BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21532_g1_i2 len=1106 path=[1084:0-569 1654:570-606 1691:607-667
1752:668-711 1796:712-735 1820:736-1105]

Length=1106
                                                                      Score     E

ref|XP_011082099.1|  PREDICTED: uncharacterized protein LOC105164948    396   2e-134   
ref|XP_009770569.1|  PREDICTED: uncharacterized protein LOC104221250    395   2e-134   
ref|XP_009612289.1|  PREDICTED: uncharacterized protein LOC104105645    392   3e-133   
gb|EYU22084.1|  hypothetical protein MIMGU_mgv1a012749mg                384   5e-130   
emb|CDP18327.1|  unnamed protein product                                378   2e-127   
ref|XP_002527988.1|  conserved hypothetical protein                     377   5e-127   Ricinus communis
ref|XP_009759307.1|  PREDICTED: uncharacterized protein LOC104211865    374   5e-126   
ref|XP_006382197.1|  hypothetical protein POPTR_0006s29270g             372   4e-125   
gb|KDP33421.1|  hypothetical protein JCGZ_06992                         371   3e-124   
ref|XP_004498551.1|  PREDICTED: uncharacterized protein LOC101505025    369   4e-124   
ref|XP_009627443.1|  PREDICTED: uncharacterized protein LOC104117990    369   8e-124   
ref|XP_011006640.1|  PREDICTED: uncharacterized protein LOC105112602    367   2e-123   
ref|XP_006342696.1|  PREDICTED: uncharacterized protein LOC102602114    367   5e-123   
ref|XP_009375722.1|  PREDICTED: uncharacterized protein LOC103964515    365   2e-122   
ref|XP_004253068.1|  PREDICTED: uncharacterized protein LOC101258542    365   2e-122   
ref|XP_008378131.1|  PREDICTED: uncharacterized protein LOC103441...    364   5e-122   
gb|ACJ85371.1|  unknown                                                 363   1e-121   Medicago truncatula
ref|XP_003550111.1|  PREDICTED: uncharacterized protein LOC100527805    360   9e-121   
gb|AFK33773.1|  unknown                                                 359   2e-120   
ref|XP_009367953.1|  PREDICTED: uncharacterized protein LOC103957506    359   3e-120   
ref|XP_006483627.1|  PREDICTED: uncharacterized protein LOC102619321    359   4e-120   
ref|XP_004291301.1|  PREDICTED: uncharacterized protein LOC101313473    358   6e-120   
ref|XP_007226094.1|  hypothetical protein PRUPE_ppa010817mg             358   7e-120   
gb|EYU29166.1|  hypothetical protein MIMGU_mgv1a012580mg                358   1e-119   
ref|XP_007161534.1|  hypothetical protein PHAVU_001G077400g             358   1e-119   
ref|XP_010112148.1|  hypothetical protein L484_019887                   358   1e-119   
ref|XP_006450105.1|  hypothetical protein CICLE_v10009046mg             359   3e-119   
ref|XP_003544658.1|  PREDICTED: uncharacterized protein LOC100801037    356   6e-119   
ref|XP_007137149.1|  hypothetical protein PHAVU_009G103900g             350   1e-116   
ref|XP_003603576.1|  hypothetical protein MTR_3g109280                  349   2e-116   
ref|XP_007011528.1|  Uncharacterized protein TCM_046898                 349   4e-116   
ref|XP_010048486.1|  PREDICTED: uncharacterized protein LOC104437268    347   3e-115   
gb|AFK45319.1|  unknown                                                 347   3e-115   
ref|XP_011076094.1|  PREDICTED: uncharacterized protein LOC105160396    345   8e-115   
ref|XP_003526465.1|  PREDICTED: uncharacterized protein LOC100780305    343   8e-114   
ref|XP_004501209.1|  PREDICTED: uncharacterized protein LOC101514150    343   8e-114   
ref|XP_003522678.1|  PREDICTED: uncharacterized protein LOC100795131    342   3e-113   
ref|XP_003588601.1|  hypothetical protein MTR_1g009030                  335   4e-111   
ref|XP_002869335.1|  hypothetical protein ARALYDRAFT_491609             335   1e-110   
ref|XP_008219983.1|  PREDICTED: uncharacterized protein LOC103320131    334   2e-110   
gb|KHG04904.1|  Uncharacterized protein F383_31215                      334   2e-110   
ref|XP_004244468.1|  PREDICTED: uncharacterized protein LOC101259062    334   2e-110   
ref|XP_010447583.1|  PREDICTED: uncharacterized protein LOC104730...    334   3e-110   
ref|XP_010432876.1|  PREDICTED: uncharacterized protein LOC104717062    333   4e-110   
ref|XP_010263286.1|  PREDICTED: uncharacterized protein LOC104601590    333   5e-110   
ref|NP_567872.1|  uncharacterized protein                               333   6e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72303.1|  BnaC07g43250D                                          333   6e-110   
ref|XP_009138005.1|  PREDICTED: uncharacterized protein LOC103862043    333   9e-110   
ref|XP_010438053.1|  PREDICTED: uncharacterized protein LOC104721707    332   1e-109   
ref|XP_006284442.1|  hypothetical protein CARUB_v10005623mg             332   1e-109   
gb|AFK38355.1|  unknown                                                 332   2e-109   
ref|XP_002283089.1|  PREDICTED: uncharacterized protein LOC100259505    331   3e-109   Vitis vinifera
ref|XP_006412605.1|  hypothetical protein EUTSA_v10026789mg             331   4e-109   
ref|XP_007143940.1|  hypothetical protein PHAVU_007G115300g             330   8e-109   
gb|KHG05690.1|  Ankyrin repeat and KH domain-containing mask            329   2e-108   
ref|XP_010669484.1|  PREDICTED: uncharacterized protein LOC104886703    328   4e-108   
ref|XP_003536184.1|  PREDICTED: uncharacterized protein LOC100816068    328   8e-108   
ref|XP_010263285.1|  PREDICTED: uncharacterized protein LOC104601589    327   1e-107   
gb|KCW80731.1|  hypothetical protein EUGRSUZ_C02127                     328   2e-107   
ref|XP_010526280.1|  PREDICTED: uncharacterized protein LOC104803882    326   4e-107   
ref|XP_008783078.1|  PREDICTED: uncharacterized protein LOC103702416    326   4e-107   
ref|XP_010049787.1|  PREDICTED: uncharacterized protein LOC104438363    326   4e-107   
gb|KFK29714.1|  hypothetical protein AALP_AA7G169500                    324   2e-106   
ref|XP_003556415.1|  PREDICTED: uncharacterized protein LOC100778681    323   6e-106   
ref|XP_004495478.1|  PREDICTED: uncharacterized protein LOC101510689    321   3e-105   
ref|XP_003622377.1|  hypothetical protein MTR_7g035200                  319   2e-104   
ref|XP_010927193.1|  PREDICTED: uncharacterized protein LOC105049287    319   2e-104   
ref|XP_009125291.1|  PREDICTED: uncharacterized protein LOC103850314    319   2e-104   
emb|CDY40107.1|  BnaC02g00230D                                          319   3e-104   
emb|CAA16536.1|  predicted protein                                      321   7e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048375.1|  PREDICTED: uncharacterized protein LOC104437177    317   7e-104   
ref|XP_009409587.1|  PREDICTED: uncharacterized protein LOC103991765    317   1e-103   
ref|NP_196620.1|  uncharacterized protein                               317   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399556.1|  hypothetical protein EUTSA_v10014328mg             318   2e-103   
emb|CDX69820.1|  BnaA10g21690D                                          315   1e-102   
ref|XP_010491734.1|  PREDICTED: uncharacterized protein LOC104769265    315   1e-102   
ref|XP_010422827.1|  PREDICTED: uncharacterized protein LOC104708039    315   1e-102   
ref|XP_006289080.1|  hypothetical protein CARUB_v10002483mg             315   2e-102   
ref|XP_003534066.1|  PREDICTED: uncharacterized protein LOC100815851    313   2e-102   
ref|XP_009403299.1|  PREDICTED: uncharacterized protein LOC103986...    313   3e-102   
ref|XP_010453093.1|  PREDICTED: uncharacterized protein LOC104735072    313   6e-102   
ref|XP_004136437.1|  PREDICTED: uncharacterized protein LOC101209101    312   1e-101   
gb|KFK25330.1|  hypothetical protein AALP_AA8G098800                    312   1e-101   
ref|XP_006850939.1|  hypothetical protein AMTR_s00025p00190370          311   3e-101   
ref|XP_002871427.1|  hypothetical protein ARALYDRAFT_487891             311   4e-101   
ref|XP_010519591.1|  PREDICTED: uncharacterized protein LOC104799002    311   4e-101   
ref|XP_010928765.1|  PREDICTED: uncharacterized protein LOC105050445    310   7e-101   
ref|XP_010548531.1|  PREDICTED: uncharacterized protein LOC104819925    309   1e-100   
ref|XP_008466268.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    309   2e-100   
ref|XP_009122039.1|  PREDICTED: uncharacterized protein LOC103846793    309   2e-100   
ref|XP_010104944.1|  hypothetical protein L484_004292                   308   2e-100   
emb|CDY13424.1|  BnaA03g51420D                                          321   8e-100   
ref|XP_010916649.1|  PREDICTED: uncharacterized protein LOC105041384    306   3e-99    
emb|CDY28256.1|  BnaA01g05930D                                          305   6e-99    
ref|XP_010913782.1|  PREDICTED: uncharacterized protein LOC105039345    305   8e-99    
ref|XP_007152480.1|  hypothetical protein PHAVU_004G134200g             304   1e-98    
emb|CDX97029.1|  BnaC09g45960D                                          304   1e-98    
gb|KEH16999.1|  plant/F12B17-70 protein                                 303   3e-98    
ref|XP_008781727.1|  PREDICTED: uncharacterized protein LOC103701456    303   3e-98    
ref|XP_009127086.1|  PREDICTED: uncharacterized protein LOC103851956    302   7e-98    
emb|CDX68734.1|  BnaC01g07190D                                          302   8e-98    
ref|XP_008378132.1|  PREDICTED: uncharacterized protein LOC103441...    299   6e-97    
ref|XP_004138780.1|  PREDICTED: uncharacterized protein LOC101209677    293   2e-94    
ref|XP_004512650.1|  PREDICTED: uncharacterized protein LOC101512480    291   2e-93    
ref|XP_008445058.1|  PREDICTED: uncharacterized protein LOC103488211    289   1e-92    
ref|XP_004152530.1|  PREDICTED: uncharacterized protein LOC101217165    286   2e-91    
ref|XP_009399613.1|  PREDICTED: uncharacterized protein LOC103983971    285   5e-91    
ref|XP_008437415.1|  PREDICTED: uncharacterized protein LOC103482834    281   2e-89    
gb|KHM99779.1|  hypothetical protein glysoja_023920                     278   2e-88    
gb|KCW82592.1|  hypothetical protein EUGRSUZ_C03984                     271   4e-86    
gb|ACU24418.1|  unknown                                                 269   7e-86    Glycine max [soybeans]
ref|XP_009151002.1|  PREDICTED: uncharacterized protein LOC103874344    270   5e-85    
ref|XP_006394730.1|  hypothetical protein EUTSA_v10004847mg             269   8e-85    
emb|CDX88131.1|  BnaA06g27220D                                          268   3e-84    
gb|ACU16981.1|  unknown                                                 263   9e-84    Glycine max [soybeans]
ref|XP_003533273.1|  PREDICTED: uncharacterized protein LOC100780363    265   2e-83    
emb|CDX80468.1|  BnaC07g29760D                                          266   2e-83    
ref|NP_974762.1|  uncharacterized protein                               261   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973918.1|  PREDICTED: uncharacterized protein LOC101763841    263   2e-82    
ref|XP_004512651.1|  PREDICTED: uncharacterized protein LOC101512798    263   2e-82    
gb|AFK36811.1|  unknown                                                 260   9e-82    
ref|XP_009403300.1|  PREDICTED: uncharacterized protein LOC103986...    259   3e-81    
gb|KEH26649.1|  plant/F12B17-70 protein                                 259   3e-81    
gb|EAZ07668.1|  hypothetical protein OsI_29924                          259   5e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001062272.1|  Os08g0521000                                       258   3e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07684.1|  hypothetical protein OsI_29941                          255   2e-79    Oryza sativa Indica Group [Indian rice]
dbj|BAJ95498.1|  predicted protein                                      254   4e-79    
gb|KCW80623.1|  hypothetical protein EUGRSUZ_C019982                    249   5e-78    
gb|KHM99780.1|  hypothetical protein glysoja_023921                     251   7e-78    
ref|XP_008798195.1|  PREDICTED: uncharacterized protein LOC103713149    250   8e-78    
gb|KFK27744.1|  hypothetical protein AALP_AA8G423500                    250   2e-77    
gb|AFK39792.1|  unknown                                                 248   6e-77    
ref|NP_001063551.1|  Os09g0494600                                       249   1e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574775.1|  PREDICTED: uncharacterized protein LOC100829514    249   1e-76    
gb|AFK38647.1|  unknown                                                 247   2e-76    
ref|XP_002872126.1|  hypothetical protein ARALYDRAFT_351499             245   2e-75    
ref|XP_006290115.1|  hypothetical protein CARUB_v10003762mg             243   2e-74    
ref|NP_568456.1|  uncharacterized protein                               243   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421322.1|  PREDICTED: uncharacterized protein LOC104706793    242   3e-74    
ref|XP_003578353.1|  PREDICTED: uncharacterized protein LOC100831783    241   8e-74    
ref|XP_006660295.1|  PREDICTED: uncharacterized protein LOC102700922    240   2e-73    
ref|XP_010454804.1|  PREDICTED: uncharacterized protein LOC104736501    239   7e-73    
ref|NP_001142840.1|  uncharacterized protein LOC100275230               238   1e-72    Zea mays [maize]
ref|XP_004957239.1|  PREDICTED: uncharacterized protein LOC101783301    238   2e-72    
ref|XP_002444749.1|  hypothetical protein SORBIDRAFT_07g027210          236   6e-72    Sorghum bicolor [broomcorn]
ref|NP_001143651.1|  hypothetical protein                               236   1e-71    Zea mays [maize]
ref|XP_002980549.1|  hypothetical protein SELMODRAFT_113190             235   1e-71    
ref|XP_002976819.1|  hypothetical protein SELMODRAFT_105772             234   1e-71    
gb|EMT00440.1|  hypothetical protein F775_12307                         234   4e-71    
dbj|BAK00871.1|  predicted protein                                      234   1e-70    
tpg|DAA48067.1|  TPA: hypothetical protein ZEAMMB73_728170              236   1e-70    
ref|XP_002460465.1|  hypothetical protein SORBIDRAFT_02g028790          233   3e-70    Sorghum bicolor [broomcorn]
ref|XP_008669307.1|  PREDICTED: uncharacterized protein LOC100275...    230   2e-68    
gb|EMS63255.1|  hypothetical protein TRIUR3_18233                       225   5e-68    
gb|EMT11752.1|  hypothetical protein F775_20337                         219   9e-66    
ref|XP_008798194.1|  PREDICTED: uncharacterized protein LOC103713148    216   2e-64    
emb|CBI20793.3|  unnamed protein product                                211   4e-63    
ref|XP_004171511.1|  PREDICTED: uncharacterized LOC101209677            210   1e-62    
ref|XP_002990864.1|  hypothetical protein SELMODRAFT_272166             210   3e-62    
ref|XP_002974327.1|  hypothetical protein SELMODRAFT_228264             210   3e-62    
gb|KCW82593.1|  hypothetical protein EUGRSUZ_C03984                     208   4e-62    
tpg|DAA62101.1|  TPA: hypothetical protein ZEAMMB73_796660              205   2e-60    
ref|XP_008798193.1|  PREDICTED: uncharacterized protein LOC103713147    204   9e-60    
ref|XP_001755789.1|  predicted protein                                  192   2e-55    
ref|XP_006357030.1|  PREDICTED: uncharacterized protein LOC102602304    178   1e-51    
ref|XP_010456681.1|  PREDICTED: uncharacterized protein LOC104738156    177   1e-49    
ref|XP_002974496.1|  hypothetical protein SELMODRAFT_101278             177   2e-49    
ref|XP_004974852.1|  PREDICTED: uncharacterized protein LOC101781536    177   2e-49    
ref|XP_008347645.1|  PREDICTED: uncharacterized protein LOC103410755    172   6e-49    
ref|XP_002990803.1|  hypothetical protein SELMODRAFT_132501             175   1e-48    
ref|XP_010470867.1|  PREDICTED: uncharacterized protein LOC104750726    168   3e-47    
ref|XP_001781319.1|  predicted protein                                  169   2e-46    
ref|XP_004165029.1|  PREDICTED: uncharacterized protein LOC101231759    159   2e-44    
gb|KDP20231.1|  hypothetical protein JCGZ_08879                         162   2e-43    
ref|XP_003518289.1|  PREDICTED: uncharacterized protein LOC100790696    161   5e-43    
gb|KEH26652.1|  plant/F12B17-70 protein                                 156   2e-42    
ref|XP_006661388.1|  PREDICTED: uncharacterized protein LOC102709310    158   2e-42    
ref|XP_010275273.1|  PREDICTED: uncharacterized protein LOC104610391    159   2e-42    
ref|XP_006493847.1|  PREDICTED: uncharacterized protein LOC102606846    159   2e-42    
gb|KDO39058.1|  hypothetical protein CISIN_1g024720mg                   158   6e-42    
gb|KHN40019.1|  hypothetical protein glysoja_009396                     157   1e-41    
ref|XP_006428045.1|  hypothetical protein CICLE_v10027188mg             156   2e-41    
gb|EPS67214.1|  hypothetical protein M569_07560                         157   2e-41    
ref|XP_006288538.1|  hypothetical protein CARUB_v10001810mg             156   2e-41    
ref|XP_006347642.1|  PREDICTED: uncharacterized protein LOC102603843    155   3e-41    
gb|KDO62812.1|  hypothetical protein CISIN_1g026254mg                   155   8e-41    
ref|XP_010549100.1|  PREDICTED: uncharacterized protein LOC104820377    154   1e-40    
ref|XP_010093541.1|  hypothetical protein L484_013974                   154   1e-40    
gb|EYU45339.1|  hypothetical protein MIMGU_mgv1a024797mg                154   1e-40    
ref|XP_008244786.1|  PREDICTED: uncharacterized protein LOC103342899    153   2e-40    
gb|EAY85439.1|  hypothetical protein OsI_06822                          154   2e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_004307929.1|  PREDICTED: uncharacterized protein LOC101292349    154   2e-40    
ref|XP_007209532.1|  hypothetical protein PRUPE_ppa010672mg             154   2e-40    
ref|XP_007033515.1|  Uncharacterized protein TCM_019691                 153   2e-40    
ref|XP_010487735.1|  PREDICTED: uncharacterized protein LOC104765678    154   2e-40    
emb|CDY05405.1|  BnaC02g41130D                                          154   2e-40    
ref|XP_006394716.1|  hypothetical protein EUTSA_v10005694mg             154   2e-40    
emb|CDY05449.1|  BnaA02g32420D                                          154   2e-40    
ref|NP_197848.1|  uncharacterized protein                               154   3e-40    Arabidopsis thaliana [mouse-ear cress]
emb|CDX80456.1|  BnaC07g29880D                                          154   3e-40    
gb|KHG14649.1|  hypothetical protein F383_20144                         153   3e-40    
gb|KFK27736.1|  hypothetical protein AALP_AA8G422500                    153   4e-40    
ref|XP_010421287.1|  PREDICTED: uncharacterized protein LOC104706...    153   4e-40    
ref|XP_006429595.1|  hypothetical protein CICLE_v10012663mg             152   5e-40    
ref|XP_010454780.1|  PREDICTED: uncharacterized protein LOC104736483    153   5e-40    
ref|XP_006490702.1|  PREDICTED: uncharacterized protein LOC102625...    152   5e-40    
ref|XP_009765451.1|  PREDICTED: uncharacterized protein LOC104216995    152   5e-40    
ref|XP_002874211.1|  hypothetical protein ARALYDRAFT_910504             152   5e-40    
ref|XP_007141352.1|  hypothetical protein PHAVU_008G188300g             152   6e-40    
ref|XP_009150984.1|  PREDICTED: uncharacterized protein LOC103874325    152   7e-40    
gb|KHG13650.1|  TRP-like ion channel pkd2                               152   7e-40    
ref|XP_004490535.1|  PREDICTED: uncharacterized protein LOC101508613    152   9e-40    
ref|XP_006451702.1|  hypothetical protein CICLE_v10009323mg             152   9e-40    
ref|XP_006374071.1|  hypothetical protein POPTR_0015s00350g             152   1e-39    
ref|XP_006596411.1|  PREDICTED: uncharacterized protein LOC100806179    152   1e-39    
ref|XP_009799025.1|  PREDICTED: uncharacterized protein LOC104245155    151   1e-39    
ref|XP_010465905.1|  PREDICTED: uncharacterized protein LOC104746186    151   1e-39    
emb|CDY24440.1|  BnaC05g35140D                                          151   2e-39    
ref|NP_001046597.1|  Os02g0292800                                       151   2e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008370268.1|  PREDICTED: uncharacterized protein LOC103433763    150   2e-39    
ref|XP_010506551.1|  PREDICTED: uncharacterized protein LOC104783145    151   2e-39    
gb|KHG14650.1|  TRP-like ion channel pkd2                               151   2e-39    
ref|XP_010941112.1|  PREDICTED: uncharacterized protein LOC105059497    150   2e-39    
ref|XP_009629932.1|  PREDICTED: uncharacterized protein LOC104119992    150   3e-39    
ref|XP_008240216.1|  PREDICTED: uncharacterized protein LOC103338750    150   3e-39    
ref|XP_002321941.2|  hypothetical protein POPTR_0015s00360g             150   3e-39    Populus trichocarpa [western balsam poplar]
ref|XP_007033799.1|  Uncharacterized protein isoform 1                  150   3e-39    
ref|XP_011075866.1|  PREDICTED: uncharacterized protein LOC105160255    151   3e-39    
ref|XP_009130055.1|  PREDICTED: uncharacterized protein LOC103854850    150   3e-39    
ref|XP_010493710.1|  PREDICTED: uncharacterized protein LOC104770932    150   4e-39    
ref|XP_004235043.1|  PREDICTED: uncharacterized protein LOC101255968    150   5e-39    
ref|XP_010251073.1|  PREDICTED: uncharacterized protein LOC104593089    150   6e-39    
ref|XP_008376853.1|  PREDICTED: uncharacterized protein LOC103439973    152   6e-39    
ref|XP_006347643.1|  PREDICTED: uncharacterized protein LOC102604178    149   8e-39    
ref|XP_009361244.1|  PREDICTED: uncharacterized protein LOC103951550    149   9e-39    
ref|XP_007039247.1|  Uncharacterized protein TCM_015546                 149   1e-38    
emb|CDY18511.1|  BnaA01g26840D                                          149   1e-38    
emb|CDX95543.1|  BnaC01g34350D                                          149   1e-38    
ref|XP_003615481.1|  hypothetical protein MTR_5g068640                  149   1e-38    
ref|XP_002883119.1|  hypothetical protein ARALYDRAFT_898182             149   2e-38    
ref|XP_008376849.1|  PREDICTED: uncharacterized protein LOC103439971    148   2e-38    
ref|NP_001190384.1|  uncharacterized protein                            148   3e-38    
gb|EMT33291.1|  hypothetical protein F775_17747                         148   4e-38    
emb|CDX92214.1|  BnaA05g21930D                                          147   4e-38    
ref|XP_009630980.1|  PREDICTED: uncharacterized protein LOC104120835    146   6e-38    
ref|XP_006298426.1|  hypothetical protein CARUB_v10014495mg             147   6e-38    
gb|EYU42030.1|  hypothetical protein MIMGU_mgv1a013359mg                146   6e-38    
ref|XP_010279393.1|  PREDICTED: uncharacterized protein LOC104613...    147   9e-38    
ref|XP_010941436.1|  PREDICTED: uncharacterized protein LOC105059718    146   9e-38    
ref|XP_010255120.1|  PREDICTED: uncharacterized protein LOC104595873    146   1e-37    
ref|XP_002519623.1|  conserved hypothetical protein                     146   1e-37    Ricinus communis
ref|XP_010035332.1|  PREDICTED: uncharacterized protein LOC104424573    146   1e-37    
ref|XP_008794823.1|  PREDICTED: uncharacterized protein LOC103710721    146   1e-37    
ref|XP_004302619.1|  PREDICTED: uncharacterized protein LOC101304593    145   2e-37    
ref|XP_011072911.1|  PREDICTED: uncharacterized protein LOC105158014    145   3e-37    
ref|XP_010541513.1|  PREDICTED: uncharacterized protein LOC104814955    145   4e-37    
ref|XP_008443077.1|  PREDICTED: uncharacterized protein LOC103486782    145   4e-37    
gb|KFK39159.1|  hypothetical protein AALP_AA3G207900                    144   5e-37    
ref|XP_009145920.1|  PREDICTED: uncharacterized protein LOC103869595    144   6e-37    
ref|XP_010034922.1|  PREDICTED: uncharacterized protein LOC104424252    145   6e-37    
ref|XP_008678268.1|  PREDICTED: uncharacterized protein LOC103653081    145   6e-37    
ref|XP_007220014.1|  hypothetical protein PRUPE_ppa010476mg             144   1e-36    
ref|XP_010671282.1|  PREDICTED: uncharacterized protein LOC104888113    143   2e-36    
ref|XP_002270575.1|  PREDICTED: uncharacterized protein LOC100250773    143   2e-36    Vitis vinifera
ref|XP_008347273.1|  PREDICTED: uncharacterized protein LOC103410334    144   2e-36    
ref|XP_006659840.1|  PREDICTED: uncharacterized protein LOC102720900    143   2e-36    
ref|XP_010264522.1|  PREDICTED: uncharacterized protein LOC104602501    142   3e-36    
ref|NP_566601.1|  uncharacterized protein                               143   3e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034924.1|  PREDICTED: uncharacterized protein LOC104424258    142   4e-36    
gb|EYU17644.1|  hypothetical protein MIMGU_mgv1a012911mg                142   5e-36    
emb|CBI15505.3|  unnamed protein product                                142   5e-36    
emb|CBI35346.3|  unnamed protein product                                142   5e-36    
ref|XP_004160433.1|  PREDICTED: uncharacterized LOC101216222            142   6e-36    
ref|XP_006406635.1|  hypothetical protein EUTSA_v10021410mg             142   6e-36    
ref|XP_002277313.2|  PREDICTED: uncharacterized protein LOC100266291    142   1e-35    Vitis vinifera
ref|XP_007207598.1|  hypothetical protein PRUPE_ppa018775mg             140   1e-35    
ref|XP_006362347.1|  PREDICTED: uncharacterized protein LOC102593750    140   1e-35    
ref|XP_011003303.1|  PREDICTED: uncharacterized protein LOC105110089    140   1e-35    
ref|XP_004136739.1|  PREDICTED: uncharacterized protein LOC101204683    140   1e-35    
ref|XP_009361333.1|  PREDICTED: uncharacterized protein LOC103951628    140   3e-35    
ref|XP_006838746.1|  hypothetical protein AMTR_s00002p00255260          139   4e-35    
emb|CDO98398.1|  unnamed protein product                                139   4e-35    
ref|XP_011003304.1|  PREDICTED: uncharacterized protein LOC105110090    139   4e-35    
ref|XP_010036005.1|  PREDICTED: uncharacterized protein LOC104425114    139   5e-35    
ref|XP_004249038.1|  PREDICTED: uncharacterized protein LOC101263359    139   5e-35    
ref|XP_009388446.1|  PREDICTED: uncharacterized protein LOC103975255    140   6e-35    
gb|KCW88599.1|  hypothetical protein EUGRSUZ_A00975                     139   6e-35    
ref|XP_010045360.1|  PREDICTED: uncharacterized protein LOC104434094    139   6e-35    
gb|KDO64115.1|  hypothetical protein CISIN_1g040661mg                   138   7e-35    
ref|XP_010683476.1|  PREDICTED: uncharacterized protein LOC104898146    138   9e-35    
ref|XP_009113425.1|  PREDICTED: uncharacterized protein LOC103838724    138   2e-34    
ref|XP_010036909.1|  PREDICTED: uncharacterized protein LOC104425804    137   2e-34    
ref|XP_011095147.1|  PREDICTED: uncharacterized protein LOC105174672    137   2e-34    
ref|XP_009361246.1|  PREDICTED: uncharacterized protein LOC103951...    139   2e-34    
ref|XP_009361245.1|  PREDICTED: uncharacterized protein LOC103951...    139   3e-34    
ref|XP_002268419.1|  PREDICTED: uncharacterized protein LOC100242299    137   3e-34    
ref|XP_008234614.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   7e-34    
gb|AFK49129.1|  unknown                                                 135   8e-34    
emb|CDM83916.1|  unnamed protein product                                136   9e-34    
ref|XP_004492566.1|  PREDICTED: uncharacterized protein LOC101499956    135   1e-33    
ref|NP_001061011.1|  Os08g0153900                                       136   1e-33    
ref|XP_008809044.1|  PREDICTED: uncharacterized protein LOC103720873    135   1e-33    
ref|XP_010695642.1|  PREDICTED: uncharacterized protein LOC104908...    136   1e-33    
ref|XP_004252268.1|  PREDICTED: uncharacterized protein LOC101245139    135   1e-33    
ref|XP_006353814.1|  PREDICTED: uncharacterized protein LOC102578337    135   1e-33    
ref|XP_010695643.1|  PREDICTED: uncharacterized protein LOC104908...    136   1e-33    
ref|XP_010695641.1|  PREDICTED: uncharacterized protein LOC104908245    135   2e-33    
ref|XP_010519578.1|  PREDICTED: uncharacterized protein LOC104798992    135   2e-33    
emb|CBI35345.3|  unnamed protein product                                135   2e-33    
emb|CDP04969.1|  unnamed protein product                                135   2e-33    
ref|XP_009774013.1|  PREDICTED: uncharacterized protein LOC104224...    135   3e-33    
ref|XP_010252049.1|  PREDICTED: uncharacterized protein LOC104593758    134   4e-33    
ref|XP_003571480.1|  PREDICTED: uncharacterized protein LOC100832465    135   4e-33    
ref|XP_008661347.1|  PREDICTED: hypothetical protein isoform X1         135   6e-33    
ref|XP_009610829.1|  PREDICTED: uncharacterized protein LOC104104450    134   6e-33    
ref|NP_001131006.1|  hypothetical protein                               135   6e-33    
ref|XP_008661348.1|  PREDICTED: hypothetical protein isoform X2         135   7e-33    
ref|XP_009774014.1|  PREDICTED: uncharacterized protein LOC104224...    133   8e-33    
gb|KDP35159.1|  hypothetical protein JCGZ_10693                         133   8e-33    
ref|XP_006838748.1|  hypothetical protein AMTR_s00002p00255400          133   9e-33    
ref|XP_003525210.1|  PREDICTED: uncharacterized protein LOC100788...    133   1e-32    
gb|EEC82916.1|  hypothetical protein OsI_27840                          132   2e-32    
ref|XP_009395548.1|  PREDICTED: uncharacterized protein LOC103980773    133   2e-32    
ref|XP_003631042.1|  hypothetical protein MTR_8g106520                  132   2e-32    
dbj|BAC55679.1|  hypothetical protein                                   132   3e-32    
ref|XP_003566999.1|  PREDICTED: uncharacterized protein LOC100834100    132   4e-32    
ref|XP_006584890.1|  PREDICTED: uncharacterized protein LOC100775...    131   5e-32    
ref|XP_006584889.1|  PREDICTED: uncharacterized protein LOC100775...    131   7e-32    
ref|XP_004137325.1|  PREDICTED: uncharacterized protein LOC101216222    130   1e-31    
gb|AFK42577.1|  unknown                                                 130   1e-31    
gb|ACU19428.1|  unknown                                                 130   1e-31    
ref|XP_003530940.1|  PREDICTED: uncharacterized protein LOC100775...    130   1e-31    
ref|XP_004972825.1|  PREDICTED: uncharacterized protein LOC101775852    130   2e-31    
emb|CAN66486.1|  hypothetical protein VITISV_015393                     129   2e-31    
gb|EMS68120.1|  hypothetical protein TRIUR3_34319                       127   3e-31    
ref|XP_008374792.1|  PREDICTED: uncharacterized protein LOC103438037    129   3e-31    
gb|AFK40919.1|  unknown                                                 128   4e-31    
ref|XP_009347590.1|  PREDICTED: uncharacterized protein LOC103939252    128   5e-31    
ref|XP_004503316.1|  PREDICTED: uncharacterized protein LOC101509852    128   5e-31    
ref|XP_008453446.1|  PREDICTED: uncharacterized protein LOC103494152    128   5e-31    
ref|XP_004299565.1|  PREDICTED: uncharacterized protein LOC101293202    128   5e-31    
gb|AFK48475.1|  unknown                                                 128   5e-31    
gb|KHN40636.1|  hypothetical protein glysoja_001134                     127   6e-31    
ref|XP_003552312.1|  PREDICTED: uncharacterized protein LOC100806984    127   7e-31    
gb|KDP21861.1|  hypothetical protein JCGZ_00648                         126   8e-31    
ref|XP_002323084.2|  hypothetical protein POPTR_0016s14480g             127   1e-30    
ref|XP_004974428.1|  PREDICTED: uncharacterized protein LOC101782340    127   2e-30    
ref|NP_001237570.1|  uncharacterized protein LOC100527542               126   2e-30    
ref|XP_002456158.1|  hypothetical protein SORBIDRAFT_03g031390          126   4e-30    
ref|XP_008345644.1|  PREDICTED: uncharacterized protein LOC103408583    125   4e-30    
ref|XP_010086934.1|  hypothetical protein L484_001579                   126   4e-30    
ref|XP_010421288.1|  PREDICTED: uncharacterized protein LOC104706...    125   5e-30    
gb|EMT28168.1|  hypothetical protein F775_11196                         127   5e-30    
ref|XP_008370267.1|  PREDICTED: uncharacterized protein LOC103433762    124   9e-30    
ref|XP_004503315.1|  PREDICTED: uncharacterized protein LOC101509529    125   9e-30    
ref|XP_003571482.1|  PREDICTED: uncharacterized protein LOC100833087    125   1e-29    
gb|EEC71284.1|  hypothetical protein OsI_03297                          125   1e-29    
ref|XP_003623633.1|  hypothetical protein MTR_7g073370                  124   1e-29    
ref|XP_007140075.1|  hypothetical protein PHAVU_008G082000g             124   1e-29    
ref|NP_001168944.1|  hypothetical protein                               124   1e-29    
ref|XP_009396338.1|  PREDICTED: uncharacterized protein LOC103981355    124   2e-29    
ref|XP_009394478.1|  PREDICTED: uncharacterized protein LOC103979939    124   2e-29    
ref|XP_008782672.1|  PREDICTED: uncharacterized protein LOC103702144    124   2e-29    
ref|XP_006580415.1|  PREDICTED: uncharacterized protein LOC100788...    125   2e-29    
ref|XP_010279399.1|  PREDICTED: uncharacterized protein LOC104613323    124   2e-29    
gb|EEE55190.1|  hypothetical protein OsJ_03034                          124   2e-29    
gb|AFW61226.1|  hypothetical protein ZEAMMB73_414085                    125   2e-29    
emb|CDY22360.1|  BnaA06g36820D                                          124   2e-29    
ref|WP_038020240.1|  hypothetical protein                               122   3e-29    
ref|WP_013706971.1|  hypothetical protein                               122   3e-29    
emb|CDY30795.1|  BnaC07g16950D                                          123   4e-29    
ref|XP_007036646.1|  Uncharacterized protein isoform 2                  123   5e-29    
ref|XP_008245317.1|  PREDICTED: uncharacterized protein LOC103343440    122   9e-29    
gb|KCW69981.1|  hypothetical protein EUGRSUZ_F03291                     122   9e-29    
ref|XP_008673149.1|  PREDICTED: hypothetical protein isoform X1         122   1e-28    
gb|ABK21406.1|  unknown                                                 122   1e-28    
ref|XP_002445064.1|  hypothetical protein SORBIDRAFT_07g003530          122   1e-28    
ref|XP_010921163.1|  PREDICTED: uncharacterized protein LOC105044834    121   1e-28    
ref|XP_002523265.1|  conserved hypothetical protein                     122   2e-28    
ref|XP_004301272.1|  PREDICTED: uncharacterized protein LOC101299969    121   2e-28    
gb|KIF83538.1|  hypothetical protein TSA66_06505                        120   2e-28    
ref|XP_009101801.1|  PREDICTED: uncharacterized protein LOC103827985    121   2e-28    
ref|XP_008461857.1|  PREDICTED: uncharacterized protein LOC103500327    120   4e-28    
ref|XP_004137490.1|  PREDICTED: uncharacterized protein LOC101217102    120   5e-28    
emb|CDP06386.1|  unnamed protein product                                120   6e-28    
ref|WP_015905709.1|  hypothetical protein                               119   7e-28    
ref|XP_007206486.1|  hypothetical protein PRUPE_ppa019067mg             119   7e-28    
ref|WP_018508217.1|  hypothetical protein                               119   8e-28    
ref|WP_009148388.1|  putative membrane protein                          119   9e-28    
ref|NP_001061010.1|  Os08g0153800                                       119   1e-27    
ref|XP_004299566.1|  PREDICTED: uncharacterized protein LOC101293491    119   1e-27    
ref|XP_010260363.1|  PREDICTED: uncharacterized protein LOC104599498    118   2e-27    
ref|XP_003631043.1|  hypothetical protein MTR_8g106530                  120   9e-27    
gb|EYU44982.1|  hypothetical protein MIMGU_mgv1a013390mg                115   1e-26    
gb|EXJ17146.1|  hypothetical protein D779_0898                          115   2e-26    
ref|XP_010279396.1|  PREDICTED: uncharacterized protein LOC104613...    115   2e-26    
ref|XP_004969565.1|  PREDICTED: uncharacterized protein LOC101755436    115   3e-26    
ref|XP_007021602.1|  Uncharacterized protein isoform 1                  115   4e-26    
ref|XP_010260365.1|  PREDICTED: uncharacterized protein LOC104599499    115   4e-26    
ref|XP_010279398.1|  PREDICTED: uncharacterized protein LOC104613322    113   2e-25    
ref|XP_008226467.1|  PREDICTED: uncharacterized protein LOC103326041    112   3e-25    
gb|EYU44119.1|  hypothetical protein MIMGU_mgv1a022843mg                112   3e-25    
ref|XP_011001690.1|  PREDICTED: uncharacterized protein LOC105108891    112   3e-25    
gb|KHN00190.1|  hypothetical protein glysoja_028718                     110   4e-25    
ref|WP_007040855.1|  hypothetical protein                               110   7e-25    
gb|AFK43701.1|  unknown                                                 111   7e-25    
ref|NP_199132.1|  uncharacterized protein                               111   7e-25    
ref|XP_007213024.1|  hypothetical protein PRUPE_ppa023086mg             111   7e-25    
ref|XP_008350029.1|  PREDICTED: uncharacterized protein LOC103413334    112   7e-25    
gb|AFK39714.1|  unknown                                                 111   7e-25    
ref|XP_010553194.1|  PREDICTED: uncharacterized protein LOC104823351    110   1e-24    
ref|XP_006387883.1|  hypothetical protein POPTR_0500s00200g             110   1e-24    
ref|XP_002863687.1|  hypothetical protein ARALYDRAFT_494686             110   1e-24    
ref|WP_037564866.1|  hypothetical protein                               109   1e-24    
ref|XP_006490703.1|  PREDICTED: uncharacterized protein LOC102625...    109   2e-24    
ref|XP_643434.1|  DUF599 family protein                                 110   2e-24    
ref|WP_035383053.1|  hypothetical protein                               109   2e-24    
ref|XP_010497885.1|  PREDICTED: uncharacterized protein LOC104775613    105   3e-24    
ref|XP_009792895.1|  PREDICTED: uncharacterized protein LOC104239...    110   3e-24    
ref|XP_009792893.1|  PREDICTED: uncharacterized protein LOC104239...    110   3e-24    
gb|KFK31732.1|  hypothetical protein AALP_AA6G151800                    109   3e-24    
ref|XP_006451701.1|  hypothetical protein CICLE_v10009323mg             108   3e-24    
gb|EAZ22658.1|  hypothetical protein OsJ_06329                          108   4e-24    
ref|XP_009347582.1|  PREDICTED: uncharacterized protein LOC103939244    109   4e-24    
ref|XP_010481897.1|  PREDICTED: uncharacterized protein LOC104760636    109   4e-24    
ref|XP_010442061.1|  PREDICTED: uncharacterized protein LOC104725152    109   4e-24    
gb|KHN00189.1|  hypothetical protein glysoja_028717                     108   4e-24    
gb|KCW74502.1|  hypothetical protein EUGRSUZ_E03214                     108   5e-24    
ref|XP_010057352.1|  PREDICTED: uncharacterized protein LOC104445227    108   7e-24    
ref|XP_008346858.1|  PREDICTED: uncharacterized protein LOC103409849    108   9e-24    
ref|XP_010093542.1|  hypothetical protein L484_013975                   107   9e-24    
ref|XP_008374791.1|  PREDICTED: uncharacterized protein LOC103438036    108   1e-23    
ref|WP_012970652.1|  hypothetical protein                               107   1e-23    
ref|XP_003286162.1|  hypothetical protein DICPUDRAFT_77060              107   2e-23    
ref|XP_002300402.1|  hypothetical protein POPTR_0001s38190g             106   2e-23    
ref|XP_007160481.1|  hypothetical protein PHAVU_002G325700g             106   3e-23    
ref|XP_010684248.1|  PREDICTED: uncharacterized protein LOC104898836    107   3e-23    
ref|XP_009383761.1|  PREDICTED: uncharacterized protein LOC103971460    106   4e-23    
ref|XP_011082717.1|  PREDICTED: uncharacterized protein LOC105165416    105   4e-23    
ref|XP_011082716.1|  PREDICTED: uncharacterized protein LOC105165414    106   5e-23    
ref|WP_002809242.1|  hypothetical protein                               105   5e-23    
ref|XP_010057353.1|  PREDICTED: uncharacterized protein LOC104445228    106   5e-23    
emb|CDO99468.1|  unnamed protein product                                105   6e-23    
ref|XP_003530939.1|  PREDICTED: uncharacterized protein LOC100820443    105   8e-23    
gb|KHG05167.1|  protein zinc induced facilitator-like 1                 105   9e-23    
ref|XP_008351067.1|  PREDICTED: uncharacterized protein LOC103414468    105   1e-22    
tpg|DAA49166.1|  TPA: hypothetical protein ZEAMMB73_033358              105   1e-22    
ref|XP_003524352.1|  PREDICTED: uncharacterized protein LOC100807201    104   2e-22    
gb|EXJ16567.1|  hypothetical protein D779_4120                          104   2e-22    
ref|XP_004485847.1|  PREDICTED: uncharacterized protein LOC101514713    103   3e-22    
ref|XP_007160482.1|  hypothetical protein PHAVU_002G325800g             103   3e-22    
emb|CBI30624.3|  unnamed protein product                                105   4e-22    
ref|XP_011086032.1|  PREDICTED: uncharacterized protein LOC105167880    102   5e-22    
ref|XP_010057355.1|  PREDICTED: uncharacterized protein LOC104445230    103   5e-22    
ref|XP_010062843.1|  PREDICTED: uncharacterized protein LOC104450108    102   8e-22    
ref|XP_004302620.1|  PREDICTED: uncharacterized protein LOC101304886    102   9e-22    
ref|XP_006659371.1|  PREDICTED: uncharacterized protein LOC102720899    102   9e-22    
ref|NP_001061682.1|  Os08g0377500                                       102   9e-22    
ref|XP_009394822.1|  PREDICTED: uncharacterized protein LOC103980226    102   1e-21    
ref|XP_006403278.1|  hypothetical protein EUTSA_v10003266mg             102   1e-21    
ref|NP_001144959.1|  uncharacterized protein LOC100278096               102   1e-21    
ref|XP_002444266.1|  hypothetical protein SORBIDRAFT_07g019180          102   1e-21    
ref|XP_007148103.1|  hypothetical protein PHAVU_006G181100g             101   1e-21    
ref|XP_010279394.1|  PREDICTED: uncharacterized protein LOC104613...    100   2e-21    
ref|XP_006441296.1|  hypothetical protein CICLE_v10023865mg             100   2e-21    
ref|XP_006659838.1|  PREDICTED: uncharacterized protein LOC102720349  99.8    2e-21    
gb|ACU18162.1|  unknown                                                 101   2e-21    
ref|XP_011097003.1|  PREDICTED: uncharacterized protein LOC105176028    101   2e-21    
ref|XP_006646211.1|  PREDICTED: uncharacterized protein LOC102723009  99.8    3e-21    
ref|XP_007021604.1|  Uncharacterized protein TCM_031654                 100   3e-21    
ref|XP_003595940.1|  hypothetical protein MTR_2g063800                95.9    3e-21    
ref|XP_003574436.1|  PREDICTED: uncharacterized protein LOC100827597    100   4e-21    
ref|XP_010279221.1|  PREDICTED: uncharacterized protein LOC104613194    101   4e-21    
dbj|GAM22677.1|  hypothetical protein SAMD00019534_058520               100   4e-21    
ref|XP_007213200.1|  hypothetical protein PRUPE_ppa026709mg             101   4e-21    
ref|XP_006449421.1|  hypothetical protein CICLE_v10017559mg             103   6e-21    
ref|WP_011871913.1|  hypothetical protein                             99.4    7e-21    
dbj|BAJ99510.1|  predicted protein                                      100   7e-21    
ref|WP_013029468.1|  hypothetical protein                             99.4    8e-21    
ref|WP_014322032.1|  hypothetical protein                             99.4    1e-20    
ref|WP_012080466.1|  hypothetical protein                             99.0    1e-20    
gb|EMS49751.1|  hypothetical protein TRIUR3_02904                     99.8    1e-20    
ref|WP_013220644.1|  hypothetical protein                             98.6    1e-20    
ref|WP_020562830.1|  hypothetical protein                             98.6    1e-20    
ref|XP_010058948.1|  PREDICTED: uncharacterized protein LOC104446847  98.2    1e-20    
ref|XP_010279222.1|  PREDICTED: uncharacterized protein LOC104613195  98.6    2e-20    
ref|WP_022660236.1|  hypothetical protein                             98.6    2e-20    
gb|KCW74504.1|  hypothetical protein EUGRSUZ_E03216                   98.2    2e-20    
ref|XP_006594566.1|  PREDICTED: uncharacterized protein LOC100789...  98.6    2e-20    
gb|KCW74507.1|  hypothetical protein EUGRSUZ_E03222                   98.2    2e-20    
ref|XP_003543017.1|  PREDICTED: uncharacterized protein LOC100789...  98.6    2e-20    
ref|XP_011001216.1|  PREDICTED: uncharacterized protein LOC105108566  98.6    2e-20    
ref|XP_010057354.1|  PREDICTED: uncharacterized protein LOC104445229  98.2    2e-20    
ref|XP_006682119.1|  hypothetical protein BATDEDRAFT_5536             97.8    3e-20    
ref|XP_007033800.1|  Uncharacterized protein isoform 2                97.1    3e-20    
ref|XP_009628721.1|  PREDICTED: uncharacterized protein LOC104119032  97.4    4e-20    
ref|WP_034607797.1|  hypothetical protein                             97.1    4e-20    
ref|WP_024826933.1|  hypothetical protein                             97.4    4e-20    
ref|XP_002528696.1|  conserved hypothetical protein                   96.7    5e-20    
gb|EMT28783.1|  hypothetical protein F775_08576                       97.8    5e-20    



>ref|XP_011082099.1| PREDICTED: uncharacterized protein LOC105164948 [Sesamum indicum]
Length=243

 Score =   396 bits (1017),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 208/241 (86%), Gaps = 7/241 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF +C+GYH WLWHKVRTQPLTTIIGTNA GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFFMCMGYHVWLWHKVRTQPLTTIIGTNARGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYS+KKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSIKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL-GVVRPDYVVELLEKSFALNAVGN  497
             YVTLL++FLFSFV HSLSIRFTNQVNFLINCPPD   GVV  +YV ELLE+ F LN VGN
Sbjct  121   YVTLLLVFLFSFVCHSLSIRFTNQVNFLINCPPDTSNGVVTAEYVSELLERGFTLNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL------GHDYDHEIGN  335
             RLFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFVF   K KL      GH+++HE   
Sbjct  181   RLFYAALPLLLWIFGPVLVFLCSVTMVPVLYNLDFVFAAEKKKLRSENGNGHEHEHEHDC  240

Query  334   G  332
             G
Sbjct  241   G  241



>ref|XP_009770569.1| PREDICTED: uncharacterized protein LOC104221250 [Nicotiana sylvestris]
Length=237

 Score =   395 bits (1016),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 208/234 (89%), Gaps = 3/234 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+IC+GYH WLWHKVRTQPLTTIIGTN+ GRRLWVSAIMKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFMICMGYHVWLWHKVRTQPLTTIIGTNSNGRRLWVSAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILA+QTLRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDA+YGAHGEFMVALK
Sbjct  61    KNILAIQTLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L+IFLFSF+ H+LSIRF NQVNFLINCP DNLG+V P+YV ELLEK F LN VGNR
Sbjct  121   YVTVLLIFLFSFICHTLSIRFINQVNFLINCPADNLGIVSPEYVSELLEKGFFLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             LFYAA+P+LLWI GPVLV LC+ TMVP+ YNLDFVF   KGK+      E GNG
Sbjct  181   LFYAALPLLLWIFGPVLVFLCFITMVPMFYNLDFVFCNAKGKMD---PRENGNG  231



>ref|XP_009612289.1| PREDICTED: uncharacterized protein LOC104105645 [Nicotiana tomentosiformis]
Length=237

 Score =   392 bits (1008),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 208/234 (89%), Gaps = 3/234 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+IC+GYH WLWHKVRTQPLTTIIGTN++GRRLWVSAIMKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFMICMGYHVWLWHKVRTQPLTTIIGTNSSGRRLWVSAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNIL VQTLRN IMG+TLMATTS+LLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILGVQTLRNTIMGATLMATTSVLLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L+IFLFSF+ H+LSIRF NQVNFLINCP DNLG+V P+YV ELLEK F LN VGNR
Sbjct  121   YVTVLLIFLFSFICHTLSIRFINQVNFLINCPADNLGIVSPEYVSELLEKGFFLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             LFYAA+P+LLWI GPVLV LC+ T+VP+ YNLDFVF   KGK+    +   GNG
Sbjct  181   LFYAALPLLLWIFGPVLVFLCFITIVPMFYNLDFVFCNAKGKMDPPQN---GNG  231



>gb|EYU22084.1| hypothetical protein MIMGU_mgv1a012749mg [Erythranthe guttata]
Length=241

 Score =   384 bits (987),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 206/240 (86%), Gaps = 7/240 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLGF +C+GYH WLWHKVRTQP +T+IGTN+ GRR WVSAIMKDNEK
Sbjct  1     MEWKKCYLDVILVPLGFSLCMGYHVWLWHKVRTQPFSTVIGTNSRGRRFWVSAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC GLAAVISSTYS+KKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCCGLAAVISSTYSIKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPD-NLGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL+IFLFSFV HSLSIRFTNQVNFLINCPPD + GVV P+YV ELLE+ FALN VGN
Sbjct  121   YVTLLVIFLFSFVCHSLSIRFTNQVNFLINCPPDTSSGVVSPEYVGELLERGFALNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK------LGHDYDHEIGN  335
             RLFY A+P++LW+ GPVLV LC AT+VPVLYNLDFVF     K      +G   +H+ G+
Sbjct  181   RLFYMAMPLMLWVFGPVLVFLCSATLVPVLYNLDFVFAAAAEKRKSGAEVGGGNEHDCGS  240



>emb|CDP18327.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 206/238 (87%), Gaps = 5/238 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLDVVLVPLGFL+C+GYH WLW KVRT PL+TIIGTNA GRRLWVSA+MKDN+K
Sbjct  1     MEWRKSYLDVVLVPLGFLVCIGYHFWLWRKVRTDPLSTIIGTNARGRRLWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKP+ND+V+GAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPINDSVFGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV++L+IFLFSF+ HSLSIRFTNQVNFL+NCP D  G+V P+YV ELLEK F LN VGNR
Sbjct  121   YVSVLLIFLFSFICHSLSIRFTNQVNFLVNCPRDETGIVTPEYVSELLEKGFVLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPP-KGKLGHDYDHEIGNGVLE  323
             LFYAA+P+LLWI GPVLV LC  T+VPVLYNLD VF    KGK    ++ +  NG  E
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSITLVPVLYNLDIVFVSNVKGK----FNLQDENGASE  234



>ref|XP_002527988.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34400.1| conserved hypothetical protein [Ricinus communis]
Length=234

 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 201/232 (87%), Gaps = 2/232 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K Y+DVVLVPLGF+I + YHAWLWHKVRTQPL+TIIGTNA GRR WVSA+MKDN+K
Sbjct  1     MEWRKCYMDVVLVPLGFMITMAYHAWLWHKVRTQPLSTIIGTNATGRRFWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAA+ISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAIISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVN LIN PPD + +V PDYV ELLEK F LN VGNR
Sbjct  121   YVTLLSIFLFSFFCHSLSIRFVNQVNLLINTPPDPMSIVTPDYVSELLEKGFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFT--PPKGKLGHDYDHE  344
             LFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFVF     KGK+G + + E
Sbjct  181   LFYAAMPLLLWIFGPVLVFLCCVTMVPVLYNLDFVFANGTAKGKVGVNGERE  232



>ref|XP_009759307.1| PREDICTED: uncharacterized protein LOC104211865 [Nicotiana sylvestris]
Length=244

 Score =   374 bits (961),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 204/239 (85%), Gaps = 2/239 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+IC+GYH WLWHKV+TQP  TIIGTNA GRR+WVSAIMKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFMICMGYHIWLWHKVKTQPFNTIIGTNANGRRVWVSAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT RN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYG HGEFMVALK
Sbjct  61    KNILAVQTFRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGGHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL+IFLFSF+ +S+SIRF NQVNFLINCP D  G+V  +Y+ ELLEKSF LNAV NR
Sbjct  121   YVTLLLIFLFSFICYSISIRFINQVNFLINCPEDIFGIVSIEYICELLEKSFILNAVANR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFT-PPKGKLGHDYDHEIG-NGVLE  323
             LFYAA+ ++LWI GPVLV LC  ++V VLYNLD V +   KGK+ H++ HE G NG  E
Sbjct  181   LFYAALTLVLWIFGPVLVFLCSISLVTVLYNLDIVISHDEKGKMVHNHHHENGINGAAE  239



>ref|XP_006382197.1| hypothetical protein POPTR_0006s29270g [Populus trichocarpa]
 gb|ERP59994.1| hypothetical protein POPTR_0006s29270g [Populus trichocarpa]
Length=234

 Score =   372 bits (955),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/235 (77%), Positives = 203/235 (86%), Gaps = 1/235 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+I + YH WLWHKVRTQPLTTIIGTNA+GRR WVSAIMKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFMISMAYHGWLWHKVRTQPLTTIIGTNASGRRFWVSAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAA+ISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAIISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L IF+FSF  HSLSIRF NQVN LIN PPD + +V  +YV ELLEK F LN VGNR
Sbjct  121   YVTILTIFMFSFFCHSLSIRFVNQVNLLINTPPDPMSMVTSEYVSELLEKGFVLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGV  329
             LFY+A+P+LLWI GPVLV LC  TMVPVLYNLDFVF   +GK+  + + EIG+ V
Sbjct  181   LFYSAMPLLLWIFGPVLVFLCSVTMVPVLYNLDFVFGNGQGKI-MNRNGEIGDFV  234



>gb|KDP33421.1| hypothetical protein JCGZ_06992 [Jatropha curcas]
Length=271

 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = -2

Query  1039  KNMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDN  860
             K MEW+K YLDV+LVPLGFLI + YH WLWHKVRTQPLTTIIGTN+ GRR WVSA+MKDN
Sbjct  37    KMMEWRKCYLDVILVPLGFLISMAYHLWLWHKVRTQPLTTIIGTNSRGRRFWVSAMMKDN  96

Query  859   EKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVA  680
             +KKNILAVQTLRN+IMGSTLMATTSILL +GLAA+ISSTYSVKKPLND VYGAHGEFMVA
Sbjct  97    DKKNILAVQTLRNLIMGSTLMATTSILLSAGLAAIISSTYSVKKPLNDVVYGAHGEFMVA  156

Query  679   LKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVG  500
             LKYVT+L IFLFSF  HSLSIRF NQVN LIN P D + VV P+YV ELLEK F LN VG
Sbjct  157   LKYVTILSIFLFSFFCHSLSIRFVNQVNLLINTPQDPMSVVTPEYVGELLEKGFVLNTVG  216

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGH  359
             NRLFY A+P+LLWI GPVLV LC  TMVPVLYNLDFVF+  +GK  H
Sbjct  217   NRLFYTAMPLLLWIFGPVLVFLCCVTMVPVLYNLDFVFSSSEGKTSH  263



>ref|XP_004498551.1| PREDICTED: uncharacterized protein LOC101505025 [Cicer arietinum]
Length=232

 Score =   369 bits (947),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI +GYH WLWHKVRTQP TTI+G NA+GRR WV A+MKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFLISIGYHLWLWHKVRTQPHTTIVGINASGRRNWVDAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDA+YGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSL+IRF NQVN LIN P D + +V P+Y+ E+LEK F LNAVGNR
Sbjct  121   YVTLLTIFLFSFFCHSLAIRFINQVNILINTPQDPMSLVTPEYIFEILEKGFILNAVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYA +PMLLWI GPVLV LC  TMVPVLYNLDFV+T  KGK+  D   +
Sbjct  181   LFYAGLPMLLWIFGPVLVFLCSITMVPVLYNLDFVYTSGKGKMDVDQKED  230



>ref|XP_009627443.1| PREDICTED: uncharacterized protein LOC104117990 [Nicotiana tomentosiformis]
Length=243

 Score =   369 bits (947),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 202/236 (86%), Gaps = 3/236 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+IC+GYH WLWHKV+TQP  TIIGTNA GRRLWVSAIMKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFMICMGYHIWLWHKVKTQPFQTIIGTNANGRRLWVSAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT RN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYG HGEFMVALK
Sbjct  61    KNILAVQTFRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGGHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL+IFLFSF+ +S+SIRF NQVNFLINCP D  G+V  +Y+ ELLEKSF LN VGNR
Sbjct  121   YVTLLLIFLFSFICYSISIRFINQVNFLINCPEDIFGIVSIEYISELLEKSFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTP-PKGKLGHDYDHEIG-NG  332
             LFYAA+ ++LWI GPVLV LC  ++V VLYNLD V +   KGK+ H + HE G NG
Sbjct  181   LFYAALTLVLWIFGPVLVFLCSISLVTVLYNLDIVISQDEKGKMVH-HHHENGING  235



>ref|XP_011006640.1| PREDICTED: uncharacterized protein LOC105112602 [Populus euphratica]
 ref|XP_011008682.1| PREDICTED: uncharacterized protein LOC105113998 [Populus euphratica]
Length=234

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+I + YH WLWHKVRTQPLTTIIGTNA+GRR WVSAIMKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFMISMAYHGWLWHKVRTQPLTTIIGTNASGRRFWVSAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAA+ISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAIISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L IF+FSF  HS SIRF NQVN LIN PPD +  V  +YV ELLEK F LN VGNR
Sbjct  121   YVTILTIFMFSFFCHSSSIRFVNQVNLLINTPPDPMSRVTSEYVSELLEKGFVLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFY+A+P+LLWI GPVLV LC  TMVPVLYNLDFVF   +GK+
Sbjct  181   LFYSAMPLLLWIFGPVLVFLCSVTMVPVLYNLDFVFGNGQGKI  223



>ref|XP_006342696.1| PREDICTED: uncharacterized protein LOC102602114 [Solanum tuberosum]
Length=242

 Score =   367 bits (941),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 207/235 (88%), Gaps = 1/235 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+IC+GYH WLWHKV+ QPLTTIIGTNA GRRLWV AIMKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFIICMGYHIWLWHKVKNQPLTTIIGTNANGRRLWVEAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATTSILLCSGLAAVISSTYSVK+PLNDA+YGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTSILLCSGLAAVISSTYSVKQPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL+IFLFSF+ H+LSIRF NQVNFLINCP DNLG+V P+YV ELLEK F LN VGNR
Sbjct  121   YVTLLLIFLFSFLCHTLSIRFINQVNFLINCPQDNLGIVSPEYVSELLEKGFGLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFT-PPKGKLGHDYDHEIGNG  332
             LFYAA+P+LLWI GPVLV LC+ TMVP+ YNLDFV +   KGK+ +  ++   +G
Sbjct  181   LFYAALPLLLWIFGPVLVFLCFVTMVPMFYNLDFVCSNQEKGKIEYPCENGCNSG  235



>ref|XP_009375722.1| PREDICTED: uncharacterized protein LOC103964515 [Pyrus x bretschneideri]
Length=236

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI + YHAWLWHKVRT P +TIIG N +GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLITVSYHAWLWHKVRTDPRSTIIGINTSGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF+ HSLSIRF NQVN LIN P D + +V P+YV ELLEK + LN  GNR
Sbjct  121   YVTLLTIFLFSFMCHSLSIRFINQVNILINTPQDPMSLVTPEYVSELLEKGYLLNTAGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYAA+P++LWI GPVLV LC  TMVPVLYNLDFVF+    K   D  +E
Sbjct  181   LFYAALPLVLWIFGPVLVFLCSVTMVPVLYNLDFVFSSSTEKRKMDIGNE  230



>ref|XP_004253068.1| PREDICTED: uncharacterized protein LOC101258542 [Solanum lycopersicum]
Length=238

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/234 (79%), Positives = 207/234 (88%), Gaps = 3/234 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLDV+LVPLGF+IC+GYH WLWHKV+ QPLTTIIGTNA GRRLWV AIMKDNEK
Sbjct  1     MEWRKSYLDVILVPLGFVICMGYHIWLWHKVKNQPLTTIIGTNANGRRLWVEAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATTSILLCSGLAAVISSTYSVK+PLNDA+YGAHGEF+VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTSILLCSGLAAVISSTYSVKQPLNDAIYGAHGEFIVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL+IFLFSF+ H+LSIRF NQVNFLINCP DNLG+V P+YV ELLEK F LN VGNR
Sbjct  121   YVTLLLIFLFSFLCHTLSIRFINQVNFLINCPQDNLGIVSPEYVSELLEKGFGLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV-FTPPKGKLGHDYDHEIGN  335
             LFYAA+P+LLWI GPVLV LC+ TMVP+ YNLDFV     KGK+  +Y  E G+
Sbjct  181   LFYAALPLLLWIFGPVLVFLCFITMVPMFYNLDFVCCNQEKGKI--EYTCENGS  232



>ref|XP_008378131.1| PREDICTED: uncharacterized protein LOC103441210 isoform X1 [Malus 
domestica]
Length=236

 Score =   364 bits (934),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI + YHAWLWHKVRT P +TIIG N +GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLITVSYHAWLWHKVRTDPRSTIIGINTSGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF+ HSLSIRF NQVN LIN P D + +V P+YV ELLEK + LN  GNR
Sbjct  121   YVSLLTIFLFSFMCHSLSIRFINQVNILINSPQDPMSLVTPEYVSELLEKGYLLNTAGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYAA+P++LWI GPVLV LC  TMVPVLYNLDFVF+    K   D  +E
Sbjct  181   LFYAALPLVLWIFGPVLVFLCSVTMVPVLYNLDFVFSSSTEKRKMDIGNE  230



>gb|ACJ85371.1| unknown [Medicago truncatula]
 gb|AFK47953.1| unknown [Medicago truncatula]
Length=232

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  LI +GYH WLWHKVRTQP TTI+G NA+GRR WV+A+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLAMLISIGYHVWLWHKVRTQPHTTIVGINASGRRNWVNAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDA+YGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF  HSLSIRF NQVN LIN P D + +V P+Y+ E+LEK F LNAVGNR
Sbjct  121   YVSLLTIFLFSFFCHSLSIRFINQVNILINTPQDPMSLVTPEYIFEILEKGFILNAVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYA +P+LLWI GPV+V LC   MVPVLYNLDFV+T  KGK+  D   +
Sbjct  181   LFYAGLPLLLWIFGPVMVFLCSLAMVPVLYNLDFVYTTGKGKMNVDQKED  230



>ref|XP_003550111.1| PREDICTED: uncharacterized protein LOC100527805 [Glycine max]
 gb|KHN12825.1| hypothetical protein glysoja_047011 [Glycine soja]
Length=233

 Score =   360 bits (925),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL FL  +GYH WLWHKVRTQP TTIIG NA+GRR WV+A+MKDN+K
Sbjct  1     MEWRKCYLDVILVPLVFLTSIGYHFWLWHKVRTQPHTTIIGINASGRRNWVNAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D + +V P Y+ E+LEK F LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFINQVNILINTPQDPMSLVTPQYIKEILEKGFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFYA +P+LLWI GPVLV LC  TMVPVLYNLDFVFT  KGK+
Sbjct  181   LFYAGLPLLLWIFGPVLVFLCSLTMVPVLYNLDFVFTSGKGKV  223



>gb|AFK33773.1| unknown [Medicago truncatula]
Length=232

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 194/230 (84%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  LI +GYH WLWHKVRTQP TTI+G NA+GRR WV+A+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLAMLISIGYHVWLWHKVRTQPHTTIVGINASGRRNWVNAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDA+YGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF  HSLSI F NQVN LIN P D + +V P+Y+ E+LEK F LNAVGNR
Sbjct  121   YVSLLTIFLFSFFCHSLSIGFINQVNILINTPQDPMSLVTPEYIFEILEKGFILNAVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYA +P+LLWI GPV+V LC   MVPVLYNLDFV+T  KGK+  D   +
Sbjct  181   LFYAGLPLLLWIFGPVMVFLCSLAMVPVLYNLDFVYTTGKGKMNVDQKED  230



>ref|XP_009367953.1| PREDICTED: uncharacterized protein LOC103957506 [Pyrus x bretschneideri]
Length=236

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 192/234 (82%), Gaps = 0/234 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFL+   YHAWLWHKVRT P +TIIG N +GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLMTASYHAWLWHKVRTDPRSTIIGINTSGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF+ HSLSIRF NQVN LIN P +   +V P+YV  LLEK + LN  GNR
Sbjct  121   YVTLLTIFLFSFMCHSLSIRFINQVNILINSPQEPTSLVTPEYVSALLEKGYLLNTAGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             LFYAA+P++LWI GPVLV LC ATMVPVLYNLDFV +    K   D  +E G+ 
Sbjct  181   LFYAALPLVLWIFGPVLVFLCSATMVPVLYNLDFVSSSSTEKTEMDSGNENGDA  234



>ref|XP_006483627.1| PREDICTED: uncharacterized protein LOC102619321 [Citrus sinensis]
 gb|KDO67188.1| hypothetical protein CISIN_1g025794mg [Citrus sinensis]
Length=248

 Score =   359 bits (922),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 194/238 (82%), Gaps = 6/238 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF I + YH WLWHK+RT+PLTTI+GTNA GRRLWV+A+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFSITMAYHIWLWHKIRTEPLTTIVGTNARGRRLWVTAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRNMIMGSTLMATTSILLC+GLAAVISSTYSVKKPLNDAVYG HGEFM+ALK
Sbjct  61    KNILAVQSLRNMIMGSTLMATTSILLCTGLAAVISSTYSVKKPLNDAVYGGHGEFMLALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF  HSL+IRF NQVN LIN PPD L +V P+YV +L EK   LN VGNR
Sbjct  121   YVSLLTIFLFSFFCHSLAIRFVNQVNLLINTPPDPLSIVTPEYVTDLFEKGSLLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF------TPPKGKLGHDYDHEIG  338
             LFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFV           G  G   DH  G
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSVTMVPVLYNLDFVLGNIDNDGKGSGTKGKQLDHVSG  238



>ref|XP_004291301.1| PREDICTED: uncharacterized protein LOC101313473 [Fragaria vesca 
subsp. vesca]
Length=236

 Score =   358 bits (920),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 194/234 (83%), Gaps = 6/234 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI  GYH WLWH VRT+P TTIIG N  GRRLWVSA++KDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLIMAGYHGWLWHNVRTKPETTIIGINTRGRRLWVSAMIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF+ HSLSIRF NQVN LIN P D    V P+YV ELLEK + LN VGNR
Sbjct  121   YVTLLTIFLFSFMCHSLSIRFINQVNILINSPQDPTSPVTPEYVSELLEKGYILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPP--KGK----LGHDYD  350
             LFYAA+P+LLWI GPVLV LC  T+VP+LYNLDFV   P  KGK     G+D D
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSITLVPMLYNLDFVLRSPDQKGKNMDASGNDSD  234



>ref|XP_007226094.1| hypothetical protein PRUPE_ppa010817mg [Prunus persica]
 gb|EMJ27293.1| hypothetical protein PRUPE_ppa010817mg [Prunus persica]
Length=235

 Score =   358 bits (920),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 189/222 (85%), Gaps = 0/222 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI   YHAWLWHKVRT P +TIIG N  GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLITASYHAWLWHKVRTDPQSTIIGINTNGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC G+AAVISSTYSVKKPLND+VYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCCGIAAVISSTYSVKKPLNDSVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF+ HSLSIRF NQVN LIN P D + +V  +YV ELLEK + LN VGNR
Sbjct  121   YVTLLTIFLFSFMCHSLSIRFINQVNILINSPQDPMSLVTSEYVSELLEKGYLLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             LFYAA+P+LLWI GPVLV LC ATMVPVLYNLDFVF   + +
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSATMVPVLYNLDFVFNCTEKR  222



>gb|EYU29166.1| hypothetical protein MIMGU_mgv1a012580mg [Erythranthe guttata]
Length=246

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 197/238 (83%), Gaps = 7/238 (3%)
 Frame = -2

Query  1030  EWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKK  851
             EW+K YLDV+LVPLG ++ +GYH WLW++VRTQP TT+IGTN+ GRR WVSAI+KDNEKK
Sbjct  3     EWRKCYLDVILVPLGLMMSMGYHIWLWNRVRTQPFTTVIGTNSHGRRFWVSAIIKDNEKK  62

Query  850   NILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKY  671
             NILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYS+KKPLNDAVYGAHGEFMVALKY
Sbjct  63    NILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSIKKPLNDAVYGAHGEFMVALKY  122

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL----GVVRPDYVVELLEKSFALNAV  503
             VTLL++FLFSFV HSLSIRF NQVNFLINCPP       G V  +YV ELLE+ FALN  
Sbjct  123   VTLLVLFLFSFVCHSLSIRFINQVNFLINCPPTETPIGSGGVTAEYVAELLERGFALNTA  182

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEI-GNG  332
             GNRLFY+A+P+LLWI GPVLV LC  TMV VLYNLD V  P   KLG     EI GNG
Sbjct  183   GNRLFYSAVPILLWIFGPVLVFLCSGTMVSVLYNLDLVLIPD--KLGKHSGGEIRGNG  238



>ref|XP_007161534.1| hypothetical protein PHAVU_001G077400g [Phaseolus vulgaris]
 gb|ESW33528.1| hypothetical protein PHAVU_001G077400g [Phaseolus vulgaris]
Length=234

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFL  +GYH WLWHKVRT P TTIIG NA+GRR WV+ ++KDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLTSIGYHFWLWHKVRTHPHTTIIGINASGRRNWVNTMIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPL+DAVYGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLSDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D + +V P+Y+ E+LEK F LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFINQVNILINTPQDPMSLVTPEYINEILEKGFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             LFYA +P+LLWI GPVLV LC  TMVPVLYNLDFVFT  KGK
Sbjct  181   LFYAGLPLLLWIFGPVLVFLCSLTMVPVLYNLDFVFTTGKGK  222



>ref|XP_010112148.1| hypothetical protein L484_019887 [Morus notabilis]
 gb|EXC32773.1| hypothetical protein L484_019887 [Morus notabilis]
Length=239

 Score =   358 bits (919),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 195/238 (82%), Gaps = 3/238 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLDV+LVPLGFLI  GYH WLWHKVRTQP +TIIG NA GRR WVSAI+KDNEK
Sbjct  1     MEWRPCYLDVILVPLGFLIVAGYHVWLWHKVRTQPESTIIGINANGRRFWVSAIVKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHG+FMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGDFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF+ HSLSIRF NQVN LIN P D+  +V   Y+ ELLEK + LN +GNR
Sbjct  121   YVTLLTIFLFSFLCHSLSIRFINQVNILINSPQDDTSLVTTAYIAELLEKGYLLNTIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGVLEV  320
             LFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFVF    G  G +   ++ NG  +V
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSLTMVPVLYNLDFVF---NGSGGGERKEKVVNGSDQV  235



>ref|XP_006450105.1| hypothetical protein CICLE_v10009046mg [Citrus clementina]
 gb|ESR63345.1| hypothetical protein CICLE_v10009046mg [Citrus clementina]
Length=298

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 194/238 (82%), Gaps = 6/238 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF I + YH WLWHK+RT+PLTTI+GTNA GRRLWV+A+MKDNEK
Sbjct  51    MEWRKCYLDVILVPLGFSITMAYHIWLWHKIRTEPLTTIVGTNARGRRLWVTAMMKDNEK  110

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRNMIMGSTLMATTSILLC+GLAAVISSTYSVKKPLNDAVYG HGEFM+ALK
Sbjct  111   KNILAVQSLRNMIMGSTLMATTSILLCTGLAAVISSTYSVKKPLNDAVYGGHGEFMLALK  170

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF  HSL+IRF NQVN LIN PPD L +V P+YV +L EK   LN VGNR
Sbjct  171   YVSLLTIFLFSFFCHSLAIRFVNQVNLLINTPPDPLSIVTPEYVTDLFEKGSLLNTVGNR  230

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF------TPPKGKLGHDYDHEIG  338
             LFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFV           G  G   DH  G
Sbjct  231   LFYAALPLLLWIFGPVLVFLCSVTMVPVLYNLDFVLGNIDNDGKGSGTKGKQLDHVSG  288



>ref|XP_003544658.1| PREDICTED: uncharacterized protein LOC100801037 [Glycine max]
 gb|KHN04706.1| hypothetical protein glysoja_043068 [Glycine soja]
Length=233

 Score =   356 bits (913),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFL  +GYH WLWHKVRTQP TTIIG NA+GRR WV+ +MKDN+K
Sbjct  1     MEWRKCYLDVILVPLGFLTSIGYHFWLWHKVRTQPHTTIIGINASGRRNWVNGMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMAT SILLCSGLAA+ISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATASILLCSGLAALISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  +SLSIRF NQVN LIN P D + +V P Y+ E+LE+ F LN VGNR
Sbjct  121   YVTLLTIFLFSFFCYSLSIRFINQVNILINTPQDPMSLVTPQYIKEILERGFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFYA +P+LLWI GPVLV LC  TMVPVLYNLDFVFT  KGK+
Sbjct  181   LFYAGLPLLLWIFGPVLVFLCSLTMVPVLYNLDFVFTSGKGKV  223



>ref|XP_007137149.1| hypothetical protein PHAVU_009G103900g [Phaseolus vulgaris]
 gb|ESW09143.1| hypothetical protein PHAVU_009G103900g [Phaseolus vulgaris]
Length=231

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLGFL+  GYH WLWH VRT P TTIIG NA+GRR WV+AIMKDN+K
Sbjct  1     MEWKKCYLDVILVPLGFLMSFGYHFWLWHTVRTHPHTTIIGINASGRRNWVAAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAA+ISSTYSVKKPL D VYG HGEFM++LK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAIISSTYSVKKPLEDTVYGGHGEFMISLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D + +V P+YV E+LEK F LN VGNR
Sbjct  121   YVTLLSIFLFSFFCHSLSIRFINQVNILINTPQDPMSLVTPEYVNEILEKGFLLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFV +  KGK+
Sbjct  181   LFYAALPLLLWIFGPVLVFLCSLTMVPVLYNLDFVVS-SKGKM  222



>ref|XP_003603576.1| hypothetical protein MTR_3g109280 [Medicago truncatula]
 gb|AES73827.1| plant/F12B17-70 protein [Medicago truncatula]
Length=230

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 192/230 (83%), Gaps = 2/230 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPL  L+ +GYH WLW+ VRT P TTII  NA+GRR WV+A+MKDNEK
Sbjct  1     MEWKKCYLDVILVPLAILLSIGYHVWLWYNVRTHPHTTIIAINASGRRNWVAAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATTSILLCSGLAA+ISSTYSVKKPLND+VYGAHGEFM ALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTSILLCSGLAAIISSTYSVKKPLNDSVYGAHGEFMEALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D++ +V P YV ELLE+ F LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFINQVNILINTPQDSMSLVTPSYVSELLERGFTLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFY+A+P+LLWI GPVLV LC  TMVP+LYNLDFV T  KGK+  + + +
Sbjct  181   LFYSALPLLLWIFGPVLVFLCSLTMVPLLYNLDFVIT--KGKMDPNQNTD  228



>ref|XP_007011528.1| Uncharacterized protein TCM_046898 [Theobroma cacao]
 gb|EOY29147.1| Uncharacterized protein TCM_046898 [Theobroma cacao]
Length=240

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLD++LVPLG L+ + YH WLWHKVRTQPLTTIIGTNA+GRR+WVSA+MKDNEK
Sbjct  1     MEWRSCYLDIILVPLGLLMTVAYHFWLWHKVRTQPLTTIIGTNASGRRVWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTYSVKKPLND+++GAHGEFM+ALK
Sbjct  61    KNILAVQTLRNSIMGSTLMATTSILLCAGLAAVISSTYSVKKPLNDSIFGAHGEFMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP--PDNLGVVRPDYVVELLEKSFALNAVG  500
             YVT+L IFLFSF  HSLSIRF NQVN LIN P   D   +V  DYV  LLEK F LN VG
Sbjct  121   YVTILCIFLFSFFCHSLSIRFINQVNILINTPQGQDPSSIVTQDYVSLLLEKGFLLNTVG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             NRLFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFVF   + K
Sbjct  181   NRLFYAALPLLLWIFGPVLVFLCSITMVPVLYNLDFVFGTGENK  224



>ref|XP_010048486.1| PREDICTED: uncharacterized protein LOC104437268 [Eucalyptus grandis]
 ref|XP_010048487.1| PREDICTED: uncharacterized protein LOC104437268 [Eucalyptus grandis]
Length=240

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 185/225 (82%), Gaps = 5/225 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD +LVPLGF+I LGYHAWLWHKVRT+PLTTIIGTN  GRR WVSA+MKDN+K
Sbjct  1     MEWRKCYLDAILVPLGFMISLGYHAWLWHKVRTEPLTTIIGTNTRGRRFWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND+VYG HGEFM+A+K
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDSVYGGHGEFMLAMK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             YVTLL IFLFSF+ HSLSI F NQVN LIN P     P+    V P Y+ ELLEK F LN
Sbjct  121   YVTLLTIFLFSFLCHSLSIGFINQVNILINTPMQQVDPEMASKVTPQYIAELLEKGFVLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPK  374
              +GNRLFY AIP+LLWI GPVLV LC   +V VLYNLDFV    K
Sbjct  181   TMGNRLFYTAIPLLLWIFGPVLVFLCSVALVLVLYNLDFVIGSGK  225



>gb|AFK45319.1| unknown [Lotus japonicus]
Length=233

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLG LI + Y+ WLWHKVRTQP TT +G N++GRR WV+AIMKDNEK
Sbjct  2     MEWRKCYLDVILVPLGLLISICYNFWLWHKVRTQPHTTTVGINSSGRRNWVNAIMKDNEK  61

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDAVYG HGEFM+ALK
Sbjct  62    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGGHGEFMIALK  121

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQVNFLIN P D + +V P+Y+ ++LE+ F LN VGNR
Sbjct  122   YVTLLTIFLFSFFCHSLSIRFLNQVNFLINTPQDPMSLVTPEYISQILERGFVLNTVGNR  181

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFY  +P+LLWI GPVLV L   TMVPVLYNLD VF   KGK+
Sbjct  182   LFYTGLPLLLWIFGPVLVFLSSVTMVPVLYNLDVVFFSGKGKM  224



>ref|XP_011076094.1| PREDICTED: uncharacterized protein LOC105160396 [Sesamum indicum]
Length=237

 Score =   345 bits (886),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 198/235 (84%), Gaps = 5/235 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD++LVPLGF+IC+GY  WLWHKVRT P +T+IG NA GRR WVS I+KDN+K
Sbjct  1     MEWRKCYLDLILVPLGFMICMGYQVWLWHKVRTHPFSTVIGRNAHGRRFWVSCIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMA+TSILLC+GLAAVISSTYSVKKP+ DAVYGAHGE MVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMASTSILLCTGLAAVISSTYSVKKPIKDAVYGAHGEVMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL-GVVRPDYVVELLEKSFALNAVGN  497
             YVTLL+ FLFSF+ HSLSIRF NQVNFLINCPP++  GVV  +YV ELLE+ FALN VGN
Sbjct  121   YVTLLLFFLFSFICHSLSIRFINQVNFLINCPPESANGVVTAEYVAELLERGFALNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             RLFY+A+P+LLWI GPVLV +C  TMVP+LYNLD VF   K KLG     E GNG
Sbjct  181   RLFYSAVPLLLWIFGPVLVFICSVTMVPLLYNLDLVFIAEKRKLG----SENGNG  231



>ref|XP_003526465.1| PREDICTED: uncharacterized protein LOC100780305 [Glycine max]
 gb|KHN18222.1| hypothetical protein glysoja_025112 [Glycine soja]
Length=234

 Score =   343 bits (880),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 193/232 (83%), Gaps = 2/232 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLGFLI +GYH WLW+ VRT P TTIIG NA+GRR WV+A+MKDN+K
Sbjct  1     MEWKKCYLDVILVPLGFLISIGYHFWLWYTVRTHPHTTIIGINASGRRNWVAAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAA++SSTYSVKKPL D VYG HGEFM++LK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAIVSSTYSVKKPLEDTVYGGHGEFMISLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDN-LGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D  + +V P+YV E+LEK F LN VGN
Sbjct  121   YVTLLSIFLFSFFCHSLSIRFINQVNILINTPQDPIMSLVTPEYVNEILEKGFLLNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPP-KGKLGHDYDHE  344
             RLFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFV T   KGK+  + + +
Sbjct  181   RLFYAALPLLLWIFGPVLVFLCSLTMVPVLYNLDFVVTGANKGKMQLNENRD  232



>ref|XP_004501209.1| PREDICTED: uncharacterized protein LOC101514150 [Cicer arietinum]
Length=232

 Score =   343 bits (879),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 191/230 (83%), Gaps = 3/230 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLG L+ +GYH WLW+ VRT P TTII  NA GRR WV++IMKDNEK
Sbjct  1     MEWKKCYLDVILVPLGILLSIGYHVWLWYNVRTHPHTTIIAINARGRRNWVASIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN +MG+TLMATTSILLCSGLAA+ISSTYS+KKPLND +YGAHGEFM ALK
Sbjct  61    KNILAVQTLRNTVMGATLMATTSILLCSGLAAIISSTYSIKKPLNDTIYGAHGEFMEALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPD-NLGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D N  +V P YV E+LE+ F LN VGN
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFINQVNILINIPQDSNTSLVTPLYVSEILERGFILNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDH  347
             RLFY+A+P+LLWI GPVLV LC  TMVP+LYNLDFV T  KGK+  ++D+
Sbjct  181   RLFYSALPLLLWIFGPVLVFLCSLTMVPLLYNLDFVLT--KGKMDPNHDN  228



>ref|XP_003522678.1| PREDICTED: uncharacterized protein LOC100795131 [Glycine max]
 gb|KHN10251.1| hypothetical protein glysoja_017855 [Glycine soja]
Length=235

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLGFLI +GYH WLW+ VRT P TTIIG NA+GRR WV+A+MKDN+K
Sbjct  1     MEWKKCYLDVILVPLGFLISIGYHFWLWYTVRTHPHTTIIGINASGRRNWVAAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAA++SSTYSVKKPL D VYG HGEFM++LK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAIVSSTYSVKKPLEDTVYGGHGEFMISLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL-GVVRPDYVVELLEKSFALNAVGN  497
             YVTLL IFLFSF  HSLSIRF NQVN LIN P D +  +V P+YV E+LEK F LN VGN
Sbjct  121   YVTLLSIFLFSFFCHSLSIRFINQVNILINTPQDPMSSLVTPEYVNEILEKGFLLNTVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             RLFYAA+P+LLWI GPVLV LC  TMVPVLYNLDFV T        D +  
Sbjct  181   RLFYAALPLLLWIFGPVLVFLCSLTMVPVLYNLDFVVTSTNKGTMDDVNQN  231



>ref|XP_003588601.1| hypothetical protein MTR_1g009030 [Medicago truncatula]
 gb|AES58852.1| plant/F12B17-70 protein [Medicago truncatula]
Length=217

 Score =   335 bits (860),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 184/230 (80%), Gaps = 15/230 (7%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  LI +GYH WLWHKVRTQP TTI+G NA+GRR WV+A+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLAMLISIGYHVWLWHKVRTQPHTTIVGINASGRRNWVNAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDA+YGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL IFLFSF  HSLSIRF NQVN LIN P D +               F LNAVGNR
Sbjct  121   YVSLLTIFLFSFFCHSLSIRFINQVNILINTPQDPM---------------FILNAVGNR  165

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYA +P+LLWI GPV+V LC   MVPVLYNLDFV+T  KGK+  D   +
Sbjct  166   LFYAGLPLLLWIFGPVMVFLCSLAMVPVLYNLDFVYTTGKGKMNVDQKED  215



>ref|XP_002869335.1| hypothetical protein ARALYDRAFT_491609 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45594.1| hypothetical protein ARALYDRAFT_491609 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 189/240 (79%), Gaps = 9/240 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPLGLMVYASYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAV+SSTY+VKKPLNDAV+GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVLSSTYAVKKPLNDAVFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFSPEELEDEMMMTAEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK     D +   G
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFFF---GKERKKLDQKSSFG  237



>ref|XP_008219983.1| PREDICTED: uncharacterized protein LOC103320131 [Prunus mume]
Length=229

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 180/222 (81%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI   YHAWLWHKVRT P +TIIG N  GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLITASYHAWLWHKVRTDPQSTIIGINTNGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATT+ILLC G+AAVISSTYSVKKPLNDAVYGAHGEFMVA  
Sbjct  61    KNILAVQTLRNTIMGSTLMATTAILLCCGIAAVISSTYSVKKPLNDAVYGAHGEFMVAXX  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
                     LFSF+ HSLSIRF NQVN LIN P D + +V  +YV ELLEK + LN VGNR
Sbjct  121   XX------LFSFMCHSLSIRFINQVNILINSPQDPMSLVTSEYVSELLEKGYLLNTVGNR  174

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             LFYAA+P+LLWI GPVLV LC ATMVPVLYNLDFVF   + +
Sbjct  175   LFYAALPLLLWIFGPVLVFLCSATMVPVLYNLDFVFNCTEKR  216



>gb|KHG04904.1| Uncharacterized protein F383_31215 [Gossypium arboreum]
Length=232

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 186/232 (80%), Gaps = 0/232 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLDV+LVPL  LI + YH WLWHKVRTQPL TIIG N+ GRR WVSAI+KDNEK
Sbjct  1     MEWRACYLDVILVPLSMLIPIAYHCWLWHKVRTQPLATIIGINSTGRRFWVSAIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLND+++GAHGEFMVALK
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCAGLAAVISSTYTVKKPLNDSIFGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L IFLFSF  H+LSIRF NQVN LIN P D   +V P Y+ +LLEK F LN  GNR
Sbjct  121   YVTILCIFLFSFSCHTLSIRFINQVNILINTPQDPTSIVTPHYLSDLLEKGFLLNTAGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIG  338
             LFYAA+P+LLWI GPVLV +   T+V +LYNLDFVF   + K     D E G
Sbjct  181   LFYAALPLLLWIFGPVLVFVGSITIVTLLYNLDFVFGFRRNKQIDVGDCESG  232



>ref|XP_004244468.1| PREDICTED: uncharacterized protein LOC101259062 [Solanum lycopersicum]
Length=243

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 202/242 (83%), Gaps = 9/242 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDV+LVPLGF+ICL YH WLWHKV+TQPL+TIIGTNA GRRLWVSAI+KDNEK
Sbjct  1     MEWKKCYLDVILVPLGFMICLTYHIWLWHKVKTQPLSTIIGTNANGRRLWVSAIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT RN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYG HGEFMVALK
Sbjct  61    KNILAVQTFRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGGHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP----DNLG--VVRPDYVVELLEKSFAL  512
             YVTLL+ FLFSF+ +S+SIRF NQVNFLINCP     ++LG  ++  DY+ ELLEK+F L
Sbjct  121   YVTLLLFFLFSFICYSISIRFINQVNFLINCPQQDHNNDLGIFILSIDYICELLEKAFIL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPP--KGKL-GHDYDHEI  341
             NAV NRLFYAA+ ++LWI GPVLV L   ++V VLYNLDFV +    KGK+   D D+ I
Sbjct  181   NAVANRLFYAALTLVLWIFGPVLVFLSSISLVTVLYNLDFVISNDNHKGKMIKCDEDYVI  240

Query  340   GN  335
              +
Sbjct  241   SH  242



>ref|XP_010447583.1| PREDICTED: uncharacterized protein LOC104730164 isoform X1 [Camelina 
sativa]
 ref|XP_010447584.1| PREDICTED: uncharacterized protein LOC104730164 isoform X2 [Camelina 
sativa]
 ref|XP_010447585.1| PREDICTED: uncharacterized protein LOC104730164 isoform X3 [Camelina 
sativa]
Length=239

 Score =   334 bits (856),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 184/222 (83%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDN+K
Sbjct  1     MEWRECYLDVILVPLGLMVYAAYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDA++GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAIFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   DYV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEDLEDEMMMTAEDYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFF  222



>ref|XP_010432876.1| PREDICTED: uncharacterized protein LOC104717062 [Camelina sativa]
Length=240

 Score =   333 bits (855),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 184/222 (83%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDN+K
Sbjct  1     MEWRECYLDVILVPLGLMVYAAYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDA++GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAIFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   DYV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEDLEDEMMMTAEDYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFF  222



>ref|XP_010263286.1| PREDICTED: uncharacterized protein LOC104601590 [Nelumbo nucifera]
Length=237

 Score =   333 bits (854),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W+K YLD+VLVPLGFL  L YH WLWHKVRTQP TTIIGTN+AGRRLWV+ ++KDN+K
Sbjct  1     MVWRKCYLDLVLVPLGFLATLVYHIWLWHKVRTQPFTTIIGTNSAGRRLWVATMVKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMGSTLMATTSILLC+GLAAV+SSTYS+KKPLND V+GAHGEFM+ALK
Sbjct  61    KNILAVQTIRNAIMGSTLMATTSILLCTGLAAVLSSTYSIKKPLNDDVFGAHGEFMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL+IFLF+F+ +SLSIRF NQVNFLIN   D LG+V P+Y+ ELLEKSF LN VGNR
Sbjct  121   YVTLLLIFLFAFLCYSLSIRFVNQVNFLINSTQDPLGIVTPEYISELLEKSFTLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFY+A+P+LLWI GPVLV L   TMVP+LYNLDFVF   K ++
Sbjct  181   LFYSALPLLLWIFGPVLVFLSSITMVPILYNLDFVFGGGKSEI  223



>ref|NP_567872.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK28647.1|AF360350_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93727.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85892.1| uncharacterized protein AT4G31330 [Arabidopsis thaliana]
Length=239

 Score =   333 bits (854),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 189/240 (79%), Gaps = 9/240 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDN+K
Sbjct  1     MEWRECYLDVILVPLGLMVYASYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAV+SSTY+VKKPLNDAV+GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVLSSTYAVKKPLNDAVFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEELEDEMMMTAEEYVAELLERGFIL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK     D +   G
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFFF---GKERRKLDQKSSFG  237



>emb|CDX72303.1| BnaC07g43250D [Brassica napus]
Length=239

 Score =   333 bits (854),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 190/241 (79%), Gaps = 9/241 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVP G ++   YH +LW+K+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPPGLMVYAAYHVYLWYKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       + + V   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPQEDLDEEMMVTPEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK     D +   G
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVMMVPLLYNLDFFFF---GKQRKKIDGKTSCG  237

Query  331   V  329
             +
Sbjct  238   I  238



>ref|XP_009138005.1| PREDICTED: uncharacterized protein LOC103862043 [Brassica rapa]
Length=239

 Score =   333 bits (853),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 192/242 (79%), Gaps = 9/242 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVP G ++   YH +LW+K+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPPGIMVYATYHVYLWYKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNLG----VVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN   PP+ L     V   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEELDEEMMVTPEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK     D +   G
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVMMVPLLYNLDFFFF---GKQRKKIDGKTSCG  237

Query  331   VL  326
             ++
Sbjct  238   IV  239



>ref|XP_010438053.1| PREDICTED: uncharacterized protein LOC104721707 [Camelina sativa]
Length=240

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/233 (70%), Positives = 188/233 (81%), Gaps = 7/233 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDN+K
Sbjct  1     MEWRECYLDVILVPLGLMVYAAYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDA++GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAIFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEDLEDEMMMTAEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD-FVFTPPKGKLGHD  356
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLD F F   + K+  D
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFFFGKERRKIDKD  233



>ref|XP_006284442.1| hypothetical protein CARUB_v10005623mg [Capsella rubella]
 gb|EOA17340.1| hypothetical protein CARUB_v10005623mg [Capsella rubella]
Length=239

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 183/222 (82%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPLGLMVYAAYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLND ++GA GEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDVIFGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEDLEDEMMMTAEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFF  222



>gb|AFK38355.1| unknown [Lotus japonicus]
Length=228

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLDV+LVPLG L+  GYH W+W+ VR  P TTIIG NA+GRR WV+ +MKDNEK
Sbjct  1     MEWKNCYLDVILVPLGVLMTGGYHFWVWYNVRNHPHTTIIGINASGRRNWVATMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMGSTLMATTS+LLCSGLAA+ISSTYSVKKPLND+VYGAHGEFM ALK
Sbjct  61    KNILAVQSLRNTIMGSTLMATTSVLLCSGLAAIISSTYSVKKPLNDSVYGAHGEFMEALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL +FLFSF  H+LSIRF NQVN LIN P D + +V P+Y+ ++LEK F LN VGNR
Sbjct  121   YVTLLTVFLFSFFCHTLSIRFINQVNILINIPQDPMSLVTPEYINDILEKGFILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY A+P+LLWI GPVLV LC  +MVPVLYNLDFV
Sbjct  181   LFYTALPLLLWIFGPVLVFLCSLSMVPVLYNLDFV  215



>ref|XP_002283089.1| PREDICTED: uncharacterized protein LOC100259505 [Vitis vinifera]
 emb|CAN79714.1| hypothetical protein VITISV_027503 [Vitis vinifera]
Length=234

 Score =   331 bits (849),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/237 (72%), Positives = 189/237 (80%), Gaps = 5/237 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDVVLVPLG  I +GYH WLWHKVRTQPL+T IG N  GRR WVSA+MKDN+K
Sbjct  1     MEWRKCYLDVVLVPLGLFITMGYHVWLWHKVRTQPLSTFIGMNVNGRRFWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC GLAAVISSTYSVKKPLND +YGAHGEFM+A+K
Sbjct  61    KNILAVQTLRNAIMGSTLMATTSILLCCGLAAVISSTYSVKKPLNDTIYGAHGEFMMAVK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L+ FLFSF+ HSLSIRF NQVN LIN P D + V  P+YV E+LEK F LN VGNR
Sbjct  121   YVTILLFFLFSFLCHSLSIRFVNQVNLLINTPQDPMNVATPEYVTEVLEKGFFLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGVLE  323
             LFY A+P+LLWI GPVLV LC  T VP+ YNLD V    KGK+     +EI N   E
Sbjct  181   LFYTALPLLLWIFGPVLVFLCSITFVPLFYNLDIVPPSRKGKM-----NEIENSGFE  232



>ref|XP_006412605.1| hypothetical protein EUTSA_v10026789mg [Eutrema salsugineum]
 gb|ESQ54058.1| hypothetical protein EUTSA_v10026789mg [Eutrema salsugineum]
Length=239

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 189/240 (79%), Gaps = 9/240 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG +    YH +LWHK+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPLGLMAYAAYHVYLWHKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN P       + + +   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEELEEEMMMTAEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK     D +   G
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPILYNLDFFFF---GKERRKLDRKTSFG  237



>ref|XP_007143940.1| hypothetical protein PHAVU_007G115300g [Phaseolus vulgaris]
 gb|ESW15934.1| hypothetical protein PHAVU_007G115300g [Phaseolus vulgaris]
Length=233

 Score =   330 bits (846),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDVV+VPLGFL+ +GYH WLWHKVRTQP +TIIG N  GRR WV A++KD EK
Sbjct  1     MEWKKYYLDVVMVPLGFLVTIGYHVWLWHKVRTQPSSTIIGINTHGRRSWVPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRNMIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDAVYGAH EFMVALK
Sbjct  61    KNILAVQTLRNMIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDAVYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  H+LSIRF NQ++ LI  P D + +V P Y+ +LLEK   L+ VGNR
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFFNQLSILICTPQDVMSLVTPQYLSDLLEKGTILSTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFY+A+P+LLWI GPVLV L    M+PVLYNLDFV    +GK+  +   E
Sbjct  181   LFYSALPLLLWIFGPVLVFLSSVAMLPVLYNLDFVCGTVRGKVMKNEKGE  230



>gb|KHG05690.1| Ankyrin repeat and KH domain-containing mask [Gossypium arboreum]
Length=239

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 184/231 (80%), Gaps = 1/231 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLD++LVPL FL  + YH WLWHKV+TQPL+TI GTNA+GRR WVS ++KDNEK
Sbjct  1     MEWRSCYLDMILVPLSFLTIIFYHCWLWHKVKTQPLSTIFGTNASGRRFWVSDMIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNI+AVQTLRN IMGSTLMATTSILL +GLAAVISSTYSVKKPLND+++GAHGE MV+LK
Sbjct  61    KNIVAVQTLRNTIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDSIFGAHGELMVSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVT+L IFLFSF  HS SIRF NQV  LI  PP     V P YV ELLEK F LN VGNR
Sbjct  121   YVTILCIFLFSFFCHSSSIRFLNQVGILITSPPHPSSSVTPHYVWELLEKGFLLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKG-KLGHDYDHE  344
             LFY+A+P++LWI GP+L  LC  TMVPVLYNLDFVF   K   LG D+ H 
Sbjct  181   LFYSALPLMLWIFGPLLAFLCSLTMVPVLYNLDFVFGFNKQLALGKDFQHN  231



>ref|XP_010669484.1| PREDICTED: uncharacterized protein LOC104886703 [Beta vulgaris 
subsp. vulgaris]
Length=239

 Score =   328 bits (842),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 190/228 (83%), Gaps = 2/228 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD++LVP G LI   YH WLWHKVRTQP +TIIGTN+  RR WV+AIMKDN+K
Sbjct  1     MEWRKCYLDLLLVPSGLLILTAYHVWLWHKVRTQPFSTIIGTNSNARRYWVAAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMG+TLMATTSILLCSGLAAV+SSTYS+K+PLN+AVYGAHGEF+VALK
Sbjct  61    KNILAVQTIRNTIMGATLMATTSILLCSGLAAVLSSTYSIKRPLNNAVYGAHGEFIVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--VRPDYVVELLEKSFALNAVG  500
             YVTLLI  LFSF+ HSLSIRF NQVNFLIN P  +L +  V P+Y+ ELLEK F LN VG
Sbjct  121   YVTLLIFLLFSFLCHSLSIRFINQVNFLINTPQQDLLIAKVTPNYICELLEKGFMLNTVG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHD  356
             NRLF+AA+P+LLWI GPVLV LC   +VPVLYNLDFVF    GK  HD
Sbjct  181   NRLFHAALPLLLWIFGPVLVFLCSVALVPVLYNLDFVFQSNVGKGAHD  228



>ref|XP_003536184.1| PREDICTED: uncharacterized protein LOC100816068 [Glycine max]
 gb|KHN14737.1| hypothetical protein glysoja_020910 [Glycine soja]
Length=238

 Score =   328 bits (840),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 185/237 (78%), Gaps = 10/237 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDVVLVPLGFLI +GYH WLWHKVRTQP +TIIG N  GRR WV A++KD EK
Sbjct  1     MEWKKYYLDVVLVPLGFLITIGYHVWLWHKVRTQPSSTIIGINTHGRRSWVPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRNMIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDA+YGAH EFMVALK
Sbjct  61    KNILAVQTLRNMIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDAIYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG---VVRPDYVVELLEKSFALNAV  503
             YVTLL IFLFSF  H+LSIRF NQV+ LI  P D +    VV P Y+ ELLEK   L+ V
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFFNQVSILICTPQDVMSSSIVVTPQYLTELLEKGTILSTV  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK-------LGHDY  353
             GNRLFY+A+P+LLWI GPVLV L    M+P+LYNLDFV     GK        G DY
Sbjct  181   GNRLFYSALPLLLWIFGPVLVFLSSVAMLPILYNLDFVCGNNNGKGKIVKNDKGEDY  237



>ref|XP_010263285.1| PREDICTED: uncharacterized protein LOC104601589 [Nelumbo nucifera]
Length=237

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 192/233 (82%), Gaps = 5/233 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W+K YLD+VLVPLGFL    YH WLWH+VRTQP TT IGTN+AGRRLWV  +MKDN+K
Sbjct  1     MVWRKCYLDLVLVPLGFLATFVYHIWLWHRVRTQPFTTTIGTNSAGRRLWVVTMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMG TLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVALK
Sbjct  61    KNILAVQTIRNAIMGLTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLF+F+ +SLSIRF NQVNFLIN P D LG+V P+Y+ ELLEKSF LN VGNR
Sbjct  121   YVTLLFIFLFAFLCYSLSIRFVNQVNFLINSPQDPLGIVTPEYISELLEKSFTLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF----TPPKGKLGH-DYD  350
             LFY+A+P+LLWI GPV V L    M+ +LYNLDFVF    +  KGK+G  D D
Sbjct  181   LFYSALPLLLWIFGPVPVFLSSIAMILILYNLDFVFGTGKSGVKGKVGEMDND  233



>gb|KCW80731.1| hypothetical protein EUGRSUZ_C02127 [Eucalyptus grandis]
Length=260

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 183/242 (76%), Gaps = 5/242 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD +LVPLGF+I LGYHAWLWHKVRT+PLTTIIGTN  GRR WVSA+MKDN+K
Sbjct  1     MEWRKCYLDAILVPLGFMISLGYHAWLWHKVRTEPLTTIIGTNTRGRRFWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND+VYG HGEFM+A+K
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDSVYGGHGEFMLAMK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             YVTLL IFLFSF+ HSLSI F NQVN LIN P     P+    V P Y+ ELLEK F LN
Sbjct  121   YVTLLTIFLFSFLCHSLSIGFINQVNILINTPMQQVDPEMASKVTPQYIAELLEKGFVLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGV  329
              +GNRLFY AIP+LLWI GP+L         P++ +L F+       +     H    G+
Sbjct  181   TMGNRLFYTAIPLLLWIFGPILTNQLEQVFFPLITSLSFLLLNRPSSMRPQLAHRREGGL  240

Query  328   LE  323
              +
Sbjct  241   CQ  242



>ref|XP_010526280.1| PREDICTED: uncharacterized protein LOC104803882 [Tarenaya hassleriana]
Length=243

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 181/225 (80%), Gaps = 9/225 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLD  LVPLG +I   YH +LWHKVRT+P TT++G NA  RRLWV +I+KDN+K
Sbjct  1     MEWRECYLDATLVPLGLMISAMYHVYLWHKVRTKPFTTVLGVNAGARRLWVDSIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILLC+GLAAVISSTYSVKKP+ND V+GAHG+ MVALK
Sbjct  61    KNILAVQTLRNIIMGSTLMATTSILLCAGLAAVISSTYSVKKPINDVVFGAHGDVMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN---------CPPDNLGVVRPDYVVELLEKS  521
             YVT+L IFLFSF SHSLSIRF NQVNFLIN          P +   VV  +YV ELL+K 
Sbjct  121   YVTVLTIFLFSFFSHSLSIRFMNQVNFLINVPISLSPEKSPEEEPVVVTAEYVTELLDKG  180

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             F LN VGNRLFYAAIP++LWI GPVLV  C   MVPVLYNLDF+F
Sbjct  181   FVLNTVGNRLFYAAIPLMLWIFGPVLVFFCSVVMVPVLYNLDFLF  225



>ref|XP_008783078.1| PREDICTED: uncharacterized protein LOC103702416 [Phoenix dactylifera]
Length=238

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD++LVPL  L  + YH WLW ++R+QP  T IG N+AGRRLWV AIMKD +K
Sbjct  1     MEWKKGYLDLILVPLSLLSPILYHIWLWQRIRSQPQQTFIGINSAGRRLWVFAIMKDGDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN+LAVQT+RN IMGSTLMATTSILLCSGLAA+ISSTYS+K+PLND+VYGAHGEF+VALK
Sbjct  61    KNVLAVQTIRNAIMGSTLMATTSILLCSGLAAMISSTYSIKQPLNDSVYGAHGEFVVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP-DNLGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL+IFLFSF+ +SL IRF  QVNFLIN P  D+  +V P+Y+  LLEK FALN VGN
Sbjct  121   YVTLLVIFLFSFLCYSLCIRFIGQVNFLINVPQGDDNSLVTPEYISNLLEKGFALNIVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHD  356
             RLFYA +P++LWI GPVLV+LC  TMVP+LYN+D  F   KG +  +
Sbjct  181   RLFYAGLPIILWIFGPVLVLLCSVTMVPILYNMDIAFGQGKGGIRKE  227



>ref|XP_010049787.1| PREDICTED: uncharacterized protein LOC104438363 [Eucalyptus grandis]
 gb|KCW82591.1| hypothetical protein EUGRSUZ_C03984 [Eucalyptus grandis]
Length=247

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 194/234 (83%), Gaps = 4/234 (2%)
 Frame = -2

Query  1036  NMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE  857
             ++EW+K YLDV+LVPLGFL+ + YH WLWH+VRT PL+TIIGTNA  RR WVSA++KDNE
Sbjct  2     DVEWRKWYLDVMLVPLGFLVMIAYHVWLWHQVRTHPLSTIIGTNARARRFWVSAMIKDNE  61

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVAL  677
             KKNILAVQ+LRNMIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDAVYGAHG+F VAL
Sbjct  62    KKNILAVQSLRNMIMGSTLMATTSILLSTGLAAVISSTYSVKKPLNDAVYGAHGDFTVAL  121

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGN  497
             KYVTLL +FLFSF+ HSLSI F +QVN LINCP D+ G V P+YV+ELLEK F LN +GN
Sbjct  122   KYVTLLTLFLFSFLCHSLSICFISQVNILINCPQDSDGAVLPEYVMELLEKGFVLNTIGN  181

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGN  335
             RLFYA +P+LLWI GPVLV L   T+VP+LYNLDFVF     K  H     IGN
Sbjct  182   RLFYAGLPLLLWIFGPVLVFLFSLTLVPILYNLDFVFL----KSDHSKPKSIGN  231



>gb|KFK29714.1| hypothetical protein AALP_AA7G169500 [Arabis alpina]
Length=239

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 181/222 (82%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVPLG +    YH +LWHK+RT+PLTTIIGTN+  RR WV++I+KDN+K
Sbjct  1     MEWREGYLDVILVPLGLMTYAAYHVYLWHKLRTEPLTTIIGTNSRARRFWVASIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILA+QTLRN IMGSTLMATTSILLC+GLAAVISSTY++KKPLNDA+YGA GEFMVALK
Sbjct  61    KNILAIQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAIKKPLNDAIYGARGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYVVELLEKSFAL  512
             YVT+L  FL SF SHSLSIRF NQVN LIN P       D + +   +YV ELLE+ F L
Sbjct  121   YVTILTFFLGSFFSHSLSIRFINQVNILINTPFPPEELEDEMMMTGEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFF  222



>ref|XP_003556415.1| PREDICTED: uncharacterized protein LOC100778681 [Glycine max]
 gb|KHN05014.1| hypothetical protein glysoja_013921 [Glycine soja]
Length=238

 Score =   323 bits (828),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 184/237 (78%), Gaps = 10/237 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDVVLVPLGFLI +GYH WLWHKVRTQP +TIIG N  GRR WV A++KD EK
Sbjct  1     MEWRKYYLDVVLVPLGFLITIGYHVWLWHKVRTQPSSTIIGINTHGRRSWVPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAAVISSTYSVKKPLNDAVYGAH EFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDAVYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL---GVVRPDYVVELLEKSFALNAV  503
             YVTLL IFLFSF  H+LSIRF NQV+ LI  P  ++     V P Y+ ELLEK   L+ V
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFFNQVSILICTPQQDVIMSSAVTPQYLTELLEKGTILSTV  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK-------LGHDY  353
             GNRLFY+A+P+LLWI GPVLV +    M+PVLYNLDFV     GK        G DY
Sbjct  181   GNRLFYSALPLLLWIFGPVLVFMSSVAMLPVLYNLDFVCGNNNGKGKIMKNDKGEDY  237



>ref|XP_004495478.1| PREDICTED: uncharacterized protein LOC101510689 [Cicer arietinum]
Length=237

 Score =   321 bits (823),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 185/225 (82%), Gaps = 4/225 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGF+I +GYH WLWHKVRTQP +TIIG NA GRR W+ A++KD EK
Sbjct  1     MEWRKYYLDVLLVPLGFMIIIGYHVWLWHKVRTQPSSTIIGINAHGRRSWIPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAAVISSTYS+KKPLNDAVYGAH EFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAVISSTYSIKKPLNDAVYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG---VVRPDYVVELLEKSFALNAV  503
             YV+LL IFLFSF  H+LSIRF NQV+ LI C P N+    V+ P+Y+ ELLEK   L+ V
Sbjct  121   YVSLLTIFLFSFFCHTLSIRFFNQVSILI-CTPLNVMSIIVITPEYLTELLEKGTILSTV  179

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             GNRLFY+A+P+LLWI GPVLV L    M+PVLYNLDFV     G+
Sbjct  180   GNRLFYSALPLLLWIFGPVLVFLSSVAMIPVLYNLDFVCGNGNGQ  224



>ref|XP_003622377.1| hypothetical protein MTR_7g035200 [Medicago truncatula]
 gb|KEH42859.1| plant/F12B17-70 protein [Medicago truncatula]
Length=237

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 179/217 (82%), Gaps = 2/217 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD +LVPLGF++ + YH WLWHKVRTQP +TIIG N  GRR WV +++KD EK
Sbjct  1     MEWRKYYLDALLVPLGFMVIISYHVWLWHKVRTQPSSTIIGINTHGRRSWVPSMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN+IMGSTLMATTSILL +GLAAVISSTYSVKKPLND++YGAH EFMVALK
Sbjct  61    KNILAVQTLRNLIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDSIYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--GVVRPDYVVELLEKSFALNAVG  500
             YVTLL IFLFSF  H+LSIRF NQV+ LI  P D L   V+ P+Y+ ELL+K   L+ VG
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFFNQVSILICTPQDVLSYAVITPEYLSELLDKGIVLSTVG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             NRLFY+A P+LLWI GPVLV LC   M+PVLYNLDFV
Sbjct  181   NRLFYSAFPLLLWIFGPVLVFLCSVAMIPVLYNLDFV  217



>ref|XP_010927193.1| PREDICTED: uncharacterized protein LOC105049287 [Elaeis guineensis]
Length=238

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 189/229 (83%), Gaps = 5/229 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++SYLD VLVPL  L+ + YH WLWHKVR QP  T IG N++GRRLWV AIMKDN+K
Sbjct  1     MEWRESYLDAVLVPLSLLLPILYHGWLWHKVRFQPHGTTIGINSSGRRLWVLAIMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K++LAVQT+RN IMGSTLMATTSILLCSGLAAVISSTYS+KKPLND V+GAHGEFM++LK
Sbjct  61    KSVLAVQTMRNAIMGSTLMATTSILLCSGLAAVISSTYSIKKPLNDTVFGAHGEFMLSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             YVTLL+IFLFSF+ +SLSIRF NQVNFLIN P       +L +V PDY+ +LLEKSFALN
Sbjct  121   YVTLLLIFLFSFICYSLSIRFINQVNFLINTPCTASADASLHLVTPDYICDLLEKSFALN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
              VGNRLFYAA+P+LLWI GPVLV LC  TM+P+LY+LD V    K   G
Sbjct  181   TVGNRLFYAALPLLLWIFGPVLVFLCSVTMLPILYHLDIVSGENKRGFG  229



>ref|XP_009125291.1| PREDICTED: uncharacterized protein LOC103850314 [Brassica rapa]
 emb|CDX85752.1| BnaA02g00610D [Brassica napus]
Length=244

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 182/223 (82%), Gaps = 6/223 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT+P +TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWRKWYLDAVLVPCALLVMFSYHIYLWYKVRTEPFSTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAV+G+HG+F VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVFGSHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG--VVRPDYVVELLEKSFAL  512
             YVT+L IFLF+F SHSLSIRF NQVN LIN P     D+ G  V  P+YV ELLEK+F L
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQDPSSDDFGSFVTTPEYVSELLEKAFLL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFT  383
             N VGNRLFY  +P++LWI GPVLV L  A MVPVLYNLDFVF+
Sbjct  181   NTVGNRLFYMGLPLMLWIFGPVLVFLSSALMVPVLYNLDFVFS  223



>emb|CDY40107.1| BnaC02g00230D [Brassica napus]
Length=244

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 182/223 (82%), Gaps = 6/223 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT+P +TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWRKWYLDAVLVPCALLVMFSYHIYLWYKVRTEPFSTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAV+G+HG+F +ALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVFGSHGDFTIALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG--VVRPDYVVELLEKSFAL  512
             YVT+L IFLF+F SHSLSIRF NQVN LIN P     D+ G  V  P+YV ELLEK+F L
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQDPSSDDFGSFVTTPEYVSELLEKAFLL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFT  383
             N VGNRLFY  +P++LWI GPVLV L  A MVPVLYNLDFVF+
Sbjct  181   NTVGNRLFYMGLPLMLWIFGPVLVFLSSALMVPVLYNLDFVFS  223



>emb|CAA16536.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79851.1| predicted protein [Arabidopsis thaliana]
Length=319

 Score =   321 bits (822),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 188/250 (75%), Gaps = 16/250 (6%)
 Frame = -2

Query  1063  RYRGNNQFKNMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLW  884
             + + NN FK         DV+LVPLG ++   YH +LWHK+RTQPLTTIIGTNA  RR W
Sbjct  78    KLKKNNYFK-------LFDVILVPLGLMVYASYHVYLWHKLRTQPLTTIIGTNARARRFW  130

Query  883   VSAIMKDNEKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYG  704
             V++I+KDN+KKNILAVQTLRN IMGSTLMATTSILLC+GLAAV+SSTY+VKKPLNDAV+G
Sbjct  131   VASIIKDNDKKNILAVQTLRNCIMGSTLMATTSILLCAGLAAVLSSTYAVKKPLNDAVFG  190

Query  703   AHGEFMVALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP------PDNLGVVRPDYV  542
             A GEFMVALKYVT+L IFLFSF SHSLSIRF NQVN LIN P       D + +   +YV
Sbjct  191   ARGEFMVALKYVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEELEDEMMMTAEEYV  250

Query  541   VELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
              ELLE+ F LN VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F    GK  
Sbjct  251   AELLERGFILNTVGNRLFYAALPLMLWIFGPVLVFLCSVVMVPLLYNLDFFFF---GKER  307

Query  361   HDYDHEIGNG  332
                D +   G
Sbjct  308   RKLDQKSSFG  317



>ref|XP_010048375.1| PREDICTED: uncharacterized protein LOC104437177 [Eucalyptus grandis]
Length=223

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 176/224 (79%), Gaps = 7/224 (3%)
 Frame = -2

Query  982  LICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQTLRNMIMGST  803
            +I L YHAWLWHKVRT+PLTTIIGTN  GRR WVSA+MKDN+KKNILAVQTLRN IMGST
Sbjct  1    MINLRYHAWLWHKVRTEPLTTIIGTNTRGRRFWVSAMMKDNDKKNILAVQTLRNTIMGST  60

Query  802  LMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLIIFLFSFVSHSL  623
            LMATTSILLCSGLAAVISSTYSVKKPLND+VYG HGEFM+A+KYVTLL IFLFSF+ HSL
Sbjct  61   LMATTSILLCSGLAAVISSTYSVKKPLNDSVYGGHGEFMLAMKYVTLLTIFLFSFLCHSL  120

Query  622  SIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAIPMLLWI  458
            SIRF NQVN LIN P     P+   +V P Y+ ELLEK F LN +GNRLFY AIP+LLWI
Sbjct  121  SIRFINQVNILINTPMQQVDPEMASIVTPRYIAELLEKGFVLNTMGNRLFYTAIPLLLWI  180

Query  457  VGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGVL  326
             GPVLV LC   +V VLYNLDFV     GK     +    NG L
Sbjct  181  FGPVLVFLCSVALVLVLYNLDFVI--GSGKKCCQMEEGTRNGDL  222



>ref|XP_009409587.1| PREDICTED: uncharacterized protein LOC103991765 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 189/226 (84%), Gaps = 2/226 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLD++LVPLG L  + YH WLWHKVR+QPL TIIG N+AGRR WV A++KDN+K
Sbjct  1     MEWRKSYLDLILVPLGLLFPIVYHLWLWHKVRSQPLRTIIGINSAGRRFWVQAVIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND+V+GAHGEFMV+LK
Sbjct  61    KNILAVQTIRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDSVFGAHGEFMVSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN--CPPDNLGVVRPDYVVELLEKSFALNAVG  500
             YV LL+IFLF+F+ +SLSIRF NQ NFL+N  C  D+   V PDYV +LLEK F LN VG
Sbjct  121   YVALLLIFLFAFLCYSLSIRFVNQANFLVNVACGLDDECPVTPDYVCDLLEKGFTLNTVG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
             NRLFYAA+P+LLWI GPVLV+    TMV +LYNLD V+   KG +G
Sbjct  181   NRLFYAALPILLWIFGPVLVVFSSLTMVLILYNLDVVYEEEKGGVG  226



>ref|NP_196620.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK60290.1|AF385697_1 AT5g10580/F12B17_70 [Arabidopsis thaliana]
 emb|CAB89385.1| putative protein [Arabidopsis thaliana]
 gb|AAL77714.1| AT5g10580/F12B17_70 [Arabidopsis thaliana]
 gb|AED91566.1| uncharacterized protein AT5G10580 [Arabidopsis thaliana]
Length=246

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 183/234 (78%), Gaps = 11/234 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+  GYH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWEKWYLDAVLVPSALLMMFGYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGGTLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P     D+ G     V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINAPQEPFSDDFGEIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKL  365
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF      KGK+
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVFLLSNKEKGKV  234



>ref|XP_006399556.1| hypothetical protein EUTSA_v10014328mg [Eutrema salsugineum]
 gb|ESQ41009.1| hypothetical protein EUTSA_v10014328mg [Eutrema salsugineum]
Length=281

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 188/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  1039  KNMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDN  860
             K MEWK  YLD VLVP   L+   YH +LW+KVRT+P +TI+GTN+  RR WV+AIMKDN
Sbjct  34    KKMEWKTWYLDAVLVPCALLMMFCYHIYLWYKVRTEPFSTIVGTNSRARRSWVAAIMKDN  93

Query  859   EKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVA  680
             EKKNILAVQTLRN IMG+TLMATT ILLC+GLAAVISSTY++KKPLN+AVYGAHG+F VA
Sbjct  94    EKKNILAVQTLRNTIMGATLMATTCILLCAGLAAVISSTYTIKKPLNNAVYGAHGDFTVA  153

Query  679   LKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEK  524
             +KYVT+L IFLF+F SHSLSIRF NQVN LIN P     D+ G     V P+YV ELLE+
Sbjct  154   IKYVTILTIFLFAFFSHSLSIRFINQVNILINSPQEHSSDDFGGIGSFVTPEYVSELLER  213

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKL---G  362
             +F LN VGNRLFY  +P++LWI GPVLV L  A MVPVLYNLDFVF      KGK+   G
Sbjct  214   AFLLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALMVPVLYNLDFVFLLSNKEKGKVDCNG  273

Query  361   HDYDH  347
                DH
Sbjct  274   GSDDH  278



>emb|CDX69820.1| BnaA10g21690D [Brassica napus]
Length=235

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 184/229 (80%), Gaps = 6/229 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT+P +TI+GTNA  RR WV+AIMKDNEK
Sbjct  1     MEWRKWYLDAVLVPCALLMMFCYHIYLWYKVRTEPFSTIVGTNARARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             +NILA+QTLRN IMG+TLMATT ILLCSGLAAV+SSTYS+KKPLNDAVYGAHG+F +A+K
Sbjct  61    RNILAIQTLRNTIMGATLMATTCILLCSGLAAVLSSTYSIKKPLNDAVYGAHGDFTMAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG----VVRPDYVVELLEKSFALNA  506
             YVT+L IFL +F +HSLSIRF  QVN LIN P D+ G     V P+YV +LLEK+F LN 
Sbjct  121   YVTILTIFLSAFFTHSLSIRFIGQVNILINAPQDDFGGIGSFVTPEYVSDLLEKAFLLNT  180

Query  505   VGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF--TPPKGKL  365
             +GNRLFY  +P++LWI GPVLV L  + MVPVLYNLDFVF  +  KGK+
Sbjct  181   IGNRLFYMGLPLMLWIFGPVLVFLGSSLMVPVLYNLDFVFMLSNKKGKV  229



>ref|XP_010491734.1| PREDICTED: uncharacterized protein LOC104769265 [Camelina sativa]
Length=246

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 182/237 (77%), Gaps = 11/237 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWQKWYLDAVLVPCALLMMFCYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--------GVVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P +            V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQEPFSDDFSGIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKLGHD  356
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF      KGK+  D
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVFLLSNKEKGKVDCD  237



>ref|XP_010422827.1| PREDICTED: uncharacterized protein LOC104708039 [Camelina sativa]
Length=246

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 182/237 (77%), Gaps = 11/237 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWQKWYLDAVLVPCALLMMFCYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--------GVVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P +            V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQEPFSDDFSGIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKLGHD  356
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF      KGK+  D
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVFLLSNKEKGKVDCD  237



>ref|XP_006289080.1| hypothetical protein CARUB_v10002483mg [Capsella rubella]
 gb|EOA21978.1| hypothetical protein CARUB_v10002483mg [Capsella rubella]
Length=247

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 185/244 (76%), Gaps = 15/244 (6%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWEKWYLDAVLVPCALLMMFSYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--------GVVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P +            V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQEPFSDDFSGIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKL----GH  359
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF      KGK+    G 
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVFLLSNKEKGKVDCNGGC  240

Query  358   DYDH  347
             D D+
Sbjct  241   DDDN  244



>ref|XP_003534066.1| PREDICTED: uncharacterized protein LOC100815851 [Glycine max]
 gb|KHM99781.1| hypothetical protein glysoja_023922 [Glycine soja]
Length=233

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 176/223 (79%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLD+VLVPL +++ + YH WLWHK RT+P +T IG NA  RR WV A++KD EK
Sbjct  1     MEWRSYYLDMVLVPLAYMVTVAYHVWLWHKTRTEPFSTTIGINAHARRFWVPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNIL  Q+LRN+IMGSTLMATT+ILL +GLAAVISSTYSVKKPL+DAVYGAH EFMVALK
Sbjct  61    KNILVAQSLRNLIMGSTLMATTAILLSAGLAAVISSTYSVKKPLDDAVYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  HSLSIRF NQ+  LI  P D + +V P+Y+ E+LEK   LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFLNQLAILICAPQDAMSLVTPEYLTEILEKGTFLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             +FY+A+P+LLWI GPVLV LC   M+PV YNLDFV    K K+
Sbjct  181   IFYSALPLLLWIFGPVLVFLCSIAMLPVFYNLDFVCGRVKAKM  223



>ref|XP_009403299.1| PREDICTED: uncharacterized protein LOC103986884 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=240

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 189/233 (81%), Gaps = 3/233 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLD VLVP+G L  L YH WLWHKVR+QPL+TIIG N+AGRR WV AI+KDNEK
Sbjct  1     MEWRKSYLDAVLVPVGLLFPLVYHLWLWHKVRSQPLSTIIGINSAGRRFWVLAIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMGS+LMATTSILLCSGLAAVISSTYSVKKPLND+V GAHGEFMV+LK
Sbjct  61    KNILAVQTIRNTIMGSSLMATTSILLCSGLAAVISSTYSVKKPLNDSVLGAHGEFMVSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN---CPPDNLGVVRPDYVVELLEKSFALNAV  503
             YVTLL++FLF+F+ +SLSIRF +Q NFLIN   C PD    V PDYV +LLE+SFALN V
Sbjct  121   YVTLLLLFLFAFLCYSLSIRFVSQANFLINTTTCDPDAACPVTPDYVCDLLERSFALNTV  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             GNRLFYAA+P+LLWI+GPVLV++    MV +LY  D V    K   G   + E
Sbjct  181   GNRLFYAALPVLLWILGPVLVLVSSLAMVLILYKFDMVCEGRKHGFGAKVEEE  233



>ref|XP_010453093.1| PREDICTED: uncharacterized protein LOC104735072 [Camelina sativa]
Length=246

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 181/234 (77%), Gaps = 11/234 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWQKWYLDAVLVPCALLMMFCYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGATLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--------GVVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P +            V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQEPFSDDFSGIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKL  365
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF      KGK+
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVFLLSNKEKGKV  234



>ref|XP_004136437.1| PREDICTED: uncharacterized protein LOC101209101 [Cucumis sativus]
 ref|XP_004163507.1| PREDICTED: uncharacterized protein LOC101230873 [Cucumis sativus]
 gb|KGN60193.1| hypothetical protein Csa_3G888520 [Cucumis sativus]
Length=239

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -2

Query  1030  EWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKK  851
             EW+  YLD++LVPLGFLI  GYHAWLWH+VRTQP TT+IG N   RR W+S+I++DNEKK
Sbjct  4     EWRSCYLDIILVPLGFLISSGYHAWLWHRVRTQPFTTLIGINTNARRFWISSILQDNEKK  63

Query  850   NILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKY  671
             NILAVQ+LRN IMG TLMATTSILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+FM+ LKY
Sbjct  64    NILAVQSLRNTIMGCTLMATTSILLCTGLAAVLSSTYSIKKPLNDAVYGAHGDFMLGLKY  123

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRL  491
             VTLL +FLFSF  HSLSIRF NQVN LIN PP     +  DY+ +LL+K F LN VGNRL
Sbjct  124   VTLLTLFLFSFFCHSLSIRFINQVNILINIPP-GAASITTDYISDLLDKGFILNTVGNRL  182

Query  490   FYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             FYAA+PMLLWI GPVLV +C  +MVPVLYNLD V +    K
Sbjct  183   FYAALPMLLWIFGPVLVFVCSVSMVPVLYNLDVVCSHTTAK  223



>gb|KFK25330.1| hypothetical protein AALP_AA8G098800 [Arabis alpina]
Length=246

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 180/234 (77%), Gaps = 11/234 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLD VLVP   L+   YH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWKAWYLDAVLVPCALLMMFCYHIYLWYKVRTDPFCTIVGTNSRARRFWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGGTLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGV---VRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P      D  G+   V  +YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINSPQEPSDDDFEGIGSFVTAEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF---TPPKGKL  365
              LN VGNRLFY  +P++LWI GPVLV L  A MVPVLYNLDFVF      KGK+
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALMVPVLYNLDFVFLLSNKEKGKV  234



>ref|XP_006850939.1| hypothetical protein AMTR_s00025p00190370 [Amborella trichopoda]
 gb|ERN12520.1| hypothetical protein AMTR_s00025p00190370 [Amborella trichopoda]
Length=238

 Score =   311 bits (796),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 188/232 (81%), Gaps = 1/232 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK Y+D++LVP GF   + YH WL++KV+TQP+ TIIG NAA RRLWV A+MKDN+K
Sbjct  1     MEWKKGYMDLILVPSGFFFVVLYHGWLYYKVKTQPMQTIIGVNAAARRLWVLAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATTSILLCSGLAAVISSTYSVKK LND++YG  GEFMVALK
Sbjct  61    KNILAVQTLRNAIMGATLMATTSILLCSGLAAVISSTYSVKKALNDSIYGGQGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV+LL+ FLF+F+ +SLSIRF NQVNFLIN P     VV PDYV ELLEK   LN VGNR
Sbjct  121   YVSLLLAFLFAFLCYSLSIRFINQVNFLINLPV-QCPVVTPDYVCELLEKGSILNTVGNR  179

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIG  338
             LFYAA+P+LLWI GPVLV L   ++VP+LYNLD ++  PK ++    + E+G
Sbjct  180   LFYAAMPLLLWIFGPVLVFLFSISIVPILYNLDIIYEVPKSEVARKVEDEVG  231



>ref|XP_002871427.1| hypothetical protein ARALYDRAFT_487891 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47686.1| hypothetical protein ARALYDRAFT_487891 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 177/224 (79%), Gaps = 8/224 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KV+T P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWEKWYLDAVLVPCALLMMFCYHIYLWYKVQTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGGTLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P     D  G     V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINAPQEPFSDGFGEIGSFVTPEYVSELLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
              LN VGNRLFY  +P++LWI GPVLV L  A ++PVLYNLDFVF
Sbjct  181   LLNTVGNRLFYMGLPLMLWIFGPVLVFLSSALIIPVLYNLDFVF  224



>ref|XP_010519591.1| PREDICTED: uncharacterized protein LOC104799002 [Tarenaya hassleriana]
Length=239

 Score =   311 bits (796),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 179/229 (78%), Gaps = 6/229 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLD VLVPL   +   YH +LWHK RT P +T++GTN+ GR  WV++IMKDN+K
Sbjct  4     MEWREWYLDAVLVPLSLTMMFCYHIFLWHKARTNPFSTVVGTNSRGRHFWVASIMKDNDK  63

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG+TLMATT ILL +GLAAVISSTYS+KKPLND V+GAHG+  VA+K
Sbjct  64    KNILAVQTLRNTIMGATLMATTCILLSAGLAAVISSTYSIKKPLNDHVFGAHGDLTVAVK  123

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             YVT+L IFLFSF SHSLSIRF NQVN LIN P     P +   + P+YV ELLEK F LN
Sbjct  124   YVTILTIFLFSFFSHSLSIRFINQVNILINSPHHHQDPSSDNFITPEYVSELLEKGFLLN  183

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF-TPPKGKL  365
              VGNRLFY  +P++LWI GPVLV L  + MVPVLYNLDFVF   PKGK+
Sbjct  184   TVGNRLFYMGMPLMLWIFGPVLVFLSSSAMVPVLYNLDFVFRNKPKGKV  232



>ref|XP_010928765.1| PREDICTED: uncharacterized protein LOC105050445 [Elaeis guineensis]
Length=238

 Score =   310 bits (794),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 187/236 (79%), Gaps = 3/236 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M WKKSYLD+ LVPL  L  + YH WLW ++R+QP  T IG N+A RRLWV A+MKDN+K
Sbjct  1     MGWKKSYLDLTLVPLSLLFPILYHIWLWRRIRSQPQQTFIGINSAARRLWVFAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN+LAVQT+RN IMGSTLMATTSILLCSGLAA+ISS+YSVK+PL ++VYGAHGE +VALK
Sbjct  61    KNVLAVQTIRNAIMGSTLMATTSILLCSGLAAMISSSYSVKQPLTNSVYGAHGELVVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP-DNLGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL+I+LFSF+ +SL IRF +QVNFLIN P  D   +V PDY+  LLE++F+LN VGN
Sbjct  121   YVTLLVIYLFSFLCYSLCIRFISQVNFLINVPQGDANSLVTPDYISNLLERAFSLNIVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGV  329
             RLFYA +P++LWI GPVLVILC  +MVP+LYN+D      KGK G   + ++   +
Sbjct  181   RLFYAGLPVILWIFGPVLVILCSVSMVPILYNMD--IAEGKGKAGIRKEDKMDGKI  234



>ref|XP_010548531.1| PREDICTED: uncharacterized protein LOC104819925 [Tarenaya hassleriana]
Length=239

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 178/226 (79%), Gaps = 10/226 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLD +LVPLG +I   YH +LWHKVRT+PLTTI+G NA  RRLW+ +I+KDN+K
Sbjct  1     MEWRECYLDAILVPLGLMIPAMYHVYLWHKVRTKPLTTILGVNARARRLWIHSIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILL +GLAAVISSTYSVKKP+NDAV+G HG+ +VALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLSAGLAAVISSTYSVKKPINDAVFGGHGDVVVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----------PDNLGVVRPDYVVELLEK  524
             YVT+L +FLFSF SH+LSIRF NQ NF+IN P           +   +V P+YV EL+EK
Sbjct  121   YVTILTVFLFSFFSHTLSIRFLNQANFVINVPMIPPPEKSLEAEATALVTPEYVSELIEK  180

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
                LN VGNRLFY AIP+++W+ GPVLV      MVPVLYNLDF+F
Sbjct  181   GLVLNTVGNRLFYTAIPLMMWVFGPVLVFFSSVVMVPVLYNLDFLF  226



>ref|XP_008466268.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103503728 
[Cucumis melo]
Length=240

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 185/236 (78%), Gaps = 1/236 (0%)
 Frame = -2

Query  1030  EWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKK  851
             EW+  YLD++LVPLGFLI  GYHAWLWH+VRTQP TT+IG N   RR W+++I++DNEKK
Sbjct  4     EWRSCYLDIILVPLGFLISSGYHAWLWHRVRTQPFTTLIGINTNARRFWIASILQDNEKK  63

Query  850   NILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKY  671
             NILAVQ+LRN IMG TLMATTSILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+FM+ LKY
Sbjct  64    NILAVQSLRNTIMGCTLMATTSILLCTGLAAVLSSTYSIKKPLNDAVYGAHGDFMLGLKY  123

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRL  491
             VTLL +FLFSF  HSLSIRF NQVN LIN P      +  +Y+ +LL+K F LN VGNRL
Sbjct  124   VTLLTLFLFSFFCHSLSIRFINQVNILINIPX-GAASITTNYISDLLDKGFILNTVGNRL  182

Query  490   FYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGVLE  323
             FYAA+PMLLWI GPVLV +C  +MVPVLYNLD V +   GK         GNG L 
Sbjct  183   FYAALPMLLWIFGPVLVFVCSVSMVPVLYNLDVVCSDATGKQKTTIVAGGGNGELS  238



>ref|XP_009122039.1| PREDICTED: uncharacterized protein LOC103846793 [Brassica rapa]
Length=240

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 183/238 (77%), Gaps = 8/238 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW+KVRT+P +TI+GTNA  RR WV+AIMKDNEK
Sbjct  1     MEWRKWYLDAVLVPCALLMMFCYHIYLWYKVRTEPFSTIVGTNARARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             +NILA+QTLRN IMG+TLMATT ILLCSGLAA++SSTYS+KKPLNDAVYGAHG+F +A+K
Sbjct  61    RNILAIQTLRNTIMGATLMATTCILLCSGLAAILSSTYSIKKPLNDAVYGAHGDFTMAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEKSF  518
             YVT+L IFL +F +HSLSIRF  QVN LIN P     D+ G     V P+YV +LLEK+F
Sbjct  121   YVTILTIFLSAFFTHSLSIRFIGQVNILINAPQEPSSDDFGGIGSFVTPEYVSDLLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              LN +GNRLFY  +P++LWI GPVLV L  + MVPVLYNLDFVF     + G    HE
Sbjct  181   LLNTIGNRLFYMGLPLMLWIFGPVLVFLGSSLMVPVLYNLDFVFMLSNKEKGKVDCHE  238



>ref|XP_010104944.1| hypothetical protein L484_004292 [Morus notabilis]
 gb|EXC02511.1| hypothetical protein L484_004292 [Morus notabilis]
Length=234

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD++L+PLGFLI + YH WLW+KVRTQPLTTIIG N  GRRLWVSAI++D +K
Sbjct  1     MEWRKCYLDMILIPLGFLITISYHVWLWYKVRTQPLTTIIGLNMTGRRLWVSAILEDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN +MGSTLMATTSILLC+GLAAVISSTYS KKPLND +YGAHGE MVALK
Sbjct  61    KNILAVQTLRNNLMGSTLMATTSILLCTGLAAVISSTYSAKKPLNDTIYGAHGEIMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y T+L IFLFSF  ++LSIR  NQ++ LI  P +   ++  +Y+ ELLEK   L+ VGNR
Sbjct  121   YATVLTIFLFSFFCNTLSIRLINQLSILICSPLEPSSILTSEYICELLEKGSVLDIVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY A+P+LLWI GPVLV L +  MV VLYN+DF+
Sbjct  181   LFYTALPLLLWIFGPVLVFLSWVAMVSVLYNMDFL  215



>emb|CDY13424.1| BnaA03g51420D [Brassica napus]
Length=645

 Score =   321 bits (822),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 176/213 (83%), Gaps = 6/213 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW++ YLDV+LVP G ++   YH +LW+K+RTQPLTTIIGTNA  RR WV++I+KDNEK
Sbjct  1     MEWRECYLDVILVPPGIMVYATYHVYLWYKLRTQPLTTIIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNLG----VVRPDYVVELLEKSFAL  512
             YVT+L IFLFSF SHSLSIRF NQVN LIN   PP+ L     V   +YV ELLE+ F L
Sbjct  121   YVTILTIFLFSFFSHSLSIRFINQVNILINTPFPPEELDEEMMVTPEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVP  413
             N VGNRLFYAA+P++LWI GPVLV LC   M P
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVMMPP  213



>ref|XP_010916649.1| PREDICTED: uncharacterized protein LOC105041384 [Elaeis guineensis]
Length=239

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKKSYLD++LVP+G L  + YH WLW K+R+QP  T IG N+AGRRLWV A+MK+N+K
Sbjct  1     MEWKKSYLDLILVPIGLLSSILYHIWLWQKIRSQPQQTFIGINSAGRRLWVIAMMKENDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN+LAVQT+RN IMGSTLMATTSILLC GLAA+ISSTYS+K+PLND+VYGAHG+F+VA K
Sbjct  61    KNVLAVQTIRNAIMGSTLMATTSILLCCGLAAMISSTYSIKQPLNDSVYGAHGQFVVAFK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP-DNLGVVRPDYVVELLEKSFALNAVGN  497
             YV LL I++ SFV +SLSIRF  QVNFLIN P  D+  +V PDY+  LLEK+FALN  GN
Sbjct  121   YVALLFIYICSFVCYSLSIRFIGQVNFLINVPQGDDNSLVTPDYISNLLEKAFALNIAGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             RLFYA +P++LWI GPV+V+    +M+P+LYN+D
Sbjct  181   RLFYAGLPIILWIFGPVVVLTGSLSMLPILYNMD  214



>emb|CDY28256.1| BnaA01g05930D [Brassica napus]
Length=240

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 187/223 (84%), Gaps = 7/223 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK+ YLDV+LVPLG +    YH +LWHK+RTQPLTT+IGTNA  RR WV++I+KDNEK
Sbjct  1     MEWKEGYLDVILVPLGLMAYAAYHVYLWHKLRTQPLTTVIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPL+DA+YGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLSDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNL----GVVRP-DYVVELLEKSFA  515
             YVT+LI FLFSF SHSLSIRF NQVN LIN   PP+ L     ++ P +YV ELLE+ F 
Sbjct  121   YVTILIFFLFSFFSHSLSIRFINQVNILINTPFPPEELEEMMAMITPEEYVAELLERGFV  180

Query  514   LNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             LN VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   LNTVGNRLFYAALPLMLWIFGPVLVFLCSVMMVPLLYNLDFFF  223



>ref|XP_010913782.1| PREDICTED: uncharacterized protein LOC105039345 [Elaeis guineensis]
Length=233

 Score =   305 bits (780),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 192/235 (82%), Gaps = 4/235 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLD++LVPL  L  + YH WLW ++R+QP  TIIG N+A RRLWV A+MKDN+K
Sbjct  1     MEWRKSYLDLILVPLSVLSPILYHIWLWQRIRSQPERTIIGINSASRRLWVFAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMGSTLMATTSILLCSGLAA+ISSTYS+KKPLND+VYGAHGEF++ALK
Sbjct  61    KNILAVQTIRNAIMGSTLMATTSILLCSGLAAMISSTYSIKKPLNDSVYGAHGEFVMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP-DNLGVVRPDYVVELLEKSFALNAVGN  497
             YV LL+IFLF+F+ +SLSIRF +QVNFLIN P  D+  +V P+YV  LLEKSFALN  GN
Sbjct  121   YVMLLLIFLFAFLCYSLSIRFISQVNFLINVPQGDDNSLVTPEYVSHLLEKSFALNIAGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNG  332
             RLFYA +P++LWI GPVLV++C  ++VP+LYN+D  +   KG+     D +I  G
Sbjct  181   RLFYAGLPIILWIFGPVLVLICSVSIVPILYNMDIAYGQGKGE---KVDRKISMG  232



>ref|XP_007152480.1| hypothetical protein PHAVU_004G134200g [Phaseolus vulgaris]
 gb|ESW24474.1| hypothetical protein PHAVU_004G134200g [Phaseolus vulgaris]
Length=230

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 173/228 (76%), Gaps = 0/228 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLD++LVP+ +L+ + YH WLWHK RTQP +T IG NA  RR WV+A++KD EK
Sbjct  1     MEWRSYYLDMMLVPVAYLVNVAYHVWLWHKTRTQPFSTTIGINAHARRFWVTAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNIL  Q+LRN+IMGSTLMATT+ILL +GLAAVISSTYSVK+PL+D +YGAH EFM+ALK
Sbjct  61    KNILVAQSLRNLIMGSTLMATTAILLSAGLAAVISSTYSVKRPLDDVIYGAHSEFMIALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  H+ SIRF NQ   LI    +   +V PDY+ E+LEK   LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHTQSIRFLNQFTILICTQQEATSLVTPDYLTEILEKGTVLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
             +FY+AIP+LLWI GPVLV+LC   M+PV YNLDFV    K  L    D
Sbjct  181   IFYSAIPLLLWIFGPVLVLLCSIAMLPVFYNLDFVCGKVKMVLNDKSD  228



>emb|CDX97029.1| BnaC09g45960D [Brassica napus]
Length=240

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 180/238 (76%), Gaps = 8/238 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+   YH +LW KVR +P +TI+G NA  RR WV+AIMKDNEK
Sbjct  1     MEWRKWYLDAVLVPCALLMMFCYHIYLWFKVRAEPFSTIVGINARARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             +NILA+QTLRN IMG+TLMATT ILLCSGLAAV+SSTYS+KKPLNDAVYGAHG+F +A+K
Sbjct  61    RNILAIQTLRNTIMGATLMATTCILLCSGLAAVLSSTYSIKKPLNDAVYGAHGDFTMAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEKSF  518
             YVT+L IFL +F +HSLSIRF  QVN LIN P     D+ G     V P+YV +LLEK+F
Sbjct  121   YVTILTIFLSAFFAHSLSIRFIGQVNILINAPQEPSSDDFGGIGSFVTPEYVSDLLEKAF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              LN +GNRLFY  +P++LWI GPVLV L  + MVPVLYNLDFVF     + G    HE
Sbjct  181   LLNTIGNRLFYMGLPLMLWIFGPVLVFLGSSLMVPVLYNLDFVFMLSNKEKGKVDCHE  238



>gb|KEH16999.1| plant/F12B17-70 protein [Medicago truncatula]
Length=232

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 175/223 (78%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLD++LVPLGF++ +GYH WLWHK R++P +T IG NA  RR WV  ++KD EK
Sbjct  1     MEWKPYYLDMMLVPLGFVMTIGYHVWLWHKTRSEPFSTTIGINAHARRFWVPTMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNIL  Q+LRN+IMGSTLMATTSILL +GLAA+ISSTYSVKKPL+D +YGAHGEFM ALK
Sbjct  61    KNILVAQSLRNLIMGSTLMATTSILLSAGLAAIISSTYSVKKPLDDVLYGAHGEFMEALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  H+LSIRF NQ++ LI  P D + +V PDY+  +LE+   LN VGNR
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFLNQLSLLICTPQDAISLVTPDYLNVILERGTTLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             +FY+A+P+LLWI GPVLV+LC   M+ V YNLD V    K K+
Sbjct  181   IFYSALPLLLWIFGPVLVLLCSLAMLLVFYNLDIVCGSAKAKI  223



>ref|XP_008781727.1| PREDICTED: uncharacterized protein LOC103701456 [Phoenix dactylifera]
Length=238

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 191/237 (81%), Gaps = 3/237 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSY+D++LVPL  L  + YH WLW ++R+QP  TIIG N+A RRLWV A+MKDN+K
Sbjct  1     MEWRKSYIDLILVPLSLLSVILYHIWLWRRIRSQPQRTIIGINSASRRLWVFAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K+ILAVQT+RN IMGSTLMATTSILLCSGLAA+ISSTYS+KKPLND+VYGAHGEF+VALK
Sbjct  61    KSILAVQTIRNAIMGSTLMATTSILLCSGLAAMISSTYSIKKPLNDSVYGAHGEFVVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-PDNLGVVRPDYVVELLEKSFALNAVGN  497
             YVTLL+IFLF+F+ +SLSIRF  QVNFLIN P  D+  +V P+YV  LLEK FALN VGN
Sbjct  121   YVTLLLIFLFAFLFYSLSIRFIGQVNFLINVPQEDDNSLVTPEYVAHLLEKGFALNIVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDY--DHEIGNG  332
             R+FYA +P++LWI GPVLV++C  ++VP+LYN+D      K  +  +   D +I  G
Sbjct  181   RIFYAGLPIVLWIFGPVLVLICSVSIVPILYNMDIADGQGKADIRKEEKVDRKISMG  237



>ref|XP_009127086.1| PREDICTED: uncharacterized protein LOC103851956 [Brassica rapa]
Length=240

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 185/223 (83%), Gaps = 7/223 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK+ YLDV+LVPLG +    YH +LWHK+RTQPLTT+IGTNA  RR WV++I+KDNEK
Sbjct  1     MEWKEGYLDVILVPLGLMAYAAYHVYLWHKLRTQPLTTVIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPL+D +YGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLSDPIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNLG-----VVRPDYVVELLEKSFA  515
             YVT+LI FLFSF SHSLSIRF NQVN LIN   PP++L      +   +YV ELLE+ F 
Sbjct  121   YVTILIFFLFSFFSHSLSIRFINQVNILINTPFPPEDLEEMMMMITPEEYVAELLERGFV  180

Query  514   LNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             LN VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   LNTVGNRLFYAALPLMLWIFGPVLVFLCSVMMVPLLYNLDFFF  223



>emb|CDX68734.1| BnaC01g07190D [Brassica napus]
Length=239

 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 185/222 (83%), Gaps = 6/222 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK+ YLDV+LVPLG +    YH +LWHK+RT+PLTT+IGTNA  RR WV++I+KDNEK
Sbjct  1     MEWKECYLDVILVPLGLMAYAAYHVYLWHKLRTRPLTTVIGTNARARRFWVASIIKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC+GLAAVISSTY+VKKPL+DA+YGAHGEFMVALK
Sbjct  61    KNILAVQTLRNCIMGSTLMATTSILLCAGLAAVISSTYAVKKPLSDAIYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNLG----VVRPDYVVELLEKSFAL  512
             YVT+LI FLFSF SHSLSIRF NQVN LIN   PP+ L     +   +YV ELLE+ F L
Sbjct  121   YVTILIFFLFSFFSHSLSIRFINQVNILINTPFPPEELEEMMMITPEEYVAELLERGFVL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             N VGNRLFYAA+P++LWI GPVLV LC   MVP+LYNLDF F
Sbjct  181   NTVGNRLFYAALPLMLWIFGPVLVFLCSVMMVPLLYNLDFFF  222



>ref|XP_008378132.1| PREDICTED: uncharacterized protein LOC103441210 isoform X2 [Malus 
domestica]
Length=205

 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 166/230 (72%), Gaps = 31/230 (13%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPLGFLI + YHAWLWHKVRT P +TIIG N +GRR WVSA+MKDNEK
Sbjct  1     MEWRKCYLDVILVPLGFLITVSYHAWLWHKVRTDPRSTIIGINTSGRRFWVSAMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVAL 
Sbjct  61    KNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALN  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
                                            P D + +V P+YV ELLEK + LN  GNR
Sbjct  121   -------------------------------PQDPMSLVTPEYVSELLEKGYLLNTAGNR  149

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             LFYAA+P++LWI GPVLV LC  TMVPVLYNLDFVF+    K   D  +E
Sbjct  150   LFYAALPLVLWIFGPVLVFLCSVTMVPVLYNLDFVFSSSTEKRKMDIGNE  199



>ref|XP_004138780.1| PREDICTED: uncharacterized protein LOC101209677 [Cucumis sativus]
 gb|KGN62846.1| hypothetical protein Csa_2G376840 [Cucumis sativus]
Length=242

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK+S+LD++LVP GF++ + YH  LW+KVRTQP TTIIG N +GRRLWVS+I+KD +K
Sbjct  1     MEWKESHLDLILVPTGFILMMCYHLGLWYKVRTQPFTTIIGINTSGRRLWVSSIIKDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSIL+  GLAA++SSTYS+KKPLND+V+GAHGEFM++LK
Sbjct  61    KNILAVQTLRNAIMGSTLMATTSILISCGLAAILSSTYSIKKPLNDSVFGAHGEFMLSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV++L IFLFSF+ HSLSIRF NQVN LIN P + +  V P Y+ EL EK   LN VGNR
Sbjct  121   YVSILTIFLFSFLCHSLSIRFINQVNVLINTPQEPMSPVTPKYLSELFEKGCILNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY A+P+LLWI GPVLV LCY +++P+LYNLDFV
Sbjct  181   LFYTAVPLLLWIFGPVLVFLCYLSLLPLLYNLDFV  215



>ref|XP_004512650.1| PREDICTED: uncharacterized protein LOC101512480 [Cicer arietinum]
Length=232

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 172/223 (77%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLD++LVPL FL+ +GY+ WLW+K R +P +T IG NA  RR WV  ++KD EK
Sbjct  1     MEWKTYYLDLMLVPLEFLMTIGYYVWLWNKTRREPFSTTIGINAHARRFWVPTMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNIL  Q+LRN +MGSTLMATTSILL +GLAA++SSTYSVKKPL+D VYGAHGEFMVALK
Sbjct  61    KNILVAQSLRNQLMGSTLMATTSILLSAGLAALMSSTYSVKKPLDDVVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YVTLL IFLFSF  H+LSIRF NQ++ LI  P D + +V  +Y+ ++LEK   LN +GNR
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFLNQLSILICTPQDVMSMVTSEYLSDILEKGTTLNTIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             +FY+A+P+LLWI GPV+V LC   M+ V YNLD V    K K+
Sbjct  181   VFYSALPLLLWIFGPVMVFLCSLVMLIVFYNLDVVCGSGKAKI  223



>ref|XP_008445058.1| PREDICTED: uncharacterized protein LOC103488211 [Cucumis melo]
Length=242

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M WK+S LD++LVP GF++ + YH  LW+KVRTQP  T IG N +GRRLWVS+IMKD EK
Sbjct  1     MGWKESNLDLILVPTGFILIMCYHLGLWYKVRTQPFATFIGINTSGRRLWVSSIMKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATT+IL+  GLAA++SSTYS+KKPLND+V+GAHGEFM++LK
Sbjct  61    KNILAVQTLRNAIMGSTLMATTAILISCGLAAILSSTYSIKKPLNDSVFGAHGEFMLSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             YV++L IFLFSF+ HSLSIRF NQVN LIN P + +  V P YV +L EK   LN VGNR
Sbjct  121   YVSILTIFLFSFLCHSLSIRFINQVNVLINTPQEPMSPVTPKYVSQLFEKGCVLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGVL  326
             LFY+A+P+LLWI GPVLV LCY +++P+LYNLDFV      K  +    E  NG++
Sbjct  181   LFYSAVPLLLWIFGPVLVFLCYLSLLPLLYNLDFVSCSAHTK-NNTTKVEANNGIV  235



>ref|XP_004152530.1| PREDICTED: uncharacterized protein LOC101217165 [Cucumis sativus]
 gb|KGN64243.1| hypothetical protein Csa_1G044920 [Cucumis sativus]
Length=234

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLDV+LVPLG L+   YHAWLW+KV+TQPL T IG NA  RR W+S I++D +K
Sbjct  1     MEWKNYYLDVILVPLGLLLTFVYHAWLWYKVKTQPLATFIGVNATVRRQWISPILEDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRNMIMGS+LMATTSILLC+GLAAV+SSTYS+KKP+ D VYGAHGEF  ALK
Sbjct  61    KNILAVQTLRNMIMGSSLMATTSILLCAGLAAVLSSTYSIKKPVTDTVYGAHGEFTAALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             +   L IF+FSF  H+LSIRF NQ + L++ P   L V+   ++VE+L+K   LN +GNR
Sbjct  121   FTITLTIFVFSFFLHTLSIRFMNQASLLMSAPLQPLSVLTESHLVEILDKGCVLNTIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             +FY A+P++LW  GP+LV L +  MV VLYNLDFV
Sbjct  181   IFYLALPLVLWTCGPLLVFLGFGVMVFVLYNLDFV  215



>ref|XP_009399613.1| PREDICTED: uncharacterized protein LOC103983971 [Musa acuminata 
subsp. malaccensis]
Length=239

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 186/232 (80%), Gaps = 4/232 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLD+VLVP   L+ + YH WLW KVR+QPL T+IG N+AGRR WV AI+KDN+K
Sbjct  1     MEWRKSYLDLVLVPSSLLLHILYHCWLWRKVRSQPLRTVIGINSAGRRHWVLAIIKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ++RN IM STLMATTSILLCSGLAAVISSTYS+KKPL+DA++GAHGEFMV+LK
Sbjct  61    KNILAVQSIRNAIMASTLMATTSILLCSGLAAVISSTYSIKKPLDDALFGAHGEFMVSLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN--CPPDNLGVVRPDYVVELLEKSFALNAVG  500
             YVTLL+IFLF+F+ +SLSIRF NQVNFLIN  C       V P YV +LLEK F LN VG
Sbjct  121   YVTLLLIFLFAFLCYSLSIRFVNQVNFLINTPCCGHEGSPVTPQYVCDLLEKGFFLNTVG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             NRLFYAA+P+LLWI GPVLV L    MVP+LYNLD V    KGK G   + E
Sbjct  181   NRLFYAALPLLLWIFGPVLVPLSSLAMVPILYNLDTVCE--KGKRGFGVEAE  230



>ref|XP_008437415.1| PREDICTED: uncharacterized protein LOC103482834 [Cucumis melo]
Length=233

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 166/215 (77%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLDV+LVP G  +   YHAWLW+KV+TQPL T IG NA  RR W+S +++D +K
Sbjct  1     MEWKNYYLDVILVPFGISLTFIYHAWLWYKVKTQPLATFIGVNATVRRQWISTMLEDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRNMIMGS+LMATTSILLC+GLAAV+SSTYS+KKP+ D VYGAHGEF  ALK
Sbjct  61    KNILAVQTLRNMIMGSSLMATTSILLCAGLAAVLSSTYSIKKPVTDTVYGAHGEFTAALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             +   L IF+FSF  H+LSIRF NQ + L++ P   L V+   ++VE+L+K   LN +GNR
Sbjct  121   FTITLTIFVFSFFFHTLSIRFMNQASLLMSAPLQPLSVLTESHLVEILDKGCVLNTIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             +FY A+P++LW  GP+LV L +  MV VLYN+DFV
Sbjct  181   IFYLALPLVLWTCGPLLVFLGFGVMVFVLYNVDFV  215



>gb|KHM99779.1| hypothetical protein glysoja_023920 [Glycine soja]
Length=231

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 164/223 (74%), Gaps = 0/223 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  Y+DV+ VP G  I L YH WLWHK RTQP TT  G +A GRRLW+ A+MKD +K
Sbjct  1     MEWRNYYMDVIFVPFGLGIILAYHVWLWHKSRTQPFTTTFGIDADGRRLWIPAMMKDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNI+A+Q+LRN+IMGSTLMATTS+L+C+GL AVISSTYSVK  +ND ++GAH +FMV LK
Sbjct  61    KNIVAIQSLRNLIMGSTLMATTSMLICTGLGAVISSTYSVKNVINDTIFGAHSDFMVGLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y  +L I LFSF+ H+ SI F NQVN LI  P D   +V  +Y+ +LL+K+  LN VGNR
Sbjct  121   YAIILAILLFSFLFHTFSIGFLNQVNILICTPQDVKSLVTLEYLTQLLDKAILLNTVGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKL  365
             LFY+A+P+LLWI GPVL       MV +LYNLDF+      K+
Sbjct  181   LFYSALPLLLWIFGPVLTFFSSMAMVLILYNLDFLAGNSNSKI  223



>gb|KCW82592.1| hypothetical protein EUGRSUZ_C03984 [Eucalyptus grandis]
Length=221

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 172/234 (74%), Gaps = 30/234 (13%)
 Frame = -2

Query  1036  NMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE  857
             ++EW+K YLDV+LVPLGFL+ + YH WLWH+                          DNE
Sbjct  2     DVEWRKWYLDVMLVPLGFLVMIAYHVWLWHQ--------------------------DNE  35

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVAL  677
             KKNILAVQ+LRNMIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDAVYGAHG+F VAL
Sbjct  36    KKNILAVQSLRNMIMGSTLMATTSILLSTGLAAVISSTYSVKKPLNDAVYGAHGDFTVAL  95

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGN  497
             KYVTLL +FLFSF+ HSLSI F +QVN LINCP D+ G V P+YV+ELLEK F LN +GN
Sbjct  96    KYVTLLTLFLFSFLCHSLSICFISQVNILINCPQDSDGAVLPEYVMELLEKGFVLNTIGN  155

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGN  335
             RLFYA +P+LLWI GPVLV L   T+VP+LYNLDFVF     K  H     IGN
Sbjct  156   RLFYAGLPLLLWIFGPVLVFLFSLTLVPILYNLDFVFL----KSDHSKPKSIGN  205



>gb|ACU24418.1| unknown [Glycine max]
Length=176

 Score =   269 bits (688),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 145/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLDVVLVPLGFLI +GYH WLWHKVRTQP +TIIG N  GRR WV A++KD EK
Sbjct  1     MEWKKYYLDVVLVPLGFLITIGYHVWLWHKVRTQPSSTIIGINTHGRRSWVPAMLKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRNMIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDA+YGAH EFMVALK
Sbjct  61    KNILAVQTLRNMIMGSTLMATTSILLSAGLAAVISSTYSVKKPLNDAIYGAHSEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG---VVRPDYVVELLEKS  521
             YVTLL IFLFSF  H+LSIRF NQV+ LI  P D +    VV P Y+ ELLEK 
Sbjct  121   YVTLLTIFLFSFFCHTLSIRFFNQVSILICTPQDVMSSSIVVTPQYLTELLEKE  174



>ref|XP_009151002.1| PREDICTED: uncharacterized protein LOC103874344 [Brassica rapa]
Length=247

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+S+++K+N+K
Sbjct  1     MEWRKWYLDVILVPLALVMMLCYHIYLSFMVRTHPFSTVLGINSRGRRIWISSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NIL VQTLRN++MG+TLMATT ILLC+GLAAVISSTYS+KKPLNDAV+GAHG+  +A+K
Sbjct  61    MNILTVQTLRNVVMGATLMATTCILLCAGLAAVISSTYSIKKPLNDAVFGAHGDIAIAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF SHSLSIRF NQV  L+N P     P     +  +YV EL +K F L+
Sbjct  121   YLTILTIFIFSFFSHSLSIRFLNQVAMLVNVPNLYTNPSGDLFLTSEYVCELFDKGFFLS  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNRLFYA   ++LWI GP+LV L    MV VLY++DFV
Sbjct  181   TVGNRLFYAGFSLMLWIFGPILVFLSVLMMVLVLYHVDFV  220



>ref|XP_006394730.1| hypothetical protein EUTSA_v10004847mg [Eutrema salsugineum]
 gb|ESQ32016.1| hypothetical protein EUTSA_v10004847mg [Eutrema salsugineum]
Length=236

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD ++VPL  ++ L YH +L+  VR+ P +T++G N+ GRRLW+SA++K+N K
Sbjct  1     MEWRKWYLDAIIVPLALVMMLCYHIYLYLMVRSHPFSTVLGINSRGRRLWISAMIKENHK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NIL VQTLRN++MG+TLMATT +LLC+GLAAVISSTYS+KKPLNDAVYGAHG+  +A+K
Sbjct  61    TNILTVQTLRNIVMGATLMATTCVLLCAGLAAVISSTYSIKKPLNDAVYGAHGDIAIAVK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF  HSLSIRF NQV  L+N P     P     +  +YV EL EK   LN
Sbjct  121   YLTILTIFIFSFFCHSLSIRFLNQVAILVNIPNLDPNPSGDLFLTSEYVSELFEKGLLLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNRLFYA   ++LWI GP+LV L    MV  LY+LDFV
Sbjct  181   TVGNRLFYAGFSLMLWIFGPILVFLSVLVMVLALYHLDFV  220



>emb|CDX88131.1| BnaA06g27220D [Brassica napus]
Length=247

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 176/235 (75%), Gaps = 11/235 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+S+++K+N+K
Sbjct  1     MEWRKWYLDVILVPLALVMMLCYHIYLSFMVRTHPFSTVLGINSRGRRIWISSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NIL VQTLRN++MG+TLMATT ILLC+GLAAVISSTYS+KKPLNDAV+GAHG+  +A+K
Sbjct  61    MNILTVQTLRNVVMGATLMATTCILLCAGLAAVISSTYSIKKPLNDAVFGAHGDIAIAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF SHSLSIRF NQV  L+N P     P     +  +YV EL +K F L+
Sbjct  121   YLTILTIFIFSFFSHSLSIRFLNQVAMLVNIPNLYPNPSGDLFLTSEYVCELFDKGFFLS  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              VGNRLFYA   ++LWI GP+LV L    MV VLY++DFV       LG++ +++
Sbjct  181   TVGNRLFYAGFCLMLWIFGPILVFLSVLMMVLVLYHVDFV------SLGNNKENQ  229



>gb|ACU16981.1| unknown [Glycine max]
Length=152

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL FL  +GYH WLWHKVRTQP TTIIG NA+GRR WV+A+MKDN+K
Sbjct  1     MEWRKCYLDVILVPLVFLTSIGYHFWLWHKVRTQPHTTIIGINASGRRNWVNAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQ+LRN IMG+TLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK
Sbjct  61    KNILAVQSLRNTIMGATLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP  578
             YVTLL IFLFSF  HSLSIRF NQVN LIN P
Sbjct  121   YVTLLTIFLFSFFCHSLSIRFINQVNILINTP  152



>ref|XP_003533273.1| PREDICTED: uncharacterized protein LOC100780363 [Glycine max]
Length=236

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 164/225 (73%), Gaps = 1/225 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+  YLD+ L+PLG LI +GYH WL +KVRTQ   TI G +A GR  WV A++KD EK
Sbjct  1     MEWRTCYLDMTLIPLGLLINIGYHVWLCYKVRTQASLTIFGIDADGRCSWVPAMIKDIEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NI+A+Q +RNMIMGS  MA+TSILLC GL A+ISSTYSVKKPL D++YGAHGEF++ALK
Sbjct  61    NNIVAIQNIRNMIMGSIFMASTSILLCCGLGAMISSTYSVKKPLIDSIYGAHGEFVLALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDN-LGVVRPDYVVELLEKSFALNAVGN  497
             Y TL  IFLFSF+ HSLS+RF  Q++ LI  P D  + +V P Y+ ELL K+  LN VGN
Sbjct  121   YATLFTIFLFSFLFHSLSVRFLTQLSILICTPQDAIMTLVTPKYLTELLRKATFLNIVGN  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
             R+ +  + +LLWI GPV+  LC   M+ VL+ LDFV    K K+G
Sbjct  181   RILHTGLALLLWICGPVMAFLCSVAMLLVLHKLDFVARKEKIKVG  225



>emb|CDX80468.1| BnaC07g29760D [Brassica napus]
Length=247

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 167/220 (76%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDV+LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+S+++K+N+K
Sbjct  1     MEWRKWYLDVILVPLALVMMLCYHIYLSFMVRTHPFSTVLGINSRGRRIWISSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NIL VQTLRN++MG+TLMATT ILLC+GLAAVISSTYS+K+PLNDAVYGAHG+  +A+K
Sbjct  61    MNILTVQTLRNVVMGATLMATTCILLCAGLAAVISSTYSIKRPLNDAVYGAHGDIAIAIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF SHSLSIRF NQV  L+N P     P     +  +YV EL +K F L+
Sbjct  121   YLTILTIFIFSFFSHSLSIRFLNQVAMLVNIPNLYPNPSGDLFLTSEYVCELFDKGFFLS  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNR FYA   ++LWI GP+LV L    M+  LY++DFV
Sbjct  181   TVGNRFFYAGFSLMLWIFGPILVFLSVLVMMLALYHVDFV  220



>ref|NP_974762.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED91565.1| uncharacterized protein AT5G10580 [Arabidopsis thaliana]
Length=192

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 147/185 (79%), Gaps = 8/185 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD VLVP   L+  GYH +LW+KVRT P  TI+GTN+  RR WV+AIMKDNEK
Sbjct  1     MEWEKWYLDAVLVPSALLMMFGYHIYLWYKVRTDPFCTIVGTNSRARRSWVAAIMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMG TLMATT ILLC+GLAAV+SSTYS+KKPLNDAVYGAHG+F VALK
Sbjct  61    KNILAVQTLRNTIMGGTLMATTCILLCAGLAAVLSSTYSIKKPLNDAVYGAHGDFTVALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLG----VVRPDYVVELLEKSF  518
             YVT+L IFLF+F SHSLSIRF NQVN LIN P     D+ G     V P+YV ELLEK+F
Sbjct  121   YVTILTIFLFAFFSHSLSIRFINQVNILINAPQEPFSDDFGEIGSFVTPEYVSELLEKAF  180

Query  517   ALNAV  503
              LN +
Sbjct  181   LLNTI  185



>ref|XP_004973918.1| PREDICTED: uncharacterized protein LOC101763841 [Setaria italica]
Length=247

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 174/235 (74%), Gaps = 5/235 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W+ SYLDVVL+PL  L    YH WLW  VR  PL++ +G +AA RRLWV ++MK+NEK
Sbjct  1     MAWRDSYLDVVLIPLAVLFPAVYHLWLWRAVRRSPLSSTVGISAAARRLWVFSMMKNNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             + IL VQ++RN++MGSTL+ATTSIL C+G+AAV+SSTY+VKKPL+DAV+GAHGE+M+ALK
Sbjct  61    QAILVVQSVRNVLMGSTLVATTSILFCTGVAAVLSSTYAVKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC----PPDNLGVVRPDYVVELLEKSFALNA  506
             YV LL +FL +F+ HSL+I   NQ +FL+N     P  +L + + DYV +++E+ F LN 
Sbjct  121   YVVLLTVFLLAFLCHSLAICTLNQASFLVNALSPSPALHLPLTK-DYVADVMERGFLLNL  179

Query  505   VGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEI  341
              GNRLF+A  P+LLWI GPVL  +C   MVP+LYN+D +    +G+   + + ++
Sbjct  180   AGNRLFFAGAPLLLWIFGPVLPCICSMAMVPILYNIDMIEYVKEGRSNGEANAKV  234



>ref|XP_004512651.1| PREDICTED: uncharacterized protein LOC101512798 [Cicer arietinum]
Length=233

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 163/216 (75%), Gaps = 1/216 (0%)
 Frame = -2

Query  1033  MEWKK-SYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE  857
             MEW+K  YLD++LVP GFLI + YH WLWH  +TQP TTI G +A GRR WV+++MKD +
Sbjct  1     MEWQKIYYLDMMLVPCGFLILIVYHFWLWHMSKTQPFTTICGRDADGRRFWVASMMKDID  60

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVAL  677
              KN LAVQTLRNMIMG+TLM+TTSILLC+GL A+ISS YSVKKP+ND++ GAHGEFMV +
Sbjct  61    NKNTLAVQTLRNMIMGTTLMSTTSILLCAGLGAIISSNYSVKKPINDSILGAHGEFMVLI  120

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGN  497
             KY  +L I  FSF+ ++LS  F NQVN LI  P +   +V P+Y+ + L+K+  LN VG+
Sbjct  121   KYGIILTILSFSFMCNTLSGAFINQVNILIGTPQNVKSLVTPEYLTQHLKKAMLLNIVGS  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             RLFY A+ + LWI GPVL  L    MV +LYNLDFV
Sbjct  181   RLFYTALTLQLWIFGPVLPFLSSMLMVCILYNLDFV  216



>gb|AFK36811.1| unknown [Medicago truncatula]
Length=222

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K Y+D++LVP GFLI + YH WLWH  R+QP TT  G +A GRR WV  +MKD + 
Sbjct  1     MEWQKYYMDMLLVPCGFLILVFYHYWLWHMTRSQPYTTTFGRDADGRRFWVPTMMKDIDN  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN++AVQ+LRN+IMG+TLM+TTSILLC+GL A+ISSTYSVKKP+ ++V+GAHGEF+V LK
Sbjct  61    KNLVAVQSLRNLIMGTTLMSTTSILLCAGLGAIISSTYSVKKPIKESVFGAHGEFVVVLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             +  +L +  FSF+ H+LS  F NQVN LI+ P     +V P+Y+ + L K+  LN VG R
Sbjct  121   FAIVLTMLSFSFICHTLSAAFINQVNMLISTPQSVKSMVTPEYLTQHLGKAMLLNVVGIR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY AI + LWI GP+L  L    MV +LYNLDFV
Sbjct  181   LFYTAITLQLWIFGPLLPFLSSMLMVCILYNLDFV  215



>ref|XP_009403300.1| PREDICTED: uncharacterized protein LOC103986884 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=214

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 166/233 (71%), Gaps = 29/233 (12%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+KSYLD VLVP+G L  L YH WLWHK                          DNEK
Sbjct  1     MEWRKSYLDAVLVPVGLLFPLVYHLWLWHK--------------------------DNEK  34

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQT+RN IMGS+LMATTSILLCSGLAAVISSTYSVKKPLND+V GAHGEFMV+LK
Sbjct  35    KNILAVQTIRNTIMGSSLMATTSILLCSGLAAVISSTYSVKKPLNDSVLGAHGEFMVSLK  94

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN---CPPDNLGVVRPDYVVELLEKSFALNAV  503
             YVTLL++FLF+F+ +SLSIRF +Q NFLIN   C PD    V PDYV +LLE+SFALN V
Sbjct  95    YVTLLLLFLFAFLCYSLSIRFVSQANFLINTTTCDPDAACPVTPDYVCDLLERSFALNTV  154

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
             GNRLFYAA+P+LLWI+GPVLV++    MV +LY  D V    K   G   + E
Sbjct  155   GNRLFYAALPVLLWILGPVLVLVSSLAMVLILYKFDMVCEGRKHGFGAKVEEE  207



>gb|KEH26649.1| plant/F12B17-70 protein [Medicago truncatula]
Length=232

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 160/215 (74%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K Y+D++LVP GFLI + YH WLWH  R+QP TT  G +A GRR WV  +MKD + 
Sbjct  1     MEWQKYYMDMLLVPCGFLILVFYHYWLWHMTRSQPYTTTFGRDADGRRFWVPTMMKDIDN  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN++AVQ+LRN+IMG+TLM+TTSILLC+GL A+ISSTYSVKKP+ ++V+GAHGEF+V LK
Sbjct  61    KNLVAVQSLRNLIMGTTLMSTTSILLCAGLGAIISSTYSVKKPIKESVFGAHGEFVVVLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             +  +L +  FSF+ H+LS  F NQVN LI+ P     +V P+Y+ + L K+  LN VG R
Sbjct  121   FAIVLTMLSFSFICHTLSAAFINQVNMLISTPQSVKSMVTPEYLTQHLGKAMLLNVVGIR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY AI + LWI GP+L  L    MV +LYNLDFV
Sbjct  181   LFYTAITLQLWIFGPLLPFLSSMLMVCILYNLDFV  215



>gb|EAZ07668.1| hypothetical protein OsI_29924 [Oryza sativa Indica Group]
Length=250

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 172/230 (75%), Gaps = 8/230 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M WK SYLD+VL+P G +  + YH WLWH VR +PL++ +G N A RRLWV  +MKDNEK
Sbjct  1     MAWKDSYLDLVLIPAGIVFPIVYHVWLWHVVRRRPLSSTVGINTATRRLWVLGMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ++RN+IMGSTLMATT+IL C+G+AA++SSTY+VKKPL+DAV+GAHGE+M+ALK
Sbjct  61    KAVLVVQSMRNVIMGSTLMATTAILFCTGVAAILSSTYTVKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPP-------DNLGV-VRPDYVVELLEKSF  518
             YVTLL+ FL SF+SH+ +I   NQ  FL+N  P       D  G+ V  DYV ++LE+ F
Sbjct  121   YVTLLLAFLLSFLSHTTAICTLNQATFLLNTLPSSSSFAADIAGLPVTKDYVADVLERGF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
              LN VGNRLFYA +P+LLWI GPVL  LC   M+P+L+++D V+     K
Sbjct  181   LLNLVGNRLFYAGVPLLLWIFGPVLACLCSVVMIPILHSIDVVYVDGSSK  230



>ref|NP_001062272.1| Os08g0521000 [Oryza sativa Japonica Group]
 dbj|BAD10444.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24186.1| Os08g0521000 [Oryza sativa Japonica Group]
 gb|EAZ43368.1| hypothetical protein OsJ_27970 [Oryza sativa Japonica Group]
Length=250

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 171/230 (74%), Gaps = 8/230 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M WK SYLD+VL+P G +  + YH WLWH VR +PL++ +G N A RRLWV  +MKDNEK
Sbjct  1     MAWKDSYLDLVLIPAGIVFPIVYHVWLWHVVRRRPLSSTVGINTATRRLWVLGMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ++RN+IMGSTLMATT+IL C+G+AA++SSTY+VKKPL+DAV+GAHGE+M+ALK
Sbjct  61    KAVLVVQSMRNVIMGSTLMATTAILFCTGVAAILSSTYTVKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC-------PPDNLGV-VRPDYVVELLEKSF  518
             YVTLL+ FL SF+SH+ +I   NQ  FL+N          D  G+ V  DYV ++LE+ F
Sbjct  121   YVTLLLAFLLSFLSHTTAICTLNQATFLLNTLSSSSSFAADIAGLPVTKDYVADVLERGF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
              LN VGNRLFYA +P+LLWI GPVL  LC   M+P+L+++D V+     K
Sbjct  181   LLNLVGNRLFYAGVPLLLWIFGPVLACLCSVVMIPILHSIDVVYVDGSSK  230



>gb|EAZ07684.1| hypothetical protein OsI_29941 [Oryza sativa Indica Group]
Length=250

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 170/230 (74%), Gaps = 8/230 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M WK SYLD+VL+P G +  + YH WLWH VR +PL++ +G N A RRLWV  +MKDNEK
Sbjct  1     MAWKDSYLDLVLIPAGIVFPIVYHVWLWHVVRRRPLSSTVGINTATRRLWVLGMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ++RN+IMGSTLMATT+IL C+G+AA++ STY+VKKPL+DAV+GAHGE+M+ALK
Sbjct  61    KAVLVVQSMRNVIMGSTLMATTAILFCTGVAAILCSTYTVKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC-------PPDNLGV-VRPDYVVELLEKSF  518
             YVTLL+ FL SF+SH+ +I   NQ  FL+N          D  G+ V  DYV ++LE+ F
Sbjct  121   YVTLLLAFLLSFLSHTTAICTLNQATFLLNTLSSSSSFAADIAGLPVTKDYVADVLERGF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
              LN VGNRLFYA +P+LLWI GPVL  LC   M+P+L+++D V+     K
Sbjct  181   LLNLVGNRLFYAGVPLLLWIFGPVLACLCSVVMIPILHSIDVVYVDGSSK  230



>dbj|BAJ95498.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 171/236 (72%), Gaps = 9/236 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W+ SYLD+VL+P+G L  + YH WLW  VR  PL + IG NAA RRLWV ++MKDNEK
Sbjct  1     MAWRDSYLDLVLIPVGLLFPIVYHMWLWRSVRRCPLRSTIGINAAARRLWVLSMMKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ+LRN+IMGSTL+ATTS+L C+G+AAV+SSTY+VKKP++DAV+GAHGE+M+ALK
Sbjct  61    KAVLVVQSLRNVIMGSTLVATTSVLFCTGVAAVLSSTYAVKKPISDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--------VRPDYVVELLEKSF  518
             YV LL  FL SF+ H+L+I   NQ  FL+N       +        V  +YV+E+L++ F
Sbjct  121   YVALLTTFLLSFLCHTLAICTFNQATFLVNALSQFFALPDGGRHLPVNKEYVLEVLDRGF  180

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
              LN VGNRLF+  +P+LLWI GPVL  LC   M+P+LYN+D V+   +GK G   D
Sbjct  181   LLNFVGNRLFFGGVPLLLWIFGPVLACLCSMVMIPILYNIDMVYI-ERGKGGEVSD  235



>gb|KCW80623.1| hypothetical protein EUGRSUZ_C019982, partial [Eucalyptus grandis]
Length=184

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = -2

Query  865  DNEKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFM  686
            DN+KKNILAVQTLRN IMGSTLMATTSILLCSGLAAVISSTYSVKKPLND+VYG HGEFM
Sbjct  1    DNDKKNILAVQTLRNTIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDSVYGGHGEFM  60

Query  685  VALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKS  521
            +A+KYVTLL IFLFSF+ HSLSIRF NQVN LIN P     P+   +V P Y+ ELLEK 
Sbjct  61   LAMKYVTLLTIFLFSFLCHSLSIRFINQVNILINTPMQQVDPEMASIVTPRYIAELLEKG  120

Query  520  FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPK  374
            F LN +GNRLFY AIP+LLWI GPVLV LC   +V VLYNLDFV    K
Sbjct  121  FVLNTMGNRLFYTAIPLLLWIFGPVLVFLCSVALVLVLYNLDFVIGSGK  169



>gb|KHM99780.1| hypothetical protein glysoja_023921 [Glycine soja]
Length=227

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = -2

Query  1000 LVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQTLRN  821
            L+PLG LI +GYH WL +KVRTQ   TI G +A GR  WV A++KD EK NI+A+Q +RN
Sbjct  3    LIPLGLLINIGYHVWLCYKVRTQASLTIFGIDADGRCSWVPAMIKDIEKNNIVAIQNIRN  62

Query  820  MIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLIIFLFS  641
            MIMGS  MA+TSILLC GL A+ISSTYSVKKPL D++YGAHGEF++ALKY TL  IFLFS
Sbjct  63   MIMGSIFMASTSILLCCGLGAMISSTYSVKKPLIDSIYGAHGEFVLALKYATLFTIFLFS  122

Query  640  FVSHSLSIRFTNQVNFLINCPPDN-LGVVRPDYVVELLEKSFALNAVGNRLFYAAIPMLL  464
            F+ HSLS+RF  Q++ LI  P D  + +V P+Y+ ELL K+  LN VGNR+ +  + +LL
Sbjct  123  FLFHSLSVRFLTQLSILICTPQDAIMTLVTPEYLTELLRKATFLNIVGNRILHTGLALLL  182

Query  463  WIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
            WI GPV+  LC   M+ VL+ LDFV    K K+G
Sbjct  183  WICGPVMAFLCSVAMLLVLHKLDFVARKEKIKVG  216



>ref|XP_008798195.1| PREDICTED: uncharacterized protein LOC103713149 [Phoenix dactylifera]
Length=207

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 3/200 (2%)
 Frame = -2

Query  910  TNAAGRRL-WVSAIMKDNEKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSV  734
            TN  G  L ++  +++DN+KK +LAVQT+RN IMG TLMATTSILLCSGLAAVISSTYS+
Sbjct  8    TNFMGASLIFLEILLQDNDKKGVLAVQTMRNAIMGLTLMATTSILLCSGLAAVISSTYSI  67

Query  733  KKPLNDAVYGAHGEFMVALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLIN--CPPDNLGV  560
            KKPLND+V+GA GEFM++LKYVTLL+IFLFSF+ +SLSIR  NQVNFLIN  C  D+   
Sbjct  68   KKPLNDSVFGAQGEFMLSLKYVTLLLIFLFSFICYSLSIRLINQVNFLINIPCGVDDASP  127

Query  559  VRPDYVVELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTP  380
            V  DY+ +LLE+SFALN VGNRLFYAA+P+LLWI GPVLV LC ATMVP+LY+LD V   
Sbjct  128  VTSDYICDLLERSFALNTVGNRLFYAALPLLLWIFGPVLVFLCSATMVPILYHLDIVSGE  187

Query  379  PKGKLGHDYDHEIGNGVLEV  320
             K   G   +       LEV
Sbjct  188  GKRGFGSKVEKMGDVEFLEV  207



>gb|KFK27744.1| hypothetical protein AALP_AA8G423500 [Arabis alpina]
Length=249

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLD +LVPL  ++   YH +L   VRT P +TI+G N+ GRR+W+SA++K+N+K
Sbjct  1     MEWRKWYLDAILVPLALVLMFCYHLYLSFMVRTHPFSTILGINSHGRRIWISAMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NIL VQTLRN+IMG+TLMATT ++LC+GLAAVISSTYS+K+PLNDAVYGAHG+F +A+K
Sbjct  61    TNILVVQTLRNIIMGATLMATTCVVLCAGLAAVISSTYSIKRPLNDAVYGAHGDFAIAVK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF  HSL+IRF NQV  L+N P     P     +  +YV E+ EK F LN
Sbjct  121   YLTILTIFIFSFFFHSLAIRFLNQVAILVNIPNLDPNPSGCFFLTSEYVSEMFEKGFLLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNRLFY    ++LWI GPVLV      MV VLY+LDFV
Sbjct  181   TVGNRLFYVGFSLMLWIFGPVLVFFSVLVMVLVLYHLDFV  220



>gb|AFK39792.1| unknown [Medicago truncatula]
Length=230

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K Y+D++ VP GFLI + YH  LW   R+QP+ T  G +A GRR WV AIMKD + 
Sbjct  1     MEWQKYYMDIMFVPCGFLILVLYHFLLWKITRSQPMNTTFGRDAGGRRHWVPAIMKDIDN  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN++AVQTLRN+IMG+ LM+TTSILLC+GL A+ISSTYSVKKP+ ++V+GAHG+F+V LK
Sbjct  61    KNVVAVQTLRNLIMGTNLMSTTSILLCAGLGAIISSTYSVKKPIKESVFGAHGDFVVVLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y  +L +  FSFV  +LS  F NQVN LI  P +   +V P+Y+ + L K+  LN +GNR
Sbjct  121   YAIVLTMLSFSFVCLTLSTAFINQVNMLICIPQNVKSMVTPEYLTQHLGKAMLLNIIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY AI + LWI GP+L  L    MV +LYNLD+V
Sbjct  181   LFYTAITLQLWIFGPLLPFLSSMLMVCILYNLDYV  215



>ref|NP_001063551.1| Os09g0494600 [Oryza sativa Japonica Group]
 dbj|BAF25465.1| Os09g0494600 [Oryza sativa Japonica Group]
 gb|EAZ09604.1| hypothetical protein OsI_31888 [Oryza sativa Indica Group]
 gb|EAZ45229.1| hypothetical protein OsJ_29873 [Oryza sativa Japonica Group]
 dbj|BAG98116.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 166/231 (72%), Gaps = 16/231 (7%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD++L+PL  L+ + YH WLW  VR  PL T  G N+A RRLW  ++ KDNEK
Sbjct  1     MEWRDSFLDLILIPLSLLVPMAYHVWLWRAVRLTPLRTAAGINSATRRLWAISMTKDNEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ+LRN+IMGSTL+ATT+IL C+G+AAV+SSTY++KKPL+DAV+GAHGE+M+ALK
Sbjct  61    KAVLVVQSLRNVIMGSTLVATTAILFCTGIAAVLSSTYTIKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV----------------RPDYV  542
             YV LL++FL +F+SHSL+I F N+ +FLIN  P  L                     DY+
Sbjct  121   YVALLLLFLVAFLSHSLAICFLNEASFLINTSPTLLAGGDGAGDDGGRRLLGLPSTRDYM  180

Query  541   VELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              E LEK F LN VGNR+F+A +P+LLWI GP+L  L    M+P+LYNLD V
Sbjct  181   EEALEKGFTLNFVGNRIFFAGVPLLLWIFGPLLAFLSSLVMIPILYNLDVV  231



>ref|XP_003574775.1| PREDICTED: uncharacterized protein LOC100829514 [Brachypodium 
distachyon]
Length=264

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 165/235 (70%), Gaps = 12/235 (5%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             W+ SYLD+VL+P+G L  + YH WL+  VR  PL +  G  AA RRLWV  +M+DNEKK 
Sbjct  4     WRDSYLDLVLIPVGLLFPILYHVWLYRAVRRCPLRSTAGIGAAARRLWVLGMMRDNEKKA  63

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +L VQ+LRN+IMGSTL+ATTS+L C+G+AAV+SSTY+VKKPL+DAV+GAHGE+MVALKY 
Sbjct  64    VLVVQSLRNVIMGSTLVATTSVLFCTGVAAVLSSTYAVKKPLSDAVFGAHGEYMVALKYA  123

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDN------------LGVVRPDYVVELLEK  524
             TLL+ FL SF+ HSL+I   NQ  FL+N                 L VV  +YVVE+LE+
Sbjct  124   TLLLAFLLSFLCHSLAICSLNQAAFLVNALSSQFFVSGAGGGAGGLSVVDKEYVVEVLER  183

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGH  359
              F L+ VGNRLF+  +P+LLWI GPVL  L    M+PVLYN+D V+   +   G 
Sbjct  184   GFVLSLVGNRLFFGGVPLLLWIFGPVLACLASMLMIPVLYNIDIVYVEKRKGSGE  238



>gb|AFK38647.1| unknown [Medicago truncatula]
Length=233

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K Y+D++ VP GFLI + YH  LW   R+QP+ T  G +A GRR WV AIMKD + 
Sbjct  1     MEWQKYYMDIMFVPCGFLILVLYHFLLWKITRSQPMNTTFGRDADGRRHWVPAIMKDIDN  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN++AVQTLRN+IMG+ LM+TTSILLC+GL A+ISSTYS+KKP+ ++V+GAHG+F+V LK
Sbjct  61    KNVVAVQTLRNLIMGTNLMSTTSILLCAGLGAIISSTYSIKKPIKESVFGAHGDFVVVLK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y  +L +  FSFV  +LS  F NQVN LI  P +   +V P+Y+ + L K+  LN +GNR
Sbjct  121   YAIVLTMLSFSFVCLTLSTAFINQVNMLICIPQNVKSMVTPEYLTQHLGKAMLLNIIGNR  180

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFY AI + LWI GP+L  L    MV +LYNLD+V
Sbjct  181   LFYTAITLQLWIFGPLLPFLSSMLMVCILYNLDYV  215



>ref|XP_002872126.1| hypothetical protein ARALYDRAFT_351499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48385.1| hypothetical protein ARALYDRAFT_351499 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 167/220 (76%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD +LVPL  ++ + YH +L   VRT P +T++G N+ GRR+W+SA++K+N+K
Sbjct  1     MEWKKWYLDAILVPLALMMMICYHIYLSFMVRTNPFSTLLGINSHGRRMWISAMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NILAVQTLRN+IMG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDAV+GAHG+F +++K
Sbjct  61    TNILAVQTLRNIIMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAVFGAHGDFAISIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-----PDNLGVVRPDYVVELLEKSFALN  509
             Y+T+L IF+FSF  HSLSIRF NQV  L+N P     P     +  ++V E+ EK   LN
Sbjct  121   YLTILTIFIFSFFFHSLSIRFLNQVAILVNIPNLDPTPSGCFFLTSEHVSEMFEKGIFLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNRLFYA   ++LWI GP+LV      MV VLYNLDFV
Sbjct  181   TVGNRLFYAGFSLMLWIFGPILVFSTVLVMVLVLYNLDFV  220



>ref|XP_006290115.1| hypothetical protein CARUB_v10003762mg [Capsella rubella]
 gb|EOA23013.1| hypothetical protein CARUB_v10003762mg [Capsella rubella]
Length=244

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 167/223 (75%), Gaps = 10/223 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK+ YLDV+LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+ +++K+N+K
Sbjct  1     MEWKRWYLDVILVPLALVMMLCYHIYLSFMVRTHPFSTLLGINSRGRRIWICSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NILAVQTLRN++MG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDAV+GAHG+F + +K
Sbjct  61    MNILAVQTLRNIVMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAVFGAHGDFAITIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--------VRPDYVVELLEKSF  518
             Y+T+L IF+FSF  HSLSIRF NQV  L+N P  NL          +  ++V E+ EK  
Sbjct  121   YLTILTIFIFSFFFHSLSIRFLNQVAILVNIP--NLDTNPSSGCFSLTSEHVSEMFEKGI  178

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              LN VGNRLFY    ++LWI GP+LV  C   MV VLYNLDFV
Sbjct  179   FLNTVGNRLFYTGFSLMLWIFGPILVFFCVMVMVLVLYNLDFV  221



>ref|NP_568456.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAC08253.1| putative protein [Arabidopsis thaliana]
 gb|AED93362.1| uncharacterized protein AT5G24790 [Arabidopsis thaliana]
Length=246

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 168/220 (76%), Gaps = 5/220 (2%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD +LVPL  ++ + YH +L   VRT P +T++G N+ GRR+W+SA++KDN+K
Sbjct  1     MEWKKWYLDAILVPLALMMMICYHIYLSFMVRTNPFSTLLGINSHGRRIWISAMIKDNQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
              NILAVQTLRN++MG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDAV+GAHG+F +++K
Sbjct  61    TNILAVQTLRNIVMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAVFGAHGDFAISIK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP---PDNLGVV--RPDYVVELLEKSFALN  509
             Y+T+L IF+FSF  HSLSIRF NQV  L+N P   P+  G V    ++V E+ EK   LN
Sbjct  121   YLTILTIFIFSFFFHSLSIRFLNQVAILVNIPNLDPNPSGCVFLTSEHVSEMFEKGIFLN  180

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              VGNRLFYA   ++LWI GP+LV      MV VL +LDFV
Sbjct  181   TVGNRLFYAGFSLMLWIFGPILVFFSVLVMVLVLSHLDFV  220



>ref|XP_010421322.1| PREDICTED: uncharacterized protein LOC104706793 [Camelina sativa]
Length=247

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 169/228 (74%), Gaps = 6/228 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD +LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+ +++K+N+K
Sbjct  1     MEWKKWYLDAILVPLALVMMLCYHIYLCFMVRTHPFSTLLGINSRGRRIWICSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVY-GAHGEFMVAL  677
              NILAVQTLRN+IMG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDA + GAHG+F +++
Sbjct  61    MNILAVQTLRNIIMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAAFLGAHGDFAISI  120

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP---PDNLGV--VRPDYVVELLEKSFAL  512
             KY+T+L IF+FSF  HSL IRF NQV  L+N P   P+  G   +  ++V E+ EK   L
Sbjct  121   KYLTILTIFIFSFFFHSLCIRFLNQVAILVNIPNLDPNLSGCLFLTSEHVSEMFEKGIFL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             N VGNRLFYA   ++LWI GP+LV L    MV VLYNLDFV    K +
Sbjct  181   NTVGNRLFYAGFSLMLWIFGPILVFLSVLGMVLVLYNLDFVSANDKKE  228



>ref|XP_003578353.1| PREDICTED: uncharacterized protein LOC100831783 [Brachypodium 
distachyon]
Length=253

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 180/253 (71%), Gaps = 15/253 (6%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD++L+PL  L+   YH WLW  VR  PL+T  G  AA RRLW + ++KD+EK
Sbjct  1     MEWRDSFLDLILIPLSLLLPALYHLWLWRAVRRSPLSTAFGVYAAARRLWAAGMVKDSEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ+LRN+IMGSTLMATT++L C+G+AAV+SSTY+VKKPL+DAV+GAHGE+M+ALK
Sbjct  61    KGVLVVQSLRNVIMGSTLMATTAVLFCTGIAAVLSSTYAVKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINC-------PPDNLGV---VRPDYVVELLEK  524
             YV LL+IFLF+F+ HSL+I F NQ +FLIN          D LG+   +  DYV E+LE+
Sbjct  121   YVALLLIFLFAFLCHSLTICFLNQASFLINTGAIGGEHGEDRLGLPPALAGDYVGEILER  180

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK-----LGH  359
              F LN VGNRLFYA +P+LLWI GP+L  L    M+P+LYNLD V    +G+     +  
Sbjct  181   GFTLNFVGNRLFYAGVPLLLWIFGPLLAFLSSVVMIPILYNLDMVSIKGEGEHSSGCVNA  240

Query  358   DYDHEIGNGVLEV  320
                   GNG L+V
Sbjct  241   KKGDTNGNGCLQV  253



>ref|XP_006660295.1| PREDICTED: uncharacterized protein LOC102700922 [Oryza brachyantha]
Length=249

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK++YLD+VL+P+G L  + YH WLW  VR  PL++ +G NAA RRLW+  +MK+NEKK 
Sbjct  4     WKEAYLDLVLIPVGVLFPVVYHVWLWRAVRRSPLSSTVGINAAARRLWLLRMMKENEKKA  63

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +L VQ++RN+IMGSTLMATT+IL C+G+AAV+SSTY+VKKPL+DAV+GAHGE+M+ALKYV
Sbjct  64    VLVVQSMRNVIMGSTLMATTAILFCTGVAAVLSSTYAVKKPLSDAVFGAHGEYMMALKYV  123

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
             TLL++FL SF+SH+ +I   NQ  FL+N  P     V  DY+ ++LE+ F LN VGNRLF
Sbjct  124   TLLLVFLLSFLSHTAAICTINQATFLVNALPAADLPVTKDYIADVLERGFLLNLVGNRLF  183

Query  487   Y----AAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             Y       P+LLWI GPVL  +C   M+P+L+++D V+
Sbjct  184   YGGGPPPPPLLLWIFGPVLACICSIVMIPILHSIDMVY  221



>ref|XP_010454804.1| PREDICTED: uncharacterized protein LOC104736501 [Camelina sativa]
Length=247

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 171/228 (75%), Gaps = 6/228 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD +LVPL  ++ L YH +L   VRT P +T++G N+ GRR+W+ +++K+N+K
Sbjct  1     MEWKKWYLDAILVPLALVMMLCYHIYLCFMVRTHPFSTLLGINSRGRRIWICSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVY-GAHGEFMVAL  677
              NIL VQTLRN+IMG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDAV+ GAHG+F++++
Sbjct  61    MNILTVQTLRNIIMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAVFLGAHGDFVISI  120

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP---PDNLGV--VRPDYVVELLEKSFAL  512
             KY+T+L IF+FSF  HSLSIRF NQV  L+N P   P+  G   +  ++V E+ EK   L
Sbjct  121   KYLTILTIFIFSFFFHSLSIRFLNQVAILVNIPNLDPNLSGCLFLTSEHVSEMFEKGIFL  180

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             N VGNRLFYA   ++LWI GP+LV L    MV VLYNLDFV    K +
Sbjct  181   NTVGNRLFYAGFSLMLWIFGPILVFLSVLGMVLVLYNLDFVSANDKKE  228



>ref|NP_001142840.1| uncharacterized protein LOC100275230 [Zea mays]
 gb|ACG27038.1| hypothetical protein [Zea mays]
Length=252

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 159/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK  YLD+VL+PL  L    YH WL+  VR  PL++ +G +AA RR+WV ++MK+NEK+ 
Sbjct  4     WKDGYLDMVLIPLAVLFPAVYHLWLYRAVRRSPLSSTVGISAAARRIWVFSMMKNNEKQA  63

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             I+ VQ++RN++M STL+ TTSIL C+G+AAV+SSTY+VKKPL+DAV+GAHG  M+ALKY+
Sbjct  64    IIVVQSIRNVLMASTLVGTTSILFCTGVAAVLSSTYAVKKPLSDAVFGAHGAHMMALKYL  123

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINC----PPDNLGVVRPDYVVELLEKSFALNAVG  500
              +L +FL +F+ HSL+I   N  +FL+N     P  +L  V  DYV +++E+ F L+  G
Sbjct  124   LILAVFLLAFLCHSLAICTLNTASFLVNALSPSPHLHLPGVTADYVADVMERGFLLSLAG  183

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             NRLF+A  P+LLWI GPV   +C   M+ VLYN+D V     G+
Sbjct  184   NRLFFAGAPLLLWISGPVFPCVCSMAMISVLYNMDVVDDADDGR  227



>ref|XP_004957239.1| PREDICTED: uncharacterized protein LOC101783301 [Setaria italica]
Length=255

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 170/248 (69%), Gaps = 14/248 (6%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD+ L+PL  L+ + YH WLW ++R +PL T  G NAA RRLW + +MKDN K
Sbjct  1     MEWRDSFLDLALIPLSLLLPMAYHVWLWREIRLRPLRTAAGINAAARRLWAAGMMKDNAK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +  VQ++RN+IMGSTLMATT+IL C+G+AAV+SSTY+VKKPL+D V+GAHGE+M+ALK
Sbjct  61    NAVTVVQSVRNVIMGSTLMATTAILFCTGIAAVLSSTYTVKKPLSDTVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLGVVRP----------DYVVE  536
             YV LL+ FLF+F+ HSL+I F NQ +FLIN       D+ G              DY+ E
Sbjct  121   YVALLLAFLFAFLCHSLAICFLNQASFLINTSGCLIADSSGSGEGGDLIGLPSARDYIGE  180

Query  535   LLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHD  356
             +LE+ F LN VGNRLFYA +P+LLWI GP+L  L    M+P+LYNLD V         + 
Sbjct  181   VLERGFTLNLVGNRLFYAGVPLLLWIFGPLLAFLSSLVMIPILYNLDVVDLKGHSGCVNA  240

Query  355   YDHEIGNG  332
                E+ NG
Sbjct  241   KSAEMSNG  248



>ref|XP_002444749.1| hypothetical protein SORBIDRAFT_07g027210 [Sorghum bicolor]
 gb|EES14244.1| hypothetical protein SORBIDRAFT_07g027210 [Sorghum bicolor]
Length=254

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 165/225 (73%), Gaps = 6/225 (3%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             W+  YLD+VL+PL  L    YH WL+  VR  PL++ +G +AA RR+WV ++MK+NEK+ 
Sbjct  4     WRDGYLDMVLIPLAILFPALYHLWLYRAVRRSPLSSTVGISAAARRIWVFSMMKNNEKQA  63

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +  VQ++RN++MGSTL+ TTSIL C+G+AAV+SSTY+VKKPL+DAV+GAHGE+M+ALKY+
Sbjct  64    VTVVQSIRNVLMGSTLVGTTSILFCTGVAAVLSSTYAVKKPLSDAVFGAHGEYMMALKYL  123

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINC--PPDNL---GVVRPDYVVELLEKSFALNAV  503
              LL +FL +F+ HSL+I   NQ +FL+N   P  +L   GV R DYV +++E+ F LN  
Sbjct  124   LLLSVFLLAFLCHSLAICTLNQASFLVNALSPAPHLHLPGVTR-DYVADVMERGFILNLA  182

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             GNRLF+A  P+LLWI GPV   +C   M+PVLYN+D V     G+
Sbjct  183   GNRLFFAGAPLLLWISGPVFPCICSMAMIPVLYNMDVVDDADDGR  227



>ref|NP_001143651.1| hypothetical protein [Zea mays]
 gb|ACG33771.1| hypothetical protein [Zea mays]
 tpg|DAA62102.1| TPA: hypothetical protein ZEAMMB73_796660 [Zea mays]
Length=257

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 169/229 (74%), Gaps = 14/229 (6%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD+ L+PL  L+ + YHAWLW +VR +PL T +G NAA RRLW   +MKDN K
Sbjct  1     MEWRDSFLDLALIPLSLLLPMAYHAWLWREVRLRPLRTAVGINAATRRLWAIGMMKDNAK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +  VQ++RN+IMGSTLMATT+IL C+G+AAV+SSTY++KKPL+D V+GAHGE+M+ALK
Sbjct  61    NAVTVVQSVRNVIMGSTLMATTAILFCTGVAAVLSSTYTIKKPLSDTVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLIN-------CPPDN----LGVVRP---DYVVE  536
             YV L+++FL +F+ HSL+I F NQ +FLIN          D+    LG+  P   DY+ +
Sbjct  121   YVALMLLFLLAFLCHSLAICFLNQASFLINTSACLFSSSADSDAAVLGLPLPPTRDYIGD  180

Query  535   LLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             +LE+ F LN VGNRLFYA +P+LLWI GP+L  L    MVP+LY+LD V
Sbjct  181   VLERGFTLNLVGNRLFYAGVPLLLWIFGPLLAFLSSMVMVPILYSLDVV  229



>ref|XP_002980549.1| hypothetical protein SELMODRAFT_113190 [Selaginella moellendorffii]
 gb|EFJ18200.1| hypothetical protein SELMODRAFT_113190 [Selaginella moellendorffii]
Length=231

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 152/207 (73%), Gaps = 1/207 (0%)
 Frame = -2

Query  1012  LDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQ  833
             LD VLVP+  LI + YH +L +K+R  PL T+IG N   +R WV +IMKD +KKNILAVQ
Sbjct  2     LDAVLVPVAILIIVAYHIFLLYKIRKDPLQTVIGINNIAKRAWVRSIMKDMDKKNILAVQ  61

Query  832   TLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLII  653
             TLRN IM STLMA+T+ILL SG+AA +SS YSVK+PL  AVYGA  +F VA+K+++LL  
Sbjct  62    TLRNSIMASTLMASTAILLTSGVAAFLSSNYSVKRPLESAVYGARDDFSVAVKFLSLLAC  121

Query  652   FLFSFVSHSLSIRFTNQVNFLINCPPD-NLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
             FLFSF+ +  SIRF N VN+LIN PP     ++ P++V ++L + FA  ++G R FY A 
Sbjct  122   FLFSFLCYMQSIRFVNNVNYLINVPPSYGSPLITPEFVGDVLVRGFAFYSIGTRAFYVAF  181

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLD  395
             P+LLWI GP+ V+LC   +VPVLY+LD
Sbjct  182   PLLLWIYGPIPVLLCSIALVPVLYHLD  208



>ref|XP_002976819.1| hypothetical protein SELMODRAFT_105772 [Selaginella moellendorffii]
 gb|EFJ21929.1| hypothetical protein SELMODRAFT_105772 [Selaginella moellendorffii]
Length=231

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 152/207 (73%), Gaps = 1/207 (0%)
 Frame = -2

Query  1012  LDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQ  833
             LD VLVP+  LI + YH +L +K+R  PL T+IG N   +R WV +IMKD +KKNILAVQ
Sbjct  2     LDAVLVPVAILIIVAYHIFLLYKIRKDPLQTVIGINNIAKRAWVRSIMKDMDKKNILAVQ  61

Query  832   TLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLII  653
             TLRN IM STLMA+T+ILL SG+AA +SS YSVK+PL  AVYGA  +F +A+K+++LL  
Sbjct  62    TLRNSIMASTLMASTAILLTSGVAAFLSSNYSVKRPLESAVYGARDDFSIAVKFLSLLAC  121

Query  652   FLFSFVSHSLSIRFTNQVNFLINCPPD-NLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
             FLFSF+ +  SIRF N VN+LIN PP     ++ P++V ++L + FA  ++G R FY A 
Sbjct  122   FLFSFLCYMQSIRFVNNVNYLINVPPSYGSPLITPEFVGDVLVRGFAFYSIGTRAFYVAF  181

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLD  395
             P+LLWI GP+ V+LC   +VPVLY+LD
Sbjct  182   PLLLWIYGPIPVLLCSIALVPVLYHLD  208



>gb|EMT00440.1| hypothetical protein F775_12307 [Aegilops tauschii]
Length=263

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 183/260 (70%), Gaps = 24/260 (9%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE-KK  851
             W+ SYLD++LVPLG L+   YHAWLW  VR +PL+T  G  +A RRLW + +M+DN+ KK
Sbjct  4     WRDSYLDLILVPLGLLLPALYHAWLWRAVRRRPLSTAFGVYSAARRLWAAGMMRDNDDKK  63

Query  850   NILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKY  671
              +L VQ++RN+IMGSTLMATTS+L C+G+AAV+SSTYSVKKPL+DAV+GAHGE+M+ALKY
Sbjct  64    GVLVVQSIRNVIMGSTLMATTSVLFCTGIAAVLSSTYSVKKPLSDAVFGAHGEYMMALKY  123

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLIN--CPP------DN-----LGVVRPD-----Y  545
             V LL++FLF+F+ H+L+I F NQ +FLIN  C P      D+     +GV  P      Y
Sbjct  124   VALLLVFLFAFLCHTLTICFLNQASFLINTSCLPLPDAGKDDDGARLVGVQLPAGAVSYY  183

Query  544   VVELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV-FTPPKGK  368
             V E+LE+SF LN VGNRLFYA +P+LLWI GP+L  L    M+P+LYNLD V     +G 
Sbjct  184   VGEILERSFTLNFVGNRLFYAGVPLLLWIFGPLLAFLSSLVMIPILYNLDMVNVAADRGA  243

Query  367   LGHDY----DHEIGNGVLEV  320
               H          GNG ++V
Sbjct  244   KEHSSGCINGKANGNGFMQV  263



>dbj|BAK00871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 183/264 (69%), Gaps = 28/264 (11%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE-KK  851
             W++SYLD++L+PLG L+   YHAWLW  VR +PL+T  G  +A RRLW + +M+DN+ KK
Sbjct  4     WRESYLDLILIPLGLLLPALYHAWLWRAVRRRPLSTAFGVYSAARRLWAAGMMRDNDDKK  63

Query  850   NILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKY  671
              +L VQ+LRN+IMGSTLMATTS+L C+G+AAV+SSTYSVKKPL+DAV+GAHGE+M+ALKY
Sbjct  64    GVLVVQSLRNVIMGSTLMATTSVLFCTGIAAVLSSTYSVKKPLSDAVFGAHGEYMMALKY  123

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLIN--CPPD-------------NLGVVRP-----  551
             V LL++FLF+F+ H+L+I F NQ +FLIN  C P               LG+  P     
Sbjct  124   VALLLVFLFAFLCHTLTICFLNQASFLINTSCIPRAAADKDGDGARMVGLGLQLPAGAVG  183

Query  550   DYVVELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKG  371
             DYV E+LE+ F LN VGNRLFYA +P+LLWI GP+L  L    M+P+LYNLD V      
Sbjct  184   DYVGEILERGFTLNFVGNRLFYAGVPLLLWIFGPLLAFLSAMVMIPILYNLDMVNVASAD  243

Query  370   KLGHDYDHEI-------GNGVLEV  320
             +  +++           GNG ++V
Sbjct  244   RGANEHSSGCVNGKAANGNGCMQV  267



>tpg|DAA48067.1| TPA: hypothetical protein ZEAMMB73_728170 [Zea mays]
Length=326

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 159/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK  YLD+VL+PL  L    YH WL+  VR  PL++ +G +AA RR+WV ++MK+NEK+ 
Sbjct  78    WKDGYLDMVLIPLAVLFPAVYHLWLYRAVRRSPLSSTVGISAAARRIWVFSMMKNNEKQA  137

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             I+ VQ++RN++M STL+ TTSIL C+G+AAV+SSTY+VKKPL+DAV+GAHG  M+ALKY+
Sbjct  138   IIVVQSIRNVLMASTLVGTTSILFCTGVAAVLSSTYAVKKPLSDAVFGAHGAHMMALKYL  197

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINC----PPDNLGVVRPDYVVELLEKSFALNAVG  500
              +L +FL +F+ HSL+I   N  +FL+N     P  +L  V  +YV +++E+ F L+  G
Sbjct  198   LILAVFLLAFLCHSLAICTLNTASFLVNALSPSPHLHLPGVTAEYVADVMERGFLLSLAG  257

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
             NRLF+A  P+LLWI GPV   +C   M+ VLYN+D V     G+
Sbjct  258   NRLFFAGAPLLLWISGPVFPCVCSMAMISVLYNMDVVDDADDGR  301



>ref|XP_002460465.1| hypothetical protein SORBIDRAFT_02g028790 [Sorghum bicolor]
 gb|EER96986.1| hypothetical protein SORBIDRAFT_02g028790 [Sorghum bicolor]
Length=265

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 171/238 (72%), Gaps = 23/238 (10%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD+VL+PL  L+ + YHAWLW +VR +PL T +G NAA RR+W  A+MKDN K
Sbjct  1     MEWRDSFLDLVLIPLSLLLPMAYHAWLWREVRLRPLRTAVGINAAARRVWAIAMMKDNAK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +  VQ++RN+IMGSTLMATT+IL C+G+AAV+SSTY++KKPL+DAV+GAHGE+M+ALK
Sbjct  61    NAVTVVQSVRNVIMGSTLMATTAILFCTGVAAVLSSTYTIKKPLSDAVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--------------------GVVR  554
             YV L+++FLF+F+ HSL+I F NQ +FLIN    +                     G+  
Sbjct  121   YVALMLLFLFAFLCHSLAICFLNQASFLINTSGCHFAAGADDSDSDASSSSLPAAGGLPL  180

Query  553   P---DYVVELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             P   DY+ ++LE+ F LN VGNRLFYA +P+LLWI GP+L  L    MVP+LY+LD V
Sbjct  181   PPTRDYIGDVLERGFTLNLVGNRLFYAGVPLLLWIFGPLLAFLSSMVMVPILYSLDVV  238



>ref|XP_008669307.1| PREDICTED: uncharacterized protein LOC100275230 isoform X1 [Zea 
mays]
Length=329

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 159/227 (70%), Gaps = 7/227 (3%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMK---DNE  857
             WK  YLD+VL+PL  L    YH WL+  VR  PL++ +G +AA RR+WV ++MK   +NE
Sbjct  78    WKDGYLDMVLIPLAVLFPAVYHLWLYRAVRRSPLSSTVGISAAARRIWVFSMMKVSKNNE  137

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVAL  677
             K+ I+ VQ++RN++M STL+ TTSIL C+G+AAV+SSTY+VKKPL+DAV+GAHG  M+AL
Sbjct  138   KQAIIVVQSIRNVLMASTLVGTTSILFCTGVAAVLSSTYAVKKPLSDAVFGAHGAHMMAL  197

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINC----PPDNLGVVRPDYVVELLEKSFALN  509
             KY+ +L +FL +F+ HSL+I   N  +FL+N     P  +L  V  +YV +++E+ F L+
Sbjct  198   KYLLILAVFLLAFLCHSLAICTLNTASFLVNALSPSPHLHLPGVTAEYVADVMERGFLLS  257

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
               GNRLF+A  P+LLWI GPV   +C   M+ VLYN+D V     G+
Sbjct  258   LAGNRLFFAGAPLLLWISGPVFPCVCSMAMISVLYNMDVVDDADDGR  304



>gb|EMS63255.1| hypothetical protein TRIUR3_18233 [Triticum urartu]
Length=224

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 153/236 (65%), Gaps = 35/236 (15%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W++SYLD+VL+P+G L  + YH WLW                            DNEK
Sbjct  1     MAWRESYLDLVLIPVGLLFPIVYHMWLWRA--------------------------DNEK  34

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ+LRN+IMGSTL+ATTS+L C+G+AAV+SSTY+VKKP++DAV+GAHGE+M+ALK
Sbjct  35    KAVLVVQSLRNVIMGSTLVATTSVLFCTGVAAVLSSTYAVKKPISDAVFGAHGEYMMALK  94

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--------VRPDYVVELLEKSF  518
             YV LL  FL SF+ HSL+I   NQ  FL+N       +        V  +YV+E+LE+ F
Sbjct  95    YVALLTAFLLSFLCHSLAICTFNQATFLVNALSHLFALPDGGRHLPVNKEYVLEVLERGF  154

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
              LN VGNRLF+  +P+LLWI GPVL  LC   M+PVLYN+D V+   +GK G   D
Sbjct  155   LLNFVGNRLFFGGVPLLLWIFGPVLACLCSMVMIPVLYNIDIVYI-ERGKGGEVSD  209



>gb|EMT11752.1| hypothetical protein F775_20337 [Aegilops tauschii]
Length=224

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 154/236 (65%), Gaps = 35/236 (15%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W++SYLD+VL+P+G L  + YH WL                  GR         DNEK
Sbjct  1     MAWRESYLDLVLIPVGLLFPIVYHMWL------------------GR--------ADNEK  34

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +L VQ+LRN+IMGSTL+ATTS+L C+G+AAV+SSTY+VKKP++DAV+GAHGE+M+ALK
Sbjct  35    KAVLVVQSLRNVIMGSTLVATTSVLFCTGVAAVLSSTYAVKKPISDAVFGAHGEYMMALK  94

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--------VRPDYVVELLEKSF  518
             YV LL  FL SF+ H+L+I   NQ  FL+N       +        V  +YV+E+L++ F
Sbjct  95    YVALLTAFLLSFLCHTLAICTFNQATFLVNALSHLFALPDGGRHLPVNKEYVLEVLDRGF  154

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
              LN VGNRLF+  +P+LLWI GPVL  LC   M+PVLYN+D V+   +GK G   D
Sbjct  155   LLNFVGNRLFFGGVPLLLWIFGPVLACLCSMVMIPVLYNIDMVYI-ERGKGGEVSD  209



>ref|XP_008798194.1| PREDICTED: uncharacterized protein LOC103713148 [Phoenix dactylifera]
Length=233

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             ME ++ YLD +LV LG L  L YH+WLWH VRT+P  T IG NA G R+WV A+ KDN+K
Sbjct  1     MEGRRLYLDFILVALGLLCSLLYHSWLWHAVRTRPRRTNIGVNAGGPRVWVMAMTKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN+LAVQTLRN IM STL+AT SI +  GL A  S+ Y  +K         H +  VA K
Sbjct  61    KNVLAVQTLRNFIMSSTLIATISIFISCGLLAFTSNMYKSQKR-------RHSDLEVASK  113

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
               T+++  L SF+ HSLSI F  QVN LIN        V P+YV +LL+K   L+ +GNR
Sbjct  114   CATVIMALLSSFLCHSLSIMFITQVNLLINTLAVEACPVTPEYVAKLLKKGLFLSTLGNR  173

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
             LF++++P++LW+ GP LV L    ++PVLY+LDFV    KG++G
Sbjct  174   LFFSSLPLVLWVFGPELVFLSSVALIPVLYSLDFVSGDEKGEVG  217



>emb|CBI20793.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+K YLDVVLVPLG  I +GYH WLWHKVRTQPL+T IG N  GRR WVSA+MKDN+K
Sbjct  1     MEWRKCYLDVVLVPLGLFITMGYHVWLWHKVRTQPLSTFIGMNVNGRRFWVSAMMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KNILAVQTLRN IMGSTLMATTSILLC GLAAVISSTYSVKKPLND +YGAHGEFM+A+K
Sbjct  61    KNILAVQTLRNAIMGSTLMATTSILLCCGLAAVISSTYSVKKPLNDTIYGAHGEFMMAVK  120



>ref|XP_004171511.1| PREDICTED: uncharacterized LOC101209677, partial [Cucumis sativus]
Length=186

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  865  DNEKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFM  686
            D +KKNILAVQTLRN IMGSTLMATTSIL+  GLAA++SSTYS+KKPLND+V+GAHGEFM
Sbjct  1    DIDKKNILAVQTLRNAIMGSTLMATTSILISCGLAAILSSTYSIKKPLNDSVFGAHGEFM  60

Query  685  VALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNA  506
            ++LKYV++L IFLFSF+ HSLSIRF NQVN LIN P + +  V P Y+ EL EK   LN 
Sbjct  61   LSLKYVSILTIFLFSFLCHSLSIRFINQVNVLINTPQEPMSPVTPKYLSELFEKGCILNT  120

Query  505  VGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
            VGNRLFY A+P+LLWI GPVLV LCY +++P+LYNLDFV
Sbjct  121  VGNRLFYTAVPLLLWIFGPVLVFLCYLSLLPLLYNLDFV  159



>ref|XP_002990864.1| hypothetical protein SELMODRAFT_272166 [Selaginella moellendorffii]
 gb|EFJ08137.1| hypothetical protein SELMODRAFT_272166 [Selaginella moellendorffii]
Length=227

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+ Y DV+LVP G L+ L YH + ++KVR  PL T++G N  GR  WV +IMKDN+KKN
Sbjct  5     WKQLYFDVLLVPAGLLLLLAYHVFYFYKVRRHPLKTVVGVNHLGRTAWVHSIMKDNDKKN  64

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLND-----AVYGAHGEFMV  683
             ILAVQTLRN IM STLMA+T+ILL SGLAA +SS+YSVK+PL+       V GAH +  +
Sbjct  65    ILAVQTLRNSIMASTLMASTAILLSSGLAAFLSSSYSVKRPLHGFSSTVTVLGAHDDITI  124

Query  682   ALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAV  503
             A K+V LL  FLFSF+ +  S+RFTN V FLIN P      + PDYV  +L +      V
Sbjct  125   ATKFVALLACFLFSFICYMQSVRFTNHVGFLINTPVTGDSKITPDYVAAVLARGSNFYTV  184

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             G R +Y A P+LLW+ GP+ V++    +VP LY LD V
Sbjct  185   GTRGYYFAFPLLLWLFGPIPVVVACLVLVPFLYRLDLV  222



>ref|XP_002974327.1| hypothetical protein SELMODRAFT_228264 [Selaginella moellendorffii]
 gb|EFJ24549.1| hypothetical protein SELMODRAFT_228264 [Selaginella moellendorffii]
Length=227

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 148/218 (68%), Gaps = 5/218 (2%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+ Y DV+LVP G L+ L YH + ++KVR  PL T++G N  GR  WV +IMKDN+KKN
Sbjct  5     WKQLYFDVLLVPAGLLLLLAYHVFYFYKVRRHPLKTVVGVNHLGRTAWVHSIMKDNDKKN  64

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLND-----AVYGAHGEFMV  683
             ILAVQTLRN IM STLMA+T+ILL SGLAA +SS+YSVK+PL+       V GAH +  +
Sbjct  65    ILAVQTLRNSIMASTLMASTAILLSSGLAAFLSSSYSVKRPLHGFSSTVTVLGAHDDITI  124

Query  682   ALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAV  503
             A K+V LL  FLFSF+ +  S+RFTN V FLIN P  +   + PDYV  +L +      V
Sbjct  125   ATKFVALLACFLFSFICYMQSVRFTNHVGFLINTPVTSDSKITPDYVAAVLARGSNFYTV  184

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             G R +Y A P+LLW+ GP+ V++    +VP LY LD V
Sbjct  185   GTRGYYFAFPLLLWLFGPIPVVVACLLLVPFLYRLDLV  222



>gb|KCW82593.1| hypothetical protein EUGRSUZ_C03984 [Eucalyptus grandis]
Length=174

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 130/162 (80%), Gaps = 4/162 (2%)
 Frame = -2

Query  820  MIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLIIFLFS  641
            MIMGSTLMATTSILL +GLAAVISSTYSVKKPLNDAVYGAHG+F VALKYVTLL +FLFS
Sbjct  1    MIMGSTLMATTSILLSTGLAAVISSTYSVKKPLNDAVYGAHGDFTVALKYVTLLTLFLFS  60

Query  640  FVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAIPMLLW  461
            F+ HSLSI F +QVN LINCP D+ G V P+YV+ELLEK F LN +GNRLFYA +P+LLW
Sbjct  61   FLCHSLSICFISQVNILINCPQDSDGAVLPEYVMELLEKGFVLNTIGNRLFYAGLPLLLW  120

Query  460  IVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGN  335
            I GPVLV L   T+VP+LYNLDFVF     K  H     IGN
Sbjct  121  IFGPVLVFLFSLTLVPILYNLDFVFL----KSDHSKPKSIGN  158



>tpg|DAA62101.1| TPA: hypothetical protein ZEAMMB73_796660 [Zea mays]
Length=202

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 139/215 (65%), Gaps = 41/215 (19%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD+ L+PL  L+ + YHAWLW +VR +PL T +G NAA RRLW   +MKDN K
Sbjct  1     MEWRDSFLDLALIPLSLLLPMAYHAWLWREVRLRPLRTAVGINAATRRLWAIGMMKDNAK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +  VQ++RN+IMGSTLMATT+IL C+G+AAV+SSTY++KKPL+D V+GAHGE+M+ALK
Sbjct  61    NAVTVVQSVRNVIMGSTLMATTAILFCTGVAAVLSSTYTIKKPLSDTVFGAHGEYMMALK  120

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
                                                      DY+ ++LE+ F LN VGNR
Sbjct  121   -----------------------------------------DYIGDVLERGFTLNLVGNR  139

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             LFYA +P+LLWI GP+L  L    MVP+LY+LD V
Sbjct  140   LFYAGVPLLLWIFGPLLAFLSSMVMVPILYSLDVV  174



>ref|XP_008798193.1| PREDICTED: uncharacterized protein LOC103713147 [Phoenix dactylifera]
Length=233

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 141/224 (63%), Gaps = 7/224 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             ME  + YLD +LV LG L  L YH WLWH VRT+P  T IG NA G R+WV A+ KDN+K
Sbjct  1     MEGSRLYLDFILVALGLLSSLLYHFWLWHAVRTRPRRTNIGVNAGGPRVWVIAMTKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             KN+LAVQTLRN  M STLMATTSI LC  L A  S+ Y  +K         H +  VA K
Sbjct  61    KNVLAVQTLRNHNMASTLMATTSIFLCCSLLAFTSNIYKSQKR-------RHSDLEVASK  113

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
                +++  L S +   LSI F +QVN LIN        V P+YV ELLEK   L+ +GNR
Sbjct  114   CAIVILALLSSLLCQCLSIMFISQVNLLINTLAVEACSVSPEYVAELLEKGLFLSTLGNR  173

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
             LF++A+P++LW+ GP LV L    ++PVLYN DFV    KG++G
Sbjct  174   LFFSALPLVLWVFGPELVFLSSVALIPVLYNFDFVSGDEKGEVG  217



>ref|XP_001755789.1| predicted protein [Physcomitrella patens]
 gb|EDQ79462.1| predicted protein [Physcomitrella patens]
Length=212

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 136/216 (63%), Gaps = 7/216 (3%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M+ +   LD +LVPLG LI L Y   L  KVR  PL T IG N   RR WV ++MKDN+K
Sbjct  1     MDTRDGVLDAILVPLGLLIILAYQVRLVWKVRCAPLLTAIGVNHLARRHWVESVMKDNDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTY-SVKKPLNDAVYGAHGEFMVAL  677
             KNILAVQ+LRN IMGSTLMA+T+IL+CS  A  +SS Y + K+PL    YG     ++  
Sbjct  61    KNILAVQSLRNTIMGSTLMASTAILMCSATAVFMSSAYFNTKEPL----YGGVSPKLLNF  116

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVR--PDYVVELLEKSFALNAV  503
             K+++L+  FLFSF+++  S+R+ N VNFL+N P      +R  P YV ++L K       
Sbjct  117   KFLSLMACFLFSFLAYMQSVRYVNHVNFLVNVPLQEAMAIRISPQYVSDVLAKGCNFYTA  176

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             G R FY A P++LW+  P+ V      +VPV+YNLD
Sbjct  177   GTRGFYVAFPLMLWLFSPIAVFCGCILLVPVMYNLD  212



>ref|XP_006357030.1| PREDICTED: uncharacterized protein LOC102602304 [Solanum tuberosum]
Length=100

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -2

Query  982  LICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQTLRNMIMGST  803
            +I L YH WLWHKV+TQPL+TIIGTNA GRRLWVSAI+KDNEKKNILAVQT RN IMGST
Sbjct  1    MISLTYHIWLWHKVKTQPLSTIIGTNANGRRLWVSAIIKDNEKKNILAVQTFRNTIMGST  60

Query  802  LMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHG  695
            LMATTSILLCSGLAAVISSTYSVKKPLNDAVYG HG
Sbjct  61   LMATTSILLCSGLAAVISSTYSVKKPLNDAVYGGHG  96



>ref|XP_010456681.1| PREDICTED: uncharacterized protein LOC104738156 [Camelina sativa]
Length=224

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 139/203 (68%), Gaps = 17/203 (8%)
 Frame = -2

Query  925  TTIIGTNAAGRRLWVSAIMKD-----------NEKKNILAVQTLRNMIMGSTLMATTSIL  779
            +T I TN   +   +  I KD           N+K NIL VQTLRN+IMG+TLMATT +L
Sbjct  3    STDISTNEVRKIFIIGEINKDFIIVYFLTFQENQKMNILTVQTLRNIIMGATLMATTCVL  62

Query  778  LCSGLAAVISSTYSVKKPLNDAVY-GAHGEFMVALKYVTLLIIFLFSFVSHSLSIRFTNQ  602
            LC+GLAAV+SSTYS+KKPLNDAV+ GAHG+F++++KY+T+L IF+FSF  HSLSIRF NQ
Sbjct  63   LCAGLAAVLSSTYSIKKPLNDAVFLGAHGDFVISIKYLTILTIFIFSFFFHSLSIRFLNQ  122

Query  601  VNFLINCP---PDNLGV--VRPDYVVELLEKSFALNAVGNRLFYAAIPMLLWIVGPVLVI  437
            V  L+N P   P+  G   +  ++V E+ EK   LN VGNRLFYA   ++LWI GP+LV 
Sbjct  123  VAILVNIPNLDPNLSGCLFLTSEHVSEMFEKGIFLNTVGNRLFYAGFSLMLWIFGPILVF  182

Query  436  LCYATMVPVLYNLDFVFTPPKGK  368
            L    MV VLYNLDFV    K +
Sbjct  183  LSVLGMVLVLYNLDFVSANDKKE  205



>ref|XP_002974496.1| hypothetical protein SELMODRAFT_101278 [Selaginella moellendorffii]
 gb|EFJ24718.1| hypothetical protein SELMODRAFT_101278 [Selaginella moellendorffii]
Length=236

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 134/215 (62%), Gaps = 7/215 (3%)
 Frame = -2

Query  1009  DVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQT  830
             D+ LVPLGF     YH +  +  +TQPL T+IG N  GRR WV ++M D EKK++LAVQ+
Sbjct  6     DLWLVPLGFATLATYHGYFLYIYKTQPLLTVIGANHVGRRAWVRSMMADVEKKSVLAVQS  65

Query  829   LRNMIMGSTLMATTSILLCSGLAAVISSTYS--VKKPLNDAVYGA---HGEFMVALKYVT  665
             LRN +MGS L A+ +ILLCSG  A I+++YS  ++KP+ ++  G      E  +++K   
Sbjct  66    LRNSMMGSILWASVAILLCSGSVAFINTSYSYGLRKPVFESFGGGKTKQDETTMSIKVTL  125

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--GVVRPDYVVELLEKSFALNAVGNRL  491
             LL  F+  F     S+RF NQV+F IN P D +    V P+YV  L EK+    A G+R 
Sbjct  126   LLGCFMVCFFCCMQSVRFLNQVSFFINTPGDEILSKFVTPEYVASLFEKACNFQAAGSRS  185

Query  490   FYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             FY  IP+LLWI+GPV + +    ++P LY+LD  F
Sbjct  186   FYFTIPLLLWILGPVPLAMACFVIIPFLYHLDMNF  220



>ref|XP_004974852.1| PREDICTED: uncharacterized protein LOC101781536 [Setaria italica]
Length=235

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 135/215 (63%), Gaps = 17/215 (8%)
 Frame = -2

Query  1033  MEWKKSYL-DVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE  857
             M W++SY+ DVVL+PL  L  + YH WLW  VR +PL TI+G NAA  RLWV A+ KD+E
Sbjct  1     MAWRESYMVDVVLIPLVLLFPVAYHLWLWRAVRHRPLRTIVGINAATCRLWVFAMAKDSE  60

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVIS-STYSVKKPLNDAVYGAHGEFMVA  680
             +  ++ V +LRN+I+ STL AT ++LLC+G+AA++S S+Y+                  A
Sbjct  61    ENALVVVHSLRNVIVDSTLAATAAVLLCTGVAAMLSCSSYAAVD---------------A  105

Query  679   LKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVG  500
             LK    L++FL + V H+L++   NQ  FL+N        V  DYVV +LE+   L+  G
Sbjct  106   LKCAAFLVVFLLACVCHTLAVCSLNQAVFLVNGYSTPSFPVSRDYVVGVLERGLLLHLAG  165

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             NR+FYA +P+LLW  GPVL  L    MVP+LYN+D
Sbjct  166   NRVFYAGVPLLLWTFGPVLACLSSLGMVPILYNID  200



>ref|XP_008347645.1| PREDICTED: uncharacterized protein LOC103410755 [Malus domestica]
Length=132

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 102/157 (65%), Gaps = 31/157 (20%)
 Frame = -2

Query  814  MGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLIIFLFSFV  635
            MGSTLMATTSILLCSGLAAVISSTYSVKKPLND VYGAHGEFMVAL              
Sbjct  1    MGSTLMATTSILLCSGLAAVISSTYSVKKPLNDTVYGAHGEFMVALN-------------  47

Query  634  SHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAIPMLLWIV  455
                              P D + +V P+YV ELLEK + LN  GNRLFYAA+P++LWI 
Sbjct  48   ------------------PQDPMSLVTPEYVSELLEKGYLLNTAGNRLFYAALPLVLWIF  89

Query  454  GPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
            GPVLV LC  TMVPVLYNLDFVF+    K   D  +E
Sbjct  90   GPVLVFLCSVTMVPVLYNLDFVFSSSTEKRKMDIGNE  126



>ref|XP_002990803.1| hypothetical protein SELMODRAFT_132501 [Selaginella moellendorffii]
 gb|EFJ08076.1| hypothetical protein SELMODRAFT_132501 [Selaginella moellendorffii]
Length=219

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 132/212 (62%), Gaps = 7/212 (3%)
 Frame = -2

Query  1009  DVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAVQT  830
             D+ LVPLGF     YH +  +  +TQPL T+IG N  GRR WV ++M D EKK +LAVQ+
Sbjct  6     DLWLVPLGFATLATYHGYFLYIYKTQPLLTVIGANHVGRRAWVRSMMADVEKKGVLAVQS  65

Query  829   LRNMIMGSTLMATTSILLCSGLAAVISSTYS--VKKPLNDAVYGA---HGEFMVALKYVT  665
             LRN +MGS L A+ +ILLCSG  A I+++YS  ++KP+ ++  G      E  +++K   
Sbjct  66    LRNSMMGSILWASVAILLCSGSVAFINTSYSYGIRKPVFESFGGGKTKQDETTMSIKVTL  125

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL--GVVRPDYVVELLEKSFALNAVGNRL  491
             LL  F+  F     S+RF NQV+F IN P + +    V P+YV  L EK+    A G+R 
Sbjct  126   LLGCFMVCFFCCMQSVRFLNQVSFFINTPGEEILSKFVTPEYVASLFEKACNFQAAGSRS  185

Query  490   FYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             FY  IP++LWI+GPV + +    ++P LY+LD
Sbjct  186   FYFTIPLILWILGPVPLAMACFVIIPFLYHLD  217



>ref|XP_010470867.1| PREDICTED: uncharacterized protein LOC104750726, partial [Camelina 
sativa]
Length=121

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWKK YLD +LVPL  +I L YH +L   VRT P +T++G N+ GRR+W+ +++K+N+K
Sbjct  1     MEWKKWYLDAILVPLALVIMLCYHIYLCFMVRTHPFSTLLGINSRGRRIWICSMIKENQK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVY-GAHGEFMVAL  677
              NILAVQTLRN+IMG+TLMATT +LLC+GLAAV+SSTYS+KKPLNDAV+ GAHG+F++++
Sbjct  61    MNILAVQTLRNIIMGATLMATTCVLLCAGLAAVLSSTYSIKKPLNDAVFLGAHGDFVISI  120

Query  676   K  674
             K
Sbjct  121   K  121



>ref|XP_001781319.1| predicted protein [Physcomitrella patens]
 gb|EDQ53847.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 136/215 (63%), Gaps = 2/215 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M W+  +LD+VLVPLG L+   YHA+LW+ V+  P  T+IG N   R+ WV  IM D+EK
Sbjct  1     MAWESRFLDMVLVPLGILLLAVYHAYLWYMVKFNPEKTVIGVNHLNRQSWVRNIMSDSEK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTY-SVKKPLNDAVYGAHGEFMVAL  677
               +LAVQTLRN IM STL+A+T+I L S + A++SST     + L   VYG  G     L
Sbjct  61    NGVLAVQTLRNSIMASTLLASTAITLSSIIGALVSSTSGGTSRTLTHFVYGETGNITSTL  120

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCP-PDNLGVVRPDYVVELLEKSFALNAVG  500
             KY+ LL+ FLFSFV H  SIR+ +  +FL++ P  DN   + P+YV E + +S     +G
Sbjct  121   KYLCLLLCFLFSFVCHVQSIRYASHASFLLSIPVGDNSPGLTPEYVNEFIFRSQNFFTLG  180

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              R +Y + P+LLWI GP+ + +C   M+ +L +LD
Sbjct  181   LRGYYFSFPLLLWIFGPIPMFVCSIVMIFLLQSLD  215



>ref|XP_004165029.1| PREDICTED: uncharacterized protein LOC101231759, partial [Cucumis 
sativus]
Length=101

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEWK  YLDV+LVPLG L+   YHAWLW+KV+TQPL T IG NA  RR W+S I++D +K
Sbjct  1     MEWKNYYLDVILVPLGLLLTFVYHAWLWYKVKTQPLATFIGVNATVRRQWISTILEDIDK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVK  731
             KNILAVQTLRNMIMGS+LMATTSILLC+GLAAV+SSTYS+K
Sbjct  61    KNILAVQTLRNMIMGSSLMATTSILLCAGLAAVLSSTYSIK  101



>gb|KDP20231.1| hypothetical protein JCGZ_08879 [Jatropha curcas]
Length=242

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/236 (38%), Positives = 138/236 (58%), Gaps = 9/236 (4%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K +LD  LVPLG  + + YH WL++++   P  TIIG NA  RR WV A+M+D+ K  +
Sbjct  2     EKKFLDYTLVPLGLAVMVAYHIWLFYRILNHPSKTIIGVNAINRRFWVRAMMEDSTKHGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISS-TYSVKKPLNDAVYGAHGEFMVALKYV  668
             LAVQTLRN IM STL+A+T+I+L S +A +++S T S    + +  YG   E  +++K+ 
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSVIAVLMTSGTRSRSAWIFE--YGDTSEMELSIKFF  119

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNA  506
             ++L+ FL +F+ +  SIR+ +  + LIN P   +        +  +YV   + K     +
Sbjct  120   SILVCFLLAFLLNVQSIRYYSHASILINVPFKKMSPNHDHHHLTAEYVARSVNKGSYFWS  179

Query  505   VGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIG  338
             +G R FY + P+ LWI GP+ + LC   +V +LY LD  F        H+ D E+G
Sbjct  180   LGLRAFYFSFPLFLWIFGPIPMFLCCVVLVFLLYFLDVTFECSWAVEHHNEDEEVG  235



>ref|XP_003518289.1| PREDICTED: uncharacterized protein LOC100790696 [Glycine max]
 gb|KHN46193.1| hypothetical protein glysoja_039917 [Glycine soja]
Length=251

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 142/252 (56%), Gaps = 24/252 (10%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD++LVP GFL+ L YH WL H+V  QP  T+IG NA  RR WV A+M+D  K  I
Sbjct  2     EKKVLDLILVPSGFLVLLAYHFWLLHQVMKQPTKTVIGVNAINRRFWVQAMMEDASKNGI  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQ+LRN IM STL+A+T+I+L S L AV+ S+ + +K +   V+G   E  +++K+ +
Sbjct  62    LAVQSLRNNIMASTLLASTAIML-SSLIAVLMSSGNERKTVVSEVFGDRTELGLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +       ++  +YV   + +     ++
Sbjct  121   ILVCFLLAFLLNVQSIRYYSHASILINVPFKKVSPNLRHQMLTAEYVANTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG-------------  362
             G R FY + P+ +W+ GP+ V      +V +LY LD  F   +G  G             
Sbjct  181   GLRAFYFSFPLFMWLFGPIPVFFSCFALVFMLYFLDVTF--ERGCAGVSDTDDSVQVVEL  238

Query  361   --HDYDHEIGNG  332
               H+ D EIG  
Sbjct  239   NKHNVDVEIGKA  250



>gb|KEH26652.1| plant/F12B17-70 protein [Medicago truncatula]
Length=160

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  814  MGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLIIFLFSFV  635
            MG+ LM+TTSILLC+GL A+ISSTYSVKKP+ ++V+GAHG+F+V LKY  +L +  FSFV
Sbjct  1    MGTNLMSTTSILLCAGLGAIISSTYSVKKPIKESVFGAHGDFVVVLKYAIVLTMLSFSFV  60

Query  634  SHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAIPMLLWIV  455
              +LS  F NQVN LI  P +   +V P+Y+ + L K+  LN +GNRLFY AI + LWI 
Sbjct  61   CLTLSTAFINQVNMLICIPQNVKSMVTPEYLTQHLGKAMLLNIIGNRLFYTAITLQLWIF  120

Query  454  GPVLVILCYATMVPVLYNLDFV  389
            GP+L  L    MV +LYNLD+V
Sbjct  121  GPLLPFLSSMLMVCILYNLDYV  142



>ref|XP_006661388.1| PREDICTED: uncharacterized protein LOC102709310 [Oryza brachyantha]
Length=213

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 130/232 (56%), Gaps = 57/232 (25%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             MEW+ S+LD++L+PL  L+ + YH WLW  VR  PL T  G N                 
Sbjct  1     MEWRDSFLDLILIPLSLLVPMAYHVWLWRAVRLSPLRTDAGAN-----------------  43

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
                                        +G+AAV+SSTY++KKPL+DAV+GAHGE+M+ALK
Sbjct  44    ---------------------------TGIAAVLSSTYTIKKPLSDAVFGAHGEYMMALK  76

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDN------------LGVVRP-DYVVEL  533
             YV LL++FL +F+ HSL+I F N+ +FL+N                 LG+    DY+ E+
Sbjct  77    YVALLLVFLVAFLCHSLAICFLNEASFLVNTSSTLLPSSSSDEGRRLLGLPSTMDYIDEV  136

Query  532   LEKSFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPP  377
             LE+ F L+  GNR+F+A +P+LLWI GP+L  L    M+P+LYNLD V   P
Sbjct  137   LERGFTLSFAGNRIFFAGVPLLLWIFGPLLAFLSSLVMIPILYNLDVVNPKP  188



>ref|XP_010275273.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275274.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275275.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275276.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275277.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275278.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
 ref|XP_010275279.1| PREDICTED: uncharacterized protein LOC104610391 [Nelumbo nucifera]
Length=237

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 137/236 (58%), Gaps = 9/236 (4%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             KK  LD  LVP G L+ + YH WL +++   P  T+IG NA  RR+WV  +M+D  K  +
Sbjct  2     KKQVLDYFLVPSGLLLMVAYHIWLLYRILKHPTKTVIGINAINRRIWVRTMMEDMSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A ++S+  S  +P +  VYG   +   ++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSLIAVLMSN--SNAQP-SGFVYGDKSQLGFSIKFFS  118

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCP----PDNLGVVRPDYVVELLEKSFALNAVGN  497
             +L+ FL +F+ +  SIR+ +  + LIN P    P     +  +YV   + +     ++G 
Sbjct  119   ILVCFLVAFLLNVQSIRYYSHASILINVPIKKIPSTSAHLMTEYVGRAMNRGSYFWSLGL  178

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV--FTPPKGKLGHDYDHEIGN  335
             R FY + P+ LWI GP+ + LC  ++V +LY LD    F   KG +  D D E G 
Sbjct  179   RAFYFSFPLFLWIFGPIPMFLCCLSLVFLLYFLDITLEFGLAKGSVDDDKDEEEGR  234



>ref|XP_006493847.1| PREDICTED: uncharacterized protein LOC102606846 [Citrus sinensis]
Length=263

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/250 (35%), Positives = 138/250 (55%), Gaps = 13/250 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD +LVP G LI   YH WL +++   P  T+IG NA  RR WV A+M+D  K  +
Sbjct  3     EQQLLDYILVPFGLLIMAAYHVWLLYRIVKHPTKTVIGVNAINRRFWVQAMMEDASKNGV  62

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A +++S+   +       +G   +F  ++K+  
Sbjct  63    LAVQTLRNNIMASTLLASTAIMLSSLIAILMTSSDGDRSTW--FTFGDRSDFFYSIKFFF  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +    LIN P   +        +  ++V   + +     +V
Sbjct  121   ILVCFLVAFLLNVQSIRYYSHAGILINVPFKKMSENVHHHQLTAEFVARTVNRGSYFWSV  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKG-----KLGHDYDHEIG  338
             G R FY + P+ LWI GP+ + LC   +V +LY LD  FT   G        H+ D E+G
Sbjct  181   GLRAFYFSFPLFLWIFGPIPMFLCCVVLVFLLYFLDVTFTFQFGLGVGVSKDHNQDEELG  240

Query  337   NGVLEV*LIW  308
                +++  +W
Sbjct  241   RSAVDLGSVW  250



>gb|KDO39058.1| hypothetical protein CISIN_1g024720mg [Citrus sinensis]
Length=263

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 138/250 (55%), Gaps = 13/250 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD +LVP G LI   YH WL +++   P  T+IG NA  RR WV A+M+D  K  +
Sbjct  3     EQQLLDYILVPFGLLIMAAYHVWLLYRIVKHPTKTVIGVNAINRRFWVQAMMEDASKNGV  62

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A +++S+   +       +G   +F  ++K+  
Sbjct  63    LAVQTLRNNIMASTLLASTAIMLSSLIAILMTSSDGDRSTW--FTFGDRSDFFYSIKFFF  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +    LIN P   +        +  ++V   + +     ++
Sbjct  121   ILVCFLVAFLLNVQSIRYYSHAGILINVPFKKMSENVHHHQLTAEFVARTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKG-----KLGHDYDHEIG  338
             G R FY + P+ LWI GP+ + LC   +V +LY LD  FT   G        H+ D E+G
Sbjct  181   GLRAFYFSFPLFLWIFGPIPMFLCCVVLVFLLYFLDVTFTFQFGLGVGVSKDHNQDEELG  240

Query  337   NGVLEV*LIW  308
                +++  +W
Sbjct  241   RSAVDLGSVW  250



>gb|KHN40019.1| hypothetical protein glysoja_009396 [Glycine soja]
Length=250

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 133/219 (61%), Gaps = 7/219 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD++LVP GFL+ L YH WL H++   P  T+IG NA  RRLWV A+M+D  K  +
Sbjct  2     EKKVLDLILVPSGFLVMLAYHFWLLHQIMKHPTKTVIGVNAINRRLWVQAMMEDVSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQ+LRN IM STL+A+T+I+L S L AV+ S+ + +K +   V+G   E  +++K+ +
Sbjct  62    LAVQSLRNNIMASTLLASTAIML-SSLIAVLMSSGNERKTVVYEVFGDRSELGLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +       ++  +YV   + +     ++
Sbjct  121   ILVCFLLAFLLNVQSIRYYSHASILINVPFKKVSPNLRHQMLTAEYVANTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             G R FY + P+ +W+ GP+ V      +V +LY LD  F
Sbjct  181   GLRAFYFSFPLFMWLFGPIPVFFSCVALVFMLYFLDVTF  219



>ref|XP_006428045.1| hypothetical protein CICLE_v10027188mg, partial [Citrus clementina]
 gb|ESR41285.1| hypothetical protein CICLE_v10027188mg, partial [Citrus clementina]
Length=240

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/241 (37%), Positives = 135/241 (56%), Gaps = 15/241 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD +LVP G LI   YH WL +++   P  T+IG NA  RR WV A+M+D  K  +
Sbjct  3     EQQLLDYILVPFGLLIMAAYHVWLLYRIVKHPTKTVIGVNAINRRFWVQAMMEDASKNGV  62

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A +++S+   +       +G   +F  ++K+  
Sbjct  63    LAVQTLRNNIMASTLLASTAIMLSSLIAILMTSSDGDRSTW--FTFGDRSDFFYSIKFFF  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +    LIN P   +        +  ++V   + +     +V
Sbjct  121   ILVCFLVAFLLNVQSIRYYSHAGILINVPFKKMSENVHHHQLTAEFVARTVNRGSYFWSV  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG------HDYDHEI  341
             G R FY + P+ LWI GP+ + LC   +V +LY LD  FT   G LG      H+ D E+
Sbjct  181   GLRAFYFSFPLFLWIFGPIPMFLCCVVLVFLLYFLDVTFTFQFG-LGVGVSKDHNQDEEL  239

Query  340   G  338
             G
Sbjct  240   G  240



>gb|EPS67214.1| hypothetical protein M569_07560 [Genlisea aurea]
Length=277

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 130/212 (61%), Gaps = 2/212 (1%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
              K  LD  LVPLG LI L YHAWL  ++  +P TT++G NA  RRLWV A+M+D  K  +
Sbjct  48    DKEILDYTLVPLGILILLIYHAWLLRQIIRRPTTTVVGINAINRRLWVRAMMEDTSKNGV  107

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDA-VYGAHGEFMVALKYV  668
             LAVQTLRN IM STL+A+T+I+L S +AA++SS+ S         V G++ +    +K  
Sbjct  108   LAVQTLRNSIMASTLLASTAIMLSSAIAALMSSSSSNGGFCPAVLVAGSNTKLTCTIKLF  167

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
             ++L+ FL +F  +  SIR+ +  + LIN  P +L   R ++V  ++ +     ++G R F
Sbjct  168   SILVCFLLAFFLNVQSIRYLSHASMLINV-PSSLSKGRMEFVWRVVNRGSYFWSLGLRAF  226

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLDF  392
             Y + P+ LWI G V + LC   MV +LY LDF
Sbjct  227   YFSFPLFLWIFGAVHLFLCCVLMVFLLYFLDF  258



>ref|XP_006288538.1| hypothetical protein CARUB_v10001810mg [Capsella rubella]
 gb|EOA21436.1| hypothetical protein CARUB_v10001810mg [Capsella rubella]
Length=248

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 135/233 (58%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + L YH WL H++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLGLMLFYHLWLLHRIINRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS L AV+ ++ +V++ +   V G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCS-LIAVLMTSGTVERSVW-LVSGDKSDLAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNSGLMINQDYVAATINRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F   K  +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMKCTVG  232



>ref|XP_006347642.1| PREDICTED: uncharacterized protein LOC102603843 [Solanum tuberosum]
Length=233

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 130/214 (61%), Gaps = 5/214 (2%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVPLG LI + YH WL  ++   P  T+IG N+  RRLWV A M+++ +  +
Sbjct  2     EKEILDYVLVPLGLLIMVAYHLWLLQRILKHPTHTVIGINSINRRLWVLARMEESSQNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S L AV+ +  S  + +   VYG   EF +++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIML-SSLIAVLMTGGSSGRSVGFHVYGDKSEFCLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVR----PDYVVELLEKSFALNAVGN  497
             +L+ F+ +F+ +  SIR+ +  + LIN P   L   R     +YV   + +     ++G 
Sbjct  121   ILVCFMVAFLFNVQSIRYYSHASILINVPYKKLDSSRHCATAEYVGSTVNRGSYFWSLGL  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             R FY + P+ LWI GP+ + LC   +V +LY LD
Sbjct  181   RAFYFSFPLFLWIFGPIPMFLCCIFLVIMLYFLD  214



>gb|KDO62812.1| hypothetical protein CISIN_1g026254mg [Citrus sinensis]
Length=241

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 127/230 (55%), Gaps = 2/230 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             ME KK  LD VL+P G L+   YH WL + +   P  ++IG NA  R  WV +IM D  K
Sbjct  1     MEEKK--LDYVLIPTGLLVMGVYHIWLLYTILRFPRRSVIGLNAESRHQWVHSIMTDPLK  58

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
                LAVQT+RN IM STL+ATT+I L S +   +SST S     ++ +YG     + ++K
Sbjct  59    NGTLAVQTIRNNIMASTLLATTAITLSSLIGVFVSSTSSSGNTASEIIYGNKTSILSSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y T+L+ FL +F+ +  SIR+ + V+FL+  P         +YV   L +     ++G R
Sbjct  119   YFTILLCFLVAFLCNVQSIRYYDHVSFLVTLPTSKGNTNYIEYVARNLNRGSFFWSLGLR  178

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              FY + P+ LWI GP+ + +C  TM  +LY LD   +  +    H +  E
Sbjct  179   AFYLSFPLFLWIFGPIPMFVCCCTMSFILYFLDTTSSFTRELHSHSFKEE  228



>ref|XP_010549100.1| PREDICTED: uncharacterized protein LOC104820377 [Tarenaya hassleriana]
Length=244

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 128/236 (54%), Gaps = 2/236 (1%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD+VLVPLG +I   YHAWL   V  +P  T+I  NA  RR WV ++M D  K   
Sbjct  3     KEEYLDLVLVPLGLVIMAAYHAWLVSAVFRRPKLTVIALNAESRRQWVFSMMTDPLKNGT  62

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQT+RN IM STL+ATT+I LCS +   +S++   K   +  VYG   + + ++K  T
Sbjct  63    LAVQTIRNNIMASTLLATTAITLCSIIGVFVSNSSGAKSSASSIVYGNKSQVLTSIKNFT  122

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFY  485
             +L+ FL +F+ +  SIR+   V+FL+  P         +YV   L +     +VG R FY
Sbjct  123   ILVCFLVAFLCNVQSIRYYAHVSFLVTVPVSRGKKEHCEYVARNLNRGSYFWSVGLRAFY  182

Query  484   AAIPMLLWIVGPVLVILCYATMVPVLYNLDFV--FTPPKGKLGHDYDHEIGNGVLE  323
              + P+ LW  GP+ + LC   M  VLY LD    FT          D E   G +E
Sbjct  183   ISFPLFLWTFGPIPMFLCCCLMSSVLYFLDTTTSFTRLLHSQSFREDSESMGGEIE  238



>ref|XP_010093541.1| hypothetical protein L484_013974 [Morus notabilis]
 gb|EXB54248.1| hypothetical protein L484_013974 [Morus notabilis]
Length=226

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 0/208 (0%)
 Frame = -2

Query  1015  YLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAV  836
             YLD VL+PL F + +GYH +LWH  + +P  T  G NA  RR W   +   N+KK++L V
Sbjct  6     YLDTVLIPLSFFLTVGYHGYLWHNFKNKPSRTTFGINALKRRAWFLDLKDGNDKKSMLVV  65

Query  835   QTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLI  656
             Q+LRN +M + L A+ SIL+   LA +I++ Y+     +  ++G+    + ALKY ++ +
Sbjct  66    QSLRNTLMATILTASISILVVISLATLINNAYTAAHLFSSPLFGSQSTKIFALKYGSIAV  125

Query  655   IFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
                 SFV  S++I F    NFLIN   +   +   ++   + EK F L  V NRL   + 
Sbjct  126   FSSLSFVFGSMAIAFLIDANFLINSNSEEFSLYNNEHRQTIFEKGFVLALVSNRLLCISF  185

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLDF  392
             P+LLW++GPV V L    +V  LY LDF
Sbjct  186   PLLLWMLGPVPVWLSSLALVWGLYQLDF  213



>gb|EYU45339.1| hypothetical protein MIMGU_mgv1a024797mg [Erythranthe guttata]
Length=243

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 135/220 (61%), Gaps = 11/220 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G ++ +GYH WL  ++  +P TT++G N+  RRLWV A+M+D  K  +
Sbjct  2     EKQILDYVLVPVGLVVMVGYHLWLLRQIIRRPATTVLGINSINRRLWVRAMMEDTSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A ++S   S  +P+ + VYG + +   ++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSVIAVLMSGGTSGHRPIGE-VYGDNSKLGFSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPD-----NLG-----VVRPDYVVELLEKSFA  515
             +++ FL +F+ +  SIR+ +  + LIN P +      +G         +YV   + +   
Sbjct  121   IMVCFLGAFLLNVQSIRYYSHASMLINVPSNIHRRSKMGSKDCVTTAEEYVWMTVNRGSY  180

Query  514   LNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
               ++G R FY + P+ LWI GP+ + +C   MV +LY LD
Sbjct  181   FWSLGLRAFYLSFPLFLWIFGPIPMFVCCVLMVFLLYFLD  220



>ref|XP_008244786.1| PREDICTED: uncharacterized protein LOC103342899 [Prunus mume]
Length=225

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 122/216 (56%), Gaps = 1/216 (0%)
 Frame = -2

Query  1015  YLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAV  836
             YLD +LVPL F + +GYHA+LWH  + +P  T IG N   R  W   +   ++KK +LAV
Sbjct  6     YLDTILVPLSFFLTVGYHAYLWHNFKNKPSHTTIGVNMLKRSAWFLELNGGDDKKGMLAV  65

Query  835   QTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLI  656
             Q+LRN +MGSTL A+ +IL+   LAA I+++YS     + A +G+    + +LKY +  +
Sbjct  66    QSLRNTLMGSTLTASIAILIEVSLAAFINNSYSATHLFSHAFFGSQSTMIFSLKYGSAAL  125

Query  655   IFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
                 SF+  S++I F    NFLIN   D+       ++  + EK F L  V +R+     
Sbjct  126   SLAVSFLCSSMAIGFLIDANFLINASGDH-EFTSSAHIRTIFEKGFILAFVSSRMLCITF  184

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGK  368
              MLLW++GPV V L    +V  LY LDFV    KG 
Sbjct  185   LMLLWMLGPVPVWLSSLALVWGLYGLDFVGKLSKGN  220



>gb|EAY85439.1| hypothetical protein OsI_06822 [Oryza sativa Indica Group]
Length=250

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 140/247 (57%), Gaps = 18/247 (7%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN-  848
             +K  LD VL+PLG  + +GYHAWL  ++R +P TT+IG NA  RR+WV  IM++   K+ 
Sbjct  2     RKEELDYVLIPLGMALMVGYHAWLLLRIRRRPATTVIGVNAINRRIWVRHIMEEASGKHA  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISST-------YSVKKPLNDAVYGAHGEF  689
             +LAVQT+RN IM STL+A+T+I L S +A ++SS             PL   V GA GE 
Sbjct  62    VLAVQTIRNNIMASTLLASTAITLSSLIAILMSSAGGGGGDGLLPGAPL---VVGAAGET  118

Query  688   MVALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP-----DYVVELLEK  524
              +++K+  +L+ FL +F+ +  SIR+ +  + L+N P   +   R      DYV   L +
Sbjct  119   ALSVKFFAILVCFLVAFLLNVQSIRYYSHTSTLVNVPVRLIQRRRRPGLAVDYVTATLNR  178

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
                  ++G R FY + P+ LW+ GP+ +    A MV  LY LD      +    HD+D +
Sbjct  179   GSYFWSLGARAFYFSCPVFLWLFGPIPMFAACAAMVCALYFLDVCDDWEEEH--HDHDEQ  236

Query  343   IGNGVLE  323
              G+G  E
Sbjct  237   DGSGSDE  243



>ref|XP_004307929.1| PREDICTED: uncharacterized protein LOC101292349 [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 133/219 (61%), Gaps = 7/219 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  +D VLVP G L+ +GYH WL ++++TQP +T+IG N   RR WV+A+M+D+ K  +
Sbjct  2     EKRDIDYVLVPAGLLVMVGYHLWLLYRIKTQPNSTVIGINCIIRRFWVAAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S L AV+ ++ +  +  +  V+G       ++KY  
Sbjct  62    LAVQTLRNNIMASTLLASTAIML-SSLIAVLMTSANKDRSASAFVFGDTSPMGYSIKYFA  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +        +  +YV   + +     ++
Sbjct  121   ILVCFLVAFLFNVQSIRYYSHASILINVPFKKMSPHLKHHHLTTEYVANTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             G R FY + P+ LWI GP+ ++ C   +V +LY LD  F
Sbjct  181   GLRAFYFSFPLFLWIFGPLPMLFCCFILVTMLYFLDITF  219



>ref|XP_007209532.1| hypothetical protein PRUPE_ppa010672mg [Prunus persica]
 gb|EMJ10731.1| hypothetical protein PRUPE_ppa010672mg [Prunus persica]
Length=240

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 123/210 (59%), Gaps = 0/210 (0%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD VLVPLG L+   YHAWL   +   P+ T++G NA  RR W  ++M D  K  +
Sbjct  2     EEEQLDYVLVPLGLLVFGTYHAWLLITILRYPIRTVVGLNAQSRRQWALSMMTDPLKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQT+RN IM STL+ATT+I L S +   +S+  + +   +  VYG   EF+ ++KYVT
Sbjct  62    LAVQTIRNNIMASTLLATTAITLSSLIGVFVSTPSNSRSTASRLVYGNKTEFLSSIKYVT  121

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFY  485
             +L+ FL +F+ +  SIR+   V+FL   P         +YVV  L +     ++G R FY
Sbjct  122   ILLCFLVAFILNVQSIRYYAHVSFLATVPTLKSQKDYMEYVVRNLNRGSFFWSLGLRAFY  181

Query  484   AAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              + P+ LWI GP+ + +C   M  VLY LD
Sbjct  182   LSFPLFLWIFGPIPMFVCCCIMSCVLYFLD  211



>ref|XP_007033515.1| Uncharacterized protein TCM_019691 [Theobroma cacao]
 gb|EOY04441.1| Uncharacterized protein TCM_019691 [Theobroma cacao]
Length=227

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 119/209 (57%), Gaps = 1/209 (0%)
 Frame = -2

Query  1015  YLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAV  836
             YLD  L+P    +  GYHA+LW   R +P +T  G +   R+ W   I + ++KK +LAV
Sbjct  6     YLDSFLIPSSLFLTFGYHAYLWQSFRQKPSSTKFGVDKLRRKAWFGDIKQGDDKKGMLAV  65

Query  835   QTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLI  656
             Q+LRN +M + L A+ +IL+   LAA+ ++TY+  +  N  V+G+H   +  LKY +  +
Sbjct  66    QSLRNTLMTTILTASIAILVNLSLAALTNNTYNASRLFNSEVFGSHSARIYPLKYGSASL  125

Query  655   IFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
               L SF+  S+++ +    NFLIN   D      P Y   + E+ FAL  +GNR+   + 
Sbjct  126   FLLVSFLCSSMALGYLIDANFLINASYDEFS-SSPAYTQTIFERGFALAVIGNRVLCISF  184

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             P+LLW+ GP+ V +  A +V  LY LDF 
Sbjct  185   PLLLWMFGPLPVAVSSAALVWALYELDFA  213



>ref|XP_010487735.1| PREDICTED: uncharacterized protein LOC104765678 [Camelina sativa]
Length=244

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G L+ + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEESLDLVLVPTGLLVMVAYHVWLVYAILHRPKLTVISLNAESRRQWVFSMMTEPMKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +LAVQT+RN IM STL+ATT+I LCS +   +S++   K      +YG+    + ++K  
Sbjct  62    VLAVQTIRNNIMASTLLATTAITLCSIIGVFVSNSSDSKSNQTSLIYGSRSPLLASIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++    ++G R F
Sbjct  122   AILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGKREHCEYVSRNLNRASYFWSLGLRSF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWTFGPIPMFVCCCIMSSILYFLD  212



>emb|CDY05405.1| BnaC02g41130D [Brassica napus]
Length=245

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 130/222 (59%), Gaps = 11/222 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD +LVPLG  + + YH WL H++  +P +T++G NA  RRLWV A+M+D  K  +
Sbjct  2     KREYLDYILVPLGMGLMIFYHLWLLHRIIHRPSSTVVGLNAFNRRLWVQAMMEDASKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDQAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV---------RPDYVVELLEKSFAL  512
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V           DYV   + +    
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGHSLMINQDYVAATVNRGSYF  179

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
              ++G R FY + P+ LWI GP+ + +    +V +LY LD  F
Sbjct  180   WSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVSLLYFLDLTF  221



>ref|XP_006394716.1| hypothetical protein EUTSA_v10005694mg [Eutrema salsugineum]
 gb|ESQ32002.1| hypothetical protein EUTSA_v10005694mg [Eutrema salsugineum]
Length=248

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 134/233 (58%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++ YLD +LVPLG  + + YH WL  ++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     EREYLDYILVPLGMGLMVFYHLWLLRRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDRAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGHSHGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ + +    +V +LY LD  F   +G +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVSLLYFLDLTFDSMEGSVG  232



>emb|CDY05449.1| BnaA02g32420D [Brassica napus]
Length=245

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 130/222 (59%), Gaps = 11/222 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD +LVPLG  + + YH WL H++  +P +T++G NA  RRLWV A+M+D  K  +
Sbjct  2     KREYLDYILVPLGMGLMIFYHLWLLHRIIHRPSSTVVGLNAFNRRLWVQAMMEDASKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDQAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV---------RPDYVVELLEKSFAL  512
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V           DYV   + +    
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGHSLMINQDYVAATVNRGSYF  179

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
              ++G R FY + P+ LWI GP+ + +    +V +LY LD  F
Sbjct  180   WSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVSLLYFLDLTF  221



>ref|NP_197848.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB11212.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT41773.1| At5g24600 [Arabidopsis thaliana]
 gb|AAT70465.1| At5g24600 [Arabidopsis thaliana]
 gb|AED93332.1| uncharacterized protein AT5G24600 [Arabidopsis thaliana]
Length=248

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 133/239 (56%), Gaps = 14/239 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLALMVFYHLWLLYRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSATGERSVW--FVFGDKSDRAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F   K  +G     E
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMKCSVGAADAEE  238



>emb|CDX80456.1| BnaC07g29880D [Brassica napus]
Length=249

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 136/233 (58%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K  YLD +LVPLG  + + YH WL H++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KLEYLDYILVPLGMGLMVFYHLWLLHRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDRAFSIKFFS  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCP--------PDNLG----VVRPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P         D  G    ++  DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKKLMAVSSDGHGRGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ +++    +V +LY LD  F      +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMLITCCVLVSLLYFLDLTFDSMDCSVG  232



>gb|KHG14649.1| hypothetical protein F383_20144 [Gossypium arboreum]
Length=246

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/246 (35%), Positives = 138/246 (56%), Gaps = 13/246 (5%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M  +K YLD VLVP+G L+ + YH WL +++   P  T+IG NA  RR WV A+M++  K
Sbjct  1     MTMEKQYLDWVLVPMGILLMVAYHVWLLYRILKHPTKTVIGVNAINRRFWVQAMMEEASK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +LAVQT RN IM STL+A+T+I+L S +A ++++    +      ++G   +   ++K
Sbjct  61    NGVLAVQTFRNNIMASTLLASTAIMLSSLIAVLMTNGKGDRSSW--FIFGDESDLAFSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFAL  512
             + ++L+ FL +F+ +  SIR+ +  + LIN P   +        +  +YV   + +    
Sbjct  119   FFSILVCFLVAFLLNLQSIRYYSHASILINVPVKKMSHHHHHHHLTVEYVANTVNRGSYF  178

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD--FVFTPPKGKL---GHDYDH  347
              ++G R FY + P+ LWI GP  +  C   +V +LY LD  F F    G +   GH+ D 
Sbjct  179   WSLGLRAFYFSFPLFLWIFGPFPMFFCCIALVFMLYFLDVTFQFGWAVGVVNDNGHNGDE  238

Query  346   EIGNGV  329
             E+G  V
Sbjct  239   ELGGSV  244



>gb|KFK27736.1| hypothetical protein AALP_AA8G422500 [Arabis alpina]
Length=246

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 136/231 (59%), Gaps = 12/231 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K  YLD  LVPLG  + L YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KLEYLDYTLVPLGMGLMLFYHLWLLYRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGSGDRSVW--FVFGDKSDRAFSLKFFS  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL----------GVVRPDYVVELLEKSFA  515
             +L+ FL +F+ +  SIR+ +  + LIN P  +L          G++  DYV   + +   
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKHLMAVSSNGKSHGMINQDYVAATVNRGSY  179

Query  514   LNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
               ++G R FY + P+ LWI GP+ + +    +V +LY LD  F   +  +G
Sbjct  180   FWSLGLRAFYFSSPLFLWIFGPIPMFITCCILVFLLYFLDLTFDSMECCVG  230



>ref|XP_010421287.1| PREDICTED: uncharacterized protein LOC104706775 isoform X1 [Camelina 
sativa]
Length=248

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 132/233 (57%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLALMVFYHLWLLYRIINRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDRAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNGGLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F   K  +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMKCTVG  232



>ref|XP_006429595.1| hypothetical protein CICLE_v10012663mg [Citrus clementina]
 ref|XP_006481202.1| PREDICTED: uncharacterized protein LOC102630253 [Citrus sinensis]
 gb|ESR42835.1| hypothetical protein CICLE_v10012663mg [Citrus clementina]
Length=228

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 118/209 (56%), Gaps = 1/209 (0%)
 Frame = -2

Query  1015  YLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAV  836
             YLD VL+ L   + LGYHA LWH  +T+PL T IG +A  R+ W   I + ++KK +LAV
Sbjct  6     YLDSVLISLSLFLMLGYHANLWHSFKTKPLHTSIGIDALRRKFWFQGIKEGDDKKGMLAV  65

Query  835   QTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLLI  656
             Q+LRN +M + L A  +IL+   + A++++ Y      N A++G+    + ALKY +  I
Sbjct  66    QSLRNTLMATILTAQIAILITLAMGALMNNAYKGSHIFNSAIFGSQSGRIFALKYGSASI  125

Query  655   IFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAAI  476
               L SF   S+++ F    NF++N   D+    R  +   + E+ F L  +GNR    + 
Sbjct  126   FLLVSFFCSSVALGFLTDANFMVNACGDDQFSYRA-HTQSIFERGFTLAFIGNRSLCMSF  184

Query  475   PMLLWIVGPVLVILCYATMVPVLYNLDFV  389
             PMLLW+ GP+ V L    +V  LY LDF 
Sbjct  185   PMLLWMFGPLPVALASVALVWGLYELDFA  213



>ref|XP_010454780.1| PREDICTED: uncharacterized protein LOC104736483 [Camelina sativa]
Length=248

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 132/233 (57%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLALMVFYHLWLLYRIINRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDQAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNGGLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F   K  +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMKCTVG  232



>ref|XP_006490702.1| PREDICTED: uncharacterized protein LOC102625973 isoform X1 [Citrus 
sinensis]
Length=241

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 126/230 (55%), Gaps = 2/230 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             ME KK  LD VL+P G L+   YH WL + +   P  ++IG NA  R  WV +IM D  K
Sbjct  1     MEEKK--LDYVLIPTGLLVMGVYHIWLLYTILRFPRRSVIGLNAESRHQWVHSIMTDPLK  58

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
                LAVQT+RN IM STL+ATT+I L S +   +SST S     ++ +YG     + ++K
Sbjct  59    NGTLAVQTIRNNIMASTLLATTAITLSSLIGVFVSSTSSSGNTASEIIYGNKTSILSSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y T+L+ FL +F+ +  SIR+   V+FL+  P         +YV   L +     ++G R
Sbjct  119   YFTILLCFLVAFLCNVQSIRYYAHVSFLVTLPTSKGNTNYIEYVARNLNRGSFFWSLGLR  178

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              FY + P+ LWI GP+ + +C  TM  +LY LD   +  +    H +  E
Sbjct  179   AFYLSFPLFLWIFGPIPMFVCCCTMSFLLYFLDTTSSFTRELHSHSFKEE  228



>ref|XP_009765451.1| PREDICTED: uncharacterized protein LOC104216995 [Nicotiana sylvestris]
Length=224

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 124/209 (59%), Gaps = 2/209 (1%)
 Frame = -2

Query  1018  SYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILA  839
             S+LD +LVPL   I +GYH +LWH+++ +P  T IG N   +R W+  + + NEKK  LA
Sbjct  5     SFLDTILVPLSLFITIGYHFYLWHQLKHKPSRTTIGMNMLKKRSWLRELNQGNEKKGTLA  64

Query  838   VQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLL  659
             VQ+LRN +M + L AT ++++   LAA+ ++TY+V+     A +G+    ++ LKY +  
Sbjct  65    VQSLRNALMETILTATITMIITLALAALTNNTYNVRNLFTSAFFGSQTGKIIVLKYGSTT  124

Query  658   IIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAA  479
             I  L SF+  SL++ +    NFL+N   +    + P Y   L E+ F L  VG+R+   A
Sbjct  125   IFLLASFLCSSLALSYLIDANFLVNALGE--FAINPMYTETLFERGFTLAFVGDRVLCMA  182

Query  478   IPMLLWIVGPVLVILCYATMVPVLYNLDF  392
              P+LLW+ GPV V++    +V  L+  DF
Sbjct  183   FPLLLWMFGPVPVVVSSLALVWGLHERDF  211



>ref|XP_002874211.1| hypothetical protein ARALYDRAFT_910504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50470.1| hypothetical protein ARALYDRAFT_910504 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 133/239 (56%), Gaps = 14/239 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLGLMVFYHLWLLYRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSATGERSVW--FVFGDKSDRAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F   K  +G     E
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMKCSVGAADAEE  238



>ref|XP_007141352.1| hypothetical protein PHAVU_008G188300g [Phaseolus vulgaris]
 gb|ESW13346.1| hypothetical protein PHAVU_008G188300g [Phaseolus vulgaris]
Length=250

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/219 (37%), Positives = 133/219 (61%), Gaps = 7/219 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD++LVP G L+ L YH WL++++   P  T+IG NA  RR WV A+M+D  K  +
Sbjct  2     EKKVLDLILVPSGLLLMLVYHLWLFYRIMKHPTKTVIGVNAINRRFWVQAMMEDVSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQ+LRN IM STL+A+T+I+L S L AV+ S+ + +K +   V+G   +  +++K+ +
Sbjct  62    LAVQSLRNNIMASTLLASTAIMLSS-LIAVLMSSGNERKTVMSEVFGDRSDLGLSVKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +       ++  +YV   + +     ++
Sbjct  121   ILVCFLLAFLLNVQSIRYYSHASILINVPFKKVSQNPRHQMLTAEYVATTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             G R FY + P+ +W+ GP+ V      +V +LY LD +F
Sbjct  181   GLRAFYLSFPLFMWLFGPIPVFFSSLALVSMLYFLDVIF  219



>ref|XP_009150984.1| PREDICTED: uncharacterized protein LOC103874325 [Brassica rapa]
 emb|CDX88116.1| BnaA06g27070D [Brassica napus]
Length=248

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 134/233 (58%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K  YLD +LVPLG  + + YH WL H++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KLEYLDYILVPLGMGLMVFYHLWLLHRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDRAFSIKFFS  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKKLMAVSSGGHGRGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ +++    +V +LY LD  F      +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMLITCCVLVSLLYFLDLTFDSMDCSVG  232



>gb|KHG13650.1| TRP-like ion channel pkd2 [Gossypium arboreum]
Length=247

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 137/245 (56%), Gaps = 17/245 (7%)
 Frame = -2

Query  1036  NMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNE  857
             NME  K YLD +LVP+G L+ + YH WL +++   P  T+IG NA  RR WV A+M+D  
Sbjct  2     NME--KQYLDWILVPMGILLMVSYHLWLLYRILKHPTKTVIGVNAINRRFWVQAMMEDGS  59

Query  856   KKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVAL  677
              K +LAVQ+LRN IM STL+A+T+I+L S +A +++S  S +      ++G   EF  ++
Sbjct  60    -KGVLAVQSLRNNIMASTLLASTAIMLSSLIAILMTSGSSDRSSW--FLFGDRSEFAFSI  116

Query  676   KYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG----VVRPDYVVELLEKSFALN  509
             K+  +L+ F+ +F+ +  SIR+ +  + LIN P   +      +  +YV   + +     
Sbjct  117   KFFAILVCFMVAFLLNLQSIRYYSHASILINVPLKKMAHRHQHLTAEYVANTVNRGSYFW  176

Query  508   AVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF--------TPPKGKLGHDY  353
             ++G R FY + P+ LWI GP+ +      +V +LY LD  F            G  GH  
Sbjct  177   SLGLRAFYFSFPLFLWIFGPLPMFFSCIALVFLLYFLDITFKFGWAVGAVDDNGHNGHSG  236

Query  352   DHEIG  338
             D E+G
Sbjct  237   DEELG  241



>ref|XP_004490535.1| PREDICTED: uncharacterized protein LOC101508613 [Cicer arietinum]
Length=259

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 136/231 (59%), Gaps = 7/231 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD++LVP G  + + YH WL +++   P  T+IG N+  RRLWV A+M+D  K  +
Sbjct  2     EKKILDLILVPSGLFVMVTYHLWLLYQIVKHPTKTVIGVNSINRRLWVQAMMEDVSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQ+LRN IM STL+A+T+I+L S L AV+ S+ + ++ +   V+G   E ++++K+ +
Sbjct  62    LAVQSLRNNIMASTLLASTAIML-SSLIAVLMSSRNEERSVVSVVFGDRSELVLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   L       ++  +YV   + +     ++
Sbjct  121   ILVCFLLAFLLNVQSIRYYSHASILINVPFKKLSPNLRQQMLTAEYVANTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
             G R FY + P+ +WI GP+ +      +V +LY LD  F      +G D D
Sbjct  181   GLRAFYFSFPLFMWIFGPIPMFFSCFALVFMLYFLDVTFECGWVNVGVDED  231



>ref|XP_006451702.1| hypothetical protein CICLE_v10009323mg [Citrus clementina]
 gb|ESR64942.1| hypothetical protein CICLE_v10009323mg [Citrus clementina]
Length=241

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 126/230 (55%), Gaps = 2/230 (1%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             ME KK  LD VL+P G L+   YH WL + +   P  ++IG NA  R  WV +IM D  K
Sbjct  1     MEEKK--LDYVLIPTGLLVMGVYHIWLLYTILRFPRRSVIGLNAESRHQWVHSIMTDPLK  58

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
                LAVQT+RN IM STL+ATT+I L S +   +SST S     ++ +YG     + ++K
Sbjct  59    NGTLAVQTIRNNIMASTLLATTAITLSSLIGVFVSSTSSSGNTASEIIYGNKTSILSSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNR  494
             Y T+L+ FL +F+ +  SIR+   V+FL+  P         +YV   L +     ++G R
Sbjct  119   YFTILLCFLVAFLCNVQSIRYYAHVSFLVTLPTSKGNRNYIEYVARNLNRGSFFWSLGLR  178

Query  493   LFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
              FY + P+ LWI GP+ + +C  TM  +LY LD   +  +    H +  E
Sbjct  179   AFYLSFPLFLWIFGPIPMFVCCCTMSFLLYFLDTTSSFTRELHSHSFKEE  228



>ref|XP_006374071.1| hypothetical protein POPTR_0015s00350g [Populus trichocarpa]
 gb|ERP51868.1| hypothetical protein POPTR_0015s00350g [Populus trichocarpa]
Length=243

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 135/235 (57%), Gaps = 9/235 (4%)
 Frame = -2

Query  1021  KSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNIL  842
             ++ LD  LVPLG +  + YH WL +++   P  T+IG NA  RR WV A+M+D  K  +L
Sbjct  3     RAILDYTLVPLGLVTMVAYHIWLLYRIMKHPTKTVIGINAINRRFWVRAMMEDVSKNGVL  62

Query  841   AVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTL  662
             AVQTLRN IM ST++A+T+I+L S L AV+ ++ S  K   + V+G   E  +++K+ ++
Sbjct  63    AVQTLRNNIMASTVLASTAIMLSS-LIAVLMTSGSGDKSARNFVFGDRSELGLSIKFFSI  121

Query  661   LIIFLFSFVSHSLSIRFTNQVNFLIN------CPPDNLGVVRPDYVVELLEKSFALNAVG  500
             L+ FL +F+ +  SIR+ +  + LIN      CP      +  +YV   + +     ++G
Sbjct  122   LVCFLVAFLLNVQSIRYYSHASILINVPFKKMCPNHRHQHLSTEYVARSVNRGSYFWSLG  181

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGN  335
              R FY + P+ LWI GP+ + L    +V +LY LD   T   G    D D ++G+
Sbjct  182   LRAFYFSFPLFLWIFGPIPMFLSCVFLVSMLYFLD--VTLGTGWADGDEDDDVGH  234



>ref|XP_006596411.1| PREDICTED: uncharacterized protein LOC100806179 [Glycine max]
Length=250

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 140/249 (56%), Gaps = 19/249 (8%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD++LVP GFL+ L YH WL H++   P  T+IG NA  RRLWV A+M+D  K  +
Sbjct  2     EKKVLDLILVPSGFLVMLAYHFWLLHQIMKHPTKTVIGVNAINRRLWVQAMMEDVSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQ+LRN IM STL+A+T+I+L S L AV+ S+ + +K +   V+G   E  +++K+ +
Sbjct  62    LAVQSLRNNIMASTLLASTAIML-SSLIAVLMSSGNERKTVVYEVFGDRSELGLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ F  + + +  SIR+ +  + LIN P   +       ++  +YV   + +     ++
Sbjct  121   ILVCFSLASLLNVQSIRYYSHASILINVPFKKVSPNLRHQMLTAEYVANTVNRGSYFWSL  180

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF-----------TPPKGKLG-H  359
             G R FY + P+ +W+ GP+ V      +V +LY LD  F           +    +L  H
Sbjct  181   GLRAFYFSFPLFMWLFGPIPVFFSCVALVFMLYFLDVTFECGCAGVSDTHSVESAELNKH  240

Query  358   DYDHEIGNG  332
             + D EIG  
Sbjct  241   NVDVEIGKA  249



>ref|XP_009799025.1| PREDICTED: uncharacterized protein LOC104245155 [Nicotiana sylvestris]
Length=233

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 128/214 (60%), Gaps = 5/214 (2%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G L  + YH WL +++   P  T+IG N+  R  WV A+M+D  K  +
Sbjct  2     EKEILDYVLVPVGLLFMVAYHIWLLNRILKHPNRTVIGINSINRHFWVRAMMEDASKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S L AV+ +  S  + +   VYG   E  +++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIML-SSLIAVLMTGGSKGRSIGFHVYGDKSELCLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG----VVRPDYVVELLEKSFALNAVGN  497
             +L+ F+ +F+ +  SIR+ +  + LIN P   L     +V  +YV   + +     ++G 
Sbjct  121   ILVCFMVAFLFNVQSIRYYSHASILINVPYKKLDCSRHIVTAEYVGRTVNRGSYFWSLGL  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             R FY + P+ LWI GP+ + LC   +V +LY LD
Sbjct  181   RAFYFSFPLFLWIFGPIPMFLCCIFLVFMLYFLD  214



>ref|XP_010465905.1| PREDICTED: uncharacterized protein LOC104746186 [Camelina sativa]
Length=244

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 120/211 (57%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G ++ + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEESLDLVLVPAGLVVMVAYHVWLVYAIFHRPKLTVISLNAESRRQWVFSMMTEPMKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +LAVQT+RN IM STL+AT +I LCS +   IS++   K      VYG+    + ++K  
Sbjct  62    VLAVQTIRNNIMASTLLATAAITLCSIIGVFISNSSDSKSKPTSLVYGSRSPLLASIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++    ++G R F
Sbjct  122   AILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGKREHCEYVSRNLNRASYFWSLGLRSF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWTFGPIPMFVCCCIMSSILYFLD  212



>emb|CDY24440.1| BnaC05g35140D [Brassica napus]
Length=244

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 118/211 (56%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G  + + YH WL + +  +P  T I  NA  RRLWV A+M D  K  
Sbjct  2     WKEESLDLVLVPAGLAVMVAYHVWLGYTIIHRPKLTAISLNAESRRLWVFAMMDDPMKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +LAVQT+RN IM ST++ATT+I LCS +   +SS    +   +  +YG     +  +K  
Sbjct  62    VLAVQTIRNNIMASTVLATTAITLCSIIGVFVSSNSPSESTASPMIYGNKSPLLATIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
             ++LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++     +G R F
Sbjct  122   SILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGEKEHCEYVARNLNRALYFWFLGLRAF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWNFGPIPMFVCCCMMSSILYFLD  212



>ref|NP_001046597.1| Os02g0292800 [Oryza sativa Japonica Group]
 dbj|BAD21471.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD21771.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08511.1| Os02g0292800 [Oryza sativa Japonica Group]
 dbj|BAG97887.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 139/247 (56%), Gaps = 18/247 (7%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN-  848
             +K  LD VL+PLG  + +GYHAWL  ++R +P TT+IG NA  RR+WV  IM++   K+ 
Sbjct  2     RKEELDYVLIPLGMALMVGYHAWLLLRIRRRPATTVIGVNAINRRIWVRHIMEEASGKHA  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISST-------YSVKKPLNDAVYGAHGEF  689
             +LAVQT+RN IM STL+A+T+I L S +A ++SS             PL   V GA GE 
Sbjct  62    VLAVQTIRNNIMASTLLASTAITLSSLIAILMSSAGGGGGDGLLPGAPL---VVGAAGET  118

Query  688   MVALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP-----DYVVELLEK  524
              +++K+  +L+ FL +F+ +  SIR+ +  + L+N P   +   R      DYV   L +
Sbjct  119   ALSVKFFAILVCFLVAFLLNVQSIRYYSHTSTLVNVPVRLIQRRRRPGLAVDYVTATLNR  178

Query  523   SFALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHE  344
                  ++G R FY + P+ LW+ GP+ +    A MV  LY LD      +     D+D +
Sbjct  179   GSYFWSLGARAFYFSCPVFLWLFGPIPMFAACAAMVCALYFLDVCDDWEEEH--QDHDEQ  236

Query  343   IGNGVLE  323
              G+G  E
Sbjct  237   DGSGSDE  243



>ref|XP_008370268.1| PREDICTED: uncharacterized protein LOC103433763 [Malus domestica]
 ref|XP_008355737.1| PREDICTED: uncharacterized protein LOC103419410 [Malus domestica]
Length=224

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 119/209 (57%), Gaps = 2/209 (1%)
 Frame = -2

Query  1018  SYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILA  839
             +YLD VLVP+   + +GYHA+LWH ++ +P  T IG N   RR W   +   ++KK +LA
Sbjct  5     AYLDNVLVPMSLFLTVGYHAYLWHNLKNKPSRTTIGINMLKRRAWFLELDGGDDKKGMLA  64

Query  838   VQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLL  659
             VQ+LRN +MG+TL AT +IL+   LAA+I++ YS     ++  +G+    + ALKY +  
Sbjct  65    VQSLRNTLMGTTLTATVAILIQVSLAALINNXYSATXLFSNTFFGSQSTKIFALKYGSAA  124

Query  658   IIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAA  479
             +     F+  S++I F    NFLIN            +   +LEK F L  V NR+    
Sbjct  125   LSLSVCFLCXSMAIAFLIDANFLINACDQEFS--SSGHARTILEKGFILALVSNRMLCIT  182

Query  478   IPMLLWIVGPVLVILCYATMVPVLYNLDF  392
              PMLLW++GPV V L    MV  LY LDF
Sbjct  183   FPMLLWMLGPVPVWLSSLAMVWGLYGLDF  211



>ref|XP_010506551.1| PREDICTED: uncharacterized protein LOC104783145 [Camelina sativa]
Length=244

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 119/211 (56%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G L+ + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEESLDLVLVPTGLLVMVAYHVWLVYAILHRPKLTVISLNAESRRQWVFSMMTEPLKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
              LAVQT+RN IM STL+AT +I LCS +   IS++   K      VYG+    + ++K  
Sbjct  62    TLAVQTIRNNIMASTLLATAAITLCSIIGVFISNSSDSKSKPTSLVYGSRSPLLASIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++    ++G R F
Sbjct  122   AILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGKREHCEYVSRNLNRASYFWSLGLRSF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWTFGPIPMFVCCCIMSSILYFLD  212



>gb|KHG14650.1| TRP-like ion channel pkd2 [Gossypium arboreum]
Length=255

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 138/241 (57%), Gaps = 10/241 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M  +K YLD VLVP+G L+ + YH WL +++   P  T+IG NA  RR WV A+M+D   
Sbjct  1     MSMEKQYLDSVLVPMGILLMVAYHLWLLYRILKHPTKTVIGINAINRRFWVQAMMEDGS-  59

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
             K +LAVQ+LRN IM STL+A+T+I+L S +A +++   S        V+G   + + ++K
Sbjct  60    KGVLAVQSLRNNIMASTLLASTAIMLSSLIAILMTGGSSASDRSFWFVFGDKSDLVYSIK  119

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP----DYVVELLEKSFALNA  506
             + ++L+ FL +F+ +  SIR+ +  + LIN P + +         +YV   + +     +
Sbjct  120   FFSILVCFLVAFLLNLQSIRYYSHASILINVPLNKMSHRHQHLTLEYVANTVNRGSYFWS  179

Query  505   VGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD--FVFTPPKGKL---GHDYDHEI  341
             +G R FY + P+ LWI GP+ +      +V +LY LD  F F    G +   GH+ D E+
Sbjct  180   LGLRAFYFSFPLFLWIFGPLPMFFSCMALVFMLYFLDVTFQFGWAIGAVDDNGHNEDEEV  239

Query  340   G  338
             G
Sbjct  240   G  240



>ref|XP_010941112.1| PREDICTED: uncharacterized protein LOC105059497 [Elaeis guineensis]
Length=241

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 130/215 (60%), Gaps = 5/215 (2%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD+VLVP+G  + + YH WL ++V   P TT+IG NA  RR+WV  +M+D  K  +
Sbjct  2     RKEELDLVLVPVGLTVMVSYHLWLLYRVIKHPTTTVIGINAINRRIWVHTMMEDPLKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPL--NDAVYGAHGEFMVALKY  671
             LAVQTLRN IM STL+A+ +I LCS +A +++++    + L   D V G   + ++++K+
Sbjct  62    LAVQTLRNNIMASTLLASMAITLCSLMAVLMTNSNGGYRGLRGKDFVLGDTSDLVLSIKF  121

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP---DYVVELLEKSFALNAVG  500
              ++LI FL +F+ +  SIR+ +    LIN P  +     P   +YV   L +     ++G
Sbjct  122   FSILICFLLAFLLNVQSIRYYSHAGLLINVPARSQRAAPPLAAEYVAGALNRGSYFWSLG  181

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              R FY + PM LWI GPV +++    +V +LY LD
Sbjct  182   LRAFYFSFPMFLWIFGPVPMLVSCLGLVLMLYFLD  216



>ref|XP_009629932.1| PREDICTED: uncharacterized protein LOC104119992 [Nicotiana tomentosiformis]
Length=236

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 129/214 (60%), Gaps = 5/214 (2%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G L  + YH WL +++   P  T+IG N+  R  WV A+M+D+ K  +
Sbjct  2     EKEILDYVLVPVGLLFMVAYHIWLLNRILKHPNRTVIGINSINRHFWVRAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S L AV+ +  S  + +   VYG   +  +++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIML-SSLIAVLMTGGSKGRSIGFHVYGDKSDLCLSIKFFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG----VVRPDYVVELLEKSFALNAVGN  497
             +L+ F+ +F+ +  SIR+ +  + LIN P   L     +V  +YV   + +     ++G 
Sbjct  121   ILVCFMVAFLFNVQSIRYYSHASILINVPYKKLDCSRHIVTAEYVGRTVNRGSYFWSLGL  180

Query  496   RLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             R FY + P+ LWI GP+ + LC   +V +LY LD
Sbjct  181   RAFYFSFPLFLWIFGPIPMFLCCIFLVFMLYFLD  214



>ref|XP_008240216.1| PREDICTED: uncharacterized protein LOC103338750 [Prunus mume]
Length=240

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 122/210 (58%), Gaps = 0/210 (0%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD VLVPLG L+   YHAWL   +   P+ T++G NA  RR W  ++M D  K  +
Sbjct  2     EEEQLDYVLVPLGLLVFGTYHAWLLITILRDPIRTVVGLNAQSRRQWALSMMSDPLKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQT+RN IM STL+ATT+I L S +   +S+  S +   +  VYG   EF+ ++KY+ 
Sbjct  62    LAVQTIRNNIMASTLLATTAITLSSLIGVFVSTPSSSRSTASRLVYGNKTEFLDSIKYIA  121

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFY  485
             +L+ FL +F+ +  SIR+   V+FL   P         +YVV  L +     ++G R FY
Sbjct  122   ILLCFLVAFLLNVQSIRYYAHVSFLATVPTWKSQKDYMEYVVRNLNRGGFFWSLGLRAFY  181

Query  484   AAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              + P+ LWI GP+ + +C   +  VLY LD
Sbjct  182   LSFPLFLWIFGPIPMFVCCCILSCVLYFLD  211



>ref|XP_002321941.2| hypothetical protein POPTR_0015s00360g [Populus trichocarpa]
 gb|EEF06068.2| hypothetical protein POPTR_0015s00360g [Populus trichocarpa]
Length=243

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 132/230 (57%), Gaps = 7/230 (3%)
 Frame = -2

Query  1021  KSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNIL  842
             ++ LD  LVPLG +  + YH WL +++   P  T+IG NA  RR WV A+M+D  K  +L
Sbjct  3     RAILDYTLVPLGLVTMVAYHIWLLYRIMKHPTKTVIGINAINRRFWVRAMMEDVSKNGVL  62

Query  841   AVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTL  662
             AVQTLRN IM ST++A+T+I+L S L AV+ ++ S  K   + V+G   E  +++K+ ++
Sbjct  63    AVQTLRNNIMASTVLASTAIMLSS-LIAVLMTSGSGDKSARNFVFGDRSELGLSIKFFSI  121

Query  661   LIIFLFSFVSHSLSIRFTNQVNFLIN------CPPDNLGVVRPDYVVELLEKSFALNAVG  500
             L+ FL +F+ +  SIR+ +  + LIN      CP      +  +YV   + +     ++G
Sbjct  122   LVCFLVAFLLNVQSIRYYSHASILINVPFKKMCPNHRHQHLSTEYVARSVNRGSYFWSLG  181

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYD  350
              R FY + P+LLWI GP+ ++L    +V +LY LD          G D D
Sbjct  182   LRAFYFSFPLLLWIFGPIPMLLSCFFLVSMLYFLDVTLEIGWAVGGEDDD  231



>ref|XP_007033799.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY04725.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=249

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 137/245 (56%), Gaps = 15/245 (6%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M  +  YLD +LVPLG L  + YH W  H++   P  TIIG NA  RR WV ++M+D  K
Sbjct  1     MSMEMKYLDCILVPLGILTMVAYHIWQLHRIIKHPTKTIIGVNAISRRFWVHSMMEDVGK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +LAVQTLRN IM ST++A+T+I+L S +A ++S+T   K    D  +G   E   ++K
Sbjct  61    NGVLAVQTLRNNIMASTVLASTAIMLSSLIALLMSNTGRDKSTWLD--FGDRSEQAFSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNL------GVVRPDYVVELLEKSFAL  512
             Y ++L+ F+  F+ +  SIR+ +  + LIN P   +        +  +YV   + +    
Sbjct  119   YFSILVCFMAVFLLNVQSIRYYSHASILINIPFKKMYSDQHHRNLTAEYVATTVNRGSYF  178

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDF-------VFTPPKGKLGHDY  353
              ++G R FY ++P+ LWI GP+ +ILC   +V +LY LD        V      + G++ 
Sbjct  179   WSLGLRGFYFSLPLFLWIFGPIPMILCCFVLVFMLYFLDVNVEFGSAVSVADDNRDGNED  238

Query  352   DHEIG  338
             D E+G
Sbjct  239   DAELG  243



>ref|XP_011075866.1| PREDICTED: uncharacterized protein LOC105160255 [Sesamum indicum]
Length=259

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 142/246 (58%), Gaps = 20/246 (8%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD VLVPLG L+ L YH  L  ++   P TT++G NA  RRLWV ++M+D  K  +
Sbjct  2     EERILDYVLVPLGLLMMLAYHICLLRQIVRHPATTVVGLNAINRRLWVRSMMEDTSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A ++S      +P+  AV+G +     ++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSVIAVLMSG--GNHRPVG-AVFGDNSRLGSSIKFFS  118

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPD-NLGV---------VRPDYVVELLEKSFA  515
             +++ FL +F+ +  SIR+ +  + LIN P    +G+         V  +YV   + +   
Sbjct  119   IMVCFLVAFLLNVQSIRYYSHASILINVPSKRKMGMNLDSYYKDCVTAEYVGRTVNRGSY  178

Query  514   LNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDF------VFTPPKGKLGHDY  353
               ++G R FY + P+ LWI GP+ + +C   MV +LY LDF      VF+ P+ + G  Y
Sbjct  179   FWSLGLRAFYFSFPLFLWIFGPIPMFVCSVVMVFMLYWLDFTFGSGTVFSAPQAE-GISY  237

Query  352   DHEIGN  335
               +  N
Sbjct  238   SRDRDN  243



>ref|XP_009130055.1| PREDICTED: uncharacterized protein LOC103854850 [Brassica rapa]
Length=245

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 129/222 (58%), Gaps = 11/222 (5%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD +LVPLG  + + YH WL H++  +P +T++G NA  RRLWV A+M+D  K  +
Sbjct  2     KREYLDYILVPLGMGLMIFYHLWLLHRIIHRPSSTVVGLNAFNRRLWVQAMMEDASKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQT RN IM STL+A+T+I+LCS +A +++S    +      V+G   +   ++K+  
Sbjct  62    LAVQTPRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDQAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV---------RPDYVVELLEKSFAL  512
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V           DYV   + +    
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGHSLMINQDYVAATVNRGSYF  179

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
              ++G R FY + P+ LWI GP+ + +    +V +LY LD  F
Sbjct  180   WSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVSLLYFLDLTF  221



>ref|XP_010493710.1| PREDICTED: uncharacterized protein LOC104770932 [Camelina sativa]
Length=248

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 131/233 (56%), Gaps = 14/233 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLALMVFYHLWLLYRIINRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSGTGERSVW--FVFGDKSDRAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGHGGLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLG  362
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD  F      +G
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLDLTFDSMNCTVG  232



>ref|XP_004235043.1| PREDICTED: uncharacterized protein LOC101255968 [Solanum lycopersicum]
Length=233

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 129/216 (60%), Gaps = 6/216 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G L+ L YH WL H++   P  T+IG N+  R+ W+ A+M+D  K  +
Sbjct  2     EKQVLDYVLVPVGLLLMLAYHLWLLHRILKHPSHTVIGINSINRQFWIRAMMEDPSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +  ++SS       ++  +YG   EF +++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSLIGVLMSSGSRGGGSISSHIYGNRTEFCLSIKFFS  121

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ F+ +F+ +  SIR+ +  + LIN P   L        V  +YV  ++ +     ++
Sbjct  122   ILVCFMVAFLFNVQSIRYYSHASILINVPYKKLDSSNSRHCVTAEYVGRIVNRGSYFWSL  181

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             G R FY + P+ LWI GP+ + L    +V +LY LD
Sbjct  182   GLRAFYFSFPLFLWIFGPIPMFLSSVFLVFMLYFLD  217



>ref|XP_010251073.1| PREDICTED: uncharacterized protein LOC104593089 [Nelumbo nucifera]
Length=237

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 131/236 (56%), Gaps = 7/236 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD  LVP G  + + YH WL +++   P  T+IG NA  RR+WV  +M+D+ K  +
Sbjct  2     RREILDYFLVPSGLCLMVAYHIWLLYRIIRHPTKTVIGINAINRRIWVQTMMEDSPKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+ATT+I+L S +A ++S++ +  +P    VYG   E   ++K  +
Sbjct  62    LAVQTLRNNIMASTLLATTAIMLSSFIAVLMSNSNNA-QPSIKLVYGDKSELEFSIKLFS  120

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV--VRPDYVVELLEKSFALNAVGNRL  491
             +L+ FL +F+ +  SIR+ +  + L+N P   +    +  +YV   L +     ++G R 
Sbjct  121   ILVCFLLAFLLNVQSIRYYSHASILVNVPVRKMSSSHLMAEYVGRALNRGSYFWSLGLRA  180

Query  490   FYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF----TPPKGKLGHDYDHEIGN  335
             FY + P+ +WI GP+ + LC   +V + Y LD  F        G      D E G 
Sbjct  181   FYLSFPLFMWIFGPIPMFLCCLVLVFMFYFLDITFEFGWATGGGATAEYKDEEQGK  236



>ref|XP_008376853.1| PREDICTED: uncharacterized protein LOC103439973 [Malus domestica]
Length=318

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 136/243 (56%), Gaps = 10/243 (4%)
 Frame = -2

Query  1039  KNMEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDN  860
             +  E ++  LD VLVP G L+ + YH WL +++ TQP +T+IG N+  RR WV A+M++ 
Sbjct  78    EEEEMQQRVLDYVLVPAGLLVMVAYHLWLLYRILTQPNSTVIGINSINRRFWVHAMMEEA  137

Query  859   EKKNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVA  680
              K  +LAVQTLRN IM STL+A+T+I LCS  A +++S    +  L   V+G   E   A
Sbjct  138   PKHGVLAVQTLRNNIMASTLLASTAITLCSLTALLMNSGTKYRAAL--FVFGDRSEIAFA  195

Query  679   LKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSF  518
             +K+  +L+ FL +F+ +  SIR+ +  + LIN P   +        +  DYV   + +  
Sbjct  196   IKFFAILVCFLVAFLFNVQSIRYYSHASILINAPCKRMSPHHQHHYLTTDYVATTVNRGS  255

Query  517   ALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD--FVFTPPKGKLGHDYDHE  344
                ++G R FY + P+ LWI GP+ + +    +V  LY LD  F F    G   +D +  
Sbjct  256   YFWSLGLRAFYFSFPLFLWIFGPIPMFVSCFVLVITLYFLDVSFQFGWEVGVADNDEEQR  315

Query  343   IGN  335
             + N
Sbjct  316   LPN  318



>ref|XP_006347643.1| PREDICTED: uncharacterized protein LOC102604178 [Solanum tuberosum]
Length=237

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 127/216 (59%), Gaps = 6/216 (3%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G +  + YH WL H++   P  T+IG N+  R+ WV A+M+D  K  +
Sbjct  2     EKQVLDYVLVPVGLIFMIAYHLWLLHRILKHPSHTVIGINSINRQFWVRAMMEDPSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+L S +A +++        ++  +YG   EF +++K+ +
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLSSLIAVLMTGGSKGGGSISTHIYGNRTEFCLSIKFFS  121

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ F+ +F+ +  SIR+ +  + LIN P   L        V  +YV   + +     ++
Sbjct  122   ILVCFMVAFLFNVQSIRYYSHASILINVPYKKLDSSNSRHCVTAEYVGRTVNRGSYFWSL  181

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             G R FY + P+ LWI GP+ + L    +V +LY LD
Sbjct  182   GLRAFYFSFPLFLWIFGPIPMFLSCVFLVFMLYFLD  217



>ref|XP_009361244.1| PREDICTED: uncharacterized protein LOC103951550 [Pyrus x bretschneideri]
Length=245

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 129/219 (59%), Gaps = 8/219 (4%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD VLVP G L+ + YH WL +++ TQP +T+IG N+  RR WV A+M++  K  +
Sbjct  2     QQRVLDYVLVPAGLLVMVTYHLWLLYRILTQPNSTVIGINSINRRFWVHAMMEEAPKHGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I LCS +A +++S    +  L   V+G   E   ++K+  
Sbjct  62    LAVQTLRNNIMASTLLASTAITLCSLIALLMTSGTKYRAAL--FVFGDRSELAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +        +  DYV   + +     ++
Sbjct  120   ILVCFLVAFLFNVQSIRYYSHASILINVPCKKMSPHHQHHYLTTDYVATTVNRGSYFWSL  179

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             G R FY + P+ LWI GP+ + +    +V +LY LD  F
Sbjct  180   GLRAFYFSFPLFLWIFGPIPMFVSCFVLVIMLYFLDVTF  218



>ref|XP_007039247.1| Uncharacterized protein TCM_015546 [Theobroma cacao]
 gb|EOY23748.1| Uncharacterized protein TCM_015546 [Theobroma cacao]
Length=245

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 129/222 (58%), Gaps = 8/222 (4%)
 Frame = -2

Query  1033  MEWKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEK  854
             M  +K YLD  LVP+G L+ L YH WL +++   P  T+IG NA  RR WV A+M+D  K
Sbjct  1     MTIEKKYLDWALVPIGILLMLAYHLWLLYRIVKHPTKTVIGVNAINRRFWVRAMMEDVAK  60

Query  853   KNILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALK  674
               +LAVQTLRN IM STL+A+T+I+L S +A +++S+   +      V+G       ++K
Sbjct  61    NGVLAVQTLRNNIMASTLLASTAIMLSSLIAVLMTSSSGNRSSW--FVFGDRSNLAFSIK  118

Query  673   YVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP------DYVVELLEKSFAL  512
             + ++L+ FL +F+ +  SIR+ +  + LIN P   +   +       +YV   + +    
Sbjct  119   FFSILVCFLVAFLLNVQSIRYYSHASILINVPVKKMSQHQRHHHLTVEYVANTVNRGSYF  178

Query  511   NAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
              ++G R FY + P+ LWI GP+ ++ C   ++ +LY LD  F
Sbjct  179   WSLGLRAFYFSFPLFLWIFGPLPMVFCCIALIFMLYFLDVTF  220



>emb|CDY18511.1| BnaA01g26840D [Brassica napus]
Length=244

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 119/211 (56%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+ +LD VLVP G  + + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKQEWLDAVLVPAGLAVMVAYHVWLGYAIIHRPKLTVISLNAESRRQWVFSMMTEPLKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
              LAVQT+RN IM STL+ATT+I LCS +   +S+T + K   +  ++G     +  +K  
Sbjct  62    TLAVQTIRNNIMASTLLATTAITLCSIIGVFVSNTSASKSTASPIIFGNKSPLLATIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +L+ FL +F+ +  SIR+   V+FLI  P         +YV   L ++    ++G R F
Sbjct  122   AILVCFLMAFLCNVQSIRYYAHVSFLITVPVSRGKREHCEYVSRNLNRASYFWSLGLRAF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWNFGPIPMFVCCCMMSSILYFLD  212



>emb|CDX95543.1| BnaC01g34350D [Brassica napus]
Length=244

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 119/211 (56%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LDV+LVP G  + + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEEGLDVILVPAGLAVMVAYHVWLGYAIIHRPKLTVISLNAESRRQWVFSMMTEPLKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
              LAVQT+RN IM STL+ATT+I LCS +   +S+T + K   +  +YG     +  +K  
Sbjct  62    TLAVQTIRNNIMASTLLATTAITLCSIIGVFVSNTSASKSTASPIIYGNKSPVLATIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +L+ FL +F+ +  SIR+   V+FLI  P         +YV   L ++    ++G R F
Sbjct  122   AILVCFLMAFLCNVQSIRYYAHVSFLITVPVSRGKREHCEYVSRNLNRASYFWSLGLRAF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWNFGPIPMFVCCCMMSSILYFLD  212



>ref|XP_003615481.1| hypothetical protein MTR_5g068640 [Medicago truncatula]
 gb|AES98439.1| transmembrane protein, putative [Medicago truncatula]
Length=254

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 136/237 (57%), Gaps = 7/237 (3%)
 Frame = -2

Query  1021  KSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNIL  842
             K  LD++LVP G  + + YH WL ++V   P  T+IG N+  RR WV A+M+D  K  +L
Sbjct  3     KKILDLILVPSGLFVMVAYHLWLLYQVVKHPTKTVIGVNSINRRYWVQAMMEDVSKNGVL  62

Query  841   AVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTL  662
             AVQ+LRN IM STL+A+T+I+L S L AV+ S+ +  + +   V+G   E ++++K+ ++
Sbjct  63    AVQSLRNNIMASTLLASTAIML-SSLIAVLMSSRNEGRSVVSLVFGDRTELVLSIKFFSI  121

Query  661   LIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV------VRPDYVVELLEKSFALNAVG  500
             L+ F+ +F+ +  SIR+ +  + LIN P   L        +  +YV   + +     ++G
Sbjct  122   LVCFMLAFLLNVQSIRYYSHASILINVPFKKLSSNLRQQKLTAEYVANTVNRGSYFWSLG  181

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVFTPPKGKLGHDYDHEIGNGV  329
              R FY + P+ +WI GP+ ++     +V +LY LD V       +G D    +G+ V
Sbjct  182   LRAFYFSFPLFMWIFGPIPMLFSCFALVSMLYFLDVVIECGWAAIGVDDADCVGDEV  238



>ref|XP_002883119.1| hypothetical protein ARALYDRAFT_898182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59378.1| hypothetical protein ARALYDRAFT_898182 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 120/211 (57%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G ++ + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEESLDLVLVPTGLVVMVAYHVWLVYAILHRPKLTVISLNAESRRQWVFSMMTEPLKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
              LAVQT+RN IM STL+ATT+I LCS +   +S++ + K      +YG     + ++K  
Sbjct  62    TLAVQTIRNNIMASTLLATTAITLCSIIGVFVSNSSASKSTPTSLIYGNKSPRLASIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++    ++G R F
Sbjct  122   AILICFLMAFLCNIQSIRYYAHVSFLVTVPVSRGKREHCEYVSRNLNRASYFWSLGLRAF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWTFGPIPMFVCCCMMSSILYFLD  212



>ref|XP_008376849.1| PREDICTED: uncharacterized protein LOC103439971 [Malus domestica]
Length=245

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 128/219 (58%), Gaps = 8/219 (4%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD VLVP G L+ + YH WL +++  QP +T+IG N+  RR WV A+M++  K  +
Sbjct  2     QQRVLDYVLVPAGLLVMVAYHLWLLYRILXQPNSTVIGINSINRRFWVHAMMEEAPKHGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I LCS +A +++S    +  L   V+G   E   ++K+  
Sbjct  62    LAVQTLRNNIMASTLLASTAITLCSLIALLMTSGTKYRAAL--FVFGDRSELAFSIKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLG------VVRPDYVVELLEKSFALNAV  503
             +L+ FL +F+ +  SIR+ +  + LIN P   +        +  DYV   + +     ++
Sbjct  120   ILVCFLVAFLFNVQSIRYYSHASILINAPCKKMSPHHQHHYLTTDYVATTVNRGSYFWSL  179

Query  502   GNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFVF  386
             G R FY + P+ LWI GP+ + +    +V +LY LD  F
Sbjct  180   GLRAFYFSFPLFLWIFGPIPMFVSCFVLVIMLYFLDVTF  218



>ref|NP_001190384.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93333.1| uncharacterized protein AT5G24600 [Arabidopsis thaliana]
Length=243

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 128/222 (58%), Gaps = 14/222 (6%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             K+ YLD  LVPLG  + + YH WL +++  +P +T++G NA  RRLWV A+M+D+ K  +
Sbjct  2     KREYLDYTLVPLGLALMVFYHLWLLYRIIHRPSSTVVGLNAFNRRLWVQAMMEDSSKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+T+I+LCS +A +++S    +      V+G   +   +LK+  
Sbjct  62    LAVQTLRNNIMASTLLASTAIMLCSLIAVLMTSATGERSVW--FVFGDKSDRAFSLKFFA  119

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVV------------RPDYVVELLEKS  521
             +L+ FL +F+ +  SIR+ +  + LIN P   L  V              DYV   + + 
Sbjct  120   ILVCFLVAFLLNVQSIRYYSHASILINVPFKQLMAVSSGGRGNGSLMINQDYVAATVNRG  179

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
                 ++G R FY + P+ LWI GP+ + +    +V  LY LD
Sbjct  180   SYFWSLGLRAFYFSSPLFLWIFGPIPMFITCCVLVCSLYFLD  221



>gb|EMT33291.1| hypothetical protein F775_17747 [Aegilops tauschii]
Length=253

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/246 (39%), Positives = 137/246 (56%), Gaps = 15/246 (6%)
 Frame = -2

Query  1021  KSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN-I  845
             K  LD VLVPLG ++ LGYH WL  +++ +P TT+IG NA  RR+WV  IM++   K+ +
Sbjct  3     KEALDYVLVPLGLVLMLGYHGWLLLRIQRRPATTVIGVNAINRRIWVRHIMEEPSGKHAV  62

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKP------LNDA--VYGAHGEF  689
             LAVQT+RN IM STL+A+T+I L S +A ++S              L DA  V GA GE 
Sbjct  63    LAVQTIRNNIMASTLLASTAITLSSLIAVLMSGGGGGGPGAGGGGLLPDAPLVVGATGEA  122

Query  688   MVALKYVTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP----DYVVELLEKS  521
              ++ K+  +L+ FL +F+ +  SIR+ +  + L+N P     + RP    DYV   L + 
Sbjct  123   ALSAKFFAILVCFLVAFLLNVQSIRYYSHTSTLVNVPIRAHRLRRPGLAVDYVTGTLNRG  182

Query  520   FALNAVGNRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLDFV--FTPPKGKLGHDYDH  347
                 ++G R FY + P+ LW+ GP+ +      MV VLY LD    +   +G  G D   
Sbjct  183   SYFWSLGVRAFYFSCPVFLWLFGPIPMFAACVVMVCVLYFLDVCEDWEEEEGVSGGDETS  242

Query  346   EIGNGV  329
             E G  V
Sbjct  243   ERGKDV  248



>emb|CDX92214.1| BnaA05g21930D [Brassica napus]
Length=244

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 121/211 (57%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK+  LD+VLVP G  + +GYH WL + +  +P  T I  NA  RRLWV A+M D  K  
Sbjct  2     WKEESLDLVLVPAGLAVMVGYHVWLGYTIIHRPKLTAISLNAESRRLWVFAMMDDPMKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
             +LAVQT+RN IM ST++ATT+I LCS +   +SST + +   +  +YG     +  +K  
Sbjct  62    VLAVQTIRNNIMASTVLATTAITLCSIIGLFVSSTSASESTASPMIYGNKSPLLATIKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
             ++LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++     +G R F
Sbjct  122   SILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGEKEHCEYVARNLNRALYFWFLGLRAF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWNFGPIPMFVCCCMMSSILYFLD  212



>ref|XP_009630980.1| PREDICTED: uncharacterized protein LOC104120835 [Nicotiana tomentosiformis]
Length=224

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 2/209 (1%)
 Frame = -2

Query  1018  SYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILA  839
             S+LD +LVPL   I +GYH +LWH ++ +P  T IG N   +R W+  + + NEKK  LA
Sbjct  5     SFLDTILVPLSLFITIGYHFYLWHHLKHKPSRTTIGMNILKKRSWLRELNQGNEKKGTLA  64

Query  838   VQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVTLL  659
             VQ+LRN +M + L AT ++++   LAA+ ++TY+V+     A +G+    ++ LKY +  
Sbjct  65    VQSLRNALMETILTATITMIITLALAALTNNTYNVRNLFTSAFFGSQTGKIIVLKYGSAT  124

Query  658   IIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFYAA  479
             I  L SF+  SL++      NFL+N   +    + P Y   + E+ F L  VG+R+   A
Sbjct  125   IFLLASFLCSSLALSCLIDANFLVNALGE--FSINPMYTETVFERGFTLAFVGDRVLCMA  182

Query  478   IPMLLWIVGPVLVILCYATMVPVLYNLDF  392
              P+LLW+ GPV V++    +V  L+  DF
Sbjct  183   FPLLLWMFGPVPVVVSSLALVWGLHERDF  211



>ref|XP_006298426.1| hypothetical protein CARUB_v10014495mg [Capsella rubella]
 gb|EOA31324.1| hypothetical protein CARUB_v10014495mg [Capsella rubella]
Length=244

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 121/211 (57%), Gaps = 0/211 (0%)
 Frame = -2

Query  1027  WKKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKN  848
             WK++ LD+VLVP G L+ + YH WL + +  +P  T+I  NA  RR WV ++M +  K  
Sbjct  2     WKEASLDLVLVPTGLLVMVAYHIWLVYAIYHRPKLTVISLNAETRRQWVFSMMTEPLKNG  61

Query  847   ILAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYV  668
              LAVQT+RN IM STL+AT +I LCS +   +S++ + K      +YG+    + ++K  
Sbjct  62    TLAVQTIRNNIMASTLLATAAITLCSIIGVFVSNSSASKNNPTSLIYGSKSPRLASVKNF  121

Query  667   TLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLF  488
              +LI FL +F+ +  SIR+   V+FL+  P         +YV   L ++    ++G R F
Sbjct  122   AILICFLTAFLCNVQSIRYYAHVSFLVTVPVSRGKREHCEYVSRNLNRASYFWSLGLRSF  181

Query  487   YAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
             Y + P+ LW  GP+ + +C   M  +LY LD
Sbjct  182   YFSFPLFLWTFGPIPMFVCCCIMSSILYFLD  212



>gb|EYU42030.1| hypothetical protein MIMGU_mgv1a013359mg [Erythranthe guttata]
Length=222

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 122/212 (58%), Gaps = 7/212 (3%)
 Frame = -2

Query  1015  YLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNILAV  836
             YLD VLVPL     +GYHA+LWH +R +P  T IG N   RR W+  + + ++KK +LAV
Sbjct  7     YLDSVLVPLSLFFTIGYHAYLWHNLRHKPSVTSIGINMLKRRAWLRQLNQGDDKKGMLAV  66

Query  835   QTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDA-VYGAHGEFMVALKYVTLL  659
             Q+LRN +M + L  T +IL+   LAA+ ++ ++    L    ++G+    ++ LKY +  
Sbjct  67    QSLRNTLMFTILTGTVTILVTISLAALTNNAFNANHILTTTELFGSQSGRIMVLKYGSAS  126

Query  658   IIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP--DYVVELLEKSFALNAVGNRLFY  485
             I  + SF+  S+++ F    NFLIN     +G   P   Y   ++E+ F +  VGNR+  
Sbjct  127   IFLVASFLCSSMAVGFLVDANFLINA----IGEFTPAAGYTEAVVERGFTMAVVGNRVLC  182

Query  484   AAIPMLLWIVGPVLVILCYATMVPVLYNLDFV  389
              A PM++WI GP+ V L    MV  LY LDFV
Sbjct  183   VAFPMMMWIFGPLPVALSSLAMVWALYELDFV  214



>ref|XP_010279393.1| PREDICTED: uncharacterized protein LOC104613320 isoform X1 [Nelumbo 
nucifera]
Length=241

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 120/210 (57%), Gaps = 0/210 (0%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             ++  LD++LVPLG L+   Y++WL   +   P  T+IG NAA R  WVS +M D  K  +
Sbjct  2     EEGQLDLILVPLGVLVMAIYYSWLLRIILRNPERTVIGLNAASRERWVSFMMSDPLKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQT+RN IM STL+ATT+I L S +   +SST +     ++ VYG     + ++KY +
Sbjct  62    LAVQTIRNNIMASTLLATTAITLSSIIGVFVSSTTNPSISASELVYGNKSHLLSSIKYFS  121

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRPDYVVELLEKSFALNAVGNRLFY  485
             +L+ FL +F+ +  SIR+ + V+ L+  PP         YV     +     ++G R FY
Sbjct  122   ILLCFLVAFLCNVQSIRYYSHVSILVTLPPLKDRRESIAYVARSFNRGSYFWSLGLRAFY  181

Query  484   AAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              + P+ LWI GP+ + +C   M   LY LD
Sbjct  182   VSFPLFLWIFGPIPMFVCCFVMSSTLYFLD  211



>ref|XP_010941436.1| PREDICTED: uncharacterized protein LOC105059718 [Elaeis guineensis]
Length=239

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 127/215 (59%), Gaps = 5/215 (2%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             +K  LD VLVP+G  + + YH WL ++V   P TT+IG NA  RR+WV  +M+D  K  +
Sbjct  2     RKEVLDFVLVPVGLTVLVSYHLWLLYRVIKHPTTTVIGINAINRRIWVHTMMEDPLKNGV  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPL--NDAVYGAHGEFMVALKY  671
             LAVQTLRN IM STL+A+ +I LCS +A +++++    + L   + V G   +  +++K+
Sbjct  62    LAVQTLRNNIMASTLLASMAITLCSLMAVLMTNSNGGYRGLRGKNFVLGDTSDLALSIKF  121

Query  670   VTLLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGVVRP---DYVVELLEKSFALNAVG  500
              ++LI FL +F+ +  SIR+ +    LIN P        P   +YV   L +     ++G
Sbjct  122   FSILICFLLAFLLNVQSIRYYSHAGLLINVPARGQWAAPPLAAEYVAGALNRGSYFWSLG  181

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD  395
              R FY + PM LWI GPV +++    +V +LY LD
Sbjct  182   LRAFYFSFPMFLWIFGPVPMLVSCLGLVLMLYFLD  216



>ref|XP_010255120.1| PREDICTED: uncharacterized protein LOC104595873 [Nelumbo nucifera]
Length=236

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 131/234 (56%), Gaps = 10/234 (4%)
 Frame = -2

Query  1024  KKSYLDVVLVPLGFLICLGYHAWLWHKVRTQPLTTIIGTNAAGRRLWVSAIMKDNEKKNI  845
             KK  LD  LV  GFL+ + YH WL H++   P  T++G NA  R LWV  +M +  K  I
Sbjct  2     KKQLLDYSLVSSGFLMMVVYHIWLLHRIIKHPTKTVLGVNAINRLLWVRTMMDNMSKNGI  61

Query  844   LAVQTLRNMIMGSTLMATTSILLCSGLAAVISSTYSVKKPLNDAVYGAHGEFMVALKYVT  665
             LAVQTLRN IM STL+A+ +I+L S +A ++S+  +  +P +  VYG   +   ++K  +
Sbjct  62    LAVQTLRNNIMASTLLASMAIMLSSVIAVLMSNRNA--RP-SKFVYGDESDLGFSIKLFS  118

Query  664   LLIIFLFSFVSHSLSIRFTNQVNFLINCPPDNLGV-----VRPDYVVELLEKSFALNAVG  500
             +LI FL +F+ +  SIR+ +  + LIN P  N+       +  +YV   + +     ++G
Sbjct  119   ILICFLMAFLFNVQSIRYYSHASILINVPVKNMSSSSSSHLTVEYVGRTVNRGSHFWSLG  178

Query  499   NRLFYAAIPMLLWIVGPVLVILCYATMVPVLYNLD--FVFTPPKGKLGHDYDHE  344
              R FY + P+  WI GP+ + LC   +V +LY LD  F F    G +  D D E
Sbjct  179   LRAFYFSFPLFFWIFGPIPMFLCCLVLVFMLYFLDVTFEFGQAIGAVDEDKDEE  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2629592296512