+NN
Sbjct  206  FQVDKNIVDFLQKQFWYDNN  225



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+ GDVFVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LHKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+NYLQSQFW +N+
Sbjct  207  FQVDKNVVNYLQSQFWTDNH  226



>gb|ADD71877.1| germin-like protein subfamily 1 member 1 precursor [Arachis hypogaea]
Length=223

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ NIG+  A A AGLSSQNPGVITIANAVFGS PPISP +L KA
Sbjct  144  LNKGDVFVFPIGLIHFQSNIGYGNAFAIAGLSSQNPGVITIANAVFGSTPPISPEILAKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NVINYLQ QFWY+NN
Sbjct  204  FQVDNNVINYLQKQFWYDNN  223



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   129 bits (323),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQ N+G + AIAFAGLSSQN GVIT+ANAVFGSDPPI+ +VL KA
Sbjct  151  LNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I+ LQ QFW++NN
Sbjct  211  FQVDKKAIDDLQEQFWWDNN  230



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score =   129 bits (323),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFA LSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I+YLQ+QFWY+NN
Sbjct  204  FQVDKKTIDYLQAQFWYDNN  223



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VF S PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ QFWY+NN
Sbjct  202  FQVDKKVVDYLQVQFWYDNN  221



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A A  SSQNPGVIT+ANAVFGS PPI+P+VLTKA
Sbjct  151  LYKGDVFVFPFGLIHFQLNVGKTNAVAIAAFSSQNPGVITVANAVFGSKPPINPDVLTKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++YLQ QFWYNN+
Sbjct  211  FQVDNNVVDYLQKQFWYNNS  230



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH+ A+A AGLSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  146  LNKGDVFVFPVGLIHFQLNVGHTSAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +++YLQ QFWY+NN
Sbjct  206  FQVDDKLVSYLQKQFWYDNN  225



>ref|XP_007030263.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10765.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=252

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ N+G + A+AFAGLSSQNPGVITIANAVFGS+PPI+P+VLT+A
Sbjct  173  LYPGDVFVFPIGLIHFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINPDVLTRA  232

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQ+D  V+ YLQS+FW+ N
Sbjct  233  FQLDNKVVKYLQSRFWWKN  251



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN +NYLQSQFW +N+
Sbjct  207  FQVDKNEVNYLQSQFWTDNH  226



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+PGDVFVFP GLIHFQFN+G +KA A   LSSQNPGVITI NAVFGS PPI  +VL KA
Sbjct  142  LHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVLAKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN+++YLQ QFWY+NN
Sbjct  202  FQVDKNLVDYLQKQFWYDNN  221



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  377  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  436

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQ QFWY+NN
Sbjct  437  FQVDNKVVDYLQKQFWYDNN  456


 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKA  206

Query  182  FQVDKNVINYLQSQFWYNNN**SKLRMD  265
            FQVD  V++YLQ QFWY+N   + ++ D
Sbjct  207  FQVDNKVVDYLQKQFWYDNTRPTAMKGD  234



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VFGS PPIS +VLTKA
Sbjct  369  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKA  428

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  429  FQVDKKVVDYLQAQFWYDNN  448


 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+N 
Sbjct  202  FQVDKKVVDYLQAQFWYDNK  221



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFA LSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFASLSSQNPGVITIANSVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  204  FQVDKKTVDYLQAQFWYDNN  223



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPG+ITIANAVFGS PPIS  VLTKA
Sbjct  413  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAGVLTKA  472

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+NN
Sbjct  473  FQVDKKVVDYLQAQFWYDNN  492


 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFW  229
            FQVDK V++YLQ+QFW
Sbjct  202  FQVDKKVVDYLQAQFW  217



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  147  LYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVD+  ++YLQ QFWYNN
Sbjct  207  FQVDEKEVDYLQKQFWYNN  225



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A + LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ QFWY+NN
Sbjct  206  FQVDKKIVDYLQKQFWYDNN  225



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP+GLIHFQFN+GH+ A+AFAGLSSQNPG ITIANAVF + PPI  +VL KA
Sbjct  143  LNKGDVFVFPKGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFEAKPPIKNDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFW +NN
Sbjct  203  FQVDKKVVDYLQAQFWMDNN  222



>ref|XP_007030283.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10785.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=166

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFNIG +KA+AFAGLSSQN  VITIA AVFGS+PPI+P+VLTKA
Sbjct  89   LNPGDVFVFPIGLIHFQFNIGKTKAVAFAGLSSQNAVVITIAKAVFGSNPPINPDVLTKA  148

Query  182  FQVDKNVINYLQSQFW  229
            FQ+DK V++YLQS+FW
Sbjct  149  FQLDKTVVSYLQSRFW  164



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPGVITIANAVFGS PPIS  +L KA
Sbjct  143  LNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDEILAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN I+YLQ QFWYNNN
Sbjct  203  FQVDKNTIDYLQKQFWYNNN  222



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGL+HFQ N+G + AIAFAGLSSQN GVIT+ANAVFGSDPPI+ +VL KA
Sbjct  151  LNPGDVFVFPEGLVHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+ LQ Q W++NN
Sbjct  211  FQVDKKVIDNLQEQIWWDNN  230



>ref|XP_008381868.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=185

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+A AGLSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  106  LNKGDVFVFPVGLIHFQLNVGHXXAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  165

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +++YLQ QFWY+NN
Sbjct  166  FQVDDKLVSYLQKQFWYDNN  185



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A + LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK +++YLQ QFWY+NN
Sbjct  206  FQLDKKIVDYLQKQFWYDNN  225



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIA AVFGS PPI+P+VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++ LQ QFWY+NN
Sbjct  207  FQVDDNVVDNLQKQFWYDNN  226



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YL +QFWY+NN
Sbjct  204  FQVDKKTVDYLLAQFWYDNN  223



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIANAVFGS PPIS +VLTKA
Sbjct  142  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ+QFWY+N 
Sbjct  202  FQVDKKVVDYLQAQFWYDNK  221


 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG + A+AFA LSSQNPGVITIAN+VF S PPIS +VLTKA
Sbjct  369  LYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTKA  428

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQ QFWY+NN
Sbjct  429  FQVDKKVVDYLQVQFWYDNN  448



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+A A LSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  154  LNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKA  213

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V+NYLQ QFWYNN+
Sbjct  214  FQVDNKVVNYLQKQFWYNNS  233



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIA AVFGS PPI+P+VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIAKAVFGSQPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD NV++ LQ QFWY+NN
Sbjct  207  FQVDDNVVDNLQKQFWYDNN  226



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A + LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  157  LKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKA  216

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ QFWY+NN
Sbjct  217  FQVDKKIVDYLQKQFWYDNN  236



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G++ A+AFAGLSSQNPGVITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGNTNALAFAGLSSQNPGVITIANAVFGAKLPISTDVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  204  FQVDKKEVDYLQAQFWYDNN  223



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPGVITIANAVFGS PPIS  +L KA
Sbjct  147  LNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDEILAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN I+YLQ QFWYNNN
Sbjct  207  FQVDKNTIDYLQKQFWYNNN  226



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQFN GH+K IA   LSSQNPG ITIANAVFGS PPIS +VL KA
Sbjct  143  LKKGDVFVFPEGLIHFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I++LQ+QFW +NN
Sbjct  203  FQVDKKTIDWLQAQFWTDNN  222



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP+GL HFQFN+GH+ A+AFAGLSSQNPG ITIANAVFG  PPI  +VL KA
Sbjct  144  LNKGDVFVFPQGLTHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGPKPPIKDDVLAKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK VI+YLQ+Q+W +NN
Sbjct  204  FQVDKKVIDYLQAQYWMDNN  223



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFNIGH+ A+A AGLSSQNPGVITIANAVFGSDP I+P+ LT+A
Sbjct  146  LNKGDVFVFPMGLIHFQFNIGHTNAVAIAGLSSQNPGVITIANAVFGSDPSINPDFLTRA  205

Query  182  FQVDKNVINYLQSQF  226
            FQ+DKNV+NYLQS+F
Sbjct  206  FQLDKNVVNYLQSRF  220



>emb|CAN79051.1| hypothetical protein VITISV_025926 [Vitis vinifera]
Length=195

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVF+FPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  121  LYKGDVFIFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  180

Query  182  FQVDKNVINYLQSQF  226
            FQVDKNV++YLQSQF
Sbjct  181  FQVDKNVVDYLQSQF  195



>ref|XP_008358299.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=185

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N GH+ A+A AGLSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  106  LNKGDVFVFPVGLIHFQLNXGHTXAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  165

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +++YLQ QFWY+NN
Sbjct  166  FQVDDKLVSYLQXQFWYDNN  185



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A + LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ Q WY+NN
Sbjct  206  FQVDKKIVDYLQKQLWYDNN  225



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  148  LNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D   + YLQ QFWYNNN
Sbjct  208  FQIDDKEVEYLQKQFWYNNN  227



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+A AGLSSQNPGVITIANAVFGS+PPI+P+VL KA
Sbjct  148  LNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSSQNPGVITIANAVFGSNPPINPDVLAKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D   + YLQ QFWYNNN
Sbjct  208  FQIDDKEVEYLQKQFWYNNN  227



>ref|XP_011013026.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQ N+G + A+AFA LSSQNPGVITIANAVFG+DPP++PNVLTKA
Sbjct  148  LNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            F +DK ++ YLQ Q W +NN
Sbjct  208  FHLDKKLVEYLQKQIWTDNN  227



>ref|XP_007140907.1| hypothetical protein PHAVU_008G151200g [Phaseolus vulgaris]
 ref|XP_007140912.1| hypothetical protein PHAVU_008G151500g [Phaseolus vulgaris]
 gb|ESW12901.1| hypothetical protein PHAVU_008G151200g [Phaseolus vulgaris]
 gb|ESW12906.1| hypothetical protein PHAVU_008G151500g [Phaseolus vulgaris]
Length=220

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPG ITIANA+F SDPPISP VLTKA
Sbjct  141  LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKSDPPISPEVLTKA  200

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK+ I+YLQ Q WY+NN
Sbjct  201  FQVDKSTIDYLQKQSWYDNN  220



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  147  LKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQ  F
Sbjct  207  FQLDKKVVDYLQKAF  221



>ref|XP_010662281.1| PREDICTED: putative germin-like protein 2-1, partial [Vitis vinifera]
Length=187

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+ GD+FVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  106  LHKGDIFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  165

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+ YLQSQFW +N+
Sbjct  166  FQVDKNVVEYLQSQFWTDNH  185



>ref|XP_011034307.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=229

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQ N+G + A+AFA LSSQNPGVITIANAVFG+DPP++PNVLTKA
Sbjct  149  LNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLTKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            F +DK ++ YLQ Q W +NN
Sbjct  209  FHLDKKLVEYLQKQIWTDNN  228



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  147  LKPGDVFVFPIGLIHFQFNMGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQ  F
Sbjct  207  FQLDKKVVDYLQKSF  221



>ref|XP_010027143.1| PREDICTED: uncharacterized protein LOC104417591 [Eucalyptus grandis]
Length=451

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  372  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISADVLTKA  431

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  ++YLQ+QFWY+NN
Sbjct  432  FQVDKKTVDYLQAQFWYDNN  451


 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDK  ++YL +QFWY+N
Sbjct  204  FQVDKKTVDYLLAQFWYDN  222



>gb|KHN14793.1| Germin-like protein subfamily 1 member 16 [Glycine soja]
Length=175

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ NIG+  A+A AGLSSQNPGVI+IANAVFGS PPIS  VL KA
Sbjct  96   LNKGDVFVFPIGLIHFQQNIGYGNALAIAGLSSQNPGVISIANAVFGSKPPISDEVLAKA  155

Query  182  FQVDKNVINYLQSQFWYN  235
            FQVDKNVI+YLQ QFWYN
Sbjct  156  FQVDKNVIDYLQKQFWYN  173



>ref|XP_007201630.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
 gb|EMJ02829.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
Length=233

 Score =   126 bits (317),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+A A LSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  154  LNKGDVFVFPIGLIHFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKA  213

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++YLQ QFWYNN+
Sbjct  214  FQVDNKVVDYLQKQFWYNNS  233



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  147  LKPGDVFVFPIGLIHFQFNMGQTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V+ YLQ  F
Sbjct  207  FQLDKKVVEYLQKSF  221



>emb|CAN61141.1| hypothetical protein VITISV_024669 [Vitis vinifera]
Length=181

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A AGLSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  107  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRA  166

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQS+F
Sbjct  167  FQLDKKVVSYLQSRF  181



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A + LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +++YLQ Q WY+NN
Sbjct  206  FQVDKKIVDYLQKQLWYDNN  225



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA+AFAGLSSQNPGVITIANAVFGSDPPI+P+VL KA
Sbjct  147  LKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK +++YLQ  F
Sbjct  207  FQLDKKIVDYLQKAF  221



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQ N+G + AIAFAGLSSQN GVIT+ANAVFGSDPPI+ +VL KA
Sbjct  151  LNSGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I+ LQ QFW++NN
Sbjct  211  FQVDKKAIDDLQEQFWWDNN  230



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A AGLSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQS+F
Sbjct  206  FQLDKKVVSYLQSRF  220



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFA LSSQNPGVITIAN+VFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD+  + YLQ+QFWY+NN
Sbjct  204  FQVDEKTVEYLQAQFWYDNN  223



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  152  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  211

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  212  FQVDKKVVDYLQSQF  226



>ref|NP_001240963.1| germin-like protein subfamily 1 member 7-like precursor [Glycine 
max]
 gb|ACG69487.1| germin-like protein 11 [Glycine max]
Length=232

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GL+HFQ NIG+  A+A AGLSSQNPGVITIANAVFGS PPIS  VL KA
Sbjct  147  LYKGDVFVFPIGLVHFQQNIGYGNAVAIAGLSSQNPGVITIANAVFGSKPPISDEVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDKNVI+YLQ QF YNN
Sbjct  207  FQVDKNVIDYLQKQFGYNN  225



>ref|XP_003535383.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 13-like [Glycine max]
Length=244

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ NIG+  A+A AGLSSQNPGVI+IANAVFGS PPIS  VL KA
Sbjct  165  LNKGDVFVFPIGLIHFQQNIGYGNALAIAGLSSQNPGVISIANAVFGSKPPISDEVLAKA  224

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNVI+YLQ QFWYNN+
Sbjct  225  FQVDKNVIDYLQKQFWYNNS  244



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP+GLIHFQFN G + A+AFAG  SQNPGVITIANAV GSDPPISP+VLTKA
Sbjct  148  LNPGDVFVFPQGLIHFQFNQGKTDAVAFAGFGSQNPGVITIANAVVGSDPPISPDVLTKA  207

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV  + I  LQSQFW++NN
Sbjct  208  FQVGNDAIKKLQSQFWWDNN  227



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>emb|CAN62429.1| hypothetical protein VITISV_005171 [Vitis vinifera]
Length=192

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  118  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  177

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  178  FQVDKKVVDYLQSQF  192



>emb|CAN70189.1| hypothetical protein VITISV_016562 [Vitis vinifera]
Length=214

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  140  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  199

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  200  FQVDKKVVDYLQSQF  214



>emb|CAN63888.1| hypothetical protein VITISV_027217 [Vitis vinifera]
Length=143

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    YPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKAF  184
            Y GDVF FPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKAF
Sbjct  70   YKGDVFXFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAF  129

Query  185  QVDKNVINYLQSQF  226
            QVDKNV++YLQSQF
Sbjct  130  QVDKNVVDYLQSQF  143



>ref|XP_010051709.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82835.1| hypothetical protein EUGRSUZ_C04206 [Eucalyptus grandis]
Length=223

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_002319674.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
 gb|EEE95597.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
Length=225

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFP GLIHFQFN+G +KA A   LSSQNPGVITIANAVFGS PPI  +VL KA
Sbjct  146  LNPGDVFVFPIGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+KN++++LQ QFWY+NN
Sbjct  206  FQVEKNIVDFLQKQFWYDNN  225



>gb|KHN04965.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GL+HFQ NIG+  A+A AGLSSQNPGVITIANAVFGS PPIS  VL KA
Sbjct  147  LYKGDVFVFPIGLVHFQQNIGYGNALAIAGLSSQNPGVITIANAVFGSKPPISDEVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDKNVI+YLQ QF YNN
Sbjct  207  FQVDKNVIDYLQKQFGYNN  225



>ref|XP_010051710.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82838.1| hypothetical protein EUGRSUZ_C04209 [Eucalyptus grandis]
Length=223

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010049992.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82837.1| hypothetical protein EUGRSUZ_C04208 [Eucalyptus grandis]
Length=223

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010049996.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82841.1| hypothetical protein EUGRSUZ_C04212 [Eucalyptus grandis]
Length=223

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010049995.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010042080.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82840.1| hypothetical protein EUGRSUZ_C04211 [Eucalyptus grandis]
Length=223

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010049993.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82839.1| hypothetical protein EUGRSUZ_C04210 [Eucalyptus grandis]
Length=223

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L++QFWY+NN
Sbjct  204  FQLDKKVVDHLEAQFWYDNN  223



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N G + A+AFAGLSSQNPGVITIAN+VFG+ PPIS + LTKA
Sbjct  470  LYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADALTKA  529

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK  I+YLQ+QFWY+NN
Sbjct  530  FQVDKKTIDYLQAQFWYDNN  549


 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP+GLIHFQ NIG + A+AFA LSSQNPG+ITIAN+VFGS P I+ +VLTKA
Sbjct  144  LTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQNPGLITIANSVFGSKPLINVDVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +INYLQ+Q W++N+
Sbjct  204  FQVDNKLINYLQAQNWFDNH  223


 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = -3

Query  207  LITFLSTWN-----ALVKTFGLIGGSDPKTALAIVMTPGF*LLRPAKAMAFECPMLNWK*  43
            LI +L   N     ALV+T   +GG DP TALA+V+TPGF LLR AKA A   PM +WK 
Sbjct  210  LINYLQAQNWFDNHALVRTSAEMGGFDPNTALAMVITPGFWLLRAAKASAGVFPMFSWKW  269

Query  42   MRPSGNTKTSPGYN  1
            MRP GNT TSP YN
Sbjct  270  MRPIGNTNTSPLYN  283



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSD---PPISPNVL  172
            L PGDVFVFPEGLIHFQ N+G + AIAFAGLSSQN GVIT+ANAVFGSD   PPI+ NVL
Sbjct  151  LNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPHPPINDNVL  210

Query  173  TKAFQVDKNVINYLQSQFWYNNN  241
            +KAFQVDK VI+ LQ +FW++NN
Sbjct  211  SKAFQVDKKVIDDLQEEFWWDNN  233



>gb|AFK49577.1| unknown [Lotus japonicus]
Length=220

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A A AGLSSQNPGV TIANAVFGSDP IS  VLTKA
Sbjct  141  LNKGDVFVFPIGLIHFQLNVGYGNAAAIAGLSSQNPGVTTIANAVFGSDPSISSQVLTKA  200

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV++YLQ QFW++NN
Sbjct  201  FQVDKNVVDYLQKQFWWDNN  220



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>ref|XP_007199406.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
 gb|EMJ00605.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
Length=226

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPGVITIANAVFGS PPI+P+VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNLGYGNAVALAGLSSQNPGVITIANAVFGSKPPINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +++YLQ QFWY NN
Sbjct  207  FQVDNKLVDYLQKQFWYENN  226



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH+ A+A +GLSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  146  LNKGDVFVFPVGLIHFQLNVGHTNAVAISGLSSQNPGVITIANAVFGANPPINPDVLAKA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV+  ++ YLQ QFWY+NN
Sbjct  206  FQVEBKLVTYLQKQFWYDNN  225



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  131  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  190

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  191  FQVDKKVVDYLQSQF  205



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  241  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  300

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  301  FQVDKKVVDYLQSQF  315



>ref|XP_008381865.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=185

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N GH+ A+A AGLSSQNPGVITIANAVFG++PPI+P+VL KA
Sbjct  106  LNKGDVFVFPVGLIHFQLNXGHTXAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKA  165

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  +++YL  QFWY+NN
Sbjct  166  FQVDDKLVSYLXKQFWYDNN  185



>ref|XP_008779597.1| PREDICTED: putative germin-like protein 2-1, partial [Phoenix 
dactylifera]
Length=100

 Score =   120 bits (302),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  11   GDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKAFQV  190
            GDVFVFP+GLIHFQFN G   A+A A LSSQNPGVIT+ANAVFGS PPIS +VL KAFQV
Sbjct  23   GDVFVFPQGLIHFQFNYGTKNAVAIAALSSQNPGVITVANAVFGSKPPISRDVLAKAFQV  82

Query  191  DKNVINYLQSQFWYNNN  241
            DK  I++LQ+QFW +NN
Sbjct  83   DKKTIDWLQAQFWMDNN  99



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ NIG+  A+A AGLSSQNPGVITIANAVFGS PPIS  VL KA
Sbjct  143  LNKGDVFVFPIGLIHFQQNIGYGNALAIAGLSSQNPGVITIANAVFGSKPPISDEVLAKA  202

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQV KNVI+YLQ QFWYNN+
Sbjct  203  FQVGKNVIDYLQKQFWYNNS  222



>emb|CAN71631.1| hypothetical protein VITISV_015711 [Vitis vinifera]
Length=204

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  130  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  189

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  190  FQVDKKVVDYLQSQF  204



>emb|CAN82524.1| hypothetical protein VITISV_028056 [Vitis vinifera]
Length=216

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP+ LIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  135  LYKGDVFVFPQVLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  194

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKNV+ YLQS+FW NN+
Sbjct  195  FQLDKNVVAYLQSRFWTNNH  214



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A AGLSSQNPGVITIANAVFGS+P I+P+VL KA
Sbjct  147  LYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPHINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVD+  ++YLQ QFWYNN
Sbjct  207  FQVDEKEVDYLQKQFWYNN  225



>ref|XP_006375874.1| germin-like protein 1, partial [Populus trichocarpa]
 gb|ERP53671.1| germin-like protein 1, partial [Populus trichocarpa]
Length=199

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA A   LSSQNPGVITI NAVFGS PPI  +VL KA
Sbjct  120  LNAGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVLAKA  179

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKN+++YLQ QFWY+NN
Sbjct  180  FQVDKNLVDYLQKQFWYDNN  199



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A AGLSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQ  223
            FQ+DK V++YLQS+
Sbjct  206  FQLDKKVVSYLQSR  219



>ref|XP_004291649.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ NIG   A+A A LSSQNPGVITIANAVFG++PPI+P+VL+KA
Sbjct  151  LNKGDVFVFPVGLIHFQLNIGPVNAVALAALSSQNPGVITIANAVFGANPPINPDVLSKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD+ ++ YLQ QFWYNNN
Sbjct  211  FQVDEKLVEYLQKQFWYNNN  230



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS P I+P+VL KA
Sbjct  149  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  208

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++ LQ QFWY+NN
Sbjct  209  FQVDDKVVDNLQKQFWYDNN  228



>ref|XP_010049991.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82836.1| hypothetical protein EUGRSUZ_C04207 [Eucalyptus grandis]
Length=223

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+GLSSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSGLSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+++L+ QFWY+NN
Sbjct  204  FQLDKKVVDHLEVQFWYDNN  223



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+GH  A+AFAGLSSQNPGVITIANAVFGS P I+P+VL KA
Sbjct  150  LNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKA  209

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V++ LQ QFWY+NN
Sbjct  210  FQVDDKVVDNLQKQFWYDNN  229



>emb|CDP10692.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   120 bits (300),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L PGDVFVFPEGLIHFQFN+G + A+AFAG  SQNPGVITIANAVFGSDP IS +VL KA
Sbjct  10   LNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKA  69

Query  182  FQVDKNVINYLQSQFW  229
            FQVDK VI+ L++QF 
Sbjct  70   FQVDKKVIDLLEAQFL  85



>emb|CAN63889.1| hypothetical protein VITISV_027218 [Vitis vinifera]
Length=212

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVF+F EGLIHFQ N+  +KA+A A LSSQN GVITIANAVFGS P IS +VLTKA
Sbjct  131  LYKGDVFIFLEGLIHFQLNVRKTKAVAIAALSSQNLGVITIANAVFGSKPAISADVLTKA  190

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW +N+
Sbjct  191  FQVDKKVVDYLQSQFWTDNH  210



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G   A+A A LSSQNPGVITIANAVFGSDPPI+P VL KA
Sbjct  147  LNKGDVFVFPIGLIHFQLNVGEGDAVAQAALSSQNPGVITIANAVFGSDPPINPEVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD   + YLQ QFWY+NN
Sbjct  207  FQVDNKAVEYLQKQFWYDNN  226



>emb|CAN70904.1| hypothetical protein VITISV_032927 [Vitis vinifera]
Length=196

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHF  N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  122  LYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  181

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  182  FQVDKKVVDYLQSQF  196



>ref|XP_010048594.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW80890.1| hypothetical protein EUGRSUZ_C02258 [Eucalyptus grandis]
Length=223

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVF FP GLIHFQ NIG++ A+AF+  SSQNPG+IT+ANAVFG+ PPIS +VLTKA
Sbjct  144  LYKGDVFAFPIGLIHFQLNIGNTYALAFSSFSSQNPGIITVANAVFGAKPPISVDVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V++YLQ+QFWY+NN
Sbjct  204  FQLDKKVVDYLQAQFWYDNN  223



>ref|XP_009758327.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein 8-12 [Nicotiana 
sylvestris]
Length=184

 Score =   122 bits (307),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  11   GDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKAFQV  190
            GDVFVFP G+IHFQ N+G +K +A +GLSSQ+ GVITIANAVFGSDPPI+P VLTKAFQV
Sbjct  108  GDVFVFPIGMIHFQLNVGKTKVVAMSGLSSQDAGVITIANAVFGSDPPINPYVLTKAFQV  167

Query  191  DKNVINYLQSQFWYNNN  241
            +  V++YLQSQFW++NN
Sbjct  168  ETKVVDYLQSQFWWDNN  184



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A A LSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQS+F
Sbjct  206  FQLDKKVVSYLQSRF  220



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVF+FPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  416  LYKGDVFIFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  475

Query  182  FQVDKNVINYLQSQF  226
            FQVDKNV++YLQSQF
Sbjct  476  FQVDKNVVDYLQSQF  490


 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   123 bits (309),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHF  N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  147  LYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  206

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  207  FQVDKKVVDYLQSQF  221



>ref|XP_010660483.1| PREDICTED: germin-like protein 8-2 [Vitis vinifera]
Length=122

 Score =   120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPE LIHFQ N+  +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  48   LYKGDVFVFPEDLIHFQLNVEKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  107

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  108  FQVDKKVVDYLQSQF  122



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   123 bits (309),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A A LSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQS+F
Sbjct  206  FQLDKKVVSYLQSRF  220



>emb|CBI36810.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+GH+ A+A AGL+SQNPGVITIA AVFGS+PPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNVGHTNAVAIAGLNSQNPGVITIAKAVFGSNPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DKNV++YLQS+F  N+ 
Sbjct  206  FQLDKNVVDYLQSRFSTNSR  225



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  205  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  264

Query  182  FQVDKNVINYLQSQ  223
            FQVDK V++YLQSQ
Sbjct  265  FQVDKKVVDYLQSQ  278



>ref|XP_003536153.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine 
max]
 gb|ACG69482.1| germin-like protein 6 [Glycine max]
Length=232

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G+  A+A A LSSQNPGVITIANAVFGS PPIS  VL KA
Sbjct  147  LYKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPPISDEVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDKN+++YLQ QF YNN
Sbjct  207  FQVDKNIVDYLQKQFGYNN  225



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHF  N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  131  LYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  190

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  191  FQVDKKVVDYLQSQF  205



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G + A+A A   SQNPGVITIANAVFGS PPI+P+VLTKA
Sbjct  151  LNKGDVFVFPIGLIHFQLNVGKTNALAIAAFGSQNPGVITIANAVFGSKPPINPDVLTKA  210

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+D NV++YLQ QFWYNN+
Sbjct  211  FQLDNNVVDYLQKQFWYNNS  230



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L+ GDVFVFP+GLIHFQFN G + A+A AGLSSQNPGVITIANAVFG+ PPIS  VL KA
Sbjct  141  LHEGDVFVFPQGLIHFQFNNGKTSAVALAGLSSQNPGVITIANAVFGAKPPISDEVLAKA  200

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK  +++LQ+QFW +NN
Sbjct  201  FQLDKKTVDWLQAQFWTDNN  220



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G + A+A  GLSSQNPGVITIANAVFGS+P I+P+VL KA
Sbjct  147  LYKGDVFVFPVGLIHFQLNVGKTNALAIGGLSSQNPGVITIANAVFGSNPHINPDVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVD+  ++YLQ QFWYNN
Sbjct  207  FQVDEKEVDYLQKQFWYNN  225



>gb|KCW82834.1| hypothetical protein EUGRSUZ_C04205 [Eucalyptus grandis]
Length=223

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ NIG++ A+AF+  SSQNPG+ITIANAVFG+  PIS +VLTKA
Sbjct  144  LYKGDVFVFPIGLIHFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKAPISADVLTKA  203

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQ+DK V+ YL++QFWY+NN
Sbjct  204  FQLDKKVVEYLEAQFWYDNN  223



>emb|CAB65370.1| germin-like protein [Pisum sativum]
Length=195

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPGVITIANA+F S+PPIS  VLTKA
Sbjct  116  LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANALFKSNPPISDEVLTKA  175

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK++I+YLQ Q WY+NN
Sbjct  176  FQVDKSIIDYLQGQTWYDNN  195



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  404  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  463

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  464  FQVDKKVVDYLQSQF  478


 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVF+F EGLIHFQ N+  +KA+A A LSSQN GVITIANAVFGS P IS +VLTKA
Sbjct  131  LYKGDVFIFLEGLIHFQLNVRKTKAVAIAALSSQNLGVITIANAVFGSKPAISADVLTKA  190

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK V++YLQSQFW +N+
Sbjct  191  FQVDKKVVDYLQSQFWTDNH  210



>gb|KHN14792.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP GLIHFQ N+G+  A+A A LSSQNPGVITIANAVFGS PPIS  VL KA
Sbjct  147  LYKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPPISDEVLAKA  206

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDKN+++YLQ QF YNN
Sbjct  207  FQVDKNIVDYLQKQFGYNN  225



>gb|ACG69479.1| germin-like protein 3 [Glycine max]
 gb|KHN10834.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=221

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPG ITIANA+F ++PPISP VLTKA
Sbjct  141  LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKANPPISPEVLTKA  200

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK+ I+YLQ Q WY+NN
Sbjct  201  FQVDKSTIDYLQKQSWYDNN  220



>gb|KDP23768.1| hypothetical protein JCGZ_23601 [Jatropha curcas]
Length=229

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NI  + A+AFAGLSSQNPGVITIANA+FG  PPI+P+VLT+A
Sbjct  152  LYPGDVFVFPIGLIHFQMNIAKTNAVAFAGLSSQNPGVITIANALFGPKPPINPDVLTRA  211

Query  182  FQVDKNVINYLQSQF  226
            FQ+DKNV+ YLQ QF
Sbjct  212  FQLDKNVVGYLQKQF  226



>ref|XP_004513532.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cicer 
arietinum]
Length=221

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A AGLSSQNPGVITIANA+F S+PPIS  VLTKA
Sbjct  142  LNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGVITIANALFKSNPPISDEVLTKA  201

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK++I+YLQ Q WY+NN
Sbjct  202  FQVDKSIIDYLQKQSWYDNN  221



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+G +KA+A AGLSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  373  LNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRA  432

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK V++YLQS+F
Sbjct  433  FQLDKKVVSYLQSRF  447


 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFNIG + A+A A LSSQNPGVITI NAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSSQNPGVITITNAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVIN  208
            FQ+DK+V++
Sbjct  206  FQLDKSVLS  214



>gb|KDP23764.1| hypothetical protein JCGZ_23597 [Jatropha curcas]
Length=229

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LYPGDVFVFP GLIHFQ NI  + A+AFAGLSSQNPGVITIANA+FG  PPI+P+VLT+A
Sbjct  152  LYPGDVFVFPIGLIHFQMNIAKTNAVAFAGLSSQNPGVITIANALFGPKPPINPDVLTRA  211

Query  182  FQVDKNVINYLQSQF  226
            FQ+DKNV+ YLQ QF
Sbjct  212  FQLDKNVVGYLQKQF  226



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFNIG + A+A A LSSQNPGVITIANAVFGSDPPI+P+VLT+A
Sbjct  146  LNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRA  205

Query  182  FQVDKNVINYLQSQF  226
            FQ+DK+V+ YLQS+F
Sbjct  206  FQLDKSVVKYLQSRF  220



>ref|NP_001236994.1| uncharacterized protein LOC100527249 precursor [Glycine max]
 gb|ACU16305.1| unknown [Glycine max]
Length=221

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GL+HFQ N+G+  A+A AGLSSQNPG ITIANA+F ++PPISP VLTKA
Sbjct  141  LNKGDVFVFPIGLVHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKANPPISPEVLTKA  200

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK+ I+YLQ Q WY+NN
Sbjct  201  FQVDKSTIDYLQKQSWYDNN  220



>ref|XP_007140910.1| hypothetical protein PHAVU_008G1514001g, partial [Phaseolus vulgaris]
 gb|ESW12904.1| hypothetical protein PHAVU_008G1514001g, partial [Phaseolus vulgaris]
Length=108

 Score =   119 bits (297),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQ N+G+  A+A A LSSQNPG ITIANA+F ++P ISP VLTKA
Sbjct  28   LNKGDVFVFPIGLIHFQLNVGYGNAVAIAALSSQNPGTITIANALFKANPSISPEVLTKA  87

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDK +I+YLQ QFW +NN
Sbjct  88   FQVDKTIIDYLQKQFWSDNN  107



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFP GLIHFQFN+GHS A+AFAGLSSQNPGVITIANAVFGSDPPIS +VLTKA
Sbjct  148  LNKGDVFVFPIGLIHFQFNVGHSPALAFAGLSSQNPGVITIANAVFGSDPPISIDVLTKA  207

Query  182  FQVDKNVINYLQSQF  226
            FQVD NVI+ L  QF
Sbjct  208  FQVDNNVIHALMKQF  222



>ref|XP_002276926.2| PREDICTED: uncharacterized protein LOC100251187, partial [Vitis 
vinifera]
Length=447

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  366  LYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  425

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVDKNV+  LQSQFW +N+
Sbjct  426  FQVDKNVVECLQSQFWTDNH  445


 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFP+GLIHFQ N+G + A+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  140  LYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKA  199

Query  182  FQVDKNVINY  211
            FQVDKNV+ +
Sbjct  200  FQVDKNVVEF  209



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPEGLIHFQ N+G +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  376  LYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  435

Query  182  FQVDKNVINYLQSQF  226
            FQVDK V++YLQSQF
Sbjct  436  FQVDKKVVDYLQSQF  450


 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            LY GDVFVFPE LIHFQ N+  +KA+A A LSSQNPGVITIANAVFGS P IS +VLTKA
Sbjct  110  LYKGDVFVFPEDLIHFQLNVEKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKA  169

Query  182  FQVDKNVINYLQSQFWYNN  238
            FQVDK V++YLQSQF  N 
Sbjct  170  FQVDKKVVDYLQSQFSINR  188



>ref|XP_006856738.1| hypothetical protein AMTR_s03266p00004160, partial [Amborella 
trichopoda]
 gb|ERN18205.1| hypothetical protein AMTR_s03266p00004160, partial [Amborella 
trichopoda]
Length=182

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LYPGDVFVFPEGLIHFQFNIGHSKAIAFAGLSSQNPGVITIANAVFGSDPPISPNVLTKA  181
            L  GDVFVFPEGLIHFQ N+G+  A+A A LSSQNPGVITIANAVFGS P I+ NVL KA
Sbjct  103  LQKGDVFVFPEGLIHFQQNVGYKNAVAIAALSSQNPGVITIANAVFGSKPAINSNVLAKA  162

Query  182  FQVDKNVINYLQSQFWYNNN  241
            FQVD  V+N LQSQFW +NN
Sbjct  163  FQVDNKVVNQLQSQFWMDNN  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507223292940