BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21484_g1_i1 len=1091 path=[2527:0-1090]

Length=1091
                                                                      Score     E

gb|AFJ12112.1|  cellulose synthase                                      332   5e-107   
dbj|BAG06271.1|  cellulose synthase Z811                                324   7e-107   Zinnia violacea [garden zinnia]
dbj|BAD94098.1|  cellulose synthase catalytic subunit                   323   1e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73700.1|  hypothetical protein VITISV_013112                     338   5e-103   Vitis vinifera
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    337   1e-102   Vitis vinifera
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    334   9e-102   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    334   1e-101   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    334   1e-101   
gb|AFP93559.1|  cellulose synthase A1                                   334   1e-101   
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    333   2e-101   
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    333   3e-101   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    333   3e-101   
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    333   4e-101   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    333   5e-101   
ref|XP_010091161.1|  OsCesA7 protein                                    332   6e-101   
emb|CDP02834.1|  unnamed protein product                                332   6e-101   
gb|AHH81946.1|  cellulose synthase                                      332   9e-101   
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    332   9e-101   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    332   1e-100   
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    332   1e-100   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    330   2e-100   Ricinus communis
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                330   3e-100   
gb|ACT67415.1|  cellulose synthase                                      330   3e-100   Shorea parvifolia subsp. parvifolia
ref|XP_002308412.1|  cellulose synthase family protein                  330   4e-100   Populus trichocarpa [western balsam poplar]
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    330   4e-100   
gb|AGX27202.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27199.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27211.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27201.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27233.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27223.1|  cellulose synthase 7                                    330   4e-100   
gb|AFZ78559.1|  cellulose synthase                                      330   4e-100   
gb|AGX27215.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27238.1|  cellulose synthase 7                                    330   4e-100   
gb|AGX27212.1|  cellulose synthase 7                                    330   5e-100   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             330   5e-100   
gb|AGX27235.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27220.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27229.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27219.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27207.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27236.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27206.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27214.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27216.1|  cellulose synthase 7                                    330   5e-100   
gb|AGX27203.1|  cellulose synthase 7                                    330   5e-100   
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    329   7e-100   
gb|AFB18636.1|  CESA7                                                   329   1e-99    
gb|AFZ78551.1|  cellulose synthase                                      329   1e-99    
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    329   1e-99    
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     328   1e-99    
ref|XP_002325122.1|  cellulose synthase family protein                  328   2e-99    Populus trichocarpa [western balsam poplar]
gb|AEE60897.1|  cellulose synthase                                      328   2e-99    
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        328   2e-99    
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    328   2e-99    
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          328   3e-99    
gb|AEE60896.1|  cellulose synthase                                      328   3e-99    
gb|AEK31217.1|  cellulose synthase A                                    328   3e-99    
gb|AGJ71354.1|  cellulose synthase 3                                    328   3e-99    
gb|AGE09566.1|  cellulose synthase-like protein                         328   3e-99    
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     328   3e-99    
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           328   3e-99    
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     328   3e-99    
gb|ADD71499.1|  cellulose synthase catalytic subunit                    327   4e-99    
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    326   6e-99    
gb|EPS60781.1|  hypothetical protein M569_14019                         327   6e-99    
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    327   6e-99    
gb|AGX27231.1|  cellulose synthase 7                                    327   6e-99    
gb|AGX27205.1|  cellulose synthase 7                                    327   7e-99    
gb|AFB18637.1|  CESA8                                                   327   7e-99    
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    327   8e-99    
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    327   9e-99    
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    326   9e-99    
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    326   9e-99    
gb|AFR58756.2|  cellulose synthase 3                                    326   1e-98    
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    326   1e-98    
gb|AAM26299.1|  cellulose synthase                                      326   1e-98    Populus tremuloides
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             326   1e-98    
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    326   1e-98    
ref|XP_010905025.1|  PREDICTED: cellulose synthase A catalytic su...    325   2e-98    
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    325   2e-98    
gb|AGX27222.1|  cellulose synthase 7                                    325   2e-98    
gb|ACC59196.1|  cellulose synthase                                      325   2e-98    Betula platyphylla [Asian white birch]
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    325   2e-98    
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    325   2e-98    
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             325   2e-98    
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          325   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    325   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ACJ38665.1|  cellulose synthase                                      325   3e-98    Betula luminifera [liang ye hua]
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             325   3e-98    
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    325   3e-98    
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    325   3e-98    
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    325   3e-98    
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    325   3e-98    
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    325   3e-98    
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    325   4e-98    
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    325   4e-98    
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    325   4e-98    
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    325   4e-98    
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             325   5e-98    
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             325   6e-98    
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             324   7e-98    
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    323   1e-97    
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    324   1e-97    
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    323   1e-97    
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    323   1e-97    
gb|KEH32618.1|  cellulose synthase-like protein                         323   2e-97    
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               323   2e-97    
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    323   2e-97    
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                323   2e-97    
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    323   2e-97    
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    323   2e-97    
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    322   2e-97    
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    323   3e-97    
gb|AFW69155.1|  putative cellulose synthase family protein              321   3e-97    
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             322   4e-97    
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   322   5e-97    Eucalyptus globulus [blue gum]
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   322   5e-97    
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    322   6e-97    
gb|AAR29968.1|  putative cellulose synthase catalytic subunit           304   1e-96    Hordeum vulgare [barley]
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          321   1e-96    Sorghum bicolor [broomcorn]
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    321   1e-96    
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    321   1e-96    
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    320   2e-96    
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            320   3e-96    Zea mays [maize]
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    320   3e-96    
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        320   4e-96    
ref|NP_001063207.1|  Os09g0422500                                       319   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    319   5e-96    
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   319   5e-96    
dbj|BAJ85783.1|  predicted protein                                      318   1e-95    
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    318   1e-95    
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    318   1e-95    
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    318   2e-95    
ref|XP_002983910.1|  family 2 glycosyltransferase                       317   6e-95    
ref|XP_002960761.1|  cellulose synthase 4-1                             317   6e-95    
gb|AII73574.1|  cellulose synthase 7-A                                  316   7e-95    
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    315   1e-94    
ref|XP_008337189.1|  PREDICTED: cellulose synthase A catalytic su...    310   5e-94    
gb|ACF81885.1|  unknown                                                 293   1e-93    Zea mays [maize]
gb|AAT48368.1|  cellulose synthase catalytic subunit                    308   1e-93    Physcomitrella patens
gb|AFJ12110.1|  cellulose synthase                                      296   2e-93    
ref|XP_001775315.1|  predicted protein                                  302   2e-93    
gb|ABI78962.1|  cellulose synthase 10                                   300   1e-92    Physcomitrella patens
ref|XP_010491045.1|  PREDICTED: cellulose synthase A catalytic su...    291   5e-92    
ref|XP_002963550.1|  family 2 glycosyltransferase                       308   7e-92    
ref|XP_001757832.1|  predicted protein                                  307   2e-91    
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715              296   5e-91    
gb|ACN34934.1|  unknown                                                 286   6e-91    Zea mays [maize]
gb|KDO60380.1|  hypothetical protein CISIN_1g001574mg                   305   9e-91    
ref|XP_003638289.1|  hypothetical protein MTR_125s1017                  285   9e-91    
gb|KDO60379.1|  hypothetical protein CISIN_1g001574mg                   305   1e-90    
ref|XP_006443764.1|  hypothetical protein CICLE_v10018639mg             305   1e-90    
ref|XP_006479463.1|  PREDICTED: cellulose synthase A catalytic su...    305   1e-90    
ref|NP_001146633.1|  uncharacterized protein LOC100280232               285   2e-90    Zea mays [maize]
gb|AAB37767.1|  cellulose synthase                                      297   2e-90    Gossypium hirsutum [American cotton]
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              304   3e-90    
ref|XP_001767133.1|  cellulose synthase 4, glycosyltransferase fa...    304   3e-90    
ref|XP_002960291.1|  family 2 glycosyltransferase                       304   3e-90    
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              304   3e-90    
gb|ABI78960.1|  cellulose synthase 7                                    304   3e-90    Physcomitrella patens
gb|AAZ86086.1|  cellulose synthase catalytic subunit                    304   3e-90    Physcomitrella patens
gb|AAZ86087.1|  cellulose synthase catalytic subunit                    304   4e-90    Physcomitrella patens
ref|XP_002983952.1|  family 2 glycosyltransferase                       304   4e-90    
dbj|BAF01916.1|  cellulose synthase catalytic subunit                   289   4e-90    Arabidopsis thaliana [mouse-ear cress]
gb|ABI78959.1|  cellulose synthase 6                                    304   4e-90    Physcomitrella patens
gb|AEP33550.1|  truncated cellulose synthase catalytic subunit          296   4e-90    
gb|ADZ16122.1|  truncated cellulose synthase A3                         296   4e-90    
gb|AEP33542.1|  truncated cellulose synthase catalytic subunit          296   5e-90    
gb|AEP33544.1|  truncated cellulose synthase catalytic subunit          296   5e-90    
gb|EYU46413.1|  hypothetical protein MIMGU_mgv1a000605mg                300   7e-90    
gb|ADZ16118.1|  truncated cellulose synthase A3                         295   1e-89    
gb|ACC59197.1|  cellulose synthase                                      301   2e-89    Betula platyphylla [Asian white birch]
ref|XP_001776974.1|  cellulose synthase 10, glycosyltransferase f...    302   2e-89    
gb|AAQ63936.1|  cellulose synthase                                      300   4e-89    Pinus radiata
gb|AAQ63930.1|  cellulose synthase                                      283   4e-89    Pinus radiata
ref|XP_008785168.1|  PREDICTED: cellulose synthase A catalytic su...    300   4e-89    
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    301   5e-89    
ref|XP_004247500.1|  PREDICTED: cellulose synthase A catalytic su...    300   5e-89    
ref|XP_010934249.1|  PREDICTED: cellulose synthase A catalytic su...    300   5e-89    
gb|AGG91493.1|  cellulose synthase A4                                   300   5e-89    
gb|KDP26042.1|  hypothetical protein JCGZ_21075                         299   6e-89    
ref|XP_006838305.1|  hypothetical protein AMTR_s00103p00124340          300   6e-89    
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                300   6e-89    
ref|XP_011080097.1|  PREDICTED: cellulose synthase A catalytic su...    300   6e-89    
dbj|BAJ85304.1|  predicted protein                                      297   6e-89    
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    300   7e-89    
emb|CDP07782.1|  unnamed protein product                                300   8e-89    
gb|EPS69824.1|  hypothetical protein M569_04932                         300   8e-89    
ref|XP_006358416.1|  PREDICTED: cellulose synthase A catalytic su...    300   9e-89    
ref|XP_010088232.1|  OsCesA3 protein                                    300   9e-89    
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1         296   9e-89    
gb|KDP26483.1|  hypothetical protein JCGZ_17641                         300   9e-89    
gb|EYU46412.1|  hypothetical protein MIMGU_mgv1a000605mg                299   1e-88    
gb|KDO83413.1|  hypothetical protein CISIN_1g001413mg                   297   1e-88    
gb|ACJ38666.1|  cellulose synthase                                      299   1e-88    Betula luminifera [liang ye hua]
ref|XP_010653789.1|  PREDICTED: cellulose synthase A catalytic su...    299   1e-88    
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    299   2e-88    
emb|CBI29854.3|  unnamed protein product                                300   2e-88    
ref|XP_008460760.1|  PREDICTED: cellulose synthase A catalytic su...    299   2e-88    
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             299   2e-88    
ref|XP_004149389.1|  PREDICTED: cellulose synthase A catalytic su...    298   2e-88    
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             299   2e-88    
ref|XP_010262430.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    
emb|CBI37171.3|  unnamed protein product                                298   3e-88    
ref|XP_002273521.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    Vitis vinifera
ref|XP_002278997.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    Vitis vinifera
ref|XP_004162186.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    
ref|XP_010696484.1|  PREDICTED: cellulose synthase A catalytic su...    298   3e-88    
ref|XP_008784835.1|  PREDICTED: probable cellulose synthase A cat...    298   3e-88    
gb|ACU87559.2|  cellulose synthase                                      298   3e-88    
ref|XP_007050192.1|  Cellulose synthase A4 isoform 2                    298   3e-88    
ref|XP_007158869.1|  hypothetical protein PHAVU_002G188600g             298   4e-88    
ref|XP_007050191.1|  Cellulose synthase A4 isoform 1                    298   4e-88    
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    298   4e-88    
emb|CDP03783.1|  unnamed protein product                                298   4e-88    
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    298   5e-88    
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...    298   5e-88    
ref|XP_002459635.1|  hypothetical protein SORBIDRAFT_02g007810          298   5e-88    Sorghum bicolor [broomcorn]
ref|XP_006373780.1|  hypothetical protein POPTR_0016s05520g             298   5e-88    
gb|KCW89002.1|  hypothetical protein EUGRSUZ_A01324                     295   5e-88    
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    298   6e-88    
ref|XP_011033320.1|  PREDICTED: cellulose synthase A catalytic su...    298   6e-88    
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             298   6e-88    
gb|ACN34304.1|  unknown                                                 281   6e-88    Zea mays [maize]
ref|XP_008231249.1|  PREDICTED: cellulose synthase A catalytic su...    298   6e-88    
ref|XP_002322712.1|  cellulose synthase family protein                  297   6e-88    Populus trichocarpa [western balsam poplar]
ref|NP_001275292.1|  cellulose synthase                                 298   6e-88    
gb|AAY43221.1|  cellulose synthase BoCesA4                              297   6e-88    Bambusa oldhamii
ref|XP_009400929.1|  PREDICTED: cellulose synthase A catalytic su...    297   6e-88    
ref|XP_009781299.1|  PREDICTED: cellulose synthase A catalytic su...    297   6e-88    
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    297   6e-88    
ref|XP_009588113.1|  PREDICTED: cellulose synthase A catalytic su...    297   6e-88    
ref|XP_009588107.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
ref|XP_009781300.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
gb|AHL45026.1|  cellulose synthase 3B                                   297   7e-88    
ref|XP_011033321.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
ref|XP_009400930.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    297   7e-88    
gb|KDO83412.1|  hypothetical protein CISIN_1g001413mg                   297   7e-88    
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
ref|XP_009588096.1|  PREDICTED: cellulose synthase A catalytic su...    297   7e-88    
gb|KDO83405.1|  hypothetical protein CISIN_1g001413mg                   297   8e-88    
gb|ACF80398.1|  unknown                                                 278   8e-88    Zea mays [maize]
ref|XP_003594882.1|  Cellulose synthase                                 297   8e-88    
gb|AES65133.2|  cellulose synthase-like protein                         297   8e-88    
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    297   8e-88    
gb|AEX20379.1|  cellulose synthase catalytic subunit 2-At               297   8e-88    
gb|AIA10372.1|  cellulose synthase                                      297   9e-88    
ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    297   9e-88    
ref|XP_002308955.1|  cellulose synthase family protein                  297   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_011020351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    297   1e-87    
ref|XP_011048033.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    296   1e-87    
gb|AAY43220.1|  cellulose synthase BoCesA4                              296   1e-87    Bambusa oldhamii
dbj|BAJ87858.1|  predicted protein                                      295   1e-87    
gb|AFZ78564.1|  cellulose synthase                                      296   1e-87    
ref|XP_001769255.1|  cellulose synthase 8, glycosyltransferase fa...    297   1e-87    
gb|ACO06090.1|  cellulose synthase                                      296   1e-87    Phyllostachys edulis [kikko-chiku]
ref|XP_010937172.1|  PREDICTED: probable cellulose synthase A cat...    296   1e-87    
gb|AFZ78565.1|  cellulose synthase                                      296   1e-87    
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    296   1e-87    
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    296   1e-87    
gb|AEP33557.1|  cellulose synthase catalytic subunit                    296   1e-87    
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    296   1e-87    
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    296   1e-87    
ref|XP_010032436.1|  PREDICTED: cellulose synthase A catalytic su...    296   1e-87    
gb|AEE60898.1|  cellulose synthase                                      296   2e-87    
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1         296   2e-87    
ref|NP_001104958.1|  cellulose synthase8                                296   2e-87    Zea mays [maize]
ref|XP_009369423.1|  PREDICTED: cellulose synthase A catalytic su...    274   2e-87    
gb|AEP33538.1|  cellulose synthase catalytic subunit                    296   2e-87    
ref|XP_006657551.1|  PREDICTED: probable cellulose synthase A cat...    296   2e-87    
gb|ADZ16121.1|  cellulose synthase A3                                   296   2e-87    
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             296   2e-87    
gb|KHG03009.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    296   2e-87    
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...    296   2e-87    
gb|ACT16002.1|  cellulose synthase                                      296   2e-87    
ref|XP_003557327.1|  PREDICTED: probable cellulose synthase A cat...    296   2e-87    
ref|XP_002314037.1|  cellulose synthase family protein                  296   2e-87    
gb|AEP33552.1|  cellulose synthase catalytic subunit                    296   2e-87    
gb|AEP33547.1|  cellulose synthase catalytic subunit                    296   2e-87    
gb|EAZ03185.1|  hypothetical protein OsI_25338                          296   2e-87    
gb|AEP33537.1|  cellulose synthase catalytic subunit                    296   2e-87    
gb|AFG25777.1|  cellulose synthase 3                                    296   2e-87    
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    296   2e-87    
gb|AFZ78557.1|  cellulose synthase                                      296   2e-87    
gb|AAT66941.1|  CesA2                                                   296   2e-87    
gb|AEP33556.1|  cellulose synthase catalytic subunit                    296   2e-87    
gb|EMT09789.1|  Putative cellulose synthase A catalytic subunit 8...    296   2e-87    
gb|AEP33551.1|  cellulose synthase catalytic subunit                    296   2e-87    
ref|XP_006650766.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    296   2e-87    
ref|NP_001051648.1|  Os03g0808100                                       296   2e-87    
gb|AFB18638.1|  CESA10                                                  296   2e-87    
ref|NP_001105621.1|  cellulose synthase-4                               296   2e-87    
dbj|BAD06322.1|  putative cellulose synthase                            296   2e-87    
gb|AEP33543.1|  cellulose synthase catalytic subunit                    296   2e-87    
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein        296   2e-87    
gb|ADZ16123.1|  cellulose synthase A3                                   296   2e-87    
gb|AEP33554.1|  cellulose synthase catalytic subunit                    296   2e-87    
ref|NP_001059162.1|  Os07g0208500                                       296   2e-87    
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    296   2e-87    
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    296   2e-87    
ref|XP_004487957.1|  PREDICTED: cellulose synthase A catalytic su...    295   3e-87    
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    296   3e-87    
ref|XP_002298432.1|  hypothetical protein POPTR_0001s27320g             296   3e-87    
ref|XP_010045345.1|  PREDICTED: probable cellulose synthase A cat...    286   3e-87    
gb|ABI78958.1|  cellulose synthase 5                                    296   3e-87    
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    296   3e-87    
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    296   3e-87    
ref|NP_001059303.1|  Os07g0252400                                       296   3e-87    
gb|AEX20380.1|  cellulose synthase 2-Dt                                 295   3e-87    
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         295   3e-87    
gb|KHG10785.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    295   3e-87    
ref|XP_003540527.1|  PREDICTED: cellulose synthase A catalytic su...    295   3e-87    
ref|NP_001104959.1|  cellulose synthase-9                               295   4e-87    
gb|AIS85987.1|  cellulose synthase 3                                    295   4e-87    
ref|XP_002461675.1|  hypothetical protein SORBIDRAFT_02g006290          295   4e-87    
gb|AIS85991.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS85990.1|  cellulose synthase 3                                    295   4e-87    
gb|AFZ78554.1|  cellulose synthase                                      295   4e-87    
gb|AIS86011.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS86009.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS86004.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS85996.1|  cellulose synthase 3                                    295   4e-87    
ref|XP_010239070.1|  PREDICTED: probable cellulose synthase A cat...    293   4e-87    
gb|AAL23710.2|  cellulose synthase                                      295   4e-87    
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...    295   4e-87    
gb|AIS86005.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS85977.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS85989.1|  cellulose synthase 3                                    295   4e-87    
gb|AIS85978.1|  cellulose synthase 3                                    295   4e-87    
gb|AII73573.1|  cellulose synthase 4                                    295   4e-87    
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...    293   5e-87    
ref|XP_006658446.1|  PREDICTED: probable cellulose synthase A cat...    295   5e-87    
ref|XP_008348984.1|  PREDICTED: cellulose synthase A catalytic su...    295   5e-87    
ref|XP_003557396.1|  PREDICTED: probable cellulose synthase A cat...    295   5e-87    
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    295   5e-87    
gb|KHN37622.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    295   5e-87    
gb|AAY43222.1|  cellulose synthase BoCesA5                              295   5e-87    
gb|AAR29966.1|  putative cellulose synthase catalytic subunit           284   5e-87    
ref|XP_008339053.1|  PREDICTED: cellulose synthase A catalytic su...    294   5e-87    
ref|XP_010228235.1|  PREDICTED: probable cellulose synthase A cat...    295   6e-87    
gb|AAT57672.1|  cellulose synthase catalytic subunit                    295   6e-87    
ref|XP_004981340.1|  PREDICTED: probable cellulose synthase A cat...    295   6e-87    
gb|AAX18649.1|  cellulose synthase catalytic subunit                    295   6e-87    
ref|XP_003542849.1|  PREDICTED: cellulose synthase A catalytic su...    295   6e-87    
ref|XP_006857480.1|  hypothetical protein AMTR_s00067p00196920          294   6e-87    
ref|XP_004955797.1|  PREDICTED: probable cellulose synthase A cat...    295   6e-87    
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    295   6e-87    
gb|KHG02090.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    294   6e-87    
gb|AGJ71353.1|  cellulose synthase 2                                    294   6e-87    
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    295   6e-87    
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...    295   7e-87    
dbj|BAG90397.1|  unnamed protein product                                291   7e-87    
gb|AEK31216.1|  cellulose synthase A                                    294   7e-87    
ref|XP_008339052.1|  PREDICTED: cellulose synthase A catalytic su...    294   8e-87    
gb|ADZ16119.1|  cellulose synthase A3                                   294   8e-87    
gb|AEP33540.1|  cellulose synthase catalytic subunit                    294   8e-87    
ref|NP_001289665.1|  cellulose synthase A catalytic subunit 4           294   8e-87    
ref|XP_010534646.1|  PREDICTED: cellulose synthase A catalytic su...    291   8e-87    
gb|ABY25278.1|  cellulose synthase                                      294   8e-87    
gb|AAY60844.1|  cellulose synthase 2                                    294   8e-87    
ref|XP_002526560.1|  Cellulose synthase A catalytic subunit 6 [UD...    294   9e-87    
ref|XP_007028786.1|  Cellulose synthase family protein                  294   9e-87    
gb|AEK31218.1|  cellulose synthase A                                    294   1e-86    
ref|XP_009370338.1|  PREDICTED: cellulose synthase A catalytic su...    294   1e-86    
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    294   1e-86    
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    294   1e-86    
gb|AAP40636.1|  cellulose synthase 6                                    294   1e-86    
ref|XP_006382504.1|  cellulose synthase 6 family protein                294   1e-86    
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    294   1e-86    
gb|ADR74043.1|  cellulose synthase                                      294   1e-86    
gb|ADV58936.1|  cellulose synthase                                      294   1e-86    
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    294   1e-86    
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         294   1e-86    
gb|ADH95191.1|  cellulose synthase                                      294   1e-86    
gb|ACF83181.1|  unknown                                                 277   2e-86    
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    294   2e-86    
ref|XP_002319002.2|  cellulose synthase 6 family protein                294   2e-86    
ref|XP_004289981.1|  PREDICTED: cellulose synthase A catalytic su...    293   2e-86    
gb|AHL45025.1|  cellulose synthase 3A                                   293   2e-86    
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    293   2e-86    
gb|ADZ16120.1|  cellulose synthase A3                                   293   2e-86    
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     293   2e-86    
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    293   2e-86    
ref|XP_008461291.1|  PREDICTED: cellulose synthase A catalytic su...    293   2e-86    
ref|XP_009383229.1|  PREDICTED: probable cellulose synthase A cat...    291   2e-86    
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    293   3e-86    
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    293   3e-86    
dbj|BAK18576.1|  cellulose synthase catalytic subunit                   293   3e-86    
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    293   3e-86    
ref|XP_009364979.1|  PREDICTED: cellulose synthase A catalytic su...    293   3e-86    
gb|AEP33559.1|  cellulose synthase catalytic subunit                    293   3e-86    
gb|AEP33545.1|  cellulose synthase catalytic subunit                    293   3e-86    
gb|AEP33536.1|  cellulose synthase catalytic subunit                    293   3e-86    
dbj|BAK18577.1|  cellulose synthase catalytic subunit                   293   3e-86    
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    293   3e-86    
gb|ACJ38667.1|  cellulose synthase                                      293   3e-86    
gb|AAQ63935.1|  cellulose synthase                                      293   3e-86    
gb|AEP33553.1|  cellulose synthase catalytic subunit                    293   3e-86    
gb|AEP33539.1|  cellulose synthase catalytic subunit                    293   3e-86    
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    293   3e-86    
gb|AAY43223.2|  cellulose synthase BoCesA6                              291   3e-86    
ref|XP_006289427.1|  hypothetical protein CARUB_v10002932mg             293   3e-86    
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    293   4e-86    
gb|AAY43224.2|  cellulose synthase BoCesA7                              293   4e-86    
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...    292   4e-86    
ref|XP_003532664.1|  PREDICTED: cellulose synthase A catalytic su...    292   4e-86    
gb|ACC59195.1|  cellulose synthase                                      293   4e-86    
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...    292   4e-86    
ref|NP_001104955.1|  cellulose synthase5                                292   4e-86    
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    292   5e-86    
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    292   5e-86    
ref|XP_001753310.1|  putative cellulose synthase 3, glycosyltrans...    292   5e-86    
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    292   5e-86    
tpg|DAA52080.1|  TPA: cellulose synthase5                               292   5e-86    
ref|XP_004981131.1|  PREDICTED: probable cellulose synthase A cat...    293   5e-86    
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    292   6e-86    
ref|XP_004135931.1|  PREDICTED: cellulose synthase A catalytic su...    292   6e-86    
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    292   6e-86    
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    292   6e-86    
ref|XP_004981132.1|  PREDICTED: probable cellulose synthase A cat...    292   6e-86    
ref|XP_004981130.1|  PREDICTED: probable cellulose synthase A cat...    292   6e-86    
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    292   7e-86    
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           291   7e-86    
ref|XP_007199679.1|  hypothetical protein PRUPE_ppa000641mg             291   7e-86    
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    292   7e-86    
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    292   7e-86    
gb|AFI71895.1|  cellulose synthase 6                                    292   8e-86    
gb|EEC81930.1|  hypothetical protein OsI_25789                          291   8e-86    
ref|NP_001051830.1|  Os03g0837100                                       292   8e-86    
dbj|BAJ96780.1|  predicted protein                                      291   8e-86    
gb|ACT78709.1|  cellulose synthase 4                                    291   8e-86    
gb|AGW52070.1|  cellulose synthase 4                                    291   8e-86    
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    292   8e-86    
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             292   8e-86    
gb|AGW52045.1|  cellulose synthase 4                                    291   8e-86    
ref|XP_008235611.1|  PREDICTED: cellulose synthase A catalytic su...    291   8e-86    
gb|AGW52062.1|  cellulose synthase 4                                    291   8e-86    
gb|AGW52072.1|  cellulose synthase 4                                    291   8e-86    
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    292   9e-86    
gb|AGW52058.1|  cellulose synthase 4                                    291   9e-86    
gb|AGW52061.1|  cellulose synthase 4                                    291   9e-86    
gb|AFZ78555.1|  cellulose synthase                                      291   9e-86    
gb|AEP33541.1|  cellulose synthase catalytic subunit                    291   9e-86    
gb|KCW87523.1|  hypothetical protein EUGRSUZ_B03971                     287   9e-86    
gb|AGW52047.1|  cellulose synthase 4                                    291   9e-86    
gb|AGW52042.1|  cellulose synthase 4                                    291   9e-86    
gb|AGW52040.1|  cellulose synthase 4                                    291   9e-86    
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          291   9e-86    
gb|AGW52078.1|  cellulose synthase 4                                    291   1e-85    
gb|AGV22107.1|  cellulose synthase 2                                    291   1e-85    
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2        291   1e-85    
gb|KHG24504.1|  putative cellulose synthase A catalytic subunit 1...    283   1e-85    
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...    291   1e-85    
gb|AFZ78563.1|  cellulose synthase                                      291   1e-85    
gb|AGW52043.1|  cellulose synthase 4                                    291   1e-85    
gb|AEE60895.1|  cellulose synthase                                      291   1e-85    
gb|ABY25277.1|  cellulose synthase                                      291   1e-85    
gb|AGW52073.1|  cellulose synthase 4                                    291   1e-85    
ref|XP_011024456.1|  PREDICTED: cellulose synthase A catalytic su...    291   1e-85    
ref|XP_011024455.1|  PREDICTED: cellulose synthase A catalytic su...    291   1e-85    
gb|AGW52057.1|  cellulose synthase 4                                    291   1e-85    
gb|AGW52052.1|  cellulose synthase 4                                    291   1e-85    
gb|AGW52077.1|  cellulose synthase 4                                    291   1e-85    
ref|XP_002301856.1|  hypothetical protein POPTR_0002s25970g             290   2e-85    
gb|AGW52065.1|  cellulose synthase 4                                    290   2e-85    
ref|XP_002455101.1|  hypothetical protein SORBIDRAFT_03g004320          279   2e-85    
gb|AGW52051.1|  cellulose synthase 4                                    290   2e-85    
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    291   2e-85    
gb|AGW52038.1|  cellulose synthase 4                                    290   2e-85    
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    291   2e-85    
gb|EEE67058.1|  hypothetical protein OsJ_24012                          291   2e-85    
ref|NP_001059487.1|  Os07g0424400                                       291   2e-85    
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    291   2e-85    
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    291   2e-85    
gb|KHN28928.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    290   2e-85    
gb|AAT09894.1|  cellulose synthase                                      290   2e-85    
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    290   3e-85    
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg             290   3e-85    
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...    290   4e-85    
dbj|BAJ33658.1|  unnamed protein product                                290   4e-85    
ref|NP_001104956.1|  cellulose synthase6                                290   4e-85    
ref|XP_008648127.1|  PREDICTED: cellulose synthase6 isoform X1          290   5e-85    
emb|CDY14127.1|  BnaC02g02440D                                          289   6e-85    
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    289   6e-85    
ref|XP_009125590.1|  PREDICTED: cellulose synthase A catalytic su...    289   7e-85    
emb|CDY04942.1|  BnaAnng01240D                                          289   7e-85    
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             289   7e-85    
gb|ACS88359.1|  cellulose synthase catalytic subunit                    282   7e-85    
ref|NP_001104957.1|  cellulose synthase7                                289   8e-85    
ref|XP_009130870.1|  PREDICTED: cellulose synthase A catalytic su...    289   8e-85    
gb|AFI71894.1|  cellulose synthase 3                                    289   8e-85    
emb|CDY52141.1|  BnaA03g55200D                                          289   8e-85    
gb|AAD39534.2|  cellulose synthase catalytic subunit                    289   9e-85    
gb|AFM37965.1|  cellulose synthase catalytic subunit                    288   9e-85    
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    288   9e-85    
emb|CDX80951.1|  BnaC03g02050D                                          288   1e-84    



>gb|AFJ12112.1| cellulose synthase, partial [Nicotiana tabacum]
Length=410

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 198/208 (95%), Positives = 204/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  203   LPAVCLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  262

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  263   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  322

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  323   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  382

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVKQCG+NC
Sbjct  383   IFSLLWVRIDPFVLKTKGPDVKQCGLNC  410



>dbj|BAG06271.1| cellulose synthase Z811 [Zinnia elegans]
Length=206

 Score =   324 bits (830),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 203/207 (98%), Gaps = 1/207 (0%)
 Frame = -2

Query  1087  PAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGGI  908
             PAICLLTGKFIMPEISTLASLFFI+LFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG+
Sbjct  1     PAICLLTGKFIMPEISTLASLFFISLFLSIFATGILELRWSGVSIEEWWRNEQFWVIGGV  60

Query  907   SAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVGV  728
             SAHLFAV+QGLLK+LAGIDTNFTVTSKA +DEEFGELY F WTTLLIPPTTILIIN+VGV
Sbjct  61    SAHLFAVIQGLLKVLAGIDTNFTVTSKATEDEEFGELYAF-WTTLLIPPTTILIINMVGV  119

Query  727   VAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASI  548
             VAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVVIWS+LLASI
Sbjct  120   VAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVIWSILLASI  179

Query  547   FSLLWVRIDPFVLKTKGPDVKQCGINC  467
             FSLLWVRIDPFVLKTKGPDVKQCG+NC
Sbjct  180   FSLLWVRIDPFVLKTKGPDVKQCGLNC  206



>dbj|BAD94098.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=251

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  44    LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  103

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKIL GIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  104   ISAHLFAVVQGLLKILTGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  163

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  164   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  223

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  224   IFSLLWVRIDPFVLKTKGPDTSKCGINC  251



>emb|CAN73700.1| hypothetical protein VITISV_013112 [Vitis vinifera]
Length=1024

 Score =   338 bits (866),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  817   LPAICLLTGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  876

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKAVDDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  877   VSAHLFAVVQGLLKVLAGIDTNFTVTSKAVDDEEFGELYTFKWTTLLIPPTTLLIINLVG  936

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  937   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  996

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+LKTKGPDVKQCGINC
Sbjct  997   IFSLLWVRIDPFILKTKGPDVKQCGINC  1024



>ref|XP_002276890.2| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Vitis vinifera]
 emb|CBI36551.3| unnamed protein product [Vitis vinifera]
Length=1037

 Score =   337 bits (864),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  830   LPAICLLTGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  889

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKAVDDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  890   VSAHLFAVVQGLLKVLAGIDTNFTVTSKAVDDEEFGELYTFKWTTLLIPPTTLLIINLVG  949

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  950   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1009

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+LKTKGPDVKQCGINC
Sbjct  1010  IFSLLWVRIDPFILKTKGPDVKQCGINC  1037



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   334 bits (857),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  822   LPAICLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  881

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  882   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  941

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  942   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1001

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1002  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1029



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   334 bits (857),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  830   LPAICLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  889

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  890   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  949

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  950   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1009

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1010  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1037



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   334 bits (857),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1036



>gb|AFP93559.1| cellulose synthase A1 [Neolamarckia cadamba]
Length=1041

 Score =   334 bits (856),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 197/208 (95%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTGKFIMPEISTFASLFFIALFLSIFTTGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDEEFGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEEFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG ++WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+IWS+LLAS
Sbjct  954   VVAGISDAINNGYRSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVKQCGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDVKQCGINC  1041



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 198/208 (95%), Positives = 204/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAVCLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  954   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVKQCG+NC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDVKQCGLNC  1041



>ref|XP_009622822.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1041

 Score =   333 bits (854),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 198/208 (95%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAVCLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD+ FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDNFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  954   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVKQCG+NC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDVKQCGLNC  1041



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   333 bits (854),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 197/208 (95%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTGKFIMPEISTFASLFFIALFLSIFITGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  954   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+LKTKGPD KQCGINC
Sbjct  1014  IFSLLWVRIDPFILKTKGPDTKQCGINC  1041



>ref|XP_009622821.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1079

 Score =   333 bits (855),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 198/208 (95%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEIST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  872   LPAVCLLTGKFIMPEISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  931

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD+ FGELY FKWTTLLIPPTTILIINLVG
Sbjct  932   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDNFGELYAFKWTTLLIPPTTILIINLVG  991

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  992   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1051

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVKQCG+NC
Sbjct  1052  IFSLLWVRIDPFVLKTKGPDVKQCGLNC  1079



>ref|XP_010273667.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nelumbo nucifera]
Length=1039

 Score =   333 bits (853),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 197/208 (95%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLKILAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  892   VSAHLFAVVQGLLKILAGIDTNFTVTSKASDDEEFGELYTFKWTTLLIPPTTLLIINLVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  952   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+K KGPD KQCGINC
Sbjct  1012  IFSLLWVRIDPFVVKAKGPDTKQCGINC  1039



>ref|XP_010091161.1| OsCesA7 protein [Morus notabilis]
 gb|EXB42931.1| OsCesA7 protein [Morus notabilis]
Length=1042

 Score =   332 bits (852),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 204/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  835   LPAICLLTDKFIMPPISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  894

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKAVDDE+FGELYTFKWTTLLIPPTT+LIIN+VG
Sbjct  895   VSAHLFAVVQGLLKVLAGIDTNFTVTSKAVDDEDFGELYTFKWTTLLIPPTTLLIINIVG  954

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGI+DAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  955   VVAGIADAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1014

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPDVKQCG+NC
Sbjct  1015  IFSLLWVRIDPFVMKTKGPDVKQCGLNC  1042



>emb|CDP02834.1| unnamed protein product [Coffea canephora]
Length=1041

 Score =   332 bits (852),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTGKFIMPEISTFASLFFIALFLSIFTTGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDTNFTVTSKA DD++F ELY FKWTTLLIPPTTIL+INLVG
Sbjct  894   ISAHLFAVIQGLLKVLAGIDTNFTVTSKASDDDDFAELYAFKWTTLLIPPTTILVINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNGSQ+WGPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIV+IWSVLLAS
Sbjct  954   VVAGISDAINNGSQSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVIIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+LKTKGPDVKQCGINC
Sbjct  1014  IFSLLWVRIDPFILKTKGPDVKQCGINC  1041



>gb|AHH81946.1| cellulose synthase [Boehmeria nivea]
Length=1039

 Score =   332 bits (851),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASL+FI+LFLSI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTDKFIMPPISTFASLYFISLFLSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKAVDDE+FGELYTFKWTTLLIPPTT+LIIN++G
Sbjct  892   VSAHLFAVVQGLLKVLAGIDTNFTVTSKAVDDEDFGELYTFKWTTLLIPPTTLLIINIIG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGI+DAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  952   VVAGIADAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPDVKQCG+NC
Sbjct  1012  IFSLLWVRIDPFVMKTKGPDVKQCGLNC  1039



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   332 bits (850),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  827   LPAVCLLTGKFIMPTISTFASLFFIALFISIFATGILEMRWSGVSIEEWWRNEQFWVIGG  886

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLKILAGIDTNFTVTSKA DDEEFGELY FKWTTLLIPPTT+LIINLVG
Sbjct  887   VSAHLFAVVQGLLKILAGIDTNFTVTSKASDDEEFGELYAFKWTTLLIPPTTLLIINLVG  946

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  947   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1006

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLK+KGPD KQCGINC
Sbjct  1007  IFSLLWVRIDPFVLKSKGPDTKQCGINC  1034



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEISTLASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAVCLLTGKFIMPEISTLASLFFIALFLSIFTTGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVVQGLLKILAGIDTNFTVTSKATDDEDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  954   VVAGISDAINNGYNSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVK+CG+NC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDVKRCGVNC  1041



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMPEISTLASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAVCLLTGKFIMPEISTLASLFFIALFLSIFTTGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVVQGLLKILAGIDTNFTVTSKATDDEDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  954   VVAGISDAINNGYNSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPDVK+CG+NC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDVKRCGVNC  1041



>ref|XP_002533228.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF29149.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
Length=977

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  770   LPAICLLTDKFIMPEISTFASLFFIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  829

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+F ELY FKWTTLLIPPTTILIINLVG
Sbjct  830   ISAHLFAVVQGLLKVLAGIDTNFTVTSKATDDEDFAELYAFKWTTLLIPPTTILIINLVG  889

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  890   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  949

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  950   IFSLLWVRIDPFVMKTKGPDTKQCGINC  977



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   330 bits (847),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTGKFIMPEISTFASLFFIALFLSIFITGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLKILAGIDTNFTVTSKA DDE+F ELY FKWTTLLIPPTTIL+INLVG
Sbjct  889   VSAHLFAVIQGLLKILAGIDTNFTVTSKASDDEDFSELYAFKWTTLLIPPTTILVINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF++KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFIVKTKGPDTKQCGINC  1036



>gb|ACT67415.1| cellulose synthase [Shorea parvifolia subsp. parvifolia]
Length=1040

 Score =   330 bits (847),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASL FIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPPISTFASLLFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+L+INLVG
Sbjct  893   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTVLVINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVI+HLYPFLKGLMGRQNRTPTIVVIWS LLAS
Sbjct  953   VVAGISDAINNGYQSWGPLFGKLFFSFWVILHLYPFLKGLMGRQNRTPTIVVIWSNLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1040



>ref|XP_002308412.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91935.1| cellulose synthase family protein [Populus trichocarpa]
Length=1027

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  820   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  879

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  880   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  939

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  940   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  999

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1000  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1027



>ref|XP_011033387.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Populus euphratica]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27202.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27208.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27210.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27230.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27199.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27209.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27218.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27221.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27224.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27211.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27232.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27201.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27233.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27223.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AFZ78559.1| cellulose synthase [Populus tomentosa]
 gb|AGX27198.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27200.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27204.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27213.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27215.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27238.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27212.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>ref|XP_006381880.1| hypothetical protein POPTR_0006s19580g [Populus trichocarpa]
 gb|ERP59677.1| hypothetical protein POPTR_0006s19580g [Populus trichocarpa]
Length=1036

 Score =   330 bits (846),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27235.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (846),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27220.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27226.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27229.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27219.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27225.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27228.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27207.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27236.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27206.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27227.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27234.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27214.1| cellulose synthase 7 [Populus tomentosa]
Length=1037

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  830   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  889

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  890   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  949

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  950   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1009

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1010  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1037



>gb|AGX27216.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27217.1| cellulose synthase 7 [Populus tomentosa]
 gb|AGX27237.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27203.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>ref|XP_011018058.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Populus euphratica]
Length=1032

 Score =   329 bits (844),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDEDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KT+GPD KQCG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTRGPDTKQCGLNC  1032



>gb|AFB18636.1| CESA7 [Gossypium hirsutum]
 gb|AIE38017.1| cellulose synthase-7 [Gossypium hirsutum]
Length=1042

 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  835   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  894

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLK+LAGIDTNFTVTSK  DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  895   ISAHLFAVVQGLLKVLAGIDTNFTVTSKTTDDEEFGELYTFKWTTLLIPPTTVLIINLVG  954

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  955   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1014

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  QCGINC
Sbjct  1015  IFSLLWVRIDPFVLKTKGPDTTQCGINC  1042



>gb|AFZ78551.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPEISTFASLFFIALFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KT+GPD KQCG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTRGPDTKQCGLNC  1032



>gb|KHG19749.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1057

 Score =   329 bits (844),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  850   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  909

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLK+LAGIDTNFTVTSK  DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  910   ISAHLFAVVQGLLKVLAGIDTNFTVTSKTTDDEEFGELYTFKWTTLLIPPTTVLIINLVG  969

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  970   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1029

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  QCGINC
Sbjct  1030  IFSLLWVRIDPFVLKTKGPDTTQCGINC  1057



>gb|KCW78813.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1012

 Score =   328 bits (841),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  805   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  864

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  865   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  924

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  925   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  984

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  985   IFSLLWVRIDPFVLKTKGPDTKKCGINC  1012



>ref|XP_002325122.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF03687.1| cellulose synthase family protein [Populus trichocarpa]
Length=1032

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KT+GPD KQCG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTRGPDTKQCGLNC  1032



>gb|AEE60897.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPEISTFASLFFIALFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KT+GPD KQCG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTRGPDTKQCGLNC  1032



>ref|XP_007013859.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOY31478.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1043

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  836   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  895

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLK+LAGIDTNFTVTSKA DDEEFGELY FKWTTLLIPPTT+LIINLVG
Sbjct  896   ISAHLFAVVQGLLKVLAGIDTNFTVTSKATDDEEFGELYAFKWTTLLIPPTTVLIINLVG  955

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  956   VVAGVSDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1015

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  QCGINC
Sbjct  1016  IFSLLWVRIDPFVLKTKGPDTTQCGINC  1043



>ref|XP_009410192.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Musa acuminata subsp. malaccensis]
Length=1047

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAICLLTDKFIMPTISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+LIIN++G
Sbjct  900   ISAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTVLIINIIG  959

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  960   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1019

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF++K+KGPD +QCGINC
Sbjct  1020  IFSLLWVRIDPFIIKSKGPDTRQCGINC  1047



>ref|XP_006826669.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
 gb|ERM93906.1| hypothetical protein AMTR_s00137p00043990 [Amborella trichopoda]
Length=1047

 Score =   328 bits (841),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLL+GKFIMP IST ASLFFI+LFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAICLLSGKFIMPTISTFASLFFISLFLSIFVTGILELRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDEEFGELY FKWTTLLIPPTT+LIINLVG
Sbjct  900   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDEEFGELYAFKWTTLLIPPTTLLIINLVG  959

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  960   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1019

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGP  KQCGINC
Sbjct  1020  IFSLLWVRIDPFVIKTKGPTTKQCGINC  1047



>gb|AEE60896.1| cellulose synthase [Populus tomentosa]
Length=1036

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGIL LRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILGLRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGHQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AEK31217.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1040

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  953   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1040



>gb|AGJ71354.1| cellulose synthase 3 [Eucalyptus urophylla]
Length=1040

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  953   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1040



>gb|AGE09566.1| cellulose synthase-like protein [Eucalyptus cladocalyx]
Length=1041

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  954   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1041



>gb|KCW78815.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1041

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  954   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1041



>ref|NP_001289644.1| cellulose synthase A catalytic subunit 7 [Eucalyptus grandis]
 gb|AAY60845.1| cellulose synthase 3 [Eucalyptus grandis]
Length=1040

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  953   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1040



>gb|KCW78814.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  953   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1040



>gb|ADD71499.1| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=1042

 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP ISTL     +  F      GILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  835   LPAICLLTDKFIMPPISTLQVYSSLPCFFQSLQLGILELRWSGVSIEEWWRNEQFWVIGG  894

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  895   ISAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTVLIINLVG  954

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  955   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1014

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  1015  IFSLLWVRIDPFVMKTKGPDTTMCGINC  1042



>gb|KHG11460.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=996

 Score =   326 bits (836),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  789   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  848

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  849   ISAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTVLIINLVG  908

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  909   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  968

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  969   IFSLLWVRIDPFVMKTKGPDTTMCGINC  996



>gb|EPS60781.1| hypothetical protein M569_14019 [Genlisea aurea]
Length=1043

 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 203/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEISTLASL FIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  836   LPAICLLTGKFIMPEISTLASLVFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  895

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKI+AGIDTNFTVTSKA DDE+F ELYTFKWTTLLIPPTTILIIN+VG
Sbjct  896   ISAHLFAVVQGLLKIIAGIDTNFTVTSKASDDEDFSELYTFKWTTLLIPPTTILIINMVG  955

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAIN+G Q+WGPLFGK+FFAFWVIVHLYPFLKGLMG+QNRTPTIV+IWS+LLAS
Sbjct  956   VVAGISDAINSGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGKQNRTPTIVIIWSILLAS  1015

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF++KTKGPD K+CGINC
Sbjct  1016  IFSLLWVRIDPFIMKTKGPDTKKCGINC  1043



>ref|XP_003527198.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Glycine max]
 gb|KHN42479.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] [Glycine 
soja]
Length=1039

 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGILELKWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  892   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTILIINIVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  952   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1012  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1039



>gb|AGX27231.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGIL LRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILGLRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AGX27205.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   327 bits (838),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI LFLSIF+TGIL LRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMPEISTFASLFFIGLFLSIFSTGILGLRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|AFB18637.1| CESA8 [Gossypium hirsutum]
Length=1039

 Score =   327 bits (837),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTT+LIINLVG
Sbjct  892   ISAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTVLIINLVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  952   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  1012  IFSLLWVRIDPFVMKTKGPDTTMCGINC  1039



>ref|XP_003549532.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoformX1 [Glycine max]
Length=1033

 Score =   327 bits (837),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  886   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTFKWTTLLIPPTTILIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1033



>ref|XP_006600535.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1034

 Score =   327 bits (837),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  827   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  886

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  887   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTFKWTTLLIPPTTILIINIVG  946

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  947   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1006

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1007  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1034



>ref|XP_003519160.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Glycine max]
Length=1033

 Score =   326 bits (836),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  886   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTFKWTTLLIPPTTILIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1033



>gb|KHN14136.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] [Glycine 
soja]
Length=1033

 Score =   326 bits (836),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  886   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTFKWTTLLIPPTTILIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1033



>gb|AFR58756.2| cellulose synthase 3 [Eucalyptus tereticornis]
Length=1040

 Score =   326 bits (836),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SIFATGILELRWSGVSI+EWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPAISTFASLFFIALFMSIFATGILELRWSGVSIKEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDDEDFGELYAFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  953   VVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKKCGINC  1040



>ref|XP_010929171.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Elaeis guineensis]
Length=1048

 Score =   326 bits (836),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLL+GKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAVCLLSGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDE EFGELY FKWTTLLIPPTT+LIINLV
Sbjct  900   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEDEFGELYAFKWTTLLIPPTTLLIINLV  959

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  960   GVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  1019

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+KTKGPDV QCGINC
Sbjct  1020  SIFSLLWVRIDPFVMKTKGPDVTQCGINC  1048



>gb|AAM26299.1| cellulose synthase [Populus tremuloides]
Length=1032

 Score =   326 bits (835),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPEISTFASLFFIALFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGID NFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   VSAHLFAVVQGLLKVLAGIDLNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KT+GPD KQCG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTRGPDTKQCGLNC  1032



>ref|XP_007138395.1| hypothetical protein PHAVU_009G205100g [Phaseolus vulgaris]
 gb|ESW10389.1| hypothetical protein PHAVU_009G205100g [Phaseolus vulgaris]
Length=1041

 Score =   326 bits (835),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+FIALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAVCLLTDKFIMPPISTFAGLYFIALFSSIIATGVLELKWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  894   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTILIINIVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  954   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1041



>gb|KHN17507.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   326 bits (836),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  845   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  904

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  905   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTFKWTTLLIPPTTILIINIVG  964

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  965   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1024

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1025  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1052



>ref|XP_010905025.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
isoform X2 [Elaeis guineensis]
Length=1007

 Score =   325 bits (833),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  799   LPAVCLLTGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  858

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDE EFGELY FKWTTLLIPPTT+LIINLV
Sbjct  859   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEDEFGELYAFKWTTLLIPPTTLLIINLV  918

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  919   GVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  978

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+K KGPDV+QCGINC
Sbjct  979   SIFSLLWVRIDPFVMKAKGPDVRQCGINC  1007



>gb|KFK25952.1| hypothetical protein AALP_AA8G184200 [Arabis alpina]
Length=1035

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  828   LPAICLLTDKFIMPPISTFASLFFIALFSSIIATGILELRWSGVSIEEWWRNEQFWVIGG  887

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  888   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  947

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  948   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1007

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1008  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1035



>gb|AGX27222.1| cellulose synthase 7 [Populus tomentosa]
Length=1036

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIM EIST ASLFFI LFLSIF+TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  829   LPAICLLTDKFIMLEISTFASLFFIGLFLSIFSTGILELRWSGVSIEEWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTTILIINLVG
Sbjct  889   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTILIINLVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  949   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD KQCGINC
Sbjct  1009  IFSLLWVRIDPFVMKTKGPDTKQCGINC  1036



>gb|ACC59196.1| cellulose synthase [Betula platyphylla]
Length=1040

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASL+FIALF+SIF TGILELRWSGV+IEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPPISTFASLYFIALFMSIFITGILELRWSGVTIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA DDE+FGELYTFKWTTLLIPPTTILIINLVG
Sbjct  893   VSAHLFAVFQGLLKVLAGIDTNFTVTSKATDDEDFGELYTFKWTTLLIPPTTILIINLVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG ++WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  953   VVAGISDAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1013  IFSLLWVRIDPFVLKTKGPDTKNCGINC  1040



>gb|KFK25953.1| hypothetical protein AALP_AA8G184200 [Arabis alpina]
Length=1037

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  830   LPAICLLTDKFIMPPISTFASLFFIALFSSIIATGILELRWSGVSIEEWWRNEQFWVIGG  889

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  890   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  949

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  950   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1009

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1010  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1037



>ref|XP_003522926.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Glycine max]
 gb|KHN11139.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] [Glycine 
soja]
Length=1039

 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGILELKWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYTFKWTTLLIPPTTILIIN+VG
Sbjct  892   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYTFKWTTLLIPPTTILIINIVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  952   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLK KGPD K CGINC
Sbjct  1012  IFSLLWVRIDPFVLKNKGPDTKLCGINC  1039



>ref|XP_002873827.1| hypothetical protein ARALYDRAFT_909737 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50086.1| hypothetical protein ARALYDRAFT_909737 [Arabidopsis lyrata subsp. 
lyrata]
Length=1025

 Score =   325 bits (833),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  818   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  877

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  878   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  937

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  938   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  997

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  998   IFSLLWVRIDPFVLKTKGPDTSKCGINC  1025



>gb|AAD32031.1|AF088917_1 cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=1026

 Score =   325 bits (833),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  819   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  878

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  879   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  938

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  939   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  998

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  999   IFSLLWVRIDPFVLKTKGPDTSKCGINC  1026



>ref|NP_197244.1| cellulose synthase A catalytic subunit 7 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q9SWW6.1|CESA7_ARATH RecName: Full=Cellulose synthase A catalytic subunit 7 [UDP-forming]; 
Short=AtCesA7; AltName: Full=Protein FRAGILE FIBER 
5; AltName: Full=Protein IRREGULAR XYLEM 3; Short=AtIRX3 [Arabidopsis 
thaliana]
 gb|AAD40885.1|AF091713_1 cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAC01737.1| cellulose synthase catalytic subunit (IRX3) [Arabidopsis thaliana]
 gb|AAM98075.1| AT5g17420/T10B6_80 [Arabidopsis thaliana]
 gb|AAO42789.1| AT5g17420/T10B6_80 [Arabidopsis thaliana]
 gb|AED92424.1| cellulose synthase A catalytic subunit 7 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38621.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1026

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  819   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  878

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  879   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  938

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  939   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  998

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  999   IFSLLWVRIDPFVLKTKGPDTSKCGINC  1026



>gb|ACJ38665.1| cellulose synthase [Betula luminifera]
Length=1041

 Score =   325 bits (834),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASL+FIALF+SIF TGILELRWSGV+IEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTDKFIMPPISTFASLYFIALFMSIFITGILELRWSGVTIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA DDE+FGELYTFKWTTLLIPPTTILIINLVG
Sbjct  894   VSAHLFAVFQGLLKVLAGIDTNFTVTSKATDDEDFGELYTFKWTTLLIPPTTILIINLVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG ++WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  954   VVAGISDAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDTKNCGINC  1041



>ref|XP_006286973.1| hypothetical protein CARUB_v10000119mg [Capsella rubella]
 gb|EOA19871.1| hypothetical protein CARUB_v10000119mg [Capsella rubella]
Length=1033

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  886   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1033



>ref|XP_010453933.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X1 [Camelina sativa]
Length=1033

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  886   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1033



>ref|XP_010492694.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Camelina sativa]
Length=1033

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  886   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1033



>ref|XP_010420461.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Camelina sativa]
Length=1033

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  826   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  885

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  886   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  945

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  946   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1005

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1006  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1033



>ref|XP_010453934.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X2 [Camelina sativa]
Length=1031

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  824   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  883

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  884   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  943

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  944   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1003

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1004  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1031



>ref|XP_010420462.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Camelina sativa]
Length=1031

 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFI+LF+SI  TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  824   LPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGG  883

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  884   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  943

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  944   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1003

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD  +CGINC
Sbjct  1004  IFSLLWVRIDPFVLKTKGPDTSKCGINC  1031



>ref|XP_008794369.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1049

 Score =   325 bits (833),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 203/209 (97%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  841   LPAVCLLTGKFIMPTISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  900

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDE EFG+LY FKWTTLLIPPTT+LIINLV
Sbjct  901   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEDEFGDLYAFKWTTLLIPPTTLLIINLV  960

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  961   GVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  1020

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFVLK+KGPDV+QCGINC
Sbjct  1021  SIFSLLWVRIDPFVLKSKGPDVRQCGINC  1049



>ref|XP_008243020.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Prunus mume]
Length=1069

 Score =   325 bits (834),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  862   LPAVCLLTDKFIMPSISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  921

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  922   VSAHLFAVIQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  981

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  982   VVAGISDAINNGYQSWGPLFGKLFFSFWVIIHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1041

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1042  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1069



>ref|XP_010545449.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010545450.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1032

 Score =   325 bits (832),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAVCLLTDKFIMPPISTFASLFFIALFSSIIATGILELRWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DDE+FGELY FKWTTLLIPPTT+LIINLVG
Sbjct  885   ISAHLFAVVQGLLKILAGIDTNFTVTSKAADDEDFGELYAFKWTTLLIPPTTVLIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD   CGINC
Sbjct  1005  IFSLLWVRIDPFVLKTKGPDPTMCGINC  1032



>ref|XP_010905024.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
isoform X1 [Elaeis guineensis]
Length=1048

 Score =   325 bits (833),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAVCLLTGKFIMPTISTFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDE EFGELY FKWTTLLIPPTT+LIINLV
Sbjct  900   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEDEFGELYAFKWTTLLIPPTTLLIINLV  959

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  960   GVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  1019

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+K KGPDV+QCGINC
Sbjct  1020  SIFSLLWVRIDPFVMKAKGPDVRQCGINC  1048



>ref|XP_006400279.1| hypothetical protein EUTSA_v10012538mg [Eutrema salsugineum]
 gb|ESQ41732.1| hypothetical protein EUTSA_v10012538mg [Eutrema salsugineum]
Length=1041

 Score =   325 bits (832),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF+SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  834   LPAICLLTDKFIMPPISTFASLFFIALFMSIIATGILELRWSGVSIEEWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  894   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  954   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD   CGINC
Sbjct  1014  IFSLLWVRIDPFVLKTKGPDTSMCGINC  1041



>ref|XP_007204670.1| hypothetical protein PRUPE_ppa000618mg [Prunus persica]
 gb|EMJ05869.1| hypothetical protein PRUPE_ppa000618mg [Prunus persica]
Length=1069

 Score =   325 bits (832),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  862   LPAVCLLTDKFIMPSISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGG  921

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  922   VSAHLFAVIQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  981

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  982   VVAGISDAINNGYQSWGPLFGKLFFSFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1041

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD KQCGINC
Sbjct  1042  IFSLLWVRIDPFVLKTKGPDTKQCGINC  1069



>ref|XP_007154868.1| hypothetical protein PHAVU_003G154600g [Phaseolus vulgaris]
 gb|ESW26862.1| hypothetical protein PHAVU_003G154600g [Phaseolus vulgaris]
Length=1031

 Score =   324 bits (830),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATG+LEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  824   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGLLELKWSGVSIEEWWRNEQFWVIGG  883

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEF ELYTFKWTTLLIPPTTILIIN+VG
Sbjct  884   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFSELYTFKWTTLLIPPTTILIINIVG  943

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  944   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1003

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1004  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1031



>ref|XP_004152851.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004163057.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming]-like [Cucumis sativus]
 gb|KGN61215.1| hypothetical protein Csa_2G070320 [Cucumis sativus]
Length=1032

 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  825   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELKWSGVSIEEWWRNEQFWVIGG  884

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDT+FTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  885   ISAHLFAVIQGLLKVLAGIDTSFTVTSKATDDEDFGELYAFKWTTLLIPPTTILIINLVG  944

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  945   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1004

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD K+CG+NC
Sbjct  1005  IFSLLWVRIDPFVMKTKGPDTKKCGLNC  1032



>ref|XP_008450511.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Cucumis melo]
Length=1068

 Score =   324 bits (830),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALFLSIFATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  861   LPAICLLTDKFIMPPISTFASLFFIALFLSIFATGILELKWSGVSIEEWWRNEQFWVIGG  920

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAV+QGLLK+LAGIDT+FTVTSKA DDE+FGELY FKWTTLLIPPTTILIINLVG
Sbjct  921   ISAHLFAVIQGLLKVLAGIDTSFTVTSKATDDEDFGELYAFKWTTLLIPPTTILIINLVG  980

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  981   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1040

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD K+CG+NC
Sbjct  1041  IFSLLWVRIDPFVMKTKGPDTKKCGLNC  1068



>ref|XP_008790154.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 9 [UDP-forming]-like [Phoenix dactylifera]
Length=1048

 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAVCLLTGKFIMPTISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDE E+G+LY FKWTTL IPPTT+LIINLV
Sbjct  900   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEDEYGDLYAFKWTTLXIPPTTLLIINLV  959

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  960   GVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  1019

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+K KGPDV+QCGINC
Sbjct  1020  SIFSLLWVRIDPFVIKAKGPDVRQCGINC  1048



>ref|XP_008394301.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming]-like [Malus domestica]
Length=1068

 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  861   LPAVCLLTDKFIMPQISTFASLFFIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  920

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  921   VSAHLFAVVQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  980

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  981   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1040

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1041  IFSLLWVRIDPFVLKTKGPDTKXCGINC  1068



>gb|KEH32618.1| cellulose synthase-like protein [Medicago truncatula]
Length=1072

 Score =   323 bits (829),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASL+F+ALF SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  865   LPAVCLLTDKFIMPPISTFASLYFVALFSSIMATGILELKWSGVSIEEWWRNEQFWVIGG  924

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELY  KWTTLLIPPTTILIIN+VG
Sbjct  925   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYAIKWTTLLIPPTTILIINIVG  984

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  985   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1044

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD K CGINC
Sbjct  1045  IFSLLWVRIDPFVMKTKGPDTKLCGINC  1072



>ref|XP_003610282.1| Cellulose synthase catalytic subunit [Medicago truncatula]
 gb|AES92479.1| cellulose synthase-like protein [Medicago truncatula]
Length=1038

 Score =   323 bits (828),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASL+F+ALF SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  831   LPAVCLLTDKFIMPPISTFASLYFVALFSSIMATGILELKWSGVSIEEWWRNEQFWVIGG  890

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELY  KWTTLLIPPTTILIIN+VG
Sbjct  891   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATDDEEFGELYAIKWTTLLIPPTTILIINIVG  950

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  951   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1010

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD K CGINC
Sbjct  1011  IFSLLWVRIDPFVMKTKGPDTKLCGINC  1038



>ref|XP_009358418.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1068

 Score =   323 bits (829),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  861   LPAVCLLTDKFIMPQISTFASLFFIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  920

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAVVQGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  921   VSSHLFAVVQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  980

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  981   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1040

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGP+ KQCGINC
Sbjct  1041  IFSLLWVRIDPFVLKTKGPNTKQCGINC  1068



>gb|ACS68197.1| cellulose synthase 7.1 catalytic subunit [Brassica napus]
Length=1031

 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  824   LPAICLLTDKFIMPPISTFASLFFIALFGSIIATGILELRWSGVSIEEWWRNEQFWVIGG  883

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  884   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  943

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  944   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1003

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  1004  IFSLLWVRIDPFVMKTKGPDTSMCGINC  1031



>ref|XP_004507755.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Cicer arietinum]
Length=1039

 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST A L+F+ALF SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAVCLLTDKFIMPPISTFAGLYFVALFSSIIATGILELKWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA DDEEFGELYT KWTTLLIPPTTILIIN+VG
Sbjct  892   VSAHLFAVIQGLLKVLAGIDTNFTVTSKAADDEEFGELYTIKWTTLLIPPTTILIINIVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMG+QNRTPTIVVIWSVLLAS
Sbjct  952   VVAGVSDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGKQNRTPTIVVIWSVLLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFVLKTKGPD K CGINC
Sbjct  1012  IFSLLWVRIDPFVLKTKGPDTKLCGINC  1039



>ref|XP_009131595.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Brassica rapa]
Length=1034

 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  827   LPAICLLTDKFIMPPISTFASLFFIALFGSIIATGILELRWSGVSIEEWWRNEQFWVIGG  886

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  887   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  946

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  947   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1006

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  1007  IFSLLWVRIDPFVMKTKGPDTSMCGINC  1034



>ref|XP_009126184.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming] [Brassica rapa]
Length=1025

 Score =   322 bits (826),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMP IST ASLFFIALF SI ATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  818   LPAICLLTDKFIMPPISTFASLFFIALFGSIIATGILELRWSGVSIEEWWRNEQFWVIGG  877

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA DD++FGELY FKWTTLLIPPTT+LIIN+VG
Sbjct  878   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVG  937

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  938   VVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  997

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD   CGINC
Sbjct  998   IFSLLWVRIDPFVMKTKGPDTSMCGINC  1025



>ref|XP_009366208.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1068

 Score =   323 bits (827),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  861   LPAVCLLTDKFIMPQISTFASLFFIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  920

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAVVQGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  921   VSSHLFAVVQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  980

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  981   VVAGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1040

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGP+ KQCGINC
Sbjct  1041  IFSLLWVRIDPFVMKTKGPNTKQCGINC  1068



>gb|AFW69155.1| putative cellulose synthase family protein [Zea mays]
Length=981

 Score =   321 bits (823),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  772   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  831

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  832   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINI  891

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  892   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  951

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDV+QCGINC
Sbjct  952   ASIFSLLWVRIDPFIVRTKGPDVRQCGINC  981



>ref|XP_006453581.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
 gb|ESR66821.1| hypothetical protein CICLE_v10007321mg [Citrus clementina]
Length=1040

 Score =   322 bits (825),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALF+SIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTDKFIMPEISTFASLFFIALFISIFTTGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA D DEEFGELY+FKWTTLLIPPTT+LIINLV
Sbjct  892   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDEDEEFGELYSFKWTTLLIPPTTVLIINLV  951

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWS+LLA
Sbjct  952   GVVAGISDAINNGYQSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSILLA  1011

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+KTKGP   +CGINC
Sbjct  1012  SIFSLLWVRIDPFVMKTKGPATTKCGINC  1040



>dbj|BAF93202.1| cellulose synthase catalytic subunit [Eucalyptus globulus]
 dbj|BAI47542.1| cellulose synthase catalytic subunit [Eucalyptus globulus subsp. 
globulus]
Length=1041

 Score =   322 bits (825),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 199/209 (95%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsif-aTGILELRWSGVSIEEWWRNEQFWVIG  914
             LPAICLLT +FIMP IST ASLF IALF+SI  ATGILELRWSGVSIEEWWRNEQFWVIG
Sbjct  833   LPAICLLTDRFIMPAISTFASLFLIALFMSIQFATGILELRWSGVSIEEWWRNEQFWVIG  892

Query  913   GISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLV  734
             G+SAHLFAVVQGLLK+LAGIDTNFTVTSK+ DDE+FGELY FKWTTLLIPPTTILIINLV
Sbjct  893   GVSAHLFAVVQGLLKVLAGIDTNFTVTSKSSDDEDFGELYAFKWTTLLIPPTTILIINLV  952

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG QAWGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWSVLLA
Sbjct  953   GVVAGISDAINNGYQAWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSVLLA  1012

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFVLKTKGPD K+CGINC
Sbjct  1013  SIFSLLWVRIDPFVLKTKGPDTKKCGINC  1041



>gb|KDO62270.1| hypothetical protein CISIN_1g039060mg [Citrus sinensis]
Length=1040

 Score =   322 bits (824),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFIALF+SIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTDKFIMPEISTFASLFFIALFISIFTTGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA D DEEFGELY+FKWTTLLIPPTT+LIINLV
Sbjct  892   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDEDEEFGELYSFKWTTLLIPPTTVLIINLV  951

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWS+LLA
Sbjct  952   GVVAGISDAINNGYQSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSILLA  1011

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+KTKGP   +CGINC
Sbjct  1012  SIFSLLWVRIDPFVMKTKGPATTKCGINC  1040



>ref|XP_004956855.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Setaria italica]
Length=1050

 Score =   322 bits (825),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  841   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  900

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  901   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINI  960

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  961   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1020

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDVKQCGINC
Sbjct  1021  ASIFSLLWVRIDPFIVRTKGPDVKQCGINC  1050



>gb|AAR29968.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=362

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 194/210 (92%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEW RNEQ WVIGG
Sbjct  153   LPAVCLLTGKFIMPPISTFASLFFISLFISIFATGILELRWSGVSIEEWCRNEQLWVIGG  212

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             + AHLFAV+QGLLK+LAGIDT FTVTSKA   +D+EF ELY FKWTTLLIP TT+L+IN+
Sbjct  213   VWAHLFAVIQGLLKVLAGIDTKFTVTSKATGYEDDEFAELYAFKWTTLLIPQTTLLVINI  272

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKG MGRQNRTPTIV+IWSVLL
Sbjct  273   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGFMGRQNRTPTIVIIWSVLL  332

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             AS+FSLLWVRIDPF +K KGPDVKQCGINC
Sbjct  333   ASMFSLLWVRIDPFTVKAKGPDVKQCGINC  362



>ref|XP_002460229.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
 gb|EER96750.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
Length=1049

 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  840   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  900   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINI  959

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  960   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1019

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDV+QCGINC
Sbjct  1020  ASIFSLLWVRIDPFIVRTKGPDVRQCGINC  1049



>ref|XP_008670200.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Zea mays]
 tpg|DAA40096.1| TPA: putative cellulose synthase family protein [Zea mays]
 gb|AIL25252.1| cellulose synthase catalytic subunit 13 [Zea mays]
Length=1052

 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  843   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  902

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  903   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINI  962

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  963   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1022

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDV+QCGINC
Sbjct  1023  ASIFSLLWVRIDPFIVRTKGPDVRQCGINC  1052



>ref|XP_006474027.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1041

 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 200/209 (96%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI+LF+SIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  833   LPAICLLTDKFIMPEISTFASLFFISLFISIFTTGILELRWSGVSIEEWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA D D+EFGELY+FKWTTLLIPPTT+LIINLV
Sbjct  893   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDEDDEFGELYSFKWTTLLIPPTTVLIINLV  952

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWS+LLA
Sbjct  953   GVVAGISDAINNGYQSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSILLA  1012

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+KTKGP   +CGINC
Sbjct  1013  SIFSLLWVRIDPFVMKTKGPATTKCGINC  1041



>ref|XP_006474028.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
Length=1040

 Score =   320 bits (821),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 200/209 (96%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFIMPEIST ASLFFI+LF+SIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  832   LPAICLLTDKFIMPEISTFASLFFISLFISIFTTGILELRWSGVSIEEWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             ISAHLFAVVQGLLKILAGIDTNFTVTSKA D D+EFGELY+FKWTTLLIPPTT+LIINLV
Sbjct  892   ISAHLFAVVQGLLKILAGIDTNFTVTSKATDEDDEFGELYSFKWTTLLIPPTTVLIINLV  951

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAINNG Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVIWS+LLA
Sbjct  952   GVVAGISDAINNGYQSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVIWSILLA  1011

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV+KTKGP   +CGINC
Sbjct  1012  SIFSLLWVRIDPFVMKTKGPATTKCGINC  1040



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   320 bits (820),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  843   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  902

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  903   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINV  962

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPT+VVIWS+LL
Sbjct  963   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTVVVIWSILL  1022

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDV+QCGINC
Sbjct  1023  ASIFSLLWVRIDPFIVRTKGPDVRQCGINC  1052



>ref|XP_003578137.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Brachypodium distachyon]
Length=1051

 Score =   320 bits (819),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 201/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  842   LPAVCLLTGKFIMPPISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA   +D+EF ELYTFKWTTLLIPPTT+LIIN+
Sbjct  902   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYTFKWTTLLIPPTTLLIINI  961

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+IWSVLL
Sbjct  962   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIIWSVLL  1021

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K KGPDV+QCGINC
Sbjct  1022  ASIFSLLWVRIDPFTVKAKGPDVRQCGINC  1051



>tpg|DAA61529.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1056

 Score =   320 bits (819),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 202/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  847   LPAVCLLTGKFIMPSISTFASLFFIALFMSIFATGILEMRWSGVSIEEWWRNEQFWVIGG  906

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LIIN+
Sbjct  907   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLIINV  966

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPT+VVIWS+LL
Sbjct  967   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTVVVIWSILL  1026

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF+++TKGPDV+QCGINC
Sbjct  1027  ASIFSLLWVRIDPFIVRTKGPDVRQCGINC  1056



>ref|NP_001063207.1| Os09g0422500 [Oryza sativa Japonica Group]
 sp|Q69P51.1|CESA9_ORYSJ RecName: Full=Cellulose synthase A catalytic subunit 9 [UDP-forming]; 
AltName: Full=OsCesA9 [Oryza sativa Japonica Group]
 sp|A2Z1C8.1|CESA9_ORYSI RecName: Full=Cellulose synthase A catalytic subunit 9 [UDP-forming]; 
AltName: Full=OsCesA9 [Oryza sativa Indica Group]
 dbj|BAD33412.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAD33645.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAF25121.1| Os09g0422500 [Oryza sativa Japonica Group]
 gb|EAZ09139.1| hypothetical protein OsI_31409 [Oryza sativa Indica Group]
 gb|EAZ44775.1| hypothetical protein OsJ_29406 [Oryza sativa Japonica Group]
 dbj|BAH00349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1055

 Score =   319 bits (818),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 201/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  846   LPAVCLLTGKFIMPPISTFASLFFIALFISIFATGILEMRWSGVSIEEWWRNEQFWVIGG  905

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LI+N+
Sbjct  906   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLILNI  965

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAG+SDAINNGS+AWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  966   IGVVAGVSDAINNGSEAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1025

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K +GPDV+QCGINC
Sbjct  1026  ASIFSLLWVRIDPFTIKARGPDVRQCGINC  1055



>ref|XP_004287144.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1049

 Score =   319 bits (818),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASLFFIALF+SIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  842   LPAVCLLTDKFIMPPISTFASLFFIALFISIFGTGILELRWSGVSIEEWWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV+QGLLK+LAGIDT+FTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLVG
Sbjct  902   VSAHLFAVIQGLLKVLAGIDTSFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVG  961

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG ++WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  962   VVAGISDAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1021

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGP  KQCGINC
Sbjct  1022  IFSLLWVRIDPFVMKTKGPTTKQCGINC  1049



>dbj|BAJ05813.1| cellulose synthase catalytic subunit [Oryza sativa Indica Group]
Length=1055

 Score =   319 bits (818),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 201/210 (96%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  846   LPAVCLLTGKFIMPPISTFASLFFIALFISIFATGILEMRWSGVSIEEWWRNEQFWVIGG  905

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LI+N+
Sbjct  906   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLILNI  965

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAG+SDAINNGS+AWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  966   IGVVAGVSDAINNGSEAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1025

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K +GPDV+QCGINC
Sbjct  1026  ASIFSLLWVRIDPFTIKARGPDVRQCGINC  1055



>dbj|BAJ85783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AIY30130.1| cellulose synthase 8 [Hordeum vulgare]
Length=1055

 Score =   318 bits (816),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 200/210 (95%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  846   LPAVCLLTGKFIMPPISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  905

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+L+IN+
Sbjct  906   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLVINI  965

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+IWSVLL
Sbjct  966   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIIWSVLL  1025

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K KGPDVKQCGINC
Sbjct  1026  ASIFSLLWVRIDPFTVKAKGPDVKQCGINC  1055



>gb|EMT30130.1| Cellulose synthase A catalytic subunit 9 (UDP-forming) [Aegilops 
tauschii]
Length=1060

 Score =   318 bits (816),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 200/210 (95%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFI+LF+SIFATGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  851   LPAVCLLTGKFIMPPISTFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGG  910

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAV+QGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+L+IN+
Sbjct  911   VSAHLFAVIQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLVINI  970

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+IWSVLL
Sbjct  971   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIIWSVLL  1030

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K KGPDVKQCGINC
Sbjct  1031  ASIFSLLWVRIDPFTVKAKGPDVKQCGINC  1060



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   318 bits (815),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 200/210 (95%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP IST ASLFFIALF+SIFATGILE+RWSGVSIEEWWRNEQFWVIGG
Sbjct  844   LPAVCLLTGKFIMPPISTFASLFFIALFISIFATGILEMRWSGVSIEEWWRNEQFWVIGG  903

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAV--DDEEFGELYTFKWttllippttiliinL  737
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA   +D+EF ELY FKWTTLLIPPTT+LI+N+
Sbjct  904   VSAHLFAVVQGLLKVLAGIDTNFTVTSKATGDEDDEFAELYAFKWTTLLIPPTTLLILNI  963

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             +GVVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL
Sbjct  964   IGVVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  1023

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSLLWVRIDPF +K KGPDV+QCGINC
Sbjct  1024  ASIFSLLWVRIDPFTVKAKGPDVRQCGINC  1053



>ref|XP_008362868.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Malus domestica]
Length=1069

 Score =   318 bits (814),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IST ASLFFIALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  862   LPAVCLLTDKFIMPQISTFASLFFIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  921

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAVVQGLLK+LAGIDTNFTVT+K+ DDE+FGELY FKWTTLLIPPTTIL+INLV 
Sbjct  922   VSAHLFAVVQGLLKVLAGIDTNFTVTAKSSDDEDFGELYAFKWTTLLIPPTTILVINLVX  981

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             V  G+SDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLAS
Sbjct  982   VXXGVSDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLAS  1041

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGP+ KQCGINC
Sbjct  1042  IFSLLWVRIDPFVMKTKGPNTKQCGINC  1069



>ref|XP_002983910.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14922.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1072

 Score =   317 bits (811),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+PEIS  ASLFFI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  865   LPAVCLLTNKFIIPEISNFASLFFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  924

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDTNFTVTSK  DDEEFGELY FKWTTLLIPPTT+L+IN++G
Sbjct  925   VSAHLFAVFQGLLKVLAGIDTNFTVTSKTSDDEEFGELYAFKWTTLLIPPTTLLVINMIG  984

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  985   VVAGISDAINNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLAS  1044

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ KTKGP+++QCGINC
Sbjct  1045  IFSLLWVRIDPFLPKTKGPNLQQCGINC  1072



>ref|XP_002960761.1| cellulose synthase 4-1 [Selaginella moellendorffii]
 gb|EFJ38300.1| cellulose synthase 4-1 [Selaginella moellendorffii]
Length=1072

 Score =   317 bits (811),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+PEIS  ASLFFI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  865   LPAVCLLTNKFIIPEISNFASLFFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  924

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDTNFTVTSK  DDEEFGELY FKWTTLLIPPTT+L+IN++G
Sbjct  925   VSAHLFAVFQGLLKVLAGIDTNFTVTSKTSDDEEFGELYAFKWTTLLIPPTTLLVINMIG  984

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  985   VVAGISDAINNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLAS  1044

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ KTKGP+++QCGINC
Sbjct  1045  IFSLLWVRIDPFLPKTKGPNLQQCGINC  1072



>gb|AII73574.1| cellulose synthase 7-A [Medicago sativa]
Length=1038

 Score =   316 bits (809),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP IST ASL+F+ALF SI ATGILEL+WSGVSIEEWW+NEQFWVIGG
Sbjct  831   LPAVCLLTDKFIMPPISTFASLYFVALFSSIMATGILELKWSGVSIEEWWKNEQFWVIGG  890

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S HLFAV+QGLLK+LAGIDTNFTVTSKA +DEEFGELY  KWTTLLIPPTTILIIN+VG
Sbjct  891   VSPHLFAVIQGLLKVLAGIDTNFTVTSKATNDEEFGELYAIKWTTLLIPPTTILIINIVG  950

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGIS+AINNG Q+WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS
Sbjct  951   VVAGISNAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  1010

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPFV+KTKGPD K CGINC
Sbjct  1011  IFSLLWVRIDPFVMKTKGPDTKLCGINC  1038



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   315 bits (808),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 197/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMP IST  SLF++ LF+SI ATGILEL+WSGVSIEEWWRNEQFWVIGG
Sbjct  828   LPAICLLTGKFIMPTISTFGSLFYLGLFMSIIATGILELKWSGVSIEEWWRNEQFWVIGG  887

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV+QGLLKILAGIDTNFTVTSK VDDE EF +LYTFKWTTLLIPPTTILIINLV
Sbjct  888   VSAHLFAVIQGLLKILAGIDTNFTVTSKTVDDEDEFSDLYTFKWTTLLIPPTTILIINLV  947

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGISDAIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWS+LLA
Sbjct  948   GVVAGISDAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLA  1007

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPFV++ KGPD K CG+NC
Sbjct  1008  SIFSLLWVRIDPFVVRAKGPDTKACGLNC  1036



>ref|XP_008337189.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Malus domestica]
Length=816

 Score =   310 bits (793),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMPEIST ASL  IALFLSIF TGILELRWSGVSIEEWWRNEQFWVIGG
Sbjct  609   LPAVCLLTDKFIMPEISTFASLIVIALFLSIFGTGILELRWSGVSIEEWWRNEQFWVIGG  668

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SA+LFAVVQGLLK+L G DTNFTVT+K+ DDE+FGELY  KWTTLLIPPTTIL+INL+G
Sbjct  669   VSAYLFAVVQGLLKVLGGNDTNFTVTAKSPDDEDFGELYALKWTTLLIPPTTILVINLIG  728

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDA+NNG+Q+ GPL GKLFFAFWVIVHLYPFLKGL+GRQNRTPTIV+IWS+LLAS
Sbjct  729   VVAGISDAVNNGNQSMGPLLGKLFFAFWVIVHLYPFLKGLLGRQNRTPTIVIIWSILLAS  788

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLW+RIDPFVL+TKGPD KQCGINC
Sbjct  789   IFSLLWIRIDPFVLQTKGPDTKQCGINC  816



>gb|ACF81885.1| unknown [Zea mays]
Length=294

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI PE++ +AS++F+ALF+ I  TGILE+RWSGV+I++WWRNEQFWVIGG
Sbjct  86    LPAICLLTGKFITPELTNVASIWFMALFICISVTGILEMRWSGVAIDDWWRNEQFWVIGG  145

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+ AGIDT+FTVTSKA DDEEF ELYTFKWTTLLIPPTT+L++N +G
Sbjct  146   VSAHLFAVFQGLLKVFAGIDTSFTVTSKAGDDEEFSELYTFKWTTLLIPPTTLLLLNFIG  205

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGIS+AINNG ++WGPLFGKLFFAFWVIVHLYPFLKGL+GRQNRTPTIV++WS+LLAS
Sbjct  206   VVAGISNAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLAS  265

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVR+DPF+ K+ GP +++CG++C
Sbjct  266   IFSLLWVRVDPFLAKSNGPLLEECGLDC  293



>gb|AAT48368.1| cellulose synthase catalytic subunit, partial [Physcomitrella 
patens]
Length=768

 Score =   308 bits (788),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  561   LPAVCLLTGKFIIPSISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  620

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+ AGIDTNFTVTSK+ +DE+FGELY FKWT+LLIPPTT+LIINLVG
Sbjct  621   VSAHLFAVFQGLLKVFAGIDTNFTVTSKSSEDEDFGELYAFKWTSLLIPPTTLLIINLVG  680

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  681   VVAGISDAINNGYQTWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  740

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GPD++QCGINC
Sbjct  741   IFSLLWVRIDPFLTKVTGPDLQQCGINC  768



>gb|AFJ12110.1| cellulose synthase, partial [Nicotiana tabacum]
Length=398

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  191   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  250

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N VG
Sbjct  251   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNTVG  310

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  311   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  370

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  371   IFSLVWVRIDPFLPKQKGPILKQCGVEC  398



>ref|XP_001775315.1| predicted protein [Physcomitrella patens]
 ref|XP_001775317.1| predicted protein [Physcomitrella patens]
 gb|EDQ59920.1| predicted protein [Physcomitrella patens]
 gb|EDQ59922.1| predicted protein [Physcomitrella patens]
Length=593

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  386   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  445

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+++IN++G
Sbjct  446   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIG  505

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  506   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  565

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  566   IFSLLWVRIDPFLAKVKGPDLSQCGINC  593



>gb|ABI78962.1| cellulose synthase 10, partial [Physcomitrella patens]
Length=601

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P I+ L SL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  394   LPAVCLLTGKFIIPTITNLDSLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  453

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+LAGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+L+IN++G
Sbjct  454   VSAHLFALFQGLLKVLAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLLVINMIG  513

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  514   VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  573

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GPD+ +CGINC
Sbjct  574   IFSLLWVRIDPFLAKVTGPDITECGINC  601



>ref|XP_010491045.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=347

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CL T +FI+P+IS +AS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  139   LPAVCLFTNQFIIPQISNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  198

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  199   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLV  258

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  259   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLA  318

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPD+ +CGINC
Sbjct  319   SIFSLLWVRIDPFTSRVTGPDILECGINC  347



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   308 bits (790),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+PEIS  ASL+FI++F+SIFAT ILE+RWS V IEEWWRNEQFWVIGG
Sbjct  886   LPAVCLLTGKFIIPEISNFASLWFISMFVSIFATAILEMRWSNVGIEEWWRNEQFWVIGG  945

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA DDEEFGELYT KWTTLL+PPTT+LIINLVG
Sbjct  946   VSSHLFAVFQGLLKVLAGIDTNFTVTSKATDDEEFGELYTLKWTTLLVPPTTLLIINLVG  1005

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG++DAIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1006  VVAGLADAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1065

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ KT+GP ++QCG+NC
Sbjct  1066  IFSLLWVRIDPFLPKTQGPHLQQCGLNC  1093



>ref|XP_001757832.1| predicted protein [Physcomitrella patens]
 gb|EDQ77472.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   307 bits (787),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  887   LPAVCLLTGKFIIPSISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  946

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+ AGIDTNFTVTSK+ +DE+FGELY FKWT+LLIPPTT+LIINLVG
Sbjct  947   VSAHLFAVFQGLLKVFAGIDTNFTVTSKSSEDEDFGELYAFKWTSLLIPPTTLLIINLVG  1006

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1007  VVAGISDAINNGYQTWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1066

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GPD++QCGINC
Sbjct  1067  IFSLLWVRIDPFLTKVTGPDLQQCGINC  1094



>tpg|DAA39507.1| TPA: hypothetical protein ZEAMMB73_844715 [Zea mays]
Length=596

 Score =   296 bits (758),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+PEIS  AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  388   LPAICLLTGKFIIPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  447

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             ISAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTTILIINLV
Sbjct  448   ISAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLV  507

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+W++LLA
Sbjct  508   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLA  567

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPD + CGINC
Sbjct  568   SIFSLLWVRIDPFTTRVTGPDTRTCGINC  596



>gb|ACN34934.1| unknown [Zea mays]
Length=294

 Score =   286 bits (733),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI PE++ +ASL+F++LF+ IFAT ILE+RWSGV I++WWRNEQFWVIGG
Sbjct  86    LPAICLLTGKFITPELNNVASLWFMSLFICIFATSILEMRWSGVGIDDWWRNEQFWVIGG  145

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK++AG+DT+FTVTSK  DDEEF ELYTFKWTTLLIPPTT+L++N +G
Sbjct  146   VSSHLFAVFQGLLKVIAGVDTSFTVTSKGGDDEEFSELYTFKWTTLLIPPTTLLLLNFIG  205

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+S+AINNG ++WGPLFGKLFFAFWVIVHLYPFLKGL+GRQNRTPTIV++WS+LLAS
Sbjct  206   VVAGVSNAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLAS  265

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GP +++CG++C
Sbjct  266   IFSLLWVRIDPFLAKDDGPLLEECGLDC  293



>gb|KDO60380.1| hypothetical protein CISIN_1g001574mg [Citrus sinensis]
Length=1050

 Score =   305 bits (781),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P ++ LAS++F+ALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  843   LPAICLLTGKFIIPTLNNLASIWFLALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  902

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK+ +DEEFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  903   VSAHLFAVFQGLLKVLAGVDTNFTVTSKSAEDEEFGELYLFKWTTLLIPPTTLIILNMVG  962

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  963   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1022

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGP +KQCG+ C
Sbjct  1023  IFSLLWVRIDPFLPKQKGPLLKQCGVEC  1050



>ref|XP_003638289.1| hypothetical protein MTR_125s1017, partial [Medicago truncatula]
Length=270

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  62    LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  121

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +  ELY  KWTTLLIPPTT+LIINLV
Sbjct  122   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDSAELYMIKWTTLLIPPTTLLIINLV  181

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  182   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  241

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GP  ++CGINC
Sbjct  242   SIFSLLWVRVDPFTTRVTGPKAEECGINC  270



>gb|KDO60379.1| hypothetical protein CISIN_1g001574mg [Citrus sinensis]
Length=1051

 Score =   305 bits (781),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P ++ LAS++F+ALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  844   LPAICLLTGKFIIPTLNNLASIWFLALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  903

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK+ +DEEFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  904   VSAHLFAVFQGLLKVLAGVDTNFTVTSKSAEDEEFGELYLFKWTTLLIPPTTLIILNMVG  963

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  964   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1023

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGP +KQCG+ C
Sbjct  1024  IFSLLWVRIDPFLPKQKGPLLKQCGVEC  1051



>ref|XP_006443764.1| hypothetical protein CICLE_v10018639mg [Citrus clementina]
 ref|XP_006479464.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR57004.1| hypothetical protein CICLE_v10018639mg [Citrus clementina]
Length=1050

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P ++ LAS++F+ALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  843   LPAICLLTGKFIIPTLNNLASIWFLALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  902

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK+ +DEEFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  903   VSAHLFAVFQGLLKVLAGVDTNFTVTSKSAEDEEFGELYLFKWTTLLIPPTTLIILNMVG  962

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  963   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1022

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGP +KQCG+ C
Sbjct  1023  IFSLLWVRIDPFLPKQKGPLLKQCGVEC  1050



>ref|XP_006479463.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1051

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P ++ LAS++F+ALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  844   LPAICLLTGKFIIPTLNNLASIWFLALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  903

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK+ +DEEFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  904   VSAHLFAVFQGLLKVLAGVDTNFTVTSKSAEDEEFGELYLFKWTTLLIPPTTLIILNMVG  963

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  964   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1023

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGP +KQCG+ C
Sbjct  1024  IFSLLWVRIDPFLPKQKGPLLKQCGVEC  1051



>ref|NP_001146633.1| uncharacterized protein LOC100280232 [Zea mays]
 gb|ACL54432.1| unknown [Zea mays]
Length=294

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI PE++ +ASL+F++LF+ IFAT ILE+RWSGV I++WWRNEQFWVIGG
Sbjct  86    LPAICLLTGKFITPELNNVASLWFMSLFICIFATSILEMRWSGVGIDDWWRNEQFWVIGG  145

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK++AG+DT+FTVTSK  DD+EF ELYTFKWTTLLIPPTT+L++N +G
Sbjct  146   VSSHLFAVFQGLLKVIAGVDTSFTVTSKGGDDDEFSELYTFKWTTLLIPPTTLLLLNFIG  205

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+S+AINNG ++WGPLFGKLFFAFWVIVHLYPFLKGL+GRQNRTPTIV++WS+LLAS
Sbjct  206   VVAGVSNAINNGYESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLAS  265

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GP +++CG++C
Sbjct  266   IFSLLWVRIDPFLAKDDGPLLEECGLDC  293



>gb|AAB37767.1| cellulose synthase [Gossypium hirsutum]
Length=685

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P +S L S++F+ALFLSI ATG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  478   IPAVCLLTGKFIIPTLSNLTSVWFLALFLSIIATGVLELRWSGVSIQDWWRNEQFWVIGG  537

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  538   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDTEFGELYLFKWTTLLIPPTTLIILNMVG  597

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  598   VVAGVSDAINNGYGSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVLWSILLAS  657

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  658   IFSLVWVRIDPFLPKQTGPVLKQCGVEC  685



>ref|XP_002967423.1| hypothetical protein SELMODRAFT_86720 [Selaginella moellendorffii]
 gb|EFJ32022.1| hypothetical protein SELMODRAFT_86720 [Selaginella moellendorffii]
Length=1076

 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFI+P IS  ASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  869   LPAICLLTNKFIIPTISNFASLWFISLFVSIFATGILEIRWSGVGIDEWWRNEQFWVIGG  928

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK+LAGIDTNFTVT+KA +DE+F ELYTFKWTTLLIPPTT+L+IN+VG
Sbjct  929   VSSHLFAVFQGLLKVLAGIDTNFTVTTKAAEDEDFAELYTFKWTTLLIPPTTLLVINMVG  988

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  989   VVAGLSDAINNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1048

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K +GP+++QCG+NC
Sbjct  1049  IFSLLWVRIDPFLPKVRGPNLQQCGLNC  1076



>ref|XP_001767133.1| cellulose synthase 4, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|ABI78957.1| cellulose synthase 4 [Physcomitrella patens]
 gb|EDQ68054.1| cellulose synthase 4, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1099

 Score =   304 bits (779),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  891   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  950

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+L+IN++G
Sbjct  951   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLLVINMIG  1010

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1011  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1070

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  1071  IFSLLWVRIDPFLAKVKGPDLSQCGINC  1098



>ref|XP_002960291.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ37830.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1080

 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFI+P IS  ASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  873   LPAICLLTNKFIIPTISNFASLWFISLFVSIFATGILEIRWSGVGIDEWWRNEQFWVIGG  932

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK+LAGIDTNFTVT+KA +DE+F ELYTFKWTTLLIPPTT+++IN+VG
Sbjct  933   VSSHLFAVFQGLLKVLAGIDTNFTVTTKAAEDEDFAELYTFKWTTLLIPPTTLIVINMVG  992

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  993   VVAGLSDAINNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1052

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K +GP+++QCG+NC
Sbjct  1053  IFSLLWVRIDPFLPKVRGPNLQQCGLNC  1080



>ref|XP_002960719.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
 gb|EFJ38258.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
Length=1082

 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P IS   SL+FI+LFLSIFATGILELRWSGV I+EWWRNEQFWVIGG
Sbjct  875   LPAVCLLTNKFIIPTISNFDSLWFISLFLSIFATGILELRWSGVGIDEWWRNEQFWVIGG  934

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK+LAGIDTNFTVTSK+ DDE+FGELY FKWTTLLIPPTT++I+NLVG
Sbjct  935   VSSHLFAVFQGLLKVLAGIDTNFTVTSKSADDEDFGELYEFKWTTLLIPPTTLIIVNLVG  994

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             V AGISDA+NNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  995   VAAGISDAVNNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLAS  1054

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRI+PF+ K +GP+++QCGINC
Sbjct  1055  IFSLLWVRINPFLQKVQGPNLEQCGINC  1082



>gb|ABI78960.1| cellulose synthase 7 [Physcomitrella patens]
Length=1096

 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  889   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  948

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+++IN++G
Sbjct  949   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIG  1008

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1009  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1068

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  1069  IFSLLWVRIDPFLAKVKGPDLSQCGINC  1096



>gb|AAZ86086.1| cellulose synthase catalytic subunit [Physcomitrella patens]
 gb|ABK91941.1| cellulose synthase catalytic subunit CesA6 [Physcomitrella patens]
Length=1096

 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  889   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  948

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+++IN++G
Sbjct  949   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIG  1008

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1009  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1068

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  1069  IFSLLWVRIDPFLAKVKGPDLSQCGINC  1096



>gb|AAZ86087.1| cellulose synthase catalytic subunit [Physcomitrella patens]
 gb|ABK91942.1| cellulose synthase catalytic subunit CesA7 [Physcomitrella patens]
Length=1096

 Score =   304 bits (778),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  889   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  948

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+++IN++G
Sbjct  949   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIG  1008

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1009  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1068

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  1069  IFSLLWVRIDPFLAKVKGPDLSQCGINC  1096



>ref|XP_002983952.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14964.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1090

 Score =   304 bits (778),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P IS   SL+FI+LFLSIFATGILELRWSGV I+EWWRNEQFWVIGG
Sbjct  883   LPAVCLLTNKFIIPTISNFDSLWFISLFLSIFATGILELRWSGVGIDEWWRNEQFWVIGG  942

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAV QGLLK+LAGIDTNFTVTSK+ DDE+FGELY FKWTTLLIPPTT++I+NLVG
Sbjct  943   VSSHLFAVFQGLLKVLAGIDTNFTVTSKSADDEDFGELYEFKWTTLLIPPTTLIIVNLVG  1002

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             V AGISDA+NNG Q+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  1003  VAAGISDAVNNGYQSWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLAS  1062

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRI+PF+ K +GP+++QCGINC
Sbjct  1063  IFSLLWVRINPFLQKVQGPNLEQCGINC  1090



>dbj|BAF01916.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=431

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CL T +FI+P+IS +AS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  223   LPAVCLFTNQFIIPQISNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  282

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QG+LK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  283   VSAHLFAVFQGILKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLV  342

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  343   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLA  402

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPD+ +CGINC
Sbjct  403   SIFSLLWVRIDPFTSRVTGPDILECGINC  431



>gb|ABI78959.1| cellulose synthase 6 [Physcomitrella patens]
Length=1096

 Score =   304 bits (778),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P IS LASL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  889   LPAVCLLTGKFIIPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  948

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+ AGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+++IN++G
Sbjct  949   VSAHLFALFQGLLKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIG  1008

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1009  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1068

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K KGPD+ QCGINC
Sbjct  1069  IFSLLWVRIDPFLAKVKGPDLSQCGINC  1096



>gb|AEP33550.1| truncated cellulose synthase catalytic subunit [Gossypium hirsutum 
subsp. latifolium]
Length=684

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  476   LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  535

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  536   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  595

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  596   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  655

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  656   SIFSLLWVRIDPFTTRVTGPDVEQCGINC  684



>gb|ADZ16122.1| truncated cellulose synthase A3 [Gossypium hirsutum]
Length=684

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  476   LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  535

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  536   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  595

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  596   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  655

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  656   SIFSLLWVRIDPFTTRVTGPDVEQCGINC  684



>gb|AEP33542.1| truncated cellulose synthase catalytic subunit [Gossypium darwinii]
 gb|AEP33546.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. brasiliense]
 gb|AEP33548.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. peruvianum]
Length=684

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  476   LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  535

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  536   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  595

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  596   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  655

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  656   SIFSLLWVRIDPFTTRVTGPDVEQCGINC  684



>gb|AEP33544.1| truncated cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=684

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  476   LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  535

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  536   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  595

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  596   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  655

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  656   SIFSLLWVRIDPFTTRVTGPDVEQCGINC  684



>gb|EYU46413.1| hypothetical protein MIMGU_mgv1a000605mg [Erythranthe guttata]
Length=882

 Score =   300 bits (768),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++FIALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  675   LPAVCLLTGKFIVPTLNNLASVWFIALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  734

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  735   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  794

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG++DAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  795   VVAGVADAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  854

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  855   IFSLVWVRIDPFLPKQTGPILKQCGVEC  882



>gb|ADZ16118.1| truncated cellulose synthase A3 [Gossypium barbadense]
Length=684

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  476   LPAVCLLTNKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  535

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  536   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  595

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  596   GVVAGISYAINSGYQLWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  655

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  656   SIFSLLWVRIDPFTTRVTGPDVEQCGINC  684



>gb|ACC59197.1| cellulose synthase [Betula platyphylla]
Length=1048

 Score =   301 bits (772),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++F+ALFLSI ATG+LELRWSGVSIE+ WRNEQFWVIGG
Sbjct  841   LPAVCLLTGKFIIPTLTNLASIYFMALFLSIIATGVLELRWSGVSIEDLWRNEQFWVIGG  900

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK  DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  901   VSAHLFAVFQGLLKVLAGVDTNFTVTSKTADDAEFGELYLFKWTTLLIPPTTLIILNMVG  960

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  961   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1020

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG++C
Sbjct  1021  IFSLIWVRIDPFLPKQKGPILKQCGVDC  1048



>ref|XP_001776974.1| cellulose synthase 10, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|EDQ58223.1| cellulose synthase 10, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1095

 Score =   302 bits (773),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P I+ L SL+FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  888   LPAVCLLTGKFIIPTITNLDSLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  947

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFA+ QGLLK+LAGIDTNFTVTSK  +DE+F ELY  KWT LLIPPTT+L+IN++G
Sbjct  948   VSAHLFALFQGLLKVLAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLLVINMIG  1007

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGISDAINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLAS
Sbjct  1008  VVAGISDAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLAS  1067

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K  GPD+ +CGINC
Sbjct  1068  IFSLLWVRIDPFLAKVTGPDITECGINC  1095



>gb|AAQ63936.1| cellulose synthase [Pinus radiata]
Length=1066

 Score =   300 bits (769),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IST ASLFFIALFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  858   LPAICLLTGKFIIPQISTFASLFFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  917

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D D +F ELY FKWT LLIPPTT+L+IN+V
Sbjct  918   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTALLIPPTTLLVINIV  977

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AI++G  AWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  978   GVVAGISQAISSGYAAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1037

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  + KGPD++QCGINC
Sbjct  1038  SIFSLLWVRIDPFTTQIKGPDLQQCGINC  1066



>gb|AAQ63930.1| cellulose synthase [Pinus radiata]
Length=331

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTG+FI+P +S LAS++F+ LF+SI  TG+LELRWSGVSIEEWWRNEQFWVIGG
Sbjct  123   LPAICLLTGEFIIPTLSNLASIYFMLLFISIIVTGVLELRWSGVSIEEWWRNEQFWVIGG  182

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAH FAV QGLLK+LAGIDTNFTVT+KA DD EFGELY FKWTTL IPPTT+L+INLVG
Sbjct  183   VSAHFFAVFQGLLKVLAGIDTNFTVTAKASDDNEFGELYAFKWTTLPIPPTTLLVINLVG  242

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             +VAG SDA+NNG Q+WGPLFGKLFF+ WVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  243   IVAGFSDALNNGYQSWGPLFGKLFFSVWVILHLYPFLKGLMGRQNRTPTIVVLWSILLAS  302

Query  550   IFSLLWVRIDPFVLKTKGPDVKQC-GINC  467
             IFSLLWV+IDPF+   + P +++C  I+C
Sbjct  303   IFSLLWVKIDPFLGPAETPTLQKCMAIDC  331



>ref|XP_008785168.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Phoenix dactylifera]
Length=1054

 Score =   300 bits (769),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PAICLLTGKFI+P ++   SL+FI LFLSI ATGILELRWSGVSI++WWRNEQFWVIGG
Sbjct  847   IPAICLLTGKFIIPSLNNFGSLWFIGLFLSIIATGILELRWSGVSIQDWWRNEQFWVIGG  906

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFG+LY FKWTTLLIPPTT++I+N+VG
Sbjct  907   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDTEFGDLYLFKWTTLLIPPTTLIILNMVG  966

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  967   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1026

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1027  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1054



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   301 bits (770),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  868   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  927

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  928   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLV  987

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  988   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1047

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1048  SIFSLLWVRIDPFTTRVTGPDVQQCGINC  1076



>ref|XP_004247500.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Solanum lycopersicum]
Length=1048

 Score =   300 bits (768),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALF+SI AT +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  841   LPAVCLLTGKFIVPTLNNFASIWFMALFISIIATSVLELRWSGVSIEAWWRNEQFWVIGG  900

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  901   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  960

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  961   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1020

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1021  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1048



>ref|XP_010934249.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Elaeis guineensis]
Length=1053

 Score =   300 bits (768),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P +++ AS++F+ALFLSI ATGILELRWSGVSI++WWRNEQFWVIGG
Sbjct  846   IPAVCLLTGKFIIPTLNSFASIWFVALFLSIIATGILELRWSGVSIQDWWRNEQFWVIGG  905

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDTNFTVT+KA DD EFG+LY FKWTTLLIPPTT++I+N+VG
Sbjct  906   VSAHLFAVFQGLLKVLAGIDTNFTVTAKAADDAEFGDLYLFKWTTLLIPPTTLIILNMVG  965

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  966   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1025

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1026  IFSLVWVRIDPFLPKQKGPVLKQCGVEC  1053



>gb|AGG91493.1| cellulose synthase A4 [Betula platyphylla]
Length=1049

 Score =   300 bits (768),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++F+ALFLSI ATG+LELRWSGVSIE+ WRNEQFWVIGG
Sbjct  842   LPAVCLLTGKFIIPTLTNLASIYFMALFLSIIATGVLELRWSGVSIEDLWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK  DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  902   VSAHLFAVFQGLLKVLAGVDTNFTVTSKTADDAEFGELYLFKWTTLLIPPTTLIILNMVG  961

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV +WSVLLAS
Sbjct  962   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVALWSVLLAS  1021

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG++C
Sbjct  1022  IFSLIWVRIDPFLPKQKGPILKQCGVDC  1049



>gb|KDP26042.1| hypothetical protein JCGZ_21075 [Jatropha curcas]
Length=957

 Score =   299 bits (765),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  749   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  808

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  809   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  868

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  869   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  928

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  929   SIFSLLWVRIDPFTTRVTGPDVQQCGINC  957



>ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
 gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
Length=1088

 Score =   300 bits (769),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  880   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  939

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  940   VSAHLFAVFQGLLKVLAGIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPPTTLLIINLV  999

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  1000  GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1059

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1060  SIFSLLWVRIDPFTTRVTGPDVQQCGINC  1088



>gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Erythranthe guttata]
Length=1065

 Score =   300 bits (768),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  857   LPAVCLLTGKFIIPQISNLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  916

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LI+N+V
Sbjct  917   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNIV  976

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  977   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1036

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1037  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1065



>ref|XP_011080097.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Sesamum indicum]
Length=1045

 Score =   300 bits (768),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++FIALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  838   LPAVCLLTGKFIVPTLNNLASIWFIALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  897

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++IIN+VG
Sbjct  898   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDAEFGELYLFKWTTLLIPPTTLIIINMVG  957

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  958   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1017

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1018  IFSLVWVRIDPFLPKQTGPILKQCGVEC  1045



>dbj|BAJ85304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=858

 Score =   297 bits (760),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFIMPEIS LAS++FIALFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  650   LPAICLLTGKFIMPEISNLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  709

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             ISAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTTILIIN+V
Sbjct  710   ISAHLFAVFQGLLKVLAGIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINMV  769

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++W+VLLA
Sbjct  770   GVVAGTSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLA  829

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GP+++ CGINC
Sbjct  830   SIFSLLWVRVDPFTTRLAGPNIQTCGINC  858



>ref|XP_010278977.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278978.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1056

 Score =   300 bits (767),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  848   LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  907

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  908   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLV  967

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  968   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1027

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1028  SIFSLLWVRIDPFTTRVTGPDVQQCGINC  1056



>emb|CDP07782.1| unnamed protein product [Coffea canephora]
Length=1083

 Score =   300 bits (768),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  875   LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  934

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  935   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLV  994

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  995   GVVAGISYAINSGYQTWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1054

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1055  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1083



>gb|EPS69824.1| hypothetical protein M569_04932, partial [Genlisea aurea]
Length=1067

 Score =   300 bits (768),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  860   LPAVCLLTGKFIIPQISNLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  919

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +S+HLFAVVQGLLK+LAGIDTNFTVTSKA D+ +F ELY FKWTTLL+PPTT+L+INLVG
Sbjct  920   VSSHLFAVVQGLLKVLAGIDTNFTVTSKASDEGDFAELYMFKWTTLLVPPTTLLVINLVG  979

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGIS AIN+G QAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  980   VVAGISYAINSGYQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLAS  1039

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF     GPDV+ CGINC
Sbjct  1040  IFSLLWVRIDPFTTSFTGPDVQACGINC  1067



>ref|XP_006358416.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like 
[Solanum tuberosum]
Length=1048

 Score =   300 bits (767),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALF+SI AT +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  841   LPAVCLLTGKFIVPTLNNFASIWFMALFISIIATSVLELRWSGVSIEAWWRNEQFWVIGG  900

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  901   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  960

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  961   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1020

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1021  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1048



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   300 bits (768),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  869   LPAVCLLTNKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  928

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  929   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEENDFAELYMFKWTTLLIPPTTLLIINLV  988

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AINNG Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  989   GVVAGISYAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1048

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1049  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1077



>ref|XP_008651867.1| PREDICTED: cellulose synthase-4 isoform X1 [Zea mays]
Length=870

 Score =   296 bits (759),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+PEIS  AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  662   LPAICLLTGKFIIPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  721

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             ISAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTTILIINLV
Sbjct  722   ISAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLV  781

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+W++LLA
Sbjct  782   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLA  841

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPD + CGINC
Sbjct  842   SIFSLLWVRIDPFTTRVTGPDTQTCGINC  870



>gb|KDP26483.1| hypothetical protein JCGZ_17641 [Jatropha curcas]
Length=1165

 Score =   300 bits (769),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++F+ALFLSI ATGILELRWSGVSIE+WWRNEQFWVIGG
Sbjct  958   IPAVCLLTGKFIIPTLTNLASVWFLALFLSIIATGILELRWSGVSIEDWWRNEQFWVIGG  1017

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  1018  VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  1077

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  1078  VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1137

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1138  IFSLVWVRIDPFLPKQTGPILKQCGVEC  1165



>gb|EYU46412.1| hypothetical protein MIMGU_mgv1a000605mg [Erythranthe guttata]
Length=1047

 Score =   299 bits (766),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++FIALFLSI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  840   LPAVCLLTGKFIVPTLNNLASVWFIALFLSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  900   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  959

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG++DAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  960   VVAGVADAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1019

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1020  IFSLVWVRIDPFLPKQTGPILKQCGVEC  1047



>gb|KDO83413.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=918

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IS LAS+ FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  710   LPAVCLLTNKFIMPQISNLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  769

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  770   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  829

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  830   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  889

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  890   SIFSLLWVRVDPFTTRVTGPDVEQCGINC  918



>gb|ACJ38666.1| cellulose synthase [Betula luminifera]
Length=1049

 Score =   299 bits (766),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++ LAS++F+ALFLSI ATG+LELRWSGVSIE+ WRNEQFWVIGG
Sbjct  842   LPAVCLLTGKFIIPTLTNLASIYFMALFLSIIATGVLELRWSGVSIEDLWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK  DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  902   VSAHLFAVFQGLLKVLAGVDTNFTVTSKTADDAEFGELYLFKWTTLLIPPTTLIIMNMVG  961

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  962   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1021

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG++C
Sbjct  1022  IFSLIWVRIDPFLPKQTGPILKQCGVDC  1049



>ref|XP_010653789.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Vitis vinifera]
Length=1087

 Score =   299 bits (766),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  879   LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  938

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  939   VSAHLFAVCQGLLKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLV  998

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  999   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1058

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1059  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1087



>ref|XP_010906116.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
 ref|XP_010906117.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1068

 Score =   299 bits (766),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFIMP+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  860   LPAVCLLTGKFIMPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  919

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  920   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  979

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  980   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1039

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1040  SIFSLLWVRVDPFTTRVTGPDVQQCGINC  1068



>emb|CBI29854.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   300 bits (769),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  1035  LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  1094

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  1095  VSAHLFAVCQGLLKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLV  1154

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  1155  GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1214

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1215  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1243



>ref|XP_008460760.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1050

 Score =   299 bits (765),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  842   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIIN+V
Sbjct  902   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIV  961

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  962   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1021

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1022  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1050



>ref|XP_007148880.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
 gb|ESW20874.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
Length=1075

 Score =   299 bits (765),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  867   LPAICLLTNKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  926

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  927   VSAHLFAVFQGLLKVLAGIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPPTTLLIINLV  986

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  987   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1046

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  K  GPDV+QCGINC
Sbjct  1047  SIFSLLWVRIDPFTTKVTGPDVEQCGINC  1075



>ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN53854.1| hypothetical protein Csa_4G166980 [Cucumis sativus]
Length=1050

 Score =   298 bits (764),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  842   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIIN+V
Sbjct  902   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIV  961

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  962   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1021

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1022  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1050



>ref|XP_006439113.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 ref|XP_006439114.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52353.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52354.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=1079

 Score =   299 bits (765),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IS LAS+ FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  871   LPAVCLLTNKFIMPQISNLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  930

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  931   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  990

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  991   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1050

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDVKQCGINC
Sbjct  1051  SIFSLLWVRVDPFTTRVTGPDVKQCGINC  1079



>ref|XP_010262430.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Nelumbo nucifera]
Length=1045

 Score =   298 bits (763),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++FIALFLSI ATG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  838   IPAVCLLTGKFIIPTLNNLASIWFIALFLSIIATGVLELRWSGVSIQDWWRNEQFWVIGG  897

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  898   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  957

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  958   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1017

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP ++QCG+ C
Sbjct  1018  IFSLVWVRIDPFLPKQTGPILRQCGVEC  1045



>ref|XP_010241248.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1071

 Score =   298 bits (764),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  863   LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  922

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  923   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  982

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  983   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1042

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1043  SIFSLLWVRIDPFTTRVTGPDVQQCGINC  1071



>emb|CBI37171.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   298 bits (762),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++  AS++F+ALFLSI  TG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  793   IPAVCLLTGKFIIPTLTNFASVWFMALFLSIIVTGVLELRWSGVSIQDWWRNEQFWVIGG  852

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFG+LY FKWTTLLIPPTT++I+N+VG
Sbjct  853   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGDLYLFKWTTLLIPPTTLIILNMVG  912

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  913   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  972

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  973   IFSLVWVRIDPFLPKQTGPVLKQCGVEC  1000



>ref|XP_002273521.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Vitis vinifera]
Length=1044

 Score =   298 bits (763),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++  AS++F+ALFLSI  TG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  837   IPAVCLLTGKFIIPTLTNFASVWFMALFLSIIVTGVLELRWSGVSIQDWWRNEQFWVIGG  896

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFG+LY FKWTTLLIPPTT++I+N+VG
Sbjct  897   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGDLYLFKWTTLLIPPTTLIILNMVG  956

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  957   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1016

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1017  IFSLVWVRIDPFLPKQTGPVLKQCGVEC  1044



>ref|XP_002278997.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Vitis vinifera]
Length=1081

 Score =   298 bits (764),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  873   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  932

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  933   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  992

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  993   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1052

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1053  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1081



>ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
Length=1070

 Score =   298 bits (764),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  862   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  921

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LIIN+V
Sbjct  922   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIV  981

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  982   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1041

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+QCGINC
Sbjct  1042  SIFSLLWVRIDPFTTRVTGPDVEQCGINC  1070



>ref|XP_010696484.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1040

 Score =   298 bits (762),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++F+ALF+SI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  833   IPAVCLLTGKFIIPTLTNLASVWFLALFISIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  892

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSK+ DD EFGELY FKWTTLLIPPTT++I N+VG
Sbjct  893   VSAHLFAVFQGLLKVLAGVDTNFTVTSKSADDAEFGELYLFKWTTLLIPPTTLIIFNMVG  952

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             +VAG+SDAINNG  +WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WSVL+AS
Sbjct  953   IVAGVSDAINNGYSSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLIAS  1012

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1013  IFSLIWVRIDPFLPKQTGPILKQCGVEC  1040



>ref|XP_008784835.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   298 bits (764),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  869   LPAVCLLTGKFIIPQISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  928

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  929   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEEGDFTELYMFKWTTLLIPPTTLLIVNLV  988

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  989   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1048

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1049  SIFSLLWVRVDPFTTRVTGPDVQQCGINC  1077



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   298 bits (763),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 197/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS +AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  867   LPAVCLLTNKFIIPQISNIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  926

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAVVQGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LI+N+V
Sbjct  927   VSSHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNMV  986

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  987   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1046

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF+ + +GPD +QCGINC
Sbjct  1047  SIFSLLWVRVDPFITRVRGPDTEQCGINC  1075



>ref|XP_007050192.1| Cellulose synthase A4 isoform 2 [Theobroma cacao]
 gb|EOX94349.1| Cellulose synthase A4 isoform 2 [Theobroma cacao]
Length=1036

 Score =   298 bits (762),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P +S   S++F+ALFLSI ATG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  829   IPAVCLLTGKFIIPTLSNFTSVWFLALFLSIIATGVLELRWSGVSIQDWWRNEQFWVIGG  888

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  889   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  948

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  949   VVAGVSDAINNGYGSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1008

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +K CG+ C
Sbjct  1009  IFSLVWVRIDPFLPKQKGPVLKPCGVEC  1036



>ref|XP_007158869.1| hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris]
 gb|ESW30863.1| hypothetical protein PHAVU_002G188600g [Phaseolus vulgaris]
Length=1034

 Score =   298 bits (762),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++F+ALF+SI  TG+LELRWSGVS+E+WWRNEQFWVIGG
Sbjct  827   IPAVCLLTGKFIIPALTNLASVWFMALFISIILTGVLELRWSGVSLEDWWRNEQFWVIGG  886

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+L G+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  887   VSAHLFAVFQGLLKVLGGVDTNFTVTAKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  946

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  947   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1006

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1007  IFSLIWVRIDPFLPKQTGPVLKQCGVEC  1034



>ref|XP_007050191.1| Cellulose synthase A4 isoform 1 [Theobroma cacao]
 gb|EOX94348.1| Cellulose synthase A4 isoform 1 [Theobroma cacao]
Length=1041

 Score =   298 bits (762),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P +S   S++F+ALFLSI ATG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  834   IPAVCLLTGKFIIPTLSNFTSVWFLALFLSIIATGVLELRWSGVSIQDWWRNEQFWVIGG  893

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVTSKA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  894   VSAHLFAVFQGLLKVLAGVDTNFTVTSKAADDAEFGELYLFKWTTLLIPPTTLIILNMVG  953

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  954   VVAGVSDAINNGYGSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1013

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +K CG+ C
Sbjct  1014  IFSLVWVRIDPFLPKQKGPVLKPCGVEC  1041



>ref|XP_011087713.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
 ref|XP_011087722.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
Length=1066

 Score =   298 bits (762),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  858   LPAVCLLTGKFIIPQISNLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  917

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  918   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  977

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  978   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1037

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1038  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1066



>emb|CDP03783.1| unnamed protein product [Coffea canephora]
Length=1057

 Score =   298 bits (762),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++   SL+FIALF+SI  TG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  850   LPAVCLLTGKFIVPTLNNFGSLWFIALFMSIIVTGVLELRWSGVSIEDWWRNEQFWVIGG  909

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  910   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYMFKWTTLLIPPTTLIILNMVG  969

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WSVLLAS
Sbjct  970   VVAGVSDAINNGYTSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVLWSVLLAS  1029

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1030  IFSLVWVRIDPFLPKQTGPILKQCGVEC  1057



>ref|XP_009799381.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana sylvestris]
Length=1087

 Score =   298 bits (763),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  879   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  938

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  939   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLV  998

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS A+N+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  999   GVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1058

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV++CGINC
Sbjct  1059  SIFSLLWVRIDPFTTRVTGPDVQECGINC  1087



>ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1061

 Score =   298 bits (762),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  853   LPAVCLLTGKFIIPQISNLASVWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  912

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  913   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLV  972

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
              VVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  973   AVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1032

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPD+KQCGINC
Sbjct  1033  SIFSLLWVRVDPFTTRVTGPDIKQCGINC  1061



>ref|XP_002459635.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor]
 gb|EER96156.1| hypothetical protein SORBIDRAFT_02g007810 [Sorghum bicolor]
Length=1100

 Score =   298 bits (763),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI PE++ +AS++F+ALF+ I  TGILE+RWSGV+I++WWRNEQFWVIGG
Sbjct  892   LPAICLLTGKFITPELTNVASIWFMALFICIAVTGILEMRWSGVAIDDWWRNEQFWVIGG  951

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAGIDT+FTVTSKA DDEEF ELYTFKWTTLLIPPTT+L++N +G
Sbjct  952   VSAHLFAVFQGLLKVLAGIDTSFTVTSKAGDDEEFSELYTFKWTTLLIPPTTLLLLNFIG  1011

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAGIS+AINNG ++WGPLFGKLFFAFWVI+HLYPFLKGL+GRQNRTPTIV++WS+LLAS
Sbjct  1012  VVAGISNAINNGYESWGPLFGKLFFAFWVIIHLYPFLKGLVGRQNRTPTIVIVWSILLAS  1071

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSLLWVRIDPF+ K+ GP +++CG++C
Sbjct  1072  IFSLLWVRIDPFLAKSDGPLLEECGLDC  1099



>ref|XP_006373780.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
 gb|ERP51577.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
Length=1064

 Score =   298 bits (762),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  856   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  915

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  916   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLV  975

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  976   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1035

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  K  GPDV QCGINC
Sbjct  1036  SIFSLLWVRVDPFTTKVTGPDVTQCGINC  1064



>gb|KCW89002.1| hypothetical protein EUGRSUZ_A01324 [Eucalyptus grandis]
Length=924

 Score =   295 bits (756),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++  AS++F+ALFLSI ATG+LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  717   IPAVCLLTGKFIIPTLTNFASIWFLALFLSIIATGVLELRWSGVSIEDWWRNEQFWVIGG  776

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  777   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDSEFGELYLFKWTTLLIPPTTLIILNMVG  836

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVV+WSVLLAS
Sbjct  837   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVLWSVLLAS  896

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +K CG+ C
Sbjct  897   IFSLVWVRIDPFLPKQTGPVLKPCGVEC  924



>ref|XP_009601834.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
 ref|XP_009601835.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1087

 Score =   298 bits (762),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  879   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  938

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  939   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLV  998

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS A+N+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  999   GVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1058

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV++CGINC
Sbjct  1059  SIFSLLWVRIDPFTTRVTGPDVQECGINC  1087



>ref|XP_011033320.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Populus euphratica]
Length=1068

 Score =   298 bits (762),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  860   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  919

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  920   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  979

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  980   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1039

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  K  GPDV QCGINC
Sbjct  1040  SIFSLLWVRVDPFTTKVTGPDVAQCGINC  1068



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   298 bits (762),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  874   LPAVCLLTNKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  933

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  934   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  993

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLA
Sbjct  994   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLA  1053

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1054  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1082



>gb|ACN34304.1| unknown [Zea mays]
Length=371

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 190/210 (90%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++FIALFLSI AT +LELRWSGVSIE+WWRNEQFWVIGG
Sbjct  162   IPAVCLLTGKFIIPTLNNLASIWFIALFLSIIATSVLELRWSGVSIEDWWRNEQFWVIGG  221

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEE--FGELYTFKWttllippttiliinL  737
             +SAHLFAV QG LK+L G+DT+FTVTSKA  DE   FG+LY FKWTTLL+PPTT++IIN+
Sbjct  222   VSAHLFAVFQGFLKVLGGVDTSFTVTSKAAGDEADAFGDLYLFKWTTLLVPPTTLIIINM  281

Query  736   VGVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLL  557
             VG+VAG+SDA+NNG  +WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LL
Sbjct  282   VGIVAGVSDAVNNGYGSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILL  341

Query  556   ASIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             ASIFSL+WVRIDPF+ K KGP +K CG+ C
Sbjct  342   ASIFSLVWVRIDPFIPKAKGPILKPCGVEC  371



>ref|XP_008231249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
 ref|XP_008231250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
Length=1082

 Score =   298 bits (762),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  874   LPAVCLLTNKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  933

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAVVQGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  934   VSAHLFAVVQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  993

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV++WS+LLA
Sbjct  994   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLA  1053

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1054  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1082



>ref|XP_002322712.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF04473.1| cellulose synthase family protein [Populus trichocarpa]
Length=1068

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  860   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  919

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  920   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLV  979

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  980   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1039

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  K  GPDV QCGINC
Sbjct  1040  SIFSLLWVRVDPFTTKVTGPDVTQCGINC  1068



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   298 bits (762),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  875   LPAICLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  934

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  935   VSAHLFAVFQGLLKVLAGIDTNFTVTSKATDEDGDFAELYLFKWTTLLIPPTTLLIVNLV  994

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  995   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1054

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV+ CGINC
Sbjct  1055  SIFSLLWVRIDPFTTRVTGPDVQACGINC  1083



>gb|AAY43221.1| cellulose synthase BoCesA4 [Bambusa oldhamii]
Length=1067

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+PEIS  AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  859   LPAICLLTGKFIIPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGG  918

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             ISAHLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTTILIINLV
Sbjct  919   ISAHLFAVFQGLLKVLAGIDTNFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLV  978

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+W++LLA
Sbjct  979   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLA  1038

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPD + CGINC
Sbjct  1039  SIFSLLWVRIDPFTTRVTGPDTQTCGINC  1067



>ref|XP_009400929.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1047

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PAICLLTGKFI+P I  +ASL+F+ LFLSI ATGILELRWSGVSI++WWRNEQFWVIGG
Sbjct  840   IPAICLLTGKFIIPTIDNIASLWFLGLFLSIIATGILELRWSGVSIQDWWRNEQFWVIGG  899

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+L G+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  900   VSAHLFAVFQGLLKVLGGVDTNFTVTAKAADDSEFGELYLFKWTTLLIPPTTLIILNMVG  959

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  960   VVAGVSDAINNGYGSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1019

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K +GP +KQCG+ C
Sbjct  1020  IFSLVWVRIDPFLPKQQGPVLKQCGVEC  1047



>ref|XP_009781299.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Nicotiana sylvestris]
Length=1054

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  847   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  906

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  907   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNMVG  966

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  967   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1026

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1027  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1054



>ref|XP_011093547.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Sesamum indicum]
Length=1047

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++F++LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  839   LPAVCLLTGKFIIPQISNLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  898

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  899   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLV  958

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  959   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1018

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1019  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1047



>ref|XP_009588113.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X3 [Nicotiana tomentosiformis]
Length=1049

 Score =   297 bits (761),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  842   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  901

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  902   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNMVG  961

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  962   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1021

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1022  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1049



>ref|XP_009588107.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1050

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  843   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  902

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  903   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNMVG  962

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  963   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1022

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1023  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1050



>ref|XP_009781300.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X2 [Nicotiana sylvestris]
Length=1053

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  846   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  905

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  906   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNMVG  965

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  966   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1025

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1026  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1053



>gb|AHL45026.1| cellulose synthase 3B [Linum usitatissimum]
Length=1059

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS LAS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  851   LPAVCLLTGKFIIPQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  910

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  911   VSAHLFAVFQGLLKVLAGIDTNFTVTSKANDEDGDFAELYLFKWTTLLIPPTTLLVINLV  970

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  971   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1030

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVRIDPF  +  GPDV QCGINC
Sbjct  1031  SIFSLLWVRIDPFTTRVTGPDVDQCGINC  1059



>ref|XP_011033321.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1064

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  856   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  915

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  916   VSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  975

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WSVLLA
Sbjct  976   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLA  1035

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  K  GPDV QCGINC
Sbjct  1036  SIFSLLWVRVDPFTTKVTGPDVAQCGINC  1064



>ref|XP_009400930.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1043

 Score =   297 bits (760),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PAICLLTGKFI+P I  +ASL+F+ LFLSI ATGILELRWSGVSI++WWRNEQFWVIGG
Sbjct  836   IPAICLLTGKFIIPTIDNIASLWFLGLFLSIIATGILELRWSGVSIQDWWRNEQFWVIGG  895

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+L G+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  896   VSAHLFAVFQGLLKVLGGVDTNFTVTAKAADDSEFGELYLFKWTTLLIPPTTLIILNMVG  955

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  956   VVAGVSDAINNGYGSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1015

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K +GP +KQCG+ C
Sbjct  1016  IFSLVWVRIDPFLPKQQGPVLKQCGVEC  1043



>ref|XP_011047398.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011047399.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X2 [Populus euphratica]
 ref|XP_011047400.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1079

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  871   LPAICLLTDKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  930

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +SAHLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLL+PPTT+LI+NLV
Sbjct  931   VSAHLFAVCQGLLKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLVPPTTLLIVNLV  990

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  991   GVVAGISHAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLA  1050

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1051  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1079



>ref|XP_008790520.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1068

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  860   LPAVCLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  919

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D+E +F ELY FKWTTLLIPPTT+LIINLV
Sbjct  920   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEEGDFTELYMFKWTTLLIPPTTLLIINLV  979

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  980   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1039

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPD++QCGINC
Sbjct  1040  SIFSLLWVRVDPFTTRVTGPDIQQCGINC  1068



>gb|KDO83412.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1082

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IS LAS+ FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  874   LPAVCLLTNKFIMPQISNLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  933

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  934   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  993

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  994   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1053

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1054  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1082



>ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Citrus sinensis]
 ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Citrus sinensis]
Length=1079

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IS LAS+ FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  871   LPAVCLLTNKFIMPQISNLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  930

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  931   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  990

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  991   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1050

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1051  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1079



>ref|XP_009588096.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1051

 Score =   297 bits (760),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLTGKFI+P ++  AS++F+ALFLSI  T +LELRWSGVSIE WWRNEQFWVIGG
Sbjct  844   LPAVCLLTGKFIVPTLNNFASIWFMALFLSIIVTSVLELRWSGVSIEAWWRNEQFWVIGG  903

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA +D EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  904   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAAEDTEFGELYLFKWTTLLIPPTTLIILNMVG  963

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  964   VVAGVSDAINNGYGSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1023

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K KGP +KQCG+ C
Sbjct  1024  IFSLVWVRIDPFLPKQKGPILKQCGVEC  1051



>gb|KDO83405.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83406.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83407.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83408.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83409.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83410.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83411.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1079

 Score =   297 bits (761),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPA+CLLT KFIMP+IS LAS+ FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  871   LPAVCLLTNKFIMPQISNLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  930

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDE-EFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D++ +F ELY FKWTTLLIPPTT+L+INLV
Sbjct  931   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLV  990

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAG+S AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  991   GVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1050

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1051  SIFSLLWVRVDPFTTRVTGPDVEQCGINC  1079



>gb|ACF80398.1| unknown [Zea mays]
Length=295

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 186/210 (89%), Gaps = 2/210 (1%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLT KFI+PEIS  A +FFI LF SIFATGILELRWSGV IE+WWRNEQFWVIGG
Sbjct  86    LPAICLLTNKFIIPEISNYAGMFFILLFASIFATGILELRWSGVGIEDWWRNEQFWVIGG  145

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
              SAHLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWT+LLIPPTT+L+INLV
Sbjct  146   TSAHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVLVINLV  205

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             G+VAGIS AIN+G Q+WGPLFGKLFF+ WVI+HLYPFLKGLMGRQNRTPTIV++WS+LLA
Sbjct  206   GMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRTPTIVIVWSILLA  265

Query  553   SIFSLLWVRIDPFVLKT-KGPDVKQCGINC  467
             SIFSLLWV+IDPF+  T K   + QCG+NC
Sbjct  266   SIFSLLWVKIDPFISPTQKAAALGQCGVNC  295



>ref|XP_003594882.1| Cellulose synthase [Medicago truncatula]
Length=1039

 Score =   297 bits (760),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++F+ALF+SI  TG+LELRWSGV+IE+WWRNEQFWVIGG
Sbjct  832   IPAVCLLTGKFIIPTLTNLASVWFMALFISIILTGVLELRWSGVAIEDWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  892   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDAEFGELYLFKWTTLLIPPTTLIILNIVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAIN+GS +WGPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVV+WS+LLAS
Sbjct  952   VVAGVSDAINSGSGSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1012  IFSLIWVRIDPFLPKQTGPILKQCGVEC  1039



>gb|AES65133.2| cellulose synthase-like protein [Medicago truncatula]
Length=1044

 Score =   297 bits (760),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P ++ LAS++F+ALF+SI  TG+LELRWSGV+IE+WWRNEQFWVIGG
Sbjct  837   IPAVCLLTGKFIIPTLTNLASVWFMALFISIILTGVLELRWSGVAIEDWWRNEQFWVIGG  896

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  897   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDAEFGELYLFKWTTLLIPPTTLIILNIVG  956

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAIN+GS +WGPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVV+WS+LLAS
Sbjct  957   VVAGVSDAINSGSGSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVLWSILLAS  1016

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1017  IFSLIWVRIDPFLPKQTGPILKQCGVEC  1044



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   297 bits (760),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             LPAICLLTGKFI+P+IS +AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG
Sbjct  858   LPAICLLTGKFIIPQISNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG  917

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVD-DEEFGELYTFKWttllippttiliinLV  734
             +S+HLFAV QGLLK+LAGIDTNFTVTSKA D D +F ELY FKWTTLLIPPTT+LI+NLV
Sbjct  918   VSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLV  977

Query  733   GVVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLA  554
             GVVAGIS AIN+G Q+WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLA
Sbjct  978   GVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLA  1037

Query  553   SIFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             SIFSLLWVR+DPF  +  GPDV+QCGINC
Sbjct  1038  SIFSLLWVRVDPFTTRVTGPDVQQCGINC  1066



>gb|AEX20379.1| cellulose synthase catalytic subunit 2-At [Gossypium hirsutum]
 gb|AEX20381.1| cellulose synthase catalytic subunit 2-At [Gossypium hirsutum]
Length=1039

 Score =   297 bits (760),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  1090  LPAICLLTGKFIMPEIstlaslffialflsifaTGILELRWSGVSIEEWWRNEQFWVIGG  911
             +PA+CLLTGKFI+P +S L S++F+ALFLSI ATG+LELRWSGVSI++WWRNEQFWVIGG
Sbjct  832   IPAVCLLTGKFIIPTLSNLTSVWFLALFLSIIATGVLELRWSGVSIQDWWRNEQFWVIGG  891

Query  910   ISAHLFAVVQGLLKILAGIDTNFTVTSKAVDDEEFGELYTFKWttllippttiliinLVG  731
             +SAHLFAV QGLLK+LAG+DTNFTVT+KA DD EFGELY FKWTTLLIPPTT++I+N+VG
Sbjct  892   VSAHLFAVFQGLLKVLAGVDTNFTVTAKAADDTEFGELYLFKWTTLLIPPTTLIILNMVG  951

Query  730   VVAGISDAINNGSQAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLAS  551
             VVAG+SDAINNG  +WGPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVV+WS+LLAS
Sbjct  952   VVAGVSDAINNGYGSWGPLFGKLFFAFWVILHLYPFLKGLMGRQNRTPTIVVLWSILLAS  1011

Query  550   IFSLLWVRIDPFVLKTKGPDVKQCGINC  467
             IFSL+WVRIDPF+ K  GP +KQCG+ C
Sbjct  1012  IFSLVWVRIDPFLPKQTGPVLKQCGVEC  1039



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592