BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21514_g2_i1 len=490 path=[590:0-95 1832:96-203 686:204-489]

Length=490
                                                                      Score     E

ref|XP_007034913.1|  G-protein gamma subunit 2                        81.3    2e-16   
ref|XP_008449308.1|  PREDICTED: guanine nucleotide-binding protei...  77.4    3e-15   
ref|XP_004150567.1|  PREDICTED: guanine nucleotide-binding protei...  77.4    4e-15   
ref|XP_006362154.1|  PREDICTED: guanine nucleotide-binding protei...  74.7    4e-14   
ref|XP_009781493.1|  PREDICTED: guanine nucleotide-binding protei...  74.3    5e-14   
ref|XP_010326697.1|  PREDICTED: guanine nucleotide-binding protei...  74.3    6e-14   
gb|AGN54390.1|  G protein gamma1 subunit                              72.8    2e-13   
ref|XP_002517046.1|  conserved hypothetical protein                   72.4    3e-13   Ricinus communis
ref|XP_009592070.1|  PREDICTED: guanine nucleotide-binding protei...  72.0    4e-13   
emb|CDO99128.1|  unnamed protein product                              71.6    4e-13   
ref|XP_002321907.1|  G-protein GAMMA SUBUNIT 2                        70.9    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011048688.1|  PREDICTED: guanine nucleotide-binding protei...  70.9    1e-12   
gb|AFK46968.1|  unknown                                               69.3    4e-12   
ref|XP_007143893.1|  hypothetical protein PHAVU_007G111000g           68.9    5e-12   
ref|XP_011073473.1|  PREDICTED: guanine nucleotide-binding protei...  68.6    6e-12   
ref|XP_010667616.1|  PREDICTED: guanine nucleotide-binding protei...  67.8    1e-11   
ref|XP_007050458.1|  Ammonium transporter 2                           71.6    2e-11   
ref|XP_008341025.1|  PREDICTED: guanine nucleotide-binding protei...  67.4    2e-11   
ref|XP_009376004.1|  PREDICTED: guanine nucleotide-binding protei...  67.4    2e-11   
ref|XP_009337270.1|  PREDICTED: guanine nucleotide-binding protei...  66.6    3e-11   
ref|XP_006420062.1|  hypothetical protein CICLE_v10006282mg           65.9    6e-11   
ref|XP_007225948.1|  hypothetical protein PRUPE_ppa013749mg           65.9    8e-11   
ref|XP_008224212.1|  PREDICTED: guanine nucleotide-binding protei...  65.5    8e-11   
gb|KEH42816.1|  guanine nucleotide-binding protein subunit gamma 2    65.5    9e-11   
gb|EYU26968.1|  hypothetical protein MIMGU_mgv1a017061mg              65.1    1e-10   
ref|XP_004296599.1|  PREDICTED: guanine nucleotide-binding protei...  65.1    1e-10   
ref|XP_010279294.1|  PREDICTED: guanine nucleotide-binding protei...  64.7    2e-10   
gb|AFK45127.1|  unknown                                               64.3    2e-10   
ref|XP_002283821.1|  PREDICTED: guanine nucleotide-binding protei...  64.3    3e-10   Vitis vinifera
ref|XP_006443953.1|  hypothetical protein CICLE_v10022979mg           64.3    3e-10   
ref|XP_003622347.1|  GTP binding protein gamma subunit                63.5    3e-10   
gb|KFK39576.1|  hypothetical protein AALP_AA3G262200                  63.9    3e-10   
ref|XP_011091078.1|  PREDICTED: guanine nucleotide-binding protei...  63.5    4e-10   
gb|AHJ60246.1|  heterotrimeric G-protein gamma subunit 1              62.0    2e-09   
gb|ADE76615.1|  unknown                                               61.6    2e-09   
gb|AIL52188.1|  heterotrimeric G-protein gamma subunit 1              59.7    7e-09   
ref|XP_010552457.1|  PREDICTED: guanine nucleotide-binding protei...  59.7    9e-09   
ref|XP_004495420.1|  PREDICTED: guanine nucleotide-binding protei...  59.7    1e-08   
ref|XP_010552456.1|  PREDICTED: guanine nucleotide-binding protei...  59.7    2e-08   
gb|KCW60666.1|  hypothetical protein EUGRSUZ_H03396                   60.5    2e-08   
ref|XP_006350656.1|  PREDICTED: guanine nucleotide-binding protei...  58.5    2e-08   
ref|XP_009420674.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    2e-08   
ref|XP_010935875.1|  PREDICTED: guanine nucleotide-binding protei...  58.5    2e-08   
ref|XP_003590556.1|  hypothetical protein MTR_1g071100                58.9    2e-08   
ref|XP_008386407.1|  PREDICTED: guanine nucleotide-binding protei...  58.5    3e-08   
gb|KHG19301.1|  hypothetical protein F383_25859                       58.2    4e-08   
ref|XP_008786059.1|  PREDICTED: guanine nucleotide-binding protei...  57.8    4e-08   
dbj|BAJ90712.1|  predicted protein                                    57.8    4e-08   
ref|XP_006838908.1|  hypothetical protein AMTR_s00002p00269650        57.8    5e-08   
ref|XP_010923513.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    6e-08   
gb|AFK38339.1|  unknown                                               57.4    7e-08   
ref|XP_010026933.1|  PREDICTED: uncharacterized protein LOC104417334  60.1    8e-08   
ref|XP_010523656.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    8e-08   
ref|XP_007201427.1|  hypothetical protein PRUPE_ppa013611mg           56.6    1e-07   
ref|XP_010274260.1|  PREDICTED: guanine nucleotide-binding protei...  56.2    2e-07   
ref|XP_003556393.1|  PREDICTED: guanine nucleotide-binding protei...  55.8    2e-07   
ref|XP_009417106.1|  PREDICTED: guanine nucleotide-binding protei...  55.8    2e-07   
ref|XP_011026086.1|  PREDICTED: guanine nucleotide-binding protei...  55.5    3e-07   
ref|XP_004290641.1|  PREDICTED: guanine nucleotide-binding protei...  55.5    3e-07   
ref|XP_008802280.1|  PREDICTED: guanine nucleotide-binding protei...  55.1    4e-07   
ref|XP_008438601.1|  PREDICTED: uncharacterized protein LOC103483662  56.2    4e-07   
ref|XP_009135837.1|  PREDICTED: guanine nucleotide-binding protei...  55.1    4e-07   
ref|XP_004134111.1|  PREDICTED: guanine nucleotide-binding protei...  54.7    5e-07   
gb|AIO11836.1|  heterotrimeric G-protein gamma subunit 3              54.7    5e-07   
gb|AIO11835.1|  heterotrimeric G-protein gamma subunit 2              54.3    7e-07   
ref|XP_004162262.1|  PREDICTED: guanine nucleotide-binding protei...  54.3    7e-07   
ref|NP_567147.1|  guanine nucleotide-binding protein subunit gamma 1  54.3    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406113.1|  hypothetical protein EUTSA_v10022265mg           54.7    7e-07   
gb|AIS73133.1|  heterotrimeric G protein gamma subunit 1              53.9    8e-07   
ref|XP_006292109.1|  hypothetical protein CARUB_v10018305mg           53.9    9e-07   
gb|ACX43275.1|  GTP binding protein gamma subunit                     53.9    9e-07   Brassica napus [oilseed rape]
emb|CDY67558.1|  BnaCnng55440D                                        53.9    1e-06   
ref|XP_009116994.1|  PREDICTED: guanine nucleotide-binding protei...  53.5    1e-06   
ref|XP_009370746.1|  PREDICTED: guanine nucleotide-binding protei...  53.5    1e-06   
ref|XP_002883385.1|  predicted protein                                53.5    1e-06   
ref|XP_002876721.1|  G-protein gamma-subunit 1                        53.1    2e-06   
ref|XP_006402277.1|  hypothetical protein EUTSA_v10006334mg           53.1    2e-06   
ref|XP_009108481.1|  PREDICTED: guanine nucleotide-binding protei...  53.1    2e-06   
emb|CDX76696.1|  BnaC08g32820D                                        52.4    2e-06   
ref|NP_001240263.1|  uncharacterized protein LOC100813941             52.8    3e-06   
emb|CAB87795.1|  putative protein                                     53.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038703.1|  PREDICTED: guanine nucleotide-binding protei...  52.8    3e-06   
ref|NP_850746.1|  G-protein gamma subunit 2                           52.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302083.2|  hypothetical protein POPTR_0002s04770g           52.4    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003536197.1|  PREDICTED: guanine nucleotide-binding protei...  52.4    3e-06   
ref|XP_010466588.1|  PREDICTED: guanine nucleotide-binding protei...  52.0    4e-06   
ref|XP_010488328.1|  PREDICTED: guanine nucleotide-binding protei...  52.0    4e-06   
ref|XP_003518900.1|  PREDICTED: guanine nucleotide-binding protei...  52.4    4e-06   
gb|KDP21388.1|  hypothetical protein JCGZ_21859                       51.6    8e-06   
ref|XP_008368662.1|  PREDICTED: guanine nucleotide-binding protei...  51.2    8e-06   
ref|NP_001152725.1|  AGG2                                             50.8    1e-05   Zea mays [maize]
ref|XP_010523655.1|  PREDICTED: guanine nucleotide-binding protei...  50.8    1e-05   
ref|XP_008368654.1|  PREDICTED: guanine nucleotide-binding protei...  50.8    1e-05   
ref|XP_007144675.1|  hypothetical protein PHAVU_007G175700g           50.8    1e-05   
ref|XP_004982370.1|  PREDICTED: guanine nucleotide-binding protei...  50.4    2e-05   
ref|XP_006298866.1|  hypothetical protein CARUB_v10014985mg           50.4    2e-05   
ref|XP_004495154.1|  PREDICTED: guanine nucleotide-binding protei...  50.4    2e-05   
ref|XP_010532589.1|  PREDICTED: guanine nucleotide-binding protei...  50.4    2e-05   
ref|XP_006350657.1|  PREDICTED: guanine nucleotide-binding protei...  49.7    2e-05   
ref|XP_002306804.1|  heterotrimeric G protein gamma-subunit           50.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009370745.1|  PREDICTED: guanine nucleotide-binding protei...  49.7    4e-05   
ref|XP_010468849.1|  PREDICTED: guanine nucleotide-binding protei...  49.3    4e-05   
ref|XP_010413150.1|  PREDICTED: guanine nucleotide-binding protei...  49.3    4e-05   
ref|XP_010512760.1|  PREDICTED: guanine nucleotide-binding protei...  49.3    4e-05   
ref|XP_002464204.1|  hypothetical protein SORBIDRAFT_01g014060        48.5    6e-05   Sorghum bicolor [broomcorn]
ref|XP_006406109.1|  hypothetical protein EUTSA_v10021823mg           48.9    6e-05   
ref|XP_010511917.1|  PREDICTED: guanine nucleotide-binding protei...  48.5    7e-05   
ref|XP_011032620.1|  PREDICTED: guanine nucleotide-binding protei...  48.5    8e-05   
gb|ABK96688.1|  unknown                                               48.1    1e-04   Populus trichocarpa x Populus deltoides
ref|XP_002307445.1|  hypothetical protein POPTR_0005s20180g           47.4    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011003443.1|  PREDICTED: guanine nucleotide-binding protei...  47.4    2e-04   
emb|CDX93908.1|  BnaC04g20670D                                        47.8    3e-04   
ref|XP_004145370.1|  PREDICTED: guanine nucleotide-binding protei...  47.0    3e-04   
gb|KFK35495.1|  hypothetical protein AALP_AA5G292100                  46.6    4e-04   
ref|NP_001050720.1|  Os03g0635100                                     45.8    6e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_007034913.1| G-protein gamma subunit 2 [Theobroma cacao]
 gb|EOY05839.1| G-protein gamma subunit 2 [Theobroma cacao]
Length=106

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 51/95 (54%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+++RMEKAS ACKEML  VE+R DPLLP                             
Sbjct  48   ELEQIERMEKASAACKEMLSNVESRPDPLLP-----------------------------  78

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+NP WDRWFEGPQDA GC+C IL
Sbjct  79   -------VTNGPLNPLWDRWFEGPQDAQGCKCWIL  106



>ref|XP_008449308.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis melo]
Length=103

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 50/95 (53%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD+++KAS  CKEML  VETR DPLLP                             
Sbjct  45   ELEQLDKLDKASTKCKEMLSNVETRPDPLLP-----------------------------  75

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T+GPINP WDRWFEGPQD+ GCRC IL
Sbjct  76   -------LTHGPINPLWDRWFEGPQDSKGCRCWIL  103



>ref|XP_004150567.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 ref|XP_004167513.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 gb|KGN61655.1| hypothetical protein Csa_2G215490 [Cucumis sativus]
Length=104

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 50/95 (53%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD+++KAS  CKEML  VETR DPLLP                             
Sbjct  46   ELEQLDKLDKASTKCKEMLSNVETRPDPLLP-----------------------------  76

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T+GPINP WDRWFEGPQD+ GCRC IL
Sbjct  77   -------LTHGPINPLWDRWFEGPQDSKGCRCWIL  104



>ref|XP_006362154.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Solanum tuberosum]
Length=99

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 45/90 (50%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+MEKAS ACKEML  VETR DPLLP                                  
Sbjct  46   DKMEKASAACKEMLSNVETRPDPLLPV---------------------------------  72

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T+GP NP WDRWFEG QDASGCRC IL
Sbjct  73   ---THGPTNPSWDRWFEGAQDASGCRCWIL  99



>ref|XP_009781493.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Nicotiana sylvestris]
Length=99

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 45/90 (50%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+MEKAS ACKEML  VETR DPLLP                                  
Sbjct  46   DKMEKASTACKEMLSNVETRPDPLLPV---------------------------------  72

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T+GP NP WDRWFEGPQD SGCRC IL
Sbjct  73   ---THGPTNPYWDRWFEGPQDTSGCRCWIL  99



>ref|XP_010326697.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Solanum lycopersicum]
Length=99

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 45/90 (50%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+MEKAS ACKEML  VETR DPLLP                                  
Sbjct  46   DKMEKASAACKEMLSNVETRPDPLLPI---------------------------------  72

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T+GP NP WDRWFEG QDASGCRC IL
Sbjct  73   ---THGPTNPSWDRWFEGAQDASGCRCWIL  99



>gb|AGN54390.1| G protein gamma1 subunit, partial [Nicotiana benthamiana]
Length=99

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 45/90 (50%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D++EKAS ACKEML  VETR DPLLP                                  
Sbjct  46   DKIEKASTACKEMLSNVETRPDPLLPV---------------------------------  72

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T+GP NP WDRWFEGPQD SGCRC IL
Sbjct  73   ---THGPTNPYWDRWFEGPQDTSGCRCWIL  99



>ref|XP_002517046.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45209.1| conserved hypothetical protein [Ricinus communis]
Length=106

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD+MEKAS ACKEML  V+ R DPLLP                             
Sbjct  48   ELEQLDKMEKASAACKEMLSNVDIRPDPLLPI----------------------------  79

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T G +NP WDRWFEGPQ++ GCRC +L
Sbjct  80   --------TKGLLNPLWDRWFEGPQESQGCRCWVL  106



>ref|XP_009592070.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Nicotiana tomentosiformis]
Length=99

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 44/90 (49%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+MEKAS ACKEML  VET  DPLLP                                  
Sbjct  46   DKMEKASTACKEMLSNVETSPDPLLPV---------------------------------  72

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T+GP NP WDRWFEGPQD SGCRC IL
Sbjct  73   ---THGPTNPYWDRWFEGPQDTSGCRCWIL  99



>emb|CDO99128.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +MEKAS +CKEML  VETR DPLLP                                   
Sbjct  44   KMEKASASCKEMLSKVETRPDPLLPT----------------------------------  69

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGP+ P WDRWFEGPQ+ SGCRC IL
Sbjct  70   --TNGPLTPSWDRWFEGPQEKSGCRCWIL  96



>ref|XP_002321907.1| G-protein GAMMA SUBUNIT 2 [Populus trichocarpa]
 gb|EEF06034.1| G-protein GAMMA SUBUNIT 2 [Populus trichocarpa]
Length=109

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD++EKAS ACKEML  VET  DPLLP                             
Sbjct  51   ELEQLDKLEKASTACKEMLNNVETIPDPLLPI----------------------------  82

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+NP WDRWFEGP+++ GC C I 
Sbjct  83   --------TNGPMNPLWDRWFEGPRESKGCSCWIF  109



>ref|XP_011048688.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Populus euphratica]
 ref|XP_011048689.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Populus euphratica]
 ref|XP_011048691.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Populus euphratica]
Length=110

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD++EKAS ACKEML  VET  DPLLP                             
Sbjct  52   ELEQLDKLEKASTACKEMLNNVETIPDPLLPI----------------------------  83

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+NP WDRWFEGP+++ GC C I 
Sbjct  84   --------TNGPMNPLWDRWFEGPRESKGCSCWIF  110



>gb|AFK46968.1| unknown [Lotus japonicus]
Length=107

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 44/91 (48%), Gaps = 38/91 (42%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RMEKAS +CKEML  VETR DPLLP                                   
Sbjct  53   RMEKASTSCKEMLSNVETRPDPLLPS----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGP-QDASG-CRCLIL  286
              T GP+NP WDRWFEGP QD+ G CRC IL
Sbjct  79   --TVGPVNPAWDRWFEGPHQDSKGCCRCSIL  107



>ref|XP_007143893.1| hypothetical protein PHAVU_007G111000g [Phaseolus vulgaris]
 gb|ESW15887.1| hypothetical protein PHAVU_007G111000g [Phaseolus vulgaris]
Length=106

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 43/90 (48%), Gaps = 37/90 (41%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RMEKAS ACK ML  VET+ DPLLP                                   
Sbjct  53   RMEKASTACKGMLSNVETKPDPLLPS----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASG-CRCLIL  286
              T GP++P WDRWFEGPQD+ G CRC IL
Sbjct  79   --TIGPVSPTWDRWFEGPQDSKGCCRCWIL  106



>ref|XP_011073473.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Sesamum indicum]
Length=99

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RMEKAS ACKEML  ++TR DPLLP                                   
Sbjct  47   RMEKASVACKEMLITIKTRPDPLLPL----------------------------------  72

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+NP WDRWFEGPQD+S CRC IL
Sbjct  73   --TQGPVNPMWDRWFEGPQDSSRCRCWIL  99



>ref|XP_010667616.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Beta vulgaris subsp. vulgaris]
Length=91

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 45/95 (47%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD+ E  S ACKE+L  VE + DPLL                              
Sbjct  33   ELEQLDKTESVSSACKELLGNVEAKPDPLL------------------------------  62

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                  + T GP+NP WDRWFEGPQD+ GCRC I 
Sbjct  63   ------SETIGPVNPSWDRWFEGPQDSKGCRCWIF  91



>ref|XP_007050458.1| Ammonium transporter 2 [Theobroma cacao]
 gb|EOX94615.1| Ammonium transporter 2 [Theobroma cacao]
Length=610

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 46/95 (48%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+E+L+  +  S  C+E+L  +ETR DPLLP                             
Sbjct  552  EMEELEGTDNVSTLCEELLLSMETRPDPLLPL----------------------------  583

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGPINP WDRWFEGPQD+ GCRC IL
Sbjct  584  --------TNGPINPSWDRWFEGPQDSQGCRCQIL  610



>ref|XP_008341025.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Malus domestica]
Length=105

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS ACKE+L   ETR DPLLP                                   
Sbjct  53   KMDKASSACKEILNSAETRPDPLLPI----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T+GP+NP WDRWFEGPQD+ GCRC IL
Sbjct  79   --THGPLNPFWDRWFEGPQDSKGCRCWIL  105



>ref|XP_009376004.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376006.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=105

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS ACKE+L   ETR DPLLP                                   
Sbjct  53   KMDKASSACKEILNSAETRPDPLLPI----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T+GP+NP WDRWFEGPQD+ GCRC IL
Sbjct  79   --THGPLNPFWDRWFEGPQDSKGCRCWIL  105



>ref|XP_009337270.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Pyrus x bretschneideri]
Length=105

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +ME AS ACKE+LK  ET+ DPLLP                                   
Sbjct  53   KMENASSACKEILKGAETKPDPLLPI----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T+GP+NP WDRWFEGPQD+ GCRC IL
Sbjct  79   --THGPLNPFWDRWFEGPQDSKGCRCWIL  105



>ref|XP_006420062.1| hypothetical protein CICLE_v10006282mg [Citrus clementina]
 ref|XP_006489481.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Citrus sinensis]
 gb|ESR33302.1| hypothetical protein CICLE_v10006282mg [Citrus clementina]
 gb|KDO53960.1| hypothetical protein CISIN_1g034008mg [Citrus sinensis]
Length=106

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+LD+ EKAS AC E L+ VE   DPLLP                             
Sbjct  48   ELEQLDKTEKASAACNETLRNVEAIPDPLLPI----------------------------  79

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+NP WDRWFE P+++ GCRC IL
Sbjct  80   --------TNGPLNPLWDRWFERPKESRGCRCWIL  106



>ref|XP_007225948.1| hypothetical protein PRUPE_ppa013749mg [Prunus persica]
 gb|EMJ27147.1| hypothetical protein PRUPE_ppa013749mg [Prunus persica]
Length=105

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS ACKE+L   ETR DPLLP                                   
Sbjct  53   KMDKASAACKEILNNAETRPDPLLPV----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T+GP+NP WDRWFEGP+D+ GCRC IL
Sbjct  79   --THGPLNPFWDRWFEGPKDSKGCRCWIL  105



>ref|XP_008224212.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Prunus mume]
Length=105

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS ACKE+L   ETR DPLLP                                   
Sbjct  53   KMDKASAACKEILNNAETRPDPLLPV----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T+GP+NP WDRWFEGP+D+ GCRC IL
Sbjct  79   --THGPLNPFWDRWFEGPKDSKGCRCWIL  105



>gb|KEH42816.1| guanine nucleotide-binding protein subunit gamma 2 [Medicago 
truncatula]
Length=108

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 43/89 (48%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+KAS +CKE+L  V+TR DPLLP                                   
Sbjct  56   RMDKASTSCKELLSSVQTRPDPLLPS----------------------------------  81

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WDRWFEGPQD+ GCRC IL
Sbjct  82   --TIGPLNRLWDRWFEGPQDSQGCRCCIL  108



>gb|EYU26968.1| hypothetical protein MIMGU_mgv1a017061mg [Erythranthe guttata]
Length=95

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +MEKAS ACKEML  +ETR +PLLP                                   
Sbjct  43   KMEKASAACKEMLINIETRPEPLLPV----------------------------------  68

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GPINP WDRWFEGPQ+++ CRC IL
Sbjct  69   --TIGPINPMWDRWFEGPQESTKCRCWIL  95



>ref|XP_004296599.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=108

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +++KAS ACKE+L  VETR DPLLP                                   
Sbjct  56   KIDKASAACKEILSNVETRPDPLLPI----------------------------------  81

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+NP WDRWFEGP+D+ GCRC IL
Sbjct  82   --TRGPLNPFWDRWFEGPKDSKGCRCWIL  108



>ref|XP_010279294.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Nelumbo nucifera]
Length=105

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 42/89 (47%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +K S AC+E+L  +ETR DPLLP                                   
Sbjct  53   KTDKVSAACEELLTNIETRPDPLLPV----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGP NP WDRWFEGPQD+ GCRC IL
Sbjct  79   --TNGPTNPSWDRWFEGPQDSKGCRCWIL  105



>gb|AFK45127.1| unknown [Lotus japonicus]
Length=106

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 43/90 (48%), Gaps = 37/90 (41%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +MEKAS +CKEM+  VE R DPLLP                                   
Sbjct  53   KMEKASTSCKEMISNVEARPDPLLP-----------------------------------  77

Query  200  TRTNGPINPCWDRWFEGPQDA-SGCRCLIL  286
              T GP++P WD+WFEGPQD+ S CRC IL
Sbjct  78   -LTAGPVSPSWDKWFEGPQDSKSCCRCSIL  106



>ref|XP_002283821.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Vitis vinifera]
 emb|CBI26335.3| unnamed protein product [Vitis vinifera]
Length=105

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 44/89 (49%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E+AS AC+E+L +VE+R DPLLP                         + Y       
Sbjct  53   KTERASDACRELLSIVESRPDPLLP-------------------------VTY-------  80

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                GP NP WDRWFEGPQD+ GCRC IL
Sbjct  81   ----GPANPIWDRWFEGPQDSQGCRCWIL  105



>ref|XP_006443953.1| hypothetical protein CICLE_v10022979mg [Citrus clementina]
 ref|XP_006479624.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Citrus sinensis]
 gb|ESR57193.1| hypothetical protein CICLE_v10022979mg [Citrus clementina]
 gb|KDO68601.1| hypothetical protein CISIN_1g033950mg [Citrus sinensis]
Length=107

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 41/90 (46%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+ E  S  C E+LK +E R DPLL                                   
Sbjct  54   DKTENVSTICDELLKFMEARPDPLL-----------------------------------  78

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
             + TN PINP WDRWFEGPQDA GCRC+IL
Sbjct  79   -SVTNSPINPIWDRWFEGPQDARGCRCMIL  107



>ref|XP_003622347.1| GTP binding protein gamma subunit [Medicago truncatula]
Length=80

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 43/89 (48%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+KAS +CKE+L  V+TR DPLLP                                   
Sbjct  28   RMDKASTSCKELLSSVQTRPDPLLPS----------------------------------  53

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WDRWFEGPQD+ GCRC IL
Sbjct  54   --TIGPLNRLWDRWFEGPQDSQGCRCCIL  80



>gb|KFK39576.1| hypothetical protein AALP_AA3G262200 [Arabis alpina]
Length=100

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+E+L++ME AS +CKE L+ VE++ DPLLP+                            
Sbjct  42   EMEQLEKMENASASCKEFLESVESKPDPLLPE----------------------------  73

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WD+WFE P++A  C C IL
Sbjct  74   --------TTGPVNATWDQWFERPKEAKRCGCTIL  100



>ref|XP_011091078.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Sesamum indicum]
Length=99

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 42/86 (49%), Gaps = 36/86 (42%)
 Frame = +2

Query  29   KASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTRT  208
            +AS ACKE+L  +ETR DPLLP                                     T
Sbjct  50   RASAACKELLMNIETRPDPLLPV------------------------------------T  73

Query  209  NGPINPCWDRWFEGPQDASGCRCLIL  286
            NGP+NP WDRWFEGP ++SGCRC IL
Sbjct  74   NGPVNPTWDRWFEGPPESSGCRCWIL  99



>gb|AHJ60246.1| heterotrimeric G-protein gamma subunit 1 [Picea abies]
Length=111

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE LD+++KA+ ACKEML ++E   DPLL                              
Sbjct  53   ELEDLDKIDKATSACKEMLLIIENTPDPLL------------------------------  82

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                  + T GP NP WDRWFEGP ++ GC+C I+
Sbjct  83   ------SVTKGPENPAWDRWFEGPVESDGCKCWII  111



>gb|ADE76615.1| unknown [Picea sitchensis]
Length=111

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE LD+++KA+ ACKEML ++E   DPLL                              
Sbjct  53   ELEDLDKIDKATSACKEMLLIIENTPDPLL------------------------------  82

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                  + T GP NP WDRWFEGP ++ GC+C I+
Sbjct  83   ------SVTKGPENPAWDRWFEGPVESDGCKCWII  111



>gb|AIL52188.1| heterotrimeric G-protein gamma subunit 1 [Capsicum annuum]
Length=84

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  191  SVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + C  T+GP NP WDRWFEGPQDASGCRC IL
Sbjct  53   AACKETHGPTNPSWDRWFEGPQDASGCRCWIL  84



>ref|XP_010552457.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X2 [Tarenaya hassleriana]
Length=100

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 45/95 (47%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+E+L++ME+AS +C+E L  V+ + DPLLP+                            
Sbjct  42   EMEQLEKMERASTSCQEFLDSVDNKPDPLLPE----------------------------  73

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGPQ+   C C IL
Sbjct  74   --------TTGPVNQMWDRWFEGPQEPKNCGCSIL  100



>ref|XP_004495420.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cicer arietinum]
Length=108

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 43/90 (48%), Gaps = 37/90 (41%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+KAS  CKEML  VE R DPLLP             L +S                  
Sbjct  55   RMDKASIPCKEMLSNVEKRPDPLLP-------------LTIS------------------  83

Query  200  TRTNGPINPCWDRWFEGPQDASG-CRCLIL  286
                 P+NP WDRWFEGPQD+ G CRC IL
Sbjct  84   -----PLNPTWDRWFEGPQDSKGCCRCRIL  108



>ref|XP_010552456.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X1 [Tarenaya hassleriana]
Length=133

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 45/95 (47%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+E+L++ME+AS +C+E L  V+ + DPLLP+                            
Sbjct  75   EMEQLEKMERASTSCQEFLDSVDNKPDPLLPE----------------------------  106

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGPQ+   C C IL
Sbjct  107  --------TTGPVNQMWDRWFEGPQEPKNCGCSIL  133



>gb|KCW60666.1| hypothetical protein EUGRSUZ_H03396, partial [Eucalyptus grandis]
Length=216

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +MEKAS AC E+L  VE + DPLLP                                   
Sbjct  164  KMEKASVACMELLAHVEAKPDPLLPV----------------------------------  189

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+NP WDRWFEGPQD+  C C IL
Sbjct  190  --TTGPLNPLWDRWFEGPQDSKRCSCWIL  216



>ref|XP_006350656.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X1 [Solanum tuberosum]
Length=92

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 37/84 (44%), Gaps = 36/84 (43%)
 Frame = +2

Query  32   ASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTRTN  211
            AS ACKEML  VETR DPLLP                                     TN
Sbjct  44   ASAACKEMLNKVETRPDPLLPA------------------------------------TN  67

Query  212  GPINPCWDRWFEGPQDASGCRCLI  283
            GP NP WDRWFEG  D +GCRC I
Sbjct  68   GPANPSWDRWFEGLNDIAGCRCWI  91



>ref|XP_009420674.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Musa acuminata subsp. malaccensis]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 42/95 (44%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++L++ EK S   +E L  VE+  DPLLP+                            
Sbjct  45   ELQQLEKTEKLSAGLQEFLLKVESIPDPLLPE----------------------------  76

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP N  WDRWFEGPQD  GCRC IL
Sbjct  77   --------TTGPANTSWDRWFEGPQDTQGCRCWIL  103



>ref|XP_010935875.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Elaeis guineensis]
Length=101

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E+ S   +E+L  VE+R DPLLP+                                  
Sbjct  49   KTERVSATLQELLLEVESRPDPLLPE----------------------------------  74

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGP N  WDRWFEGPQD  GC+CLIL
Sbjct  75   --TNGPANSSWDRWFEGPQDLHGCKCLIL  101



>ref|XP_003590556.1| hypothetical protein MTR_1g071100 [Medicago truncatula]
 gb|AES60807.1| guanine nucleotide-binding protein subunit gamma 2 [Medicago 
truncatula]
Length=109

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 45/95 (47%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++L++ E  S  CKE+L+ +++R DPL+P+                            
Sbjct  51   ELDELEKTENVSAICKELLQNMDSRPDPLIPE----------------------------  82

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                     +GP+N  WDRWFEGPQD   CRC IL
Sbjct  83   --------VHGPVNLLWDRWFEGPQDPQACRCWIL  109



>ref|XP_008386407.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Malus domestica]
Length=115

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL +L+R E  S  C E+L  VE R DPLLP                             
Sbjct  57   ELGELERTENVSTICSELLPYVEGRLDPLLP-----------------------------  87

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGPQD+  C C IL
Sbjct  88   -------LTNGPVNLVWDRWFEGPQDSQSCSCWIL  115



>gb|KHG19301.1| hypothetical protein F383_25859 [Gossypium arboreum]
Length=102

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +  S  CKE+L  +ETR DPLLP                                   
Sbjct  50   KTDNVSTLCKELLLSMETRPDPLLP-----------------------------------  74

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGPINP WD WFEGPQ + GCRC IL
Sbjct  75   -LTNGPINPSWDVWFEGPQTSQGCRCQIL  102



>ref|XP_008786059.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Phoenix dactylifera]
Length=102

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E+ S A +E+L +VE+R DPLLP                                   
Sbjct  50   KTERVSAALQELLLIVESRPDPLLPV----------------------------------  75

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TN P NP WDRWFEGPQD  GC+C IL
Sbjct  76   --TNAPANPSWDRWFEGPQDLHGCKCWIL  102



>dbj|BAJ90712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=96

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELEKL++M+K S A +E +  +E++ADPLLP                             
Sbjct  38   ELEKLNKMDKVSAALQEFVVTIESKADPLLPV----------------------------  69

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T G     WDRWFEGPQD   C+C  L
Sbjct  70   --------TTGVAYQSWDRWFEGPQDLRRCKCWFL  96



>ref|XP_006838908.1| hypothetical protein AMTR_s00002p00269650 [Amborella trichopoda]
 gb|ERN01477.1| hypothetical protein AMTR_s00002p00269650 [Amborella trichopoda]
Length=103

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 41/89 (46%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +K S AC+E+L ++E + DPLLP                                   
Sbjct  51   KTQKVSAACQELLVLIEAKPDPLLP-----------------------------------  75

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGP NP WDRWFEG Q++ GCRC I+
Sbjct  76   -ITNGPANPAWDRWFEGAQESQGCRCWIV  103



>ref|XP_010923513.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Elaeis guineensis]
Length=102

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            R +  S A +E+L  VE+R DPLLP                                   
Sbjct  50   RTDTVSAALQELLLRVESRPDPLLPV----------------------------------  75

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              TNGP NP WDRWFEGPQD  GC+C IL
Sbjct  76   --TNGPANPSWDRWFEGPQDLHGCKCWIL  102



>gb|AFK38339.1| unknown [Medicago truncatula]
Length=109

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++L++ E     CKE+L+ +++R DPL+P+                            
Sbjct  51   ELDELEKTENVPAICKELLQNMDSRPDPLIPE----------------------------  82

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                     +GP+N  WDRWFEGPQD   CRC IL
Sbjct  83   --------VHGPVNLLWDRWFEGPQDPQACRCRIL  109



>ref|XP_010026933.1| PREDICTED: uncharacterized protein LOC104417334 [Eucalyptus grandis]
Length=397

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +MEKAS AC E+L  VE + DPLLP                                   
Sbjct  345  KMEKASVACMELLAHVEAKPDPLLPV----------------------------------  370

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+NP WDRWFEGPQD+  C C IL
Sbjct  371  --TTGPLNPLWDRWFEGPQDSKRCSCWIL  397



>ref|XP_010523656.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1 
isoform X2 [Tarenaya hassleriana]
Length=81

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  185  IFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + +VC  TNGP N  WDRWFEGP  A GCRCLIL
Sbjct  48   VSTVCEETNGPFNMAWDRWFEGPNGAQGCRCLIL  81



>ref|XP_007201427.1| hypothetical protein PRUPE_ppa013611mg [Prunus persica]
 gb|EMJ02626.1| hypothetical protein PRUPE_ppa013611mg [Prunus persica]
Length=113

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL +L+R E  S  C E+L   E  ADPLLP                             
Sbjct  55   ELGELERTENVSTICSELLPYAEGTADPLLPV----------------------------  86

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGPQD+  C C IL
Sbjct  87   --------TNGPVNLLWDRWFEGPQDSQRCSCRIL  113



>ref|XP_010274260.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
isoform X1 [Nelumbo nucifera]
Length=105

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 40/84 (48%), Gaps = 36/84 (43%)
 Frame = +2

Query  35   SGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTRTNG  214
            S AC+E++  +ETR+DPLLP                                     TNG
Sbjct  58   SAACQELMLKIETRSDPLLPV------------------------------------TNG  81

Query  215  PINPCWDRWFEGPQDASGCRCLIL  286
              NP W+RWFEGPQD++GCRC +L
Sbjct  82   LTNPSWNRWFEGPQDSNGCRCWML  105



>ref|XP_003556393.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform 1 [Glycine max]
 gb|KHN05047.1| hypothetical protein glysoja_013954 [Glycine soja]
Length=106

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 42/90 (47%), Gaps = 37/90 (41%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RMEKAS +CK ML  VET+ DPLLP                                   
Sbjct  53   RMEKASTSCKIMLINVETKPDPLLPS----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASG-CRCLIL  286
              + GP++P WDRWFEGPQD+   CRC IL
Sbjct  79   --SVGPLSPTWDRWFEGPQDSKSCCRCWIL  106



>ref|XP_009417106.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Musa acuminata subsp. malaccensis]
Length=105

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 42/95 (44%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+ +L+++EK S +  E+L  VE+R DPLLP+                            
Sbjct  45   EISELEKIEKVSASLHELLLQVESRRDPLLPE----------------------------  76

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T G  +  WDRWFEGPQD  GCRC + 
Sbjct  77   --------TTGSTSTSWDRWFEGPQDMPGCRCWVF  103



>ref|XP_011026086.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Populus euphratica]
Length=106

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +  S  C+E+L+ VE R DPLL                                    
Sbjct  54   KTDNLSIVCEELLRNVENRPDPLL------------------------------------  77

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + T+GP NP WDRWFEGPQD+ GCRC IL
Sbjct  78   SLTSGPANPLWDRWFEGPQDSQGCRCSIL  106



>ref|XP_004290641.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Fragaria vesca subsp. vesca]
Length=105

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            E+ +L+  E  S  C E+L  +E R DPLLP                             
Sbjct  47   EVGELENTENVSTICSELLPYIEGRPDPLLP-----------------------------  77

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGPIN  WD+WFEGPQ++  C CLIL
Sbjct  78   -------VTNGPINLIWDQWFEGPQNSQSCSCLIL  105



>ref|XP_008802280.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Phoenix dactylifera]
Length=102

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E+ S   +E+L  VE+R DPLLP+                                  
Sbjct  50   KTERVSATLQELLLEVESRPDPLLPE----------------------------------  75

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP NP WDRWFEGPQD  GC+C IL
Sbjct  76   --TIGPANPSWDRWFEGPQDLHGCKCWIL  102



>ref|XP_008438601.1| PREDICTED: uncharacterized protein LOC103483662 [Cucumis melo]
Length=176

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 40/84 (48%), Gaps = 36/84 (43%)
 Frame = +2

Query  26   EKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTR  205
            +KAS +CKE+L  VE R+DPLLP+                                    
Sbjct  122  DKASASCKELLGSVEMRSDPLLPE------------------------------------  145

Query  206  TNGPINPCWDRWFEGPQDASGCRC  277
            T GP+NP WD+WFEGP+D++ C C
Sbjct  146  TLGPVNPVWDQWFEGPKDSNRCHC  169



>ref|XP_009135837.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Brassica rapa]
 emb|CDX94882.1| BnaC03g43060D [Brassica napus]
 emb|CDX92967.1| BnaA03g36890D [Brassica napus]
Length=101

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  VE++ DPLLP+                                  
Sbjct  49   KMDTASASCKEFLDSVESKPDPLLPE----------------------------------  74

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP +A GC C IL
Sbjct  75   --TIGPVNATWDQWFEGPPEAKGCGCFIL  101



>ref|XP_004134111.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 gb|KGN56929.1| hypothetical protein Csa_3G144190 [Cucumis sativus]
Length=105

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 40/84 (48%), Gaps = 36/84 (43%)
 Frame = +2

Query  26   EKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTR  205
            +KAS +CKE+L  +E R+DPLLP+                                    
Sbjct  51   DKASTSCKELLGSIEMRSDPLLPE------------------------------------  74

Query  206  TNGPINPCWDRWFEGPQDASGCRC  277
            T GP+NP WDRWFEGP+D++ C C
Sbjct  75   TLGPVNPVWDRWFEGPKDSNRCHC  98



>gb|AIO11836.1| heterotrimeric G-protein gamma subunit 3 [Brassica rapa]
 gb|AIS73135.1| heterotrimeric G protein gamma subunit 3 [Brassica nigra]
Length=100

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  V+++ DPLLPQ                                  
Sbjct  48   KMDNASASCKEFLDSVDSKPDPLLPQ----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFE P++A  C C IL
Sbjct  74   --TIGPVNTTWDQWFERPKEAKRCGCFIL  100



>gb|AIO11835.1| heterotrimeric G-protein gamma subunit 2 [Brassica rapa]
 gb|AIS73134.1| heterotrimeric G protein gamma subunit 2 [Brassica nigra]
Length=101

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  VE++ DPLLP+                                  
Sbjct  49   KMDTASASCKEFLDSVESKPDPLLPE----------------------------------  74

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP +A GC C IL
Sbjct  75   --TIGPVNGTWDQWFEGPPEAKGCGCFIL  101



>ref|XP_004162262.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
Length=105

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 39/84 (46%), Gaps = 36/84 (43%)
 Frame = +2

Query  26   EKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTR  205
            +KAS  CKE+L  +E R+DPLLP+                                    
Sbjct  51   DKASTTCKELLGSIEMRSDPLLPE------------------------------------  74

Query  206  TNGPINPCWDRWFEGPQDASGCRC  277
            T GP+NP WDRWFEGP+D++ C C
Sbjct  75   TLGPVNPVWDRWFEGPKDSNRCHC  98



>ref|NP_567147.1| guanine nucleotide-binding protein subunit gamma 1 [Arabidopsis 
thaliana]
 ref|NP_850741.1| guanine nucleotide-binding protein subunit gamma 1 [Arabidopsis 
thaliana]
 sp|Q9FDX9.1|GG1_ARATH RecName: Full=Guanine nucleotide-binding protein subunit gamma 
1; AltName: Full=Ggamma-subunit 1; AltName: Full=Heterotrimeric 
G protein gamma-subunit 1; Short=AtAGG1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG45959.1|AF283673_1 heterotrimeric G protein gamma-subunit [Arabidopsis thaliana]
 gb|AAG45960.1|AF283674_1 heterotrimeric G protein gamma-subunit [Arabidopsis thaliana]
 dbj|BAD43578.1| heterotrimeric G protein gamma-subunit (AGG1) [Arabidopsis thaliana]
 gb|ABD38879.1| At3g63420 [Arabidopsis thaliana]
 gb|AEE80479.1| Ggamma-subunit 1 [Arabidopsis thaliana]
 gb|AEE80480.1| Ggamma-subunit 1 [Arabidopsis thaliana]
Length=98

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 42/95 (44%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++++  +  S  C+E+L ++E   DPLLP                             
Sbjct  40   ELKEVENTDIVSTVCEELLSVIEKGPDPLLP-----------------------------  70

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRCLIL
Sbjct  71   -------LTNGPLNLGWDRWFEGPNGGEGCRCLIL  98



>ref|XP_006406113.1| hypothetical protein EUTSA_v10022265mg [Eutrema salsugineum]
 gb|ESQ47566.1| hypothetical protein EUTSA_v10022265mg [Eutrema salsugineum]
Length=113

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 9/96 (9%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+L++M+ +S +CKE L  V+       P             +L S  +     I+  
Sbjct  26   ELEQLEKMDNSSASCKEFLDSVDISLILFFPS--------NPNSVLHSPFHTVRSFILID  77

Query  182  -SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               F    RT GP+N  WD+WFEGP++A  C C IL
Sbjct  78   LKAFVTTCRTTGPVNATWDQWFEGPKEAKRCGCSIL  113



>gb|AIS73133.1| heterotrimeric G protein gamma subunit 1 [Brassica nigra]
Length=89

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+L + +  S  C+E+L ++E   DPLLP                             
Sbjct  31   ELEELGQTDIVSAVCEELLCLIEKAPDPLLP-----------------------------  61

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRC IL
Sbjct  62   -------LTNGPLNLGWDRWFEGPDGGDGCRCFIL  89



>ref|XP_006292109.1| hypothetical protein CARUB_v10018305mg [Capsella rubella]
 gb|EOA25007.1| hypothetical protein CARUB_v10018305mg [Capsella rubella]
Length=98

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 42/95 (44%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL ++++ E  S  C+E+L ++E   DPLLP                             
Sbjct  40   ELVEVEQTEIVSAVCEELLCVIEKGPDPLLP-----------------------------  70

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRCLIL
Sbjct  71   -------LTNGPLNLGWDRWFEGPNGGEGCRCLIL  98



>gb|ACX43275.1| GTP binding protein gamma subunit [Brassica napus]
Length=100

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  VE++ DPLLP+                                  
Sbjct  48   KMDTASASCKEFLDSVESKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP +A GC C IL
Sbjct  74   --TIGPVNATWDQWFEGPPEAKGCGCSIL  100



>emb|CDY67558.1| BnaCnng55440D [Brassica napus]
Length=100

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS +CKE L  V+++ DPLLP                                   
Sbjct  48   KMDKASASCKEFLHSVDSKPDPLLPL----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFE P++A  C C IL
Sbjct  74   --TVGPVNATWDQWFERPKEAKRCGCFIL  100



>ref|XP_009116994.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1 
[Brassica rapa]
 emb|CDY11472.1| BnaA09g40380D [Brassica napus]
 gb|AIO11834.1| heterotrimeric G-protein gamma subunit 1 [Brassica rapa]
Length=89

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+L + +  S  C+E+L ++E   DPLLP                             
Sbjct  31   ELEELGQTDIVSAVCEELLCLIEKAPDPLLP-----------------------------  61

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRC IL
Sbjct  62   -------LTNGPLNLGWDRWFEGPDGGDGCRCFIL  89



>ref|XP_009370746.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
isoform X2 [Pyrus x bretschneideri]
Length=99

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            ++ ++C+ TNGP+N  WDRWFEGPQD+  C C IL
Sbjct  65   NVSTICSETNGPVNLVWDRWFEGPQDSQSCSCWIL  99



>ref|XP_002883385.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59644.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=100

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  VE++ DPLLP+                                  
Sbjct  48   KMDNASASCKEFLDSVESKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++A  C C IL
Sbjct  74   --TTGPVNDTWDQWFEGPKEAKRCGCSIL  100



>ref|XP_002876721.1| G-protein gamma-subunit 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52980.1| G-protein gamma-subunit 1 [Arabidopsis lyrata subsp. lyrata]
Length=96

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+++  +  S  C+E+L +VE   DPLLP                             
Sbjct  38   ELEEVESTDIVSTVCEELLCVVEKGPDPLLP-----------------------------  68

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP N  WDRWFEGP    GCRCLIL
Sbjct  69   -------LTNGPFNLGWDRWFEGPNGGEGCRCLIL  96



>ref|XP_006402277.1| hypothetical protein EUTSA_v10006334mg [Eutrema salsugineum]
 gb|ESQ43730.1| hypothetical protein EUTSA_v10006334mg [Eutrema salsugineum]
Length=99

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+L   +  S  C+E+L ++E   DPLLP                             
Sbjct  41   ELEELGHTDIVSNVCEELLCVIEKAPDPLLPL----------------------------  72

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRC IL
Sbjct  73   --------TNGPLNLGWDRWFEGPNGGEGCRCFIL  99



>ref|XP_009108481.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Brassica rapa]
 emb|CDY35482.1| BnaA01g24300D [Brassica napus]
Length=101

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS +CKE L  V+++ DPLLP                                   
Sbjct  49   KMDKASASCKEFLDSVDSKPDPLLP-----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFE P++A  C C IL
Sbjct  74   -LTIGPVNATWDQWFERPKEAKRCGCFIL  101



>emb|CDX76696.1| BnaC08g32820D [Brassica napus]
Length=89

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 41/95 (43%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE+L + +  S  C+E+L ++E   DPLLP                             
Sbjct  31   ELEELGQTDIVSTVCEELLFLIEKAPDPLLPL----------------------------  62

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRC +L
Sbjct  63   --------TNGPLNLGWDRWFEGPDGGDGCRCFML  89



>ref|NP_001240263.1| uncharacterized protein LOC100813941 [Glycine max]
 gb|ACU14015.1| unknown [Glycine max]
 gb|ACU18032.1| unknown [Glycine max]
Length=109

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 38/89 (43%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E  S  C E+L+ ++TR DPLLP+                                  
Sbjct  57   KTENVSTICTELLQNIDTRPDPLLPE----------------------------------  82

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               +GP+N  WDRWFEGPQD   CRC IL
Sbjct  83   --VHGPVNLLWDRWFEGPQDPQACRCWIL  109



>emb|CAB87795.1| putative protein [Arabidopsis thaliana]
Length=138

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 42/95 (44%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++++  +  S  C+E+L ++E   DPLLP                             
Sbjct  80   ELKEVENTDIVSTVCEELLSVIEKGPDPLLPL----------------------------  111

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    TNGP+N  WDRWFEGP    GCRCLIL
Sbjct  112  --------TNGPLNLGWDRWFEGPNGGEGCRCLIL  138



>ref|XP_010038703.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Eucalyptus grandis]
 gb|KCW84652.1| hypothetical protein EUGRSUZ_B01476 [Eucalyptus grandis]
Length=102

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 36/85 (42%), Gaps = 36/85 (42%)
 Frame = +2

Query  32   ASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTRTN  211
            AS  CKE+L  VE + D LLP                                     TN
Sbjct  54   ASSICKELLNYVEAKPDALLPV------------------------------------TN  77

Query  212  GPINPCWDRWFEGPQDASGCRCLIL  286
            GP NP W+RWFEG QD+ GCRC I+
Sbjct  78   GPANPSWNRWFEGFQDSEGCRCQIM  102



>ref|NP_850746.1| G-protein gamma subunit 2 [Arabidopsis thaliana]
 sp|Q93V47.1|GG2_ARATH RecName: Full=Guanine nucleotide-binding protein subunit gamma 
2; AltName: Full=Ggamma-subunit 2; AltName: Full=Heterotrimeric 
G protein gamma-subunit 2; Short=AtAGG2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK71536.1|AF347077_1 heterotrimeric G-protein gamma subunit 2 [Arabidopsis thaliana]
 gb|AAK71537.1|AF347078_1 heterotrimeric G-protein gamma subunit 2 [Arabidopsis thaliana]
 gb|ABD57482.1| At3g22942 [Arabidopsis thaliana]
 dbj|BAF00249.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76694.1| G-protein gamma subunit 2 [Arabidopsis thaliana]
Length=100

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 40/89 (45%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS +CKE L  V+++ DPLLP+                                  
Sbjct  48   KMDNASASCKEFLDSVDSKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++A  C C IL
Sbjct  74   --TTGPVNATWDQWFEGPKEAKRCGCSIL  100



>ref|XP_002302083.2| hypothetical protein POPTR_0002s04770g [Populus trichocarpa]
 gb|EEE81356.2| hypothetical protein POPTR_0002s04770g [Populus trichocarpa]
Length=106

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  206  TNGPINPCWDRWFEGPQDASGCRCLIL  286
            TNGP NP WDRWFEG QD+ GCRC IL
Sbjct  80   TNGPANPLWDRWFEGAQDSQGCRCSIL  106



>ref|XP_003536197.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Glycine max]
 gb|KHN30552.1| hypothetical protein glysoja_029989 [Glycine soja]
Length=106

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 39/90 (43%), Gaps = 37/90 (41%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + EKAS  CK M   VET+ DPLLP                                   
Sbjct  53   KTEKASTTCKVMPSNVETKPDPLLPS----------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASG-CRCLIL  286
              T GP++P WDRWFEGPQD+   CRC IL
Sbjct  79   --TVGPLSPAWDRWFEGPQDSKSCCRCWIL  106



>ref|XP_010466588.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Camelina sativa]
Length=101

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+ AS +CKE L  V+++ DPLLP+                                  
Sbjct  49   RMDNASASCKEFLDSVDSKPDPLLPE----------------------------------  74

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++   C C IL
Sbjct  75   --TTGPVNETWDQWFEGPKETKRCGCSIL  101



>ref|XP_010488328.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Camelina sativa]
Length=100

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+ AS +CKE L  V+++ DPLLP+                                  
Sbjct  48   RMDNASASCKEFLDSVDSKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++   C C IL
Sbjct  74   --TTGPVNETWDQWFEGPKETKRCGCSIL  100



>ref|XP_003518900.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Glycine max]
 gb|KHN18848.1| hypothetical protein glysoja_028217 [Glycine soja]
Length=109

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 38/89 (43%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E  S  C E+L+ +E+R DPLLP+                                  
Sbjct  57   KTENVSTICTELLQNMESRPDPLLPE----------------------------------  82

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               +GP+N  WDRWFEGPQD   CRC IL
Sbjct  83   --VHGPVNLLWDRWFEGPQDPQACRCWIL  109



>gb|KDP21388.1| hypothetical protein JCGZ_21859 [Jatropha curcas]
Length=107

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +  S  C+E+L+ V+   DPLL                                    
Sbjct  55   KTDNVSTICEELLRNVQISPDPLL------------------------------------  78

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + T GP+NP WDRWFEGPQ++ GCRC IL
Sbjct  79   SETIGPVNPLWDRWFEGPQESQGCRCWIL  107



>ref|XP_008368662.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X2 [Malus domestica]
Length=97

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            ++ ++C+ T GP+N  WDRWFEGPQD+  C C IL
Sbjct  63   NVSTICSETXGPVNLVWDRWFEGPQDSQSCSCGIL  97



>ref|NP_001152725.1| AGG2 [Zea mays]
 gb|ACG43762.1| AGG2 [Zea mays]
 gb|ACG49162.1| AGG2 [Zea mays]
Length=94

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 38/90 (42%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+ +K S A +E L  +E +ADPLLP                                  
Sbjct  41   DKADKVSSALQEFLIAMERKADPLLPV---------------------------------  67

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               + GP+N  WDRWFEGPQD  GC+C  L
Sbjct  68   ---SAGPVNQSWDRWFEGPQDLRGCKCWFL  94



>ref|XP_010523655.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1 
isoform X1 [Tarenaya hassleriana]
Length=96

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 4/50 (8%)
 Frame = +2

Query  149  LYCNVCHIVY*SIFSV----CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            +   VC  ++ +I ++       TNGP N  WDRWFEGP  A GCRCLIL
Sbjct  47   MVSTVCEELFSAIEAIPDPLLPLTNGPFNMAWDRWFEGPNGAQGCRCLIL  96



>ref|XP_008368654.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
isoform X1 [Malus domestica]
Length=112

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 35/89 (39%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            R E  S  C E+L  +E R DPLLP                                   
Sbjct  60   RTENVSTICSELLPYIEGRPDPLLPV----------------------------------  85

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WDRWFEGPQD+  C C IL
Sbjct  86   --TXGPVNLVWDRWFEGPQDSQSCSCGIL  112



>ref|XP_007144675.1| hypothetical protein PHAVU_007G175700g [Phaseolus vulgaris]
 gb|ESW16669.1| hypothetical protein PHAVU_007G175700g [Phaseolus vulgaris]
Length=107

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E  S  C ++L+ +E+R DPLLP+                                  
Sbjct  55   KTENVSTICMDLLQSMESRPDPLLPE----------------------------------  80

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               +GP+N  WDRWFEGPQD   CRC IL
Sbjct  81   --VHGPVNLLWDRWFEGPQDPQACRCWIL  107



>ref|XP_004982370.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Setaria italica]
Length=97

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 37/90 (41%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
             + +K S A +E L  +E++ADPLLP                                  
Sbjct  44   QKTDKVSSALQEFLTAMESKADPLLPV---------------------------------  70

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T GP+N  WDRWFEGPQD   C+C  L
Sbjct  71   ---TTGPVNQSWDRWFEGPQDLRRCKCWFL  97



>ref|XP_006298866.1| hypothetical protein CARUB_v10014985mg [Capsella rubella]
 gb|EOA31764.1| hypothetical protein CARUB_v10014985mg [Capsella rubella]
Length=100

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 37/89 (42%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+  S +CKE L  V+++ DPLLP+                                  
Sbjct  48   RMDNVSSSCKEFLDSVDSKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFE  ++A  C C IL
Sbjct  74   --TTGPVNETWDQWFEKTREAKRCGCTIL  100



>ref|XP_004495154.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X1 [Cicer arietinum]
 ref|XP_004495155.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X2 [Cicer arietinum]
 ref|XP_004495156.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X3 [Cicer arietinum]
Length=109

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 37/89 (42%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + E  S  C E+L+ +++R DPLLP+                                  
Sbjct  57   KTENVSAICMELLQNMDSRPDPLLPE----------------------------------  82

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                GP+N  WDRWFEGPQD   CRC IL
Sbjct  83   --VQGPVNLLWDRWFEGPQDPQACRCWIL  109



>ref|XP_010532589.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 
[Tarenaya hassleriana]
Length=100

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 39/89 (44%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+KAS +C+E    V+ + DPLLP+                                  
Sbjct  48   KMKKASASCQEFSDSVDNKPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+NP WDRWFEGP++   C C IL
Sbjct  74   --TAGPVNPVWDRWFEGPREPKRCGCPIL  100



>ref|XP_006350657.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
isoform X2 [Solanum tuberosum]
Length=77

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  191  SVCTRTNGPINPCWDRWFEGPQDASGCRCLI  283
            + C  TNGP NP WDRWFEG  D +GCRC I
Sbjct  46   AACKETNGPANPSWDRWFEGLNDIAGCRCWI  76



>ref|XP_002306804.1| heterotrimeric G protein gamma-subunit [Populus trichocarpa]
 gb|EEE93800.1| heterotrimeric G protein gamma-subunit [Populus trichocarpa]
Length=116

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 37/89 (42%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +  S  C+E+L+ VE   DPLL                                    
Sbjct  64   KTDNVSTVCEELLRNVENIPDPLL------------------------------------  87

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + TNGP NP WDRWFEGPQ + GC C IL
Sbjct  88   SLTNGPANPLWDRWFEGPQKSQGCVCRIL  116



>ref|XP_009370745.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1 
isoform X1 [Pyrus x bretschneideri]
Length=114

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 34/86 (40%), Gaps = 36/86 (42%)
 Frame = +2

Query  29   KASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVCTRT  208
              S  C E+L  +E R DPLLP                                     T
Sbjct  65   NVSTICSELLPYIEGRPDPLLPV------------------------------------T  88

Query  209  NGPINPCWDRWFEGPQDASGCRCLIL  286
            NGP+N  WDRWFEGPQD+  C C IL
Sbjct  89   NGPVNLVWDRWFEGPQDSQSCSCWIL  114



>ref|XP_010468849.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Camelina sativa]
Length=98

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL ++++ +  S  C+E+L  +E   DPLLP                             
Sbjct  40   ELVEVEKTDIVSNVCEELLCSIEKEPDPLLP-----------------------------  70

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGP    GCRCLIL
Sbjct  71   -------LTIGPLNLGWDRWFEGPNGGDGCRCLIL  98



>ref|XP_010413150.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Camelina sativa]
Length=98

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL ++++ +  S  C+E+L  +E   DPLLP                             
Sbjct  40   ELVEVEKTDIVSTVCEELLCAIEKEPDPLLP-----------------------------  70

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGP    GCRCLIL
Sbjct  71   -------LTIGPLNLGWDRWFEGPNGGDGCRCLIL  98



>ref|XP_010512760.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like 
[Camelina sativa]
Length=96

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL ++++ +  S  C+E+L  +E   DPLLP                             
Sbjct  38   ELVEVEKTDIVSTVCEELLCAIEKEPDPLLP-----------------------------  68

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGP    GCRCLIL
Sbjct  69   -------LTIGPLNLGWDRWFEGPNGGDGCRCLIL  96



>ref|XP_002464204.1| hypothetical protein SORBIDRAFT_01g014060 [Sorghum bicolor]
 gb|EER91202.1| hypothetical protein SORBIDRAFT_01g014060 [Sorghum bicolor]
Length=98

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 37/89 (42%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +K S A +E+L  +E +ADPLLP                                   
Sbjct  46   KADKVSSALQELLTAMERKADPLLPV----------------------------------  71

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              + GP+N  WDRWFEGPQD   C+C  L
Sbjct  72   --STGPVNQSWDRWFEGPQDLRRCKCWFL  98



>ref|XP_006406109.1| hypothetical protein EUTSA_v10021823mg [Eutrema salsugineum]
 gb|ESQ47562.1| hypothetical protein EUTSA_v10021823mg [Eutrema salsugineum]
Length=100

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            +M+ AS  CKE L  V++  DPLLP+                                  
Sbjct  48   KMDNASACCKEFLDSVDSNPDPLLPE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++A  C C IL
Sbjct  74   --TMGPVNATWDQWFEGPKEAKRCGCSIL  100



>ref|XP_010511917.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Camelina sativa]
Length=100

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 38/89 (43%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            RM+ AS +CKE L  V+++ DPLL +                                  
Sbjct  48   RMDNASASCKEFLDSVDSKPDPLLLE----------------------------------  73

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
              T GP+N  WD+WFEGP++   C C IL
Sbjct  74   --TTGPVNETWDQWFEGPKETKRCGCSIL  100



>ref|XP_011032620.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Populus euphratica]
Length=113

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 36/89 (40%), Gaps = 36/89 (40%)
 Frame = +2

Query  20   RMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSVC  199
            + +  S  C+E+L+ VE   DPLL                                    
Sbjct  61   KTDNVSTVCEELLRNVENTPDPLL------------------------------------  84

Query  200  TRTNGPINPCWDRWFEGPQDASGCRCLIL  286
            + TNGP NP WDRWFEGPQ +  C C IL
Sbjct  85   SLTNGPANPLWDRWFEGPQKSQDCVCRIL  113



>gb|ABK96688.1| unknown [Populus trichocarpa x Populus deltoides]
Length=120

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 38/87 (44%), Gaps = 36/87 (41%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++LD + ++S  C+E+L  VE+  DPLLP                             
Sbjct  65   ELDQLDTLGESSIVCQELLSSVESIPDPLLPS----------------------------  96

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDA  262
                    T GP+N  WDRWF+G Q++
Sbjct  97   --------TQGPVNASWDRWFKGNQNS  115



>ref|XP_002307445.1| hypothetical protein POPTR_0005s20180g [Populus trichocarpa]
 gb|EEE94441.1| hypothetical protein POPTR_0005s20180g [Populus trichocarpa]
Length=120

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 38/87 (44%), Gaps = 36/87 (41%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++LD + ++S  C+E+L  VE+  DPLLP                             
Sbjct  65   ELDQLDTLGESSIVCEELLSSVESIPDPLLPS----------------------------  96

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDA  262
                    T GP+N  WDRWF+G Q++
Sbjct  97   --------TQGPVNASWDRWFKGNQNS  115



>ref|XP_011003443.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Populus euphratica]
Length=120

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 38/87 (44%), Gaps = 36/87 (41%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL++LD + ++S  C+E+L  VE+  DPLLP                             
Sbjct  65   ELDQLDTLGESSIVCEELLSSVESIPDPLLPS----------------------------  96

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDA  262
                    T GP+N  WDRWF+G Q++
Sbjct  97   --------TQGPVNASWDRWFKGNQNS  115



>emb|CDX93908.1| BnaC04g20670D [Brassica napus]
Length=151

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 38/95 (40%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            ELE L + +  S  C+E+L ++E   DPLLP                             
Sbjct  93   ELEALGQTDIVSTVCEELLCVIEEAPDPLLPL----------------------------  124

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                    T GP+N  WDRWFEGP    GC C IL
Sbjct  125  --------TKGPLNLGWDRWFEGPNGGEGCICFIL  151



>ref|XP_004145370.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 ref|XP_004153998.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 ref|XP_004167404.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like 
[Cucumis sativus]
 gb|KGN61700.1| hypothetical protein Csa_2G228360 [Cucumis sativus]
Length=104

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 40/95 (42%), Gaps = 36/95 (38%)
 Frame = +2

Query  2    ELEKLDRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*  181
            EL+++++M   S  CK++L  +ET+ DPLLP                             
Sbjct  46   ELDEVEKMGNISSICKDLLPCIETKTDPLLPV----------------------------  77

Query  182  SIFSVCTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
                     NG +NP WDRWFEG   +  C C IL
Sbjct  78   --------LNGVVNPSWDRWFEGSPSSPECSCWIL  104



>gb|KFK35495.1| hypothetical protein AALP_AA5G292100 [Arabis alpina]
Length=102

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  206  TNGPINPCWDRWFEGPQDASGCRCLIL  286
            T+GP+N  WDRWFEGP    GCRCLIL
Sbjct  76   TSGPLNLGWDRWFEGPNGGEGCRCLIL  102



>ref|NP_001050720.1| Os03g0635100 [Oryza sativa Japonica Group]
 dbj|BAD15277.1| heterotrimeric G protein gamma subunit 1 [Oryza sativa Japonica 
Group]
 gb|ABF97778.1| heterotrimeric G protein protein gamma subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12634.1| Os03g0635100 [Oryza sativa Japonica Group]
 dbj|BAH00984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75798.1| hypothetical protein OsI_12732 [Oryza sativa Indica Group]
 gb|EEE59552.1| hypothetical protein OsJ_11830 [Oryza sativa Japonica Group]
 gb|ACY69169.1| G protein gamma subunit 1 [Oryza sativa Indica Group]
Length=93

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 36/90 (40%), Gaps = 36/90 (40%)
 Frame = +2

Query  17   DRMEKASGACKEMLKMVETRADPLLPQ*E**YP*FRVKCLLVSLLYCNVCHIVY*SIFSV  196
            D+ +K S A +E++   E++ADPLLP                                  
Sbjct  40   DKTDKVSAALQELMVTAESKADPLLPV---------------------------------  66

Query  197  CTRTNGPINPCWDRWFEGPQDASGCRCLIL  286
               T GP    WDRWFEGPQD   C+C  L
Sbjct  67   ---TTGPACQSWDRWFEGPQDLRRCKCWFL  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513327796892