BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21481_g1_i5 len=623 path=[1071:0-206 1278:207-284 197:285-285
1355:286-287 1357:288-622]

Length=623
                                                                      Score     E

ref|XP_006361023.1|  PREDICTED: uncharacterized protein LOC102579...    122   1e-31   
ref|XP_006361022.1|  PREDICTED: uncharacterized protein LOC102579...    122   1e-31   
ref|XP_009607983.1|  PREDICTED: uncharacterized protein LOC104102...    121   1e-31   
ref|XP_004234103.1|  PREDICTED: uncharacterized protein LOC101255...    121   2e-31   
ref|XP_004248106.1|  PREDICTED: uncharacterized protein LOC101245801    120   3e-31   
ref|XP_004234102.1|  PREDICTED: uncharacterized protein LOC101255...    119   1e-30   
ref|XP_009607984.1|  PREDICTED: uncharacterized protein LOC104102...    119   1e-30   
ref|XP_009759715.1|  PREDICTED: uncharacterized protein LOC104212...    116   2e-29   
ref|XP_009759716.1|  PREDICTED: uncharacterized protein LOC104212...    116   2e-29   
ref|XP_009607985.1|  PREDICTED: uncharacterized protein LOC104102...    110   2e-27   
ref|XP_006361024.1|  PREDICTED: uncharacterized protein LOC102579...    110   2e-27   
ref|XP_006364294.1|  PREDICTED: uncharacterized protein LOC102604...    109   7e-27   
ref|XP_006364295.1|  PREDICTED: uncharacterized protein LOC102604...    109   8e-27   
ref|XP_009630296.1|  PREDICTED: uncharacterized protein LOC104120...    108   1e-26   
ref|XP_009630294.1|  PREDICTED: uncharacterized protein LOC104120...    108   1e-26   
ref|XP_004234108.1|  PREDICTED: uncharacterized protein LOC101255...    108   2e-26   
ref|XP_009759717.1|  PREDICTED: uncharacterized protein LOC104212...    107   3e-26   
ref|XP_009773521.1|  PREDICTED: uncharacterized protein LOC104223...    107   6e-26   
ref|XP_009773516.1|  PREDICTED: uncharacterized protein LOC104223...    106   7e-26   
ref|XP_011086046.1|  PREDICTED: uncharacterized protein LOC105167...    105   2e-25   
ref|XP_004234107.1|  PREDICTED: uncharacterized protein LOC101255...    105   2e-25   
emb|CDO99502.1|  unnamed protein product                                101   7e-24   
emb|CDO99501.1|  unnamed protein product                                101   1e-23   
ref|XP_006467741.1|  PREDICTED: uncharacterized protein LOC102611...  99.0    8e-23   
gb|EYU43376.1|  hypothetical protein MIMGU_mgv1a016994mg              98.6    9e-23   
ref|XP_006364296.1|  PREDICTED: uncharacterized protein LOC102604...  98.6    1e-22   
ref|XP_009630305.1|  PREDICTED: uncharacterized protein LOC104120...  98.2    1e-22   
ref|XP_009630302.1|  PREDICTED: uncharacterized protein LOC104120...  97.8    2e-22   
ref|XP_006449402.1|  hypothetical protein CICLE_v10017075mg           99.8    2e-22   
gb|KDO77677.1|  hypothetical protein CISIN_1g031795mg                 99.4    2e-22   
ref|XP_006384044.1|  hypothetical protein POPTR_0004s04770g           97.4    3e-22   
ref|XP_008371406.1|  PREDICTED: uncharacterized protein LOC103434...  96.3    7e-22   
ref|XP_009773528.1|  PREDICTED: uncharacterized protein LOC104223...  96.3    8e-22   
ref|XP_009773525.1|  PREDICTED: uncharacterized protein LOC104223...  96.3    8e-22   
ref|XP_010316771.1|  PREDICTED: uncharacterized protein LOC104645...  95.5    1e-21   
ref|XP_007212289.1|  hypothetical protein PRUPE_ppa013893mg           95.5    1e-21   
ref|XP_009343348.1|  PREDICTED: uncharacterized protein LOC103935...  95.5    2e-21   
ref|XP_011043430.1|  PREDICTED: uncharacterized protein LOC105138...  95.5    2e-21   
ref|XP_009630295.1|  PREDICTED: uncharacterized protein LOC104120...  95.1    2e-21   
ref|XP_010052276.1|  PREDICTED: uncharacterized protein LOC104440...  95.5    2e-21   
ref|XP_006410536.1|  hypothetical protein EUTSA_v10017477mg           95.1    2e-21   
ref|XP_008358662.1|  PREDICTED: uncharacterized protein LOC103422...  94.7    3e-21   
ref|NP_001117372.1|  uncharacterized protein                          94.7    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43377.1|  hypothetical protein MIMGU_mgv1a016994mg              94.7    3e-21   
ref|XP_010499366.1|  PREDICTED: uncharacterized protein LOC104776...  94.0    5e-21   
ref|XP_009630293.1|  PREDICTED: uncharacterized protein LOC104120...  94.4    7e-21   
ref|XP_006377403.1|  hypothetical protein POPTR_0011s05620g           94.0    7e-21   
ref|XP_006303426.1|  hypothetical protein CARUB_v10010643mg           94.4    7e-21   
ref|XP_009773517.1|  PREDICTED: uncharacterized protein LOC104223...  93.2    1e-20   
ref|XP_010538174.1|  PREDICTED: uncharacterized protein LOC104812...  93.2    1e-20   
ref|XP_009109727.1|  PREDICTED: uncharacterized protein LOC103835...  92.4    2e-20   
ref|XP_006415660.1|  hypothetical protein EUTSA_v10009195mg           92.4    2e-20   
gb|KHG30560.1|  hypothetical protein F383_13400                       92.4    2e-20   
gb|EYU43378.1|  hypothetical protein MIMGU_mgv1a016994mg              91.3    5e-20   
ref|NP_001078001.1|  uncharacterized protein                          91.3    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28329.1|  unknown                                               91.3    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086047.1|  PREDICTED: uncharacterized protein LOC105167...  91.3    5e-20   
ref|XP_010509820.1|  PREDICTED: uncharacterized protein LOC104786170  91.3    6e-20   
ref|XP_010413797.1|  PREDICTED: uncharacterized protein LOC104700050  91.3    6e-20   
ref|XP_010478212.1|  PREDICTED: uncharacterized protein LOC104757...  90.5    9e-20   
ref|XP_010469415.1|  PREDICTED: uncharacterized protein LOC104749471  90.5    1e-19   
ref|XP_010655453.1|  PREDICTED: uncharacterized protein LOC100264...  90.1    2e-19   
ref|XP_011086045.1|  PREDICTED: uncharacterized protein LOC105167...  90.1    2e-19   
ref|XP_010686407.1|  PREDICTED: uncharacterized protein LOC104900...  89.4    3e-19   
gb|EYU28007.1|  hypothetical protein MIMGU_mgv1a016927mg              88.6    6e-19   
ref|XP_007148130.1|  hypothetical protein PHAVU_006G182900g           88.2    7e-19   
ref|XP_006467744.1|  PREDICTED: uncharacterized protein LOC102611...  87.8    1e-18   
ref|XP_003633236.1|  PREDICTED: uncharacterized protein LOC100243...  87.0    2e-18   
ref|XP_004134688.1|  PREDICTED: uncharacterized protein LOC101221...  87.4    2e-18   
gb|KFK24423.1|  hypothetical protein AALP_AAs55026U000200             85.9    3e-18   
ref|XP_006295320.1|  hypothetical protein CARUB_v10024407mg           86.3    4e-18   
ref|XP_004300265.1|  PREDICTED: uncharacterized protein LOC101291628  86.3    4e-18   
ref|XP_002276788.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    6e-18   Vitis vinifera
gb|EYU28006.1|  hypothetical protein MIMGU_mgv1a016927mg              85.5    8e-18   
gb|EYU28005.1|  hypothetical protein MIMGU_mgv1a016927mg              85.5    9e-18   
ref|XP_006597455.1|  PREDICTED: uncharacterized protein LOC100806...  85.1    1e-17   
ref|XP_008371410.1|  PREDICTED: uncharacterized protein LOC103434...  85.1    1e-17   
ref|XP_006467739.1|  PREDICTED: uncharacterized protein LOC102611...  84.7    1e-17   
ref|XP_007212288.1|  hypothetical protein PRUPE_ppa013893mg           84.3    2e-17   
ref|XP_011043433.1|  PREDICTED: uncharacterized protein LOC105138...  84.3    2e-17   
ref|XP_006449401.1|  hypothetical protein CICLE_v10017075mg           85.5    2e-17   
ref|NP_001185107.1|  uncharacterized protein                          84.0    3e-17   
ref|XP_009343604.1|  PREDICTED: uncharacterized protein LOC103935...  84.0    3e-17   
ref|XP_010052282.1|  PREDICTED: uncharacterized protein LOC104440...  84.3    3e-17   
gb|KDO77678.1|  hypothetical protein CISIN_1g031795mg                 85.5    3e-17   
ref|XP_003543032.1|  PREDICTED: uncharacterized protein LOC100797...  84.0    3e-17   
ref|XP_007132785.1|  hypothetical protein PHAVU_011G124500g           83.6    4e-17   
ref|XP_008358666.1|  PREDICTED: uncharacterized protein LOC103422...  83.6    4e-17   
emb|CDO99500.1|  unnamed protein product                              83.2    5e-17   
gb|KFK44713.1|  hypothetical protein AALP_AA1G293200                  83.2    5e-17   
ref|XP_010499368.1|  PREDICTED: uncharacterized protein LOC104776...  83.2    5e-17   
ref|XP_006303424.1|  hypothetical protein CARUB_v10010643mg           83.6    7e-17   
ref|XP_002893527.1|  hypothetical protein ARALYDRAFT_313543           82.8    7e-17   
ref|XP_006410535.1|  hypothetical protein EUTSA_v10017477mg           82.8    8e-17   
ref|XP_010538178.1|  PREDICTED: uncharacterized protein LOC104812...  82.4    1e-16   
ref|XP_011096352.1|  PREDICTED: uncharacterized protein LOC105175...  85.1    1e-16   
emb|CDO98620.1|  unnamed protein product                              82.0    1e-16   
ref|XP_002509436.1|  conserved hypothetical protein                   82.0    1e-16   Ricinus communis
ref|NP_564308.1|  uncharacterized protein                             82.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371409.1|  PREDICTED: uncharacterized protein LOC103434...  82.0    1e-16   
ref|XP_008371407.1|  PREDICTED: uncharacterized protein LOC103434...  82.0    1e-16   
ref|XP_009109729.1|  PREDICTED: uncharacterized protein LOC103835...  82.0    2e-16   
ref|XP_008371408.1|  PREDICTED: uncharacterized protein LOC103434...  82.0    2e-16   
ref|XP_006415659.1|  hypothetical protein EUTSA_v10009195mg           81.6    2e-16   
ref|XP_002881310.1|  hypothetical protein ARALYDRAFT_902473           81.6    2e-16   
ref|XP_008225140.1|  PREDICTED: uncharacterized protein LOC103324...  81.6    2e-16   
ref|XP_008225141.1|  PREDICTED: uncharacterized protein LOC103324...  81.3    2e-16   
ref|XP_010499367.1|  PREDICTED: uncharacterized protein LOC104776...  81.6    2e-16   
ref|XP_007212290.1|  hypothetical protein PRUPE_ppa013893mg           81.3    2e-16   
ref|XP_010052279.1|  PREDICTED: uncharacterized protein LOC104440...  81.6    3e-16   
gb|EPS69777.1|  hypothetical protein M569_04988                       80.9    3e-16   
ref|XP_011043432.1|  PREDICTED: uncharacterized protein LOC105138...  81.3    3e-16   
ref|XP_009343471.1|  PREDICTED: uncharacterized protein LOC103935...  81.3    3e-16   
ref|XP_004487201.1|  PREDICTED: uncharacterized protein LOC101514...  81.3    3e-16   
ref|XP_006303425.1|  hypothetical protein CARUB_v10010643mg           82.0    3e-16   
ref|XP_009343542.1|  PREDICTED: uncharacterized protein LOC103935...  80.9    3e-16   
ref|XP_011043431.1|  PREDICTED: uncharacterized protein LOC105138...  81.3    4e-16   
ref|XP_009343674.1|  PREDICTED: uncharacterized protein LOC103935...  80.9    4e-16   
ref|XP_004293874.1|  PREDICTED: uncharacterized protein LOC101297...  80.9    5e-16   
ref|XP_008358665.1|  PREDICTED: uncharacterized protein LOC103422...  80.9    5e-16   
ref|XP_010538176.1|  PREDICTED: uncharacterized protein LOC104812...  80.5    5e-16   
ref|NP_001078002.1|  uncharacterized protein                          80.1    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358669.1|  PREDICTED: uncharacterized protein LOC103422...  80.5    6e-16   
ref|XP_008358667.1|  PREDICTED: uncharacterized protein LOC103422...  80.5    6e-16   
gb|KEH36562.1|  hypothetical protein MTR_2g014370                     80.1    6e-16   
ref|XP_008383893.1|  PREDICTED: uncharacterized protein LOC103446533  80.5    7e-16   
ref|XP_009109728.1|  PREDICTED: uncharacterized protein LOC103835...  80.1    8e-16   
ref|XP_006415661.1|  hypothetical protein EUTSA_v10009195mg           80.1    8e-16   
ref|XP_006377406.1|  hypothetical protein POPTR_0011s05620g           79.7    9e-16   
ref|XP_010478214.1|  PREDICTED: uncharacterized protein LOC104757...  79.7    9e-16   
ref|XP_006377405.1|  hypothetical protein POPTR_0011s05620g           80.1    9e-16   
ref|XP_011096349.1|  PREDICTED: uncharacterized protein LOC105175...  82.0    1e-15   
ref|XP_011096353.1|  PREDICTED: uncharacterized protein LOC105175...  82.0    1e-15   
ref|XP_004485820.1|  PREDICTED: uncharacterized protein LOC101505...  79.3    1e-15   
ref|XP_002279363.2|  PREDICTED: uncharacterized protein LOC100264...  79.0    2e-15   Vitis vinifera
ref|XP_006377402.1|  hypothetical protein POPTR_0011s05620g           79.7    2e-15   
gb|KGN49250.1|  hypothetical protein Csa_6G518070                     81.3    2e-15   
emb|CDY35740.1|  BnaC03g58610D                                        79.0    2e-15   
ref|XP_006592846.1|  PREDICTED: uncharacterized protein LOC100788...  78.6    3e-15   
ref|XP_003543327.2|  PREDICTED: uncharacterized protein LOC100777...  79.3    3e-15   
ref|XP_010686409.1|  PREDICTED: uncharacterized protein LOC104900...  78.6    3e-15   
ref|XP_010478213.1|  PREDICTED: uncharacterized protein LOC104757...  78.6    3e-15   
emb|CDY34102.1|  BnaA09g27280D                                        78.2    3e-15   
ref|XP_010540465.1|  PREDICTED: uncharacterized protein LOC104814228  78.2    5e-15   
ref|XP_009143826.1|  PREDICTED: uncharacterized protein LOC103867...  77.8    6e-15   
ref|XP_007148131.1|  hypothetical protein PHAVU_006G182900g           77.4    7e-15   
emb|CDY17208.1|  BnaA05g09800D                                        76.3    2e-14   
ref|XP_004134692.1|  PREDICTED: uncharacterized protein LOC101221...  76.3    2e-14   
ref|XP_002279344.1|  PREDICTED: uncharacterized protein LOC100264...  76.3    2e-14   Vitis vinifera
ref|XP_004134690.1|  PREDICTED: uncharacterized protein LOC101221...  76.3    2e-14   
ref|XP_011027936.1|  PREDICTED: uncharacterized protein LOC105128111  75.9    2e-14   
ref|XP_004134689.1|  PREDICTED: uncharacterized protein LOC101221...  75.9    3e-14   
ref|XP_003633235.1|  PREDICTED: uncharacterized protein LOC100243...  75.9    3e-14   
ref|XP_003633234.1|  PREDICTED: uncharacterized protein LOC100243...  75.5    3e-14   
ref|XP_003633237.1|  PREDICTED: uncharacterized protein LOC100243...  75.5    3e-14   
ref|XP_010686408.1|  PREDICTED: uncharacterized protein LOC104900...  75.9    3e-14   
ref|NP_001240187.1|  uncharacterized protein LOC100776551             75.5    4e-14   
ref|XP_010686410.1|  PREDICTED: uncharacterized protein LOC104900...  75.5    4e-14   
ref|XP_007198943.1|  hypothetical protein PRUPE_ppa013910mg           74.7    7e-14   
ref|XP_007148132.1|  hypothetical protein PHAVU_006G182900g           74.3    8e-14   
ref|XP_003546003.1|  PREDICTED: uncharacterized protein LOC100806...  74.3    9e-14   
ref|XP_006388109.1|  hypothetical protein POPTR_0335s00210g           73.2    1e-13   
ref|XP_004505543.1|  PREDICTED: uncharacterized protein LOC101498...  73.6    2e-13   
ref|XP_009357138.1|  PREDICTED: uncharacterized protein LOC103947...  73.6    2e-13   
ref|XP_010035780.1|  PREDICTED: uncharacterized protein LOC104424...  73.6    2e-13   
ref|XP_007149815.1|  hypothetical protein PHAVU_005G101000g           73.9    2e-13   
ref|XP_007149813.1|  hypothetical protein PHAVU_005G101000g           73.9    2e-13   
ref|XP_004134691.1|  PREDICTED: uncharacterized protein LOC101221...  73.2    2e-13   
ref|XP_007149812.1|  hypothetical protein PHAVU_005G101000g           73.9    3e-13   
ref|XP_009143825.1|  PREDICTED: uncharacterized protein LOC103867...  73.2    3e-13   
ref|XP_004293876.1|  PREDICTED: uncharacterized protein LOC101297...  72.8    3e-13   
gb|AFK44475.1|  unknown                                               72.8    3e-13   
ref|XP_006594573.1|  PREDICTED: uncharacterized protein LOC100797...  72.4    3e-13   
ref|XP_004155641.1|  PREDICTED: uncharacterized protein LOC101231364  72.8    4e-13   
ref|XP_008459322.1|  PREDICTED: uncharacterized protein LOC103498...  72.4    4e-13   
ref|XP_009357137.1|  PREDICTED: uncharacterized protein LOC103947...  72.0    6e-13   
ref|XP_003546005.1|  PREDICTED: uncharacterized protein LOC100806...  71.6    9e-13   
ref|XP_006597456.1|  PREDICTED: uncharacterized protein LOC100806...  71.2    1e-12   
gb|KDP21004.1|  hypothetical protein JCGZ_21475                       71.2    1e-12   
ref|XP_008358242.1|  PREDICTED: uncharacterized protein LOC103421...  71.2    1e-12   
ref|XP_010259168.1|  PREDICTED: uncharacterized protein LOC104598...  71.2    1e-12   
ref|XP_007043672.1|  Nuclear fusion defective 6 isoform 2             71.2    1e-12   
ref|XP_007043671.1|  Nuclear fusion defective 6 isoform 1             70.9    1e-12   
ref|XP_004148698.1|  PREDICTED: uncharacterized protein LOC101214...  70.9    2e-12   
gb|KDP24089.1|  hypothetical protein JCGZ_25746                       70.9    2e-12   
ref|XP_007132782.1|  hypothetical protein PHAVU_011G124500g           70.5    2e-12   
ref|XP_007132781.1|  hypothetical protein PHAVU_011G124500g           70.1    2e-12   
ref|XP_007132780.1|  hypothetical protein PHAVU_011G124500g           70.1    3e-12   
ref|XP_004293274.1|  PREDICTED: uncharacterized protein LOC101313580  70.5    3e-12   
ref|XP_011100248.1|  PREDICTED: uncharacterized protein LOC105178...  70.5    3e-12   
ref|XP_010259217.1|  PREDICTED: uncharacterized protein LOC104598...  70.1    3e-12   
ref|XP_011100249.1|  PREDICTED: uncharacterized protein LOC105178...  70.1    3e-12   
ref|XP_004293877.1|  PREDICTED: uncharacterized protein LOC101297...  70.1    3e-12   
ref|XP_004293873.1|  PREDICTED: uncharacterized protein LOC101297...  70.1    3e-12   
ref|XP_003543030.1|  PREDICTED: uncharacterized protein LOC100797...  70.1    3e-12   
gb|KDO43069.1|  hypothetical protein CISIN_1g0343852mg                69.7    4e-12   
ref|XP_008358241.1|  PREDICTED: uncharacterized protein LOC103421...  69.7    4e-12   
ref|XP_003543031.1|  PREDICTED: uncharacterized protein LOC100797...  69.7    4e-12   
ref|XP_006594574.1|  PREDICTED: uncharacterized protein LOC100797...  69.3    4e-12   
gb|AFK47257.1|  unknown                                               69.3    5e-12   
gb|AFK46480.1|  unknown                                               68.9    6e-12   
ref|XP_004505545.1|  PREDICTED: uncharacterized protein LOC101498...  68.6    9e-12   
ref|XP_009761838.1|  PREDICTED: uncharacterized protein LOC104213960  68.6    1e-11   
ref|XP_004485828.1|  PREDICTED: uncharacterized protein LOC101505...  68.2    1e-11   
ref|XP_010111183.1|  hypothetical protein L484_015066                 68.9    1e-11   
gb|KEH36564.1|  hypothetical protein MTR_2g014370                     68.2    2e-11   
ref|XP_004487204.1|  PREDICTED: uncharacterized protein LOC101514...  67.8    2e-11   
ref|XP_004487200.1|  PREDICTED: uncharacterized protein LOC101514...  67.8    2e-11   
ref|XP_004487205.1|  PREDICTED: uncharacterized protein LOC101514...  67.8    2e-11   
ref|XP_010274637.1|  PREDICTED: uncharacterized protein LOC104609...  67.8    2e-11   
ref|XP_009599604.1|  PREDICTED: uncharacterized protein LOC104095...  67.8    2e-11   
ref|XP_006592851.1|  PREDICTED: uncharacterized protein LOC100788...  67.8    2e-11   
ref|XP_006447226.1|  hypothetical protein CICLE_v10017238mg           67.8    2e-11   
ref|XP_010100969.1|  hypothetical protein L484_001331                 68.2    2e-11   
ref|XP_006594841.1|  PREDICTED: uncharacterized protein LOC100777...  68.2    3e-11   
ref|XP_009610350.1|  PREDICTED: uncharacterized protein LOC104104...  68.2    3e-11   
gb|KGN63195.1|  hypothetical protein Csa_2G408410                     67.0    3e-11   
ref|XP_004505547.1|  PREDICTED: uncharacterized protein LOC101498...  66.6    4e-11   
ref|XP_004505548.1|  PREDICTED: uncharacterized protein LOC101498...  66.6    5e-11   
ref|XP_004505546.1|  PREDICTED: uncharacterized protein LOC101498...  66.6    5e-11   
ref|XP_004505549.1|  PREDICTED: uncharacterized protein LOC101498...  66.6    5e-11   
ref|XP_009610358.1|  PREDICTED: uncharacterized protein LOC104104...  66.6    5e-11   
ref|XP_011100252.1|  PREDICTED: uncharacterized protein LOC105178...  66.2    7e-11   
gb|AES63883.2|  hypothetical protein MTR_2g014370                     65.9    7e-11   
gb|KEH36563.1|  hypothetical protein MTR_2g014370                     65.9    8e-11   
ref|XP_003593632.1|  hypothetical protein MTR_2g014370                65.9    8e-11   
emb|CDY27930.1|  BnaCnng05150D                                        66.2    9e-11   
gb|AFK42622.1|  unknown                                               65.9    1e-10   
ref|XP_003540376.1|  PREDICTED: uncharacterized protein LOC100788...  65.9    1e-10   
ref|XP_003540375.1|  PREDICTED: uncharacterized protein LOC100788...  65.9    1e-10   
ref|XP_006592850.1|  PREDICTED: uncharacterized protein LOC100788...  65.5    1e-10   
ref|XP_006594839.1|  PREDICTED: uncharacterized protein LOC100777...  66.2    1e-10   
ref|XP_004485826.1|  PREDICTED: uncharacterized protein LOC101505...  65.5    1e-10   
ref|XP_004485816.1|  PREDICTED: uncharacterized protein LOC101505...  65.5    1e-10   
ref|XP_008459321.1|  PREDICTED: uncharacterized protein LOC103498...  65.5    1e-10   
ref|XP_006594840.1|  PREDICTED: uncharacterized protein LOC100777...  65.9    1e-10   
ref|XP_006594835.1|  PREDICTED: uncharacterized protein LOC100777...  66.2    1e-10   
ref|XP_010035779.1|  PREDICTED: uncharacterized protein LOC104424...  65.5    1e-10   
emb|CDP20531.1|  unnamed protein product                              65.1    1e-10   
ref|XP_010035783.1|  PREDICTED: uncharacterized protein LOC104424...  65.1    2e-10   
ref|XP_008229020.1|  PREDICTED: uncharacterized protein LOC103328405  64.3    2e-10   
gb|KHN27907.1|  hypothetical protein glysoja_007639                   65.1    2e-10   
ref|XP_010274636.1|  PREDICTED: uncharacterized protein LOC104609...  65.1    2e-10   
ref|XP_010035786.1|  PREDICTED: uncharacterized protein LOC104424...  64.7    2e-10   
ref|XP_009759398.1|  PREDICTED: uncharacterized protein LOC104211...  64.7    2e-10   
ref|XP_004485815.1|  PREDICTED: uncharacterized protein LOC101505...  65.1    3e-10   
ref|XP_006372742.1|  hypothetical protein POPTR_0017s04630g           64.3    3e-10   
ref|XP_004148697.1|  PREDICTED: uncharacterized protein LOC101214...  64.3    3e-10   
ref|XP_004170261.1|  PREDICTED: uncharacterized protein LOC101225805  63.9    3e-10   
ref|XP_002517865.1|  conserved hypothetical protein                   64.3    4e-10   Ricinus communis
ref|XP_009357141.1|  PREDICTED: uncharacterized protein LOC103947...  63.9    4e-10   
ref|XP_007198942.1|  hypothetical protein PRUPE_ppa013910mg           63.9    4e-10   
gb|KEH30708.1|  hypothetical protein MTR_4g078770                     63.9    5e-10   
ref|XP_006582306.1|  PREDICTED: uncharacterized protein LOC100800...  62.8    1e-09   
ref|XP_009759399.1|  PREDICTED: uncharacterized protein LOC104211...  62.8    1e-09   
ref|XP_006582303.1|  PREDICTED: uncharacterized protein LOC100800...  62.8    1e-09   
ref|XP_003527420.1|  PREDICTED: uncharacterized protein LOC100800...  62.4    1e-09   
ref|XP_009610365.1|  PREDICTED: uncharacterized protein LOC104104...  62.4    1e-09   
ref|XP_006447224.1|  hypothetical protein CICLE_v10017238mg           62.8    2e-09   
ref|XP_006591852.1|  PREDICTED: uncharacterized protein LOC100776...  62.4    2e-09   
ref|XP_009610386.1|  PREDICTED: uncharacterized protein LOC104104...  62.0    2e-09   
ref|XP_011029053.1|  PREDICTED: uncharacterized protein LOC105128...  62.0    2e-09   
ref|XP_006591853.1|  PREDICTED: uncharacterized protein LOC100776...  62.0    2e-09   
ref|XP_008358244.1|  PREDICTED: uncharacterized protein LOC103421...  61.6    3e-09   
gb|KEH39179.1|  hypothetical protein MTR_2g090650                     61.6    3e-09   
ref|XP_009357140.1|  PREDICTED: uncharacterized protein LOC103947...  61.6    3e-09   
ref|XP_009599605.1|  PREDICTED: uncharacterized protein LOC104095...  61.2    3e-09   
ref|XP_003607503.1|  hypothetical protein MTR_4g078770                61.2    4e-09   
gb|AES89701.2|  hypothetical protein MTR_4g078770                     61.2    4e-09   
gb|AES89699.2|  hypothetical protein MTR_4g078770                     61.2    4e-09   
ref|XP_003607504.1|  hypothetical protein MTR_4g078770                61.2    4e-09   
ref|XP_003607502.1|  hypothetical protein MTR_4g078770                61.2    4e-09   
ref|XP_006447225.1|  hypothetical protein CICLE_v10017238mg           60.8    6e-09   
gb|KHG20170.1|  hypothetical protein F383_08587                       60.5    8e-09   
ref|XP_004296339.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    8e-09   
gb|KDO43070.1|  hypothetical protein CISIN_1g0343852mg                60.1    1e-08   
gb|KEH39182.1|  hypothetical protein MTR_2g090650                     60.1    1e-08   
ref|XP_006447227.1|  hypothetical protein CICLE_v10017238mg           60.1    1e-08   
ref|XP_006469914.1|  PREDICTED: uncharacterized protein LOC102614...  59.7    1e-08   
ref|XP_006298870.1|  hypothetical protein CARUB_v10014989mg           59.7    2e-08   
gb|KEH39181.1|  hypothetical protein MTR_2g090650                     59.3    2e-08   
gb|KDO43071.1|  hypothetical protein CISIN_1g0343852mg                59.3    2e-08   
ref|XP_011100253.1|  PREDICTED: uncharacterized protein LOC105178...  59.3    2e-08   
ref|XP_010540884.1|  PREDICTED: uncharacterized protein LOC104814...  59.3    2e-08   
ref|XP_010540882.1|  PREDICTED: uncharacterized protein LOC104814...  59.3    2e-08   
ref|XP_011100250.1|  PREDICTED: uncharacterized protein LOC105178...  59.3    2e-08   
gb|AFK39507.1|  unknown                                               58.9    2e-08   
ref|XP_008358243.1|  PREDICTED: uncharacterized protein LOC103421...  58.9    2e-08   
ref|XP_011047684.1|  PREDICTED: uncharacterized protein LOC105141...  58.9    2e-08   
ref|XP_009759401.1|  PREDICTED: uncharacterized protein LOC104211...  58.9    3e-08   
ref|XP_011100247.1|  PREDICTED: uncharacterized protein LOC105178...  58.9    3e-08   
ref|XP_010274635.1|  PREDICTED: uncharacterized protein LOC104609...  58.5    3e-08   
ref|XP_006348821.1|  PREDICTED: uncharacterized protein LOC102585...  58.5    3e-08   
ref|XP_009759402.1|  PREDICTED: uncharacterized protein LOC104211...  58.2    4e-08   
ref|XP_006469917.1|  PREDICTED: uncharacterized protein LOC102614...  58.2    6e-08   
gb|KHN24631.1|  hypothetical protein glysoja_032275                   57.8    7e-08   
ref|XP_010924417.1|  PREDICTED: uncharacterized protein LOC105047...  57.0    1e-07   
ref|XP_006469921.1|  PREDICTED: uncharacterized protein LOC102614...  57.0    1e-07   
ref|XP_006469920.1|  PREDICTED: uncharacterized protein LOC102614...  57.0    1e-07   
gb|KGN63193.1|  hypothetical protein Csa_2G408390                     57.0    1e-07   
ref|XP_006469915.1|  PREDICTED: uncharacterized protein LOC102614...  57.0    1e-07   
ref|XP_006469919.1|  PREDICTED: uncharacterized protein LOC102614...  57.0    1e-07   
ref|XP_008811891.1|  PREDICTED: uncharacterized protein LOC103722...  56.6    1e-07   
ref|XP_010919473.1|  PREDICTED: uncharacterized protein LOC105043...  56.6    1e-07   
ref|XP_006408989.1|  hypothetical protein EUTSA_v10002135mg           56.2    3e-07   
ref|XP_010467793.1|  PREDICTED: uncharacterized protein LOC104747...  55.8    4e-07   
ref|XP_010415469.1|  PREDICTED: uncharacterized protein LOC104701...  55.5    4e-07   
ref|XP_009102005.1|  PREDICTED: uncharacterized protein LOC103828...  55.5    5e-07   
ref|XP_006298871.1|  hypothetical protein CARUB_v10014989mg           55.1    6e-07   
ref|XP_006644721.1|  PREDICTED: uncharacterized protein LOC102720374  55.1    6e-07   
emb|CDX81969.1|  BnaC08g36320D                                        54.7    7e-07   
gb|AFK39127.1|  unknown                                               54.7    9e-07   
ref|XP_009102006.1|  PREDICTED: uncharacterized protein LOC103828...  54.7    1e-06   
ref|NP_001044276.1|  Os01g0754000                                     54.7    1e-06   
ref|NP_565478.1|  nuclear fusion defective 6                          54.3    1e-06   
ref|XP_010666075.1|  PREDICTED: uncharacterized protein LOC104883284  54.3    1e-06   
ref|XP_008811892.1|  PREDICTED: uncharacterized protein LOC103722...  54.3    1e-06   
ref|XP_009395700.1|  PREDICTED: uncharacterized protein LOC103980...  54.3    1e-06   
gb|KFK40433.1|  hypothetical protein AALP_AA3G372700                  53.5    3e-06   
gb|ABK94908.1|  unknown                                               53.1    3e-06   
ref|XP_008798254.1|  PREDICTED: uncharacterized protein LOC103713...  52.8    4e-06   
ref|XP_006372744.1|  hypothetical protein POPTR_0017s04630g           52.8    4e-06   
ref|XP_009395699.1|  PREDICTED: uncharacterized protein LOC103980...  52.0    7e-06   
ref|XP_009395996.1|  PREDICTED: uncharacterized protein LOC103981...  52.0    8e-06   
ref|XP_010924419.1|  PREDICTED: uncharacterized protein LOC105047...  52.0    8e-06   
ref|XP_006408988.1|  hypothetical protein EUTSA_v10002135mg           51.6    1e-05   
ref|XP_010919521.1|  PREDICTED: uncharacterized protein LOC105043...  51.6    1e-05   
ref|XP_008811906.1|  PREDICTED: uncharacterized protein LOC103722...  51.6    1e-05   
gb|KGN63196.1|  hypothetical protein Csa_2G408420                     51.2    1e-05   
ref|XP_010467792.1|  PREDICTED: uncharacterized protein LOC104747...  51.6    1e-05   
ref|XP_010924414.1|  PREDICTED: uncharacterized protein LOC105047...  51.2    1e-05   
emb|CDP15865.1|  unnamed protein product                              51.2    2e-05   
ref|XP_010415463.1|  PREDICTED: uncharacterized protein LOC104701...  51.2    2e-05   
ref|XP_010919456.1|  PREDICTED: uncharacterized protein LOC105043...  51.2    2e-05   
ref|XP_008811890.1|  PREDICTED: uncharacterized protein LOC103722...  51.2    2e-05   
gb|KHN36661.1|  hypothetical protein glysoja_001392                   50.8    2e-05   
gb|EPS71494.1|  hypothetical protein M569_03266                       50.8    2e-05   
ref|XP_011047683.1|  PREDICTED: uncharacterized protein LOC105141...  50.8    2e-05   
ref|XP_011029057.1|  PREDICTED: uncharacterized protein LOC105128...  50.8    2e-05   
gb|ACG39455.1|  hypothetical protein                                  50.8    2e-05   
ref|XP_011029056.1|  PREDICTED: uncharacterized protein LOC105128...  50.4    3e-05   
ref|XP_011029055.1|  PREDICTED: uncharacterized protein LOC105128...  50.8    3e-05   
ref|XP_002456370.1|  hypothetical protein SORBIDRAFT_03g034870        50.8    3e-05   
ref|XP_008798260.1|  PREDICTED: uncharacterized protein LOC103713...  50.4    3e-05   
emb|CDY05777.1|  BnaC07g00260D                                        50.4    4e-05   
ref|NP_850002.1|  nuclear fusion defective 6                          50.1    4e-05   
ref|XP_009102008.1|  PREDICTED: uncharacterized protein LOC103828...  50.1    5e-05   
ref|XP_008798255.1|  PREDICTED: uncharacterized protein LOC103713...  49.7    5e-05   
ref|XP_010086918.1|  hypothetical protein L484_005178                 49.7    6e-05   
ref|XP_010540886.1|  PREDICTED: uncharacterized protein LOC104814...  49.7    6e-05   
ref|XP_010540883.1|  PREDICTED: uncharacterized protein LOC104814...  49.7    6e-05   
emb|CDY31951.1|  BnaA07g00440D                                        50.1    8e-05   
ref|XP_009419971.1|  PREDICTED: uncharacterized protein LOC103999823  49.3    9e-05   
ref|XP_010924418.1|  PREDICTED: uncharacterized protein LOC105047...  48.9    1e-04   
ref|XP_009395995.1|  PREDICTED: uncharacterized protein LOC103981...  48.5    1e-04   
ref|XP_011047688.1|  PREDICTED: uncharacterized protein LOC105141...  48.5    1e-04   
ref|XP_008811904.1|  PREDICTED: uncharacterized protein LOC103722...  48.5    1e-04   
ref|XP_011047686.1|  PREDICTED: uncharacterized protein LOC105141...  48.5    2e-04   
gb|KGN53698.1|  hypothetical protein Csa_4G107400                     48.5    2e-04   
ref|XP_003569836.1|  PREDICTED: uncharacterized protein LOC100843...  47.8    4e-04   
ref|NP_001042540.1|  Os01g0238800                                     47.4    4e-04   
ref|XP_008798259.1|  PREDICTED: uncharacterized protein LOC103713...  47.4    4e-04   
emb|CDP15864.1|  unnamed protein product                              47.8    5e-04   
gb|EAY73207.1|  hypothetical protein OsI_01078                        47.0    6e-04   
ref|XP_009395701.1|  PREDICTED: uncharacterized protein LOC103980...  47.0    6e-04   
ref|XP_009117479.1|  PREDICTED: uncharacterized protein LOC103842593  46.6    7e-04   
dbj|BAB17206.1|  unknown protein                                      46.6    8e-04   
ref|XP_009405667.1|  PREDICTED: uncharacterized protein LOC103988760  46.6    8e-04   
ref|XP_010467794.1|  PREDICTED: uncharacterized protein LOC104747...  46.6    8e-04   
ref|XP_008654701.1|  PREDICTED: hypothetical protein isoform X4       46.6    9e-04   
ref|XP_004169814.1|  PREDICTED: probable inactive receptor kinase...  49.3    0.001   
gb|ACG47217.1|  hypothetical protein                                  46.6    0.001   



>ref|XP_006361023.1| PREDICTED: uncharacterized protein LOC102579909 isoform X2 [Solanum 
tuberosum]
Length=98

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SPFRIP+QKPL ARIFR P+E+SCV VETM PYHTATA ALLNSMLS  PRS G
Sbjct  29   KPKVSSSPFRIPSQKPLAARIFRLPVEMSCVSVETMFPYHTATASALLNSMLSATPRSYG  88

Query  301  WSLEDCNDD  275
            W+LEDCNDD
Sbjct  89   WTLEDCNDD  97



>ref|XP_006361022.1| PREDICTED: uncharacterized protein LOC102579909 isoform X1 [Solanum 
tuberosum]
Length=98

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SPFRIP+QKPL ARIFR P+E+SCV VETM PYHTATA ALLNSMLS  PRS G
Sbjct  29   KPKVSSSPFRIPSQKPLAARIFRLPVEMSCVSVETMFPYHTATASALLNSMLSATPRSYG  88

Query  301  WSLEDCNDD  275
            W+LEDCNDD
Sbjct  89   WTLEDCNDD  97



>ref|XP_009607983.1| PREDICTED: uncharacterized protein LOC104102077 isoform X1 [Nicotiana 
tomentosiformis]
Length=98

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S S FRIP+QKPLTARIFRSP+E+SC+RVETM PYH+ATA ALLNSMLS  PR  G
Sbjct  29   KPKASASTFRIPSQKPLTARIFRSPVEMSCIRVETMFPYHSATASALLNSMLSGTPRCYG  88

Query  301  WSLEDCNDD  275
            WSLEDCNDD
Sbjct  89   WSLEDCNDD  97



>ref|XP_004234103.1| PREDICTED: uncharacterized protein LOC101255560 isoform X1 [Solanum 
lycopersicum]
 ref|XP_004234104.1| PREDICTED: uncharacterized protein LOC101255560 isoform X1 [Solanum 
lycopersicum]
 ref|XP_004234106.1| PREDICTED: uncharacterized protein LOC101255560 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010317435.1| PREDICTED: uncharacterized protein LOC101255560 isoform X1 [Solanum 
lycopersicum]
Length=97

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPKTS  PFRIPTQKP+TARIFRSP+E+SCVRVE+M P+HTATA ALL SMLS  PRS G
Sbjct  30   KPKTS--PFRIPTQKPVTARIFRSPVEMSCVRVESMFPFHTATASALLTSMLSATPRSYG  87

Query  301  WSLEDCNDDA  272
            W+LEDCNDDA
Sbjct  88   WTLEDCNDDA  97



>ref|XP_004248106.1| PREDICTED: uncharacterized protein LOC101245801 [Solanum lycopersicum]
Length=98

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SPFRIP+QKP+ ARIFR P+E+SCV VETM PYHTATA ALLNSMLS  PRS G
Sbjct  29   KPKVSSSPFRIPSQKPIAARIFRLPVEMSCVSVETMFPYHTATASALLNSMLSATPRSYG  88

Query  301  WSLEDCNDD  275
            W+LEDCNDD
Sbjct  89   WTLEDCNDD  97



>ref|XP_004234102.1| PREDICTED: uncharacterized protein LOC101255560 isoform X2 [Solanum 
lycopersicum]
 ref|XP_006343222.1| PREDICTED: uncharacterized protein LOC102595182 [Solanum tuberosum]
 ref|XP_010317436.1| PREDICTED: uncharacterized protein LOC101255560 isoform X2 [Solanum 
lycopersicum]
Length=97

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 2/69 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPKTS  PFRIPTQKP+TARIFRSP+E+SCVRVE+M P+HTATA ALL SMLS  PRS G
Sbjct  30   KPKTS--PFRIPTQKPVTARIFRSPVEMSCVRVESMFPFHTATASALLTSMLSATPRSYG  87

Query  301  WSLEDCNDD  275
            W+LEDCNDD
Sbjct  88   WTLEDCNDD  96



>ref|XP_009607984.1| PREDICTED: uncharacterized protein LOC104102077 isoform X2 [Nicotiana 
tomentosiformis]
Length=98

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S S FRIP+QKPLTARIFRSP+E+SC+RVETM PYH+ATA ALLNSMLS  PR  G
Sbjct  29   KPKASASTFRIPSQKPLTARIFRSPVEMSCIRVETMFPYHSATASALLNSMLSGTPRCYG  88

Query  301  WSLEDCNDD  275
            WSLEDC DD
Sbjct  89   WSLEDCEDD  97



>ref|XP_009759715.1| PREDICTED: uncharacterized protein LOC104212198 isoform X1 [Nicotiana 
sylvestris]
Length=98

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SP RIP+QKPLTARIFRSP+E+SC+RVET+ PYHTATA ALLNSMLS  PR  G
Sbjct  29   KPKASPSPIRIPSQKPLTARIFRSPVEMSCIRVETLFPYHTATASALLNSMLSGTPRCYG  88

Query  301  WSLEDCNDD  275
            W+LEDC+DD
Sbjct  89   WTLEDCSDD  97



>ref|XP_009759716.1| PREDICTED: uncharacterized protein LOC104212198 isoform X2 [Nicotiana 
sylvestris]
Length=98

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SP RIP+QKPLTARIFRSP+E+SC+RVET+ PYHTATA ALLNSMLS  PR  G
Sbjct  29   KPKASPSPIRIPSQKPLTARIFRSPVEMSCIRVETLFPYHTATASALLNSMLSGTPRCYG  88

Query  301  WSLEDCNDD  275
            W+LEDC DD
Sbjct  89   WTLEDCKDD  97



>ref|XP_009607985.1| PREDICTED: uncharacterized protein LOC104102077 isoform X3 [Nicotiana 
tomentosiformis]
Length=94

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S S FRIP+QKPLTARIFRSP+E+SC+RVETM PYH+ATA ALLNSMLS  PR  G
Sbjct  29   KPKASASTFRIPSQKPLTARIFRSPVEMSCIRVETMFPYHSATASALLNSMLSGTPRCYG  88

Query  301  WSLED  287
            WSLED
Sbjct  89   WSLED  93



>ref|XP_006361024.1| PREDICTED: uncharacterized protein LOC102579909 isoform X3 [Solanum 
tuberosum]
Length=94

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SPFRIP+QKPL ARIFR P+E+SCV VETM PYHTATA ALLNSMLS  PRS G
Sbjct  29   KPKVSSSPFRIPSQKPLAARIFRLPVEMSCVSVETMFPYHTATASALLNSMLSATPRSYG  88

Query  301  WSLED  287
            W+LED
Sbjct  89   WTLED  93



>ref|XP_006364294.1| PREDICTED: uncharacterized protein LOC102604157 isoform X1 [Solanum 
tuberosum]
 ref|XP_010316773.1| PREDICTED: uncharacterized protein LOC104645835 isoform X3 [Solanum 
lycopersicum]
Length=97

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            SPFR+PTQKPL ARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDC
Sbjct  35   SPFRMPTQKPLAARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDC  93

Query  283  NDD  275
            NDD
Sbjct  94   NDD  96



>ref|XP_006364295.1| PREDICTED: uncharacterized protein LOC102604157 isoform X2 [Solanum 
tuberosum]
 ref|XP_010316772.1| PREDICTED: uncharacterized protein LOC104645835 isoform X2 [Solanum 
lycopersicum]
Length=97

 Score =   109 bits (272),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            SPFR+PTQKPL ARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDC
Sbjct  35   SPFRMPTQKPLAARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDC  93

Query  283  NDD  275
            NDD
Sbjct  94   NDD  96



>ref|XP_009630296.1| PREDICTED: uncharacterized protein LOC104120262 isoform X4 [Nicotiana 
tomentosiformis]
Length=97

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDCND
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDCND  95

Query  277  D  275
            D
Sbjct  96   D  96



>ref|XP_009630294.1| PREDICTED: uncharacterized protein LOC104120262 isoform X2 [Nicotiana 
tomentosiformis]
Length=97

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDCND
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDCND  95

Query  277  D  275
            D
Sbjct  96   D  96



>ref|XP_004234108.1| PREDICTED: uncharacterized protein LOC101255560 isoform X4 [Solanum 
lycopersicum]
Length=93

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 2/65 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPKTS  PFRIPTQKP+TARIFRSP+E+SCVRVE+M P+HTATA ALL SMLS  PRS G
Sbjct  30   KPKTS--PFRIPTQKPVTARIFRSPVEMSCVRVESMFPFHTATASALLTSMLSATPRSYG  87

Query  301  WSLED  287
            W+LED
Sbjct  88   WTLED  92



>ref|XP_009759717.1| PREDICTED: uncharacterized protein LOC104212198 isoform X3 [Nicotiana 
sylvestris]
Length=94

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S SP RIP+QKPLTARIFRSP+E+SC+RVET+ PYHTATA ALLNSMLS  PR  G
Sbjct  29   KPKASPSPIRIPSQKPLTARIFRSPVEMSCIRVETLFPYHTATASALLNSMLSGTPRCYG  88

Query  301  WSLED  287
            W+LED
Sbjct  89   WTLED  93



>ref|XP_009773521.1| PREDICTED: uncharacterized protein LOC104223729 isoform X3 [Nicotiana 
sylvestris]
Length=97

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            FR+PTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDCND
Sbjct  37   FRLPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDCND  95

Query  277  D  275
            D
Sbjct  96   D  96



>ref|XP_009773516.1| PREDICTED: uncharacterized protein LOC104223729 isoform X1 [Nicotiana 
sylvestris]
Length=97

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            FR+PTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LEDCND
Sbjct  37   FRLPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEDCND  95

Query  277  D  275
            D
Sbjct  96   D  96



>ref|XP_011086046.1| PREDICTED: uncharacterized protein LOC105167888 isoform X2 [Sesamum 
indicum]
Length=94

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP  + SPFR+ ++KPL+ARIFRSP+ +S V + +MLPYHTATA +LLNSMLSVAPR + 
Sbjct  25   KPTAAPSPFRVASEKPLSARIFRSPVGISSVSLVSMLPYHTATASSLLNSMLSVAPRGQA  84

Query  301  WSLEDCNDD  275
            WS+EDCNDD
Sbjct  85   WSIEDCNDD  93



>ref|XP_004234107.1| PREDICTED: uncharacterized protein LOC101255560 isoform X3 [Solanum 
lycopersicum]
Length=93

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 2/65 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPKTS  PFRIPTQKP+TARIFRSP+E+SCVRVE+M P+HTATA ALL SMLS  PRS G
Sbjct  30   KPKTS--PFRIPTQKPVTARIFRSPVEMSCVRVESMFPFHTATASALLTSMLSATPRSYG  87

Query  301  WSLED  287
            W+LE 
Sbjct  88   WTLEG  92



>emb|CDO99502.1| unnamed protein product [Coffea canephora]
Length=97

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            K K S SPFRIP QKPL+AR FRSP+E+S V VE+MLPYHTATA ALL SMLSV+PRS G
Sbjct  29   KSKPSSSPFRIPAQKPLSARFFRSPVEMSSVSVESMLPYHTATASALLTSMLSVSPRSYG  88

Query  301  WSLE  290
            W+LE
Sbjct  89   WTLE  92



>emb|CDO99501.1| unnamed protein product [Coffea canephora]
Length=98

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + SPF IPTQKPL+ARIFRSP+E+SCV +E+MLPYHTATA ALL SMLSV+PRS  
Sbjct  29   KPKPAFSPFSIPTQKPLSARIFRSPVEMSCVSLESMLPYHTATASALLTSMLSVSPRSYD  88

Query  301  WSLE  290
            W+L+
Sbjct  89   WALD  92



>ref|XP_006467741.1| PREDICTED: uncharacterized protein LOC102611622 isoform X3 [Citrus 
sinensis]
Length=99

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  29   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  87

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  88   YGWTSEDCNDD  98



>gb|EYU43376.1| hypothetical protein MIMGU_mgv1a016994mg [Erythranthe guttata]
Length=98

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + SPFRIP+Q P +ARIFRSP+ELS V V +MLPYHTATA ALL SMLSVAPR + 
Sbjct  30   KPKAAPSPFRIPSQNPQSARIFRSPVELSSVSVVSMLPYHTATASALLTSMLSVAPRGQA  89

Query  301  WSLEDCND  278
            WS+ED +D
Sbjct  90   WSIEDTDD  97



>ref|XP_006364296.1| PREDICTED: uncharacterized protein LOC102604157 isoform X3 [Solanum 
tuberosum]
 ref|XP_010316774.1| PREDICTED: uncharacterized protein LOC104645835 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010316775.1| PREDICTED: uncharacterized protein LOC104645835 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010316776.1| PREDICTED: uncharacterized protein LOC104645835 isoform X4 [Solanum 
lycopersicum]
Length=93

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFR+PTQKPL ARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LED
Sbjct  35   SPFRMPTQKPLAARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLED  92



>ref|XP_009630305.1| PREDICTED: uncharacterized protein LOC104120262 isoform X6 [Nicotiana 
tomentosiformis]
Length=93

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LED
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLED  92



>ref|XP_009630302.1| PREDICTED: uncharacterized protein LOC104120262 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009630303.1| PREDICTED: uncharacterized protein LOC104120262 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009630304.1| PREDICTED: uncharacterized protein LOC104120262 isoform X5 [Nicotiana 
tomentosiformis]
Length=93

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LED
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLED  92



>ref|XP_006449402.1| hypothetical protein CICLE_v10017075mg [Citrus clementina]
 gb|ESR62642.1| hypothetical protein CICLE_v10017075mg [Citrus clementina]
Length=150

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  80   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  138

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  139  YGWTSEDCNDD  149



>gb|KDO77677.1| hypothetical protein CISIN_1g031795mg [Citrus sinensis]
Length=153

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  83   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  141

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  142  YGWTSEDCNDD  152



>ref|XP_006384044.1| hypothetical protein POPTR_0004s04770g [Populus trichocarpa]
 gb|ERP61841.1| hypothetical protein POPTR_0004s04770g [Populus trichocarpa]
Length=95

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            SPFRI  Q P + RIFRSP+E+SC  VETMLPYHTAT+ ALLNSMLSV+ RS GW+ EDC
Sbjct  33   SPFRISKQSPFSPRIFRSPVEMSCC-VETMLPYHTATSSALLNSMLSVSRRSYGWTPEDC  91

Query  283  NDD  275
            NDD
Sbjct  92   NDD  94



>ref|XP_008371406.1| PREDICTED: uncharacterized protein LOC103434827 isoform X1 [Malus 
domestica]
Length=99

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  88   YGWTSEDCNDD  98



>ref|XP_009773528.1| PREDICTED: uncharacterized protein LOC104223729 isoform X5 [Nicotiana 
sylvestris]
Length=93

 Score = 96.3 bits (238),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR+PTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LED
Sbjct  37   FRLPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLED  92



>ref|XP_009773525.1| PREDICTED: uncharacterized protein LOC104223729 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009773526.1| PREDICTED: uncharacterized protein LOC104223729 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009773527.1| PREDICTED: uncharacterized protein LOC104223729 isoform X4 [Nicotiana 
sylvestris]
Length=93

 Score = 96.3 bits (238),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR+PTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LED
Sbjct  37   FRLPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLED  92



>ref|XP_010316771.1| PREDICTED: uncharacterized protein LOC104645835 isoform X1 [Solanum 
lycopersicum]
Length=97

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFR+PTQKPL ARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LE 
Sbjct  35   SPFRMPTQKPLAARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEG  92



>ref|XP_007212289.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
 ref|XP_007212291.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
 ref|XP_008225139.1| PREDICTED: uncharacterized protein LOC103324809 isoform X1 [Prunus 
mume]
 gb|EMJ13488.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
 gb|EMJ13490.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
Length=98

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP   Q   + RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  28   RPKPASSPFRIPKLNQSSTSPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  86

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  87   YGWTPEDCNDD  97



>ref|XP_009343348.1| PREDICTED: uncharacterized protein LOC103935279 isoform X1 [Pyrus 
x bretschneideri]
Length=99

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = -2

Query  478  PKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS 
Sbjct  30   PKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRSY  88

Query  304  GWSLEDCNDD  275
            GW+ EDCNDD
Sbjct  89   GWTSEDCNDD  98



>ref|XP_011043430.1| PREDICTED: uncharacterized protein LOC105138897 isoform X1 [Populus 
euphratica]
Length=99

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+S   VETMLPYHTATA ALLNSMLSV+ RS GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSFC-VETMLPYHTATASALLNSMLSVSRRSYGWT  91

Query  295  LEDCNDD  275
             EDCNDD
Sbjct  92   PEDCNDD  98



>ref|XP_009630295.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630297.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630298.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630299.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630300.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009630301.1| PREDICTED: uncharacterized protein LOC104120262 isoform X3 [Nicotiana 
tomentosiformis]
Length=97

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LE 
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEG  92



>ref|XP_010052276.1| PREDICTED: uncharacterized protein LOC104440992 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052280.1| PREDICTED: uncharacterized protein LOC104440992 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76214.1| hypothetical protein EUGRSUZ_D00599 [Eucalyptus grandis]
Length=107

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + SPFRIP QKPL+ RIFRSP+E+S   +E++LPYHTATA ALL SMLSV+ R+ G
Sbjct  39   KPRPARSPFRIPAQKPLSHRIFRSPVEMSSC-LESVLPYHTATASALLTSMLSVSRRASG  97

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  98   WTPEDCNDD  106



>ref|XP_006410536.1| hypothetical protein EUTSA_v10017477mg [Eutrema salsugineum]
 gb|ESQ51989.1| hypothetical protein EUTSA_v10017477mg [Eutrema salsugineum]
Length=93

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ R+FRSP+ LSC  VETMLPYHTATA ALLNSMLSV+PRS  W
Sbjct  27   PASARSSFRMPKQSPLSHRVFRSPVALSCC-VETMLPYHTATASALLNSMLSVSPRS-VW  84

Query  298  SLEDCNDDA  272
            +L DCNDDA
Sbjct  85   TLGDCNDDA  93



>ref|XP_008358662.1| PREDICTED: uncharacterized protein LOC103422383 isoform X1 [Malus 
domestica]
 ref|XP_008358663.1| PREDICTED: uncharacterized protein LOC103422383 isoform X1 [Malus 
domestica]
 ref|XP_008358664.1| PREDICTED: uncharacterized protein LOC103422383 isoform X1 [Malus 
domestica]
 ref|XP_009352861.1| PREDICTED: uncharacterized protein LOC103944170 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009352862.1| PREDICTED: uncharacterized protein LOC103944170 isoform X1 [Pyrus 
x bretschneideri]
Length=99

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  88   YGWTPEDCNDD  98



>ref|NP_001117372.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30971.1| uncharacterized protein AT1G28395 [Arabidopsis thaliana]
Length=95

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ + FR+P Q PLT RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+   RGW
Sbjct  30   PSSARTAFRMPKQSPLTNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVS--RRGW  86

Query  298  SLEDCNDD  275
             ++DCNDD
Sbjct  87   IVDDCNDD  94



>gb|EYU43377.1| hypothetical protein MIMGU_mgv1a016994mg [Erythranthe guttata]
Length=95

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + SPFRIP+Q P +ARIFRSP+ELS V V +MLPYHTATA ALL SMLSVAPR + 
Sbjct  30   KPKAAPSPFRIPSQNPQSARIFRSPVELSSVSVVSMLPYHTATASALLTSMLSVAPRGQA  89

Query  301  WSLED  287
            WS+ED
Sbjct  90   WSIED  94



>ref|XP_010499366.1| PREDICTED: uncharacterized protein LOC104776902 isoform X1 [Camelina 
sativa]
 ref|XP_010460633.1| PREDICTED: uncharacterized protein LOC104741451 isoform X2 [Camelina 
sativa]
Length=95

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCNDD  275
             +EDCNDD
Sbjct  87   IVEDCNDD  94



>ref|XP_009630293.1| PREDICTED: uncharacterized protein LOC104120262 isoform X1 [Nicotiana 
tomentosiformis]
Length=119

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FRIPTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LE 
Sbjct  37   FRIPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEG  92



>ref|XP_006377403.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 ref|XP_006377404.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 gb|ERP55200.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 gb|ERP55201.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
Length=98

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+SC  VETMLPYHTATA ALLNSMLSV+ R  GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSCC-VETMLPYHTATASALLNSMLSVS-RRYGWT  90

Query  295  LEDCNDD  275
             EDCNDD
Sbjct  91   PEDCNDD  97



>ref|XP_006303426.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
 gb|EOA36324.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
Length=127

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  62   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  118

Query  298  SLEDCNDD  275
             +EDCNDD
Sbjct  119  IVEDCNDD  126



>ref|XP_009773517.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009773518.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009773520.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009773522.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009773523.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009773524.1| PREDICTED: uncharacterized protein LOC104223729 isoform X2 [Nicotiana 
sylvestris]
Length=97

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR+PTQKPLTARIFRSP+E+SC  VETMLPYHTATA ALL SMLS  PRS GW+LE 
Sbjct  37   FRLPTQKPLTARIFRSPVEMSCA-VETMLPYHTATASALLTSMLSATPRSYGWTLEG  92



>ref|XP_010538174.1| PREDICTED: uncharacterized protein LOC104812615 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538177.1| PREDICTED: uncharacterized protein LOC104812615 isoform X1 [Tarenaya 
hassleriana]
Length=96

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 2/68 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ SPFR+P + PL+ RIFRSP+E+SC  VETM+PYHTATA ALLNSMLSV+ RS  W
Sbjct  30   PASAQSPFRVPKRSPLSHRIFRSPVEMSCC-VETMMPYHTATASALLNSMLSVSRRS-CW  87

Query  298  SLEDCNDD  275
            + EDCNDD
Sbjct  88   TPEDCNDD  95



>ref|XP_009109727.1| PREDICTED: uncharacterized protein LOC103835326 isoform X1 [Brassica 
rapa]
Length=95

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +S   FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSSRPAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCNDD  275
             +EDCNDD
Sbjct  87   IVEDCNDD  94



>ref|XP_006415660.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
 gb|ESQ34013.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
Length=95

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +  S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PASPRSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCNDD  275
             +EDCNDD
Sbjct  87   IVEDCNDD  94



>gb|KHG30560.1| hypothetical protein F383_13400 [Gossypium arboreum]
Length=96

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P+ + SPFRI  Q P  ARIFRSP+E+SC  VET+LPYHTATA ALL SMLSV+ R   W
Sbjct  29   PRPACSPFRISKQNPFPARIFRSPVEMSCC-VETLLPYHTATASALLTSMLSVSRRRSNW  87

Query  298  SLEDCNDD  275
            + EDCNDD
Sbjct  88   TAEDCNDD  95



>gb|EYU43378.1| hypothetical protein MIMGU_mgv1a016994mg [Erythranthe guttata]
Length=95

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + SPFRIP+Q P +ARIFRSP+ELS V V +MLPYHTATA ALL SMLSVAPR + 
Sbjct  30   KPKAAPSPFRIPSQNPQSARIFRSPVELSSVSVVSMLPYHTATASALLTSMLSVAPRGQA  89

Query  301  WSLED  287
            WS+E 
Sbjct  90   WSIEG  94



>ref|NP_001078001.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF59210.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08896.1| uncharacterized protein AT2G33847 [Arabidopsis thaliana]
Length=93

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S F++P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+ RS  W
Sbjct  27   PSSARSSFKLPKQSPLSHRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVSGRSI-W  84

Query  298  SLEDCNDDA  272
            + +DC DDA
Sbjct  85   TFQDCIDDA  93



>gb|ABK28329.1| unknown [Arabidopsis thaliana]
Length=94

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S F++P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+ RS  W
Sbjct  27   PSSARSSFKLPKQSPLSHRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVSGRSI-W  84

Query  298  SLEDCNDDA  272
            + +DC DDA
Sbjct  85   TFQDCIDDA  93



>ref|XP_011086047.1| PREDICTED: uncharacterized protein LOC105167888 isoform X3 [Sesamum 
indicum]
Length=90

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP  + SPFR+ ++KPL+ARIFRSP+ +S V + +MLPYHTATA +LLNSMLSVAPR + 
Sbjct  25   KPTAAPSPFRVASEKPLSARIFRSPVGISSVSLVSMLPYHTATASSLLNSMLSVAPRGQA  84

Query  301  WSLED  287
            WS+E 
Sbjct  85   WSIEG  89



>ref|XP_010509820.1| PREDICTED: uncharacterized protein LOC104786170 [Camelina sativa]
Length=93

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 4/72 (6%)
 Frame = -2

Query  481  KPKTSG--SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KP +S   S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS + RS
Sbjct  24   KPTSSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSASGRS  82

Query  307  RGWSLEDCNDDA  272
              W+L+DC DDA
Sbjct  83   I-WTLQDCIDDA  93



>ref|XP_010413797.1| PREDICTED: uncharacterized protein LOC104700050 [Camelina sativa]
Length=93

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS + RS  W
Sbjct  27   PSSARSTFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSASGRSI-W  84

Query  298  SLEDCNDDA  272
            +++DC DDA
Sbjct  85   TIQDCIDDA  93



>ref|XP_010478212.1| PREDICTED: uncharacterized protein LOC104757185 isoform X1 [Camelina 
sativa]
Length=95

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELS   VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSSC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCNDD  275
             +EDCNDD
Sbjct  87   IVEDCNDD  94



>ref|XP_010469415.1| PREDICTED: uncharacterized protein LOC104749471 [Camelina sativa]
Length=93

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q P++ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS + RS  W
Sbjct  27   PSSARSTFRMPKQSPISNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSASGRSI-W  84

Query  298  SLEDCNDDA  272
            +++DC DDA
Sbjct  85   TIQDCIDDA  93



>ref|XP_010655453.1| PREDICTED: uncharacterized protein LOC100264194 isoform X1 [Vitis 
vinifera]
Length=97

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + S   I  QKPL+ RIFRSP+E+S   VE+MLP+H ATA ALLNSMLSV+ RS G
Sbjct  29   KPKRTFSSLGISNQKPLSRRIFRSPVEMSFC-VESMLPFHAATASALLNSMLSVSRRSYG  87

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  88   WTPEDCNDD  96



>ref|XP_011086045.1| PREDICTED: uncharacterized protein LOC105167888 isoform X1 [Sesamum 
indicum]
Length=114

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP  + SPFR+ ++KPL+ARIFRSP+ +S V + +MLPYHTATA +LLNSMLSVAPR + 
Sbjct  25   KPTAAPSPFRVASEKPLSARIFRSPVGISSVSLVSMLPYHTATASSLLNSMLSVAPRGQA  84

Query  301  WSLED  287
            WS+E 
Sbjct  85   WSIEG  89



>ref|XP_010686407.1| PREDICTED: uncharacterized protein LOC104900632 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=101

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = -2

Query  478  PKTSGSP-----FRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVA  317
            PKT  +P     F +P Q PL+A RIFRSP+ELSC  VE+++PYHTATA ALL SMLS A
Sbjct  28   PKTKSNPSFNSTFHLPKQNPLSAPRIFRSPVELSCC-VESLMPYHTATASALLTSMLSGA  86

Query  316  PRSRGWSLEDCNDD  275
            PR  GW+ EDCNDD
Sbjct  87   PRRFGWTPEDCNDD  100



>gb|EYU28007.1| hypothetical protein MIMGU_mgv1a016927mg [Erythranthe guttata]
Length=97

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR P+QKPL+ARIFRSP+E+SCV   +MLPYHTATA ALL SMLSVAPR   W++ED
Sbjct  41   FRTPSQKPLSARIFRSPVEMSCV-AASMLPYHTATASALLTSMLSVAPRIHAWNIED  96



>ref|XP_007148130.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
 gb|ESW20124.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
Length=94

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+++ SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   KPRSARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  85   WTPEDCNDD  93



>ref|XP_006467744.1| PREDICTED: uncharacterized protein LOC102611622 isoform X6 [Citrus 
sinensis]
Length=95

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  29   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  87

Query  307  RGWSLED  287
             GW+ ED
Sbjct  88   YGWTSED  94



>ref|XP_003633236.1| PREDICTED: uncharacterized protein LOC100243665 isoform X1 [Vitis 
vinifera]
Length=96

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SP RI + KPL+ RIFR P+ELSCV  ETM+P+HTATA AL+ SMLS++ R  G
Sbjct  29   EAKAARSPLRISSNKPLSNRIFRCPVELSCV--ETMVPFHTATASALMTSMLSISRRGYG  86

Query  301  WSLEDCNDDA  272
            W  E CNDDA
Sbjct  87   WLPEACNDDA  96



>ref|XP_004134688.1| PREDICTED: uncharacterized protein LOC101221672 isoform 1 [Cucumis 
sativus]
Length=101

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLEDCNDD  275
             GW+ EDCNDD
Sbjct  90   YGWTPEDCNDD  100



>gb|KFK24423.1| hypothetical protein AALP_AAs55026U000200 [Arabis alpina]
Length=69

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQK-PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            P +  SPF +P Q+ PL+ +IFRSP++LSC  VETMLPYHTATA ALLNSMLSV+ RS  
Sbjct  2    PSSVRSPFTMPKQRSPLSHQIFRSPVQLSCC-VETMLPYHTATASALLNSMLSVSRRS-V  59

Query  301  WSLEDCNDDA  272
            W+  DCNDDA
Sbjct  60   WTFGDCNDDA  69



>ref|XP_006295320.1| hypothetical protein CARUB_v10024407mg [Capsella rubella]
 gb|EOA28218.1| hypothetical protein CARUB_v10024407mg [Capsella rubella]
Length=93

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S F++P Q PL+ RIFRSP+ELSC  V+T+LPYHTATA ALLNSMLS + RS  W
Sbjct  27   PSSARSTFKMPKQSPLSNRIFRSPVELSCC-VDTILPYHTATASALLNSMLSASGRSI-W  84

Query  298  SLEDCNDDA  272
             L+DC DDA
Sbjct  85   ILQDCIDDA  93



>ref|XP_004300265.1| PREDICTED: uncharacterized protein LOC101291628 [Fragaria vesca 
subsp. vesca]
Length=99

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + +PF IP Q   P++  IFRSP+ELSC  VET+LPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASAPFSIPKQNKNPISHAIFRSPVELSCC-VETLLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLEDCNDD  275
             GW+ E CND+
Sbjct  88   CGWTPEACNDE  98



>ref|XP_002276788.1| PREDICTED: uncharacterized protein LOC100243665 isoform X3 [Vitis 
vinifera]
Length=96

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SP RI + KPL+ RIFR P+ELSCV  ETM+P+HTATA AL+ SMLS++ R  G
Sbjct  29   EAKAARSPLRISSNKPLSNRIFRCPVELSCV--ETMVPFHTATASALMTSMLSISRRGYG  86

Query  301  WSLEDCNDD  275
            W  E CNDD
Sbjct  87   WLPEACNDD  95



>gb|EYU28006.1| hypothetical protein MIMGU_mgv1a016927mg [Erythranthe guttata]
Length=97

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR P+QKPL+ARIFRSP+E+SCV   +MLPYHTATA ALL SMLSVAPR   W++E 
Sbjct  41   FRTPSQKPLSARIFRSPVEMSCV-AASMLPYHTATASALLTSMLSVAPRIHAWNIEG  96



>gb|EYU28005.1| hypothetical protein MIMGU_mgv1a016927mg [Erythranthe guttata]
 gb|EYU28008.1| hypothetical protein MIMGU_mgv1a016927mg [Erythranthe guttata]
Length=101

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            FR P+QKPL+ARIFRSP+E+SCV   +MLPYHTATA ALL SMLSVAPR   W++E 
Sbjct  41   FRTPSQKPLSARIFRSPVEMSCV-AASMLPYHTATASALLTSMLSVAPRIHAWNIEG  96



>ref|XP_006597455.1| PREDICTED: uncharacterized protein LOC100806196 isoform X5 [Glycine 
max]
 gb|KHN18950.1| hypothetical protein glysoja_036129 [Glycine soja]
Length=94

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            +P+ + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RPRPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  85   WTPEDCNDD  93



>ref|XP_008371410.1| PREDICTED: uncharacterized protein LOC103434827 isoform X5 [Malus 
domestica]
Length=95

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ ED
Sbjct  88   YGWTSED  94



>ref|XP_006467739.1| PREDICTED: uncharacterized protein LOC102611622 isoform X1 [Citrus 
sinensis]
 ref|XP_006467740.1| PREDICTED: uncharacterized protein LOC102611622 isoform X2 [Citrus 
sinensis]
 ref|XP_006467742.1| PREDICTED: uncharacterized protein LOC102611622 isoform X4 [Citrus 
sinensis]
 ref|XP_006467743.1| PREDICTED: uncharacterized protein LOC102611622 isoform X5 [Citrus 
sinensis]
Length=99

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  29   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  87

Query  307  RGWSLEDCN  281
             GW+ E  +
Sbjct  88   YGWTSEGQD  96



>ref|XP_007212288.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
 ref|XP_008225143.1| PREDICTED: uncharacterized protein LOC103324809 isoform X5 [Prunus 
mume]
 gb|EMJ13487.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
Length=94

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP   Q   + RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  28   RPKPASSPFRIPKLNQSSTSPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  86

Query  307  RGWSLED  287
             GW+ ED
Sbjct  87   YGWTPED  93



>ref|XP_011043433.1| PREDICTED: uncharacterized protein LOC105138897 isoform X4 [Populus 
euphratica]
Length=95

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+S   VETMLPYHTATA ALLNSMLSV+ RS GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSFC-VETMLPYHTATASALLNSMLSVSRRSYGWT  91

Query  295  LED  287
             ED
Sbjct  92   PED  94



>ref|XP_006449401.1| hypothetical protein CICLE_v10017075mg [Citrus clementina]
 gb|ESR62641.1| hypothetical protein CICLE_v10017075mg [Citrus clementina]
Length=150

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  80   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  138

Query  307  RGWSLEDCN  281
             GW+ E  +
Sbjct  139  YGWTSEGQD  147



>ref|NP_001185107.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30972.1| uncharacterized protein AT1G28395 [Arabidopsis thaliana]
Length=91

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ + FR+P Q PLT RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+   RGW
Sbjct  30   PSSARTAFRMPKQSPLTNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVS--RRGW  86

Query  298  SLED  287
             ++D
Sbjct  87   IVDD  90



>ref|XP_009343604.1| PREDICTED: uncharacterized protein LOC103935279 isoform X4 [Pyrus 
x bretschneideri]
Length=95

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = -2

Query  478  PKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS 
Sbjct  30   PKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRSY  88

Query  304  GWSLED  287
            GW+ ED
Sbjct  89   GWTSED  94



>ref|XP_010052282.1| PREDICTED: uncharacterized protein LOC104440992 isoform X3 [Eucalyptus 
grandis]
 gb|KCW76213.1| hypothetical protein EUGRSUZ_D00599 [Eucalyptus grandis]
Length=103

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + SPFRIP QKPL+ RIFRSP+E+S   +E++LPYHTATA ALL SMLSV+ R+ G
Sbjct  39   KPRPARSPFRIPAQKPLSHRIFRSPVEMSSC-LESVLPYHTATASALLTSMLSVSRRASG  97

Query  301  WSLED  287
            W+ ED
Sbjct  98   WTPED  102



>gb|KDO77678.1| hypothetical protein CISIN_1g031795mg [Citrus sinensis]
Length=153

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = -2

Query  481  KPKT--SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            KPK   + SPFR+P Q PL+ R+FRSP+ELSC  VETMLP+HTATA ALL SMLSV+ RS
Sbjct  83   KPKAAPTSSPFRMPKQNPLSQRLFRSPVELSCC-VETMLPFHTATASALLTSMLSVSRRS  141

Query  307  RGWSLEDCN  281
             GW+ E  +
Sbjct  142  YGWTSEGQD  150



>ref|XP_003543032.1| PREDICTED: uncharacterized protein LOC100797119 isoformX3 [Glycine 
max]
Length=94

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RTKPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  85   WTPEDCNDD  93



>ref|XP_007132785.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04779.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
Length=93

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT  SPFRI + KPL+    R P+ELS   VE+M+PYHTATA AL+NSMLS++ R+ G
Sbjct  25   EAKTVRSPFRIASNKPLSQSTIRLPVELSSC-VESMMPYHTATASALMNSMLSISSRTCG  83

Query  301  WSLEDCNDD  275
            W  EDCNDD
Sbjct  84   WIPEDCNDD  92



>ref|XP_008358666.1| PREDICTED: uncharacterized protein LOC103422383 isoform X3 [Malus 
domestica]
 ref|XP_008358668.1| PREDICTED: uncharacterized protein LOC103422383 isoform X3 [Malus 
domestica]
 ref|XP_009352865.1| PREDICTED: uncharacterized protein LOC103944170 isoform X4 [Pyrus 
x bretschneideri]
Length=95

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ ED
Sbjct  88   YGWTPED  94



>emb|CDO99500.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLS-VAPRSR  305
            KPK S S FRIP QKPL+ RIFRSP+E+SC+ V +M PYH+ATA ALL SMLS V+P + 
Sbjct  29   KPKPSRSTFRIPGQKPLSTRIFRSPVEMSCISVGSMFPYHSATASALLTSMLSEVSPWTY  88

Query  304  GWSLED  287
             WS + 
Sbjct  89   NWSQDS  94



>gb|KFK44713.1| hypothetical protein AALP_AA1G293200 [Arabis alpina]
Length=91

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLED  287
             +ED
Sbjct  87   IVED  90



>ref|XP_010499368.1| PREDICTED: uncharacterized protein LOC104776902 isoform X3 [Camelina 
sativa]
 ref|XP_010460634.1| PREDICTED: uncharacterized protein LOC104741451 isoform X3 [Camelina 
sativa]
Length=91

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLED  287
             +ED
Sbjct  87   IVED  90



>ref|XP_006303424.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
 gb|EOA36322.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
Length=123

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  62   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  118

Query  298  SLED  287
             +ED
Sbjct  119  IVED  122



>ref|XP_002893527.1| hypothetical protein ARALYDRAFT_313543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69786.1| hypothetical protein ARALYDRAFT_313543 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVS--RRGW  86

Query  298  SLEDCND  278
             L+  ++
Sbjct  87   ILDGLDE  93



>ref|XP_006410535.1| hypothetical protein EUTSA_v10017477mg [Eutrema salsugineum]
 gb|ESQ51988.1| hypothetical protein EUTSA_v10017477mg [Eutrema salsugineum]
Length=92

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ R+FRSP+ LSC  VETMLPYHTATA ALLNSMLSV+PRS  W
Sbjct  27   PASARSSFRMPKQSPLSHRVFRSPVALSCC-VETMLPYHTATASALLNSMLSVSPRS-VW  84

Query  298  SLEDCNDD  275
            +L   +D+
Sbjct  85   TLGGKDDN  92



>ref|XP_010538178.1| PREDICTED: uncharacterized protein LOC104812615 isoform X3 [Tarenaya 
hassleriana]
Length=92

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ SPFR+P + PL+ RIFRSP+E+SC  VETM+PYHTATA ALLNSMLSV+ RS  W
Sbjct  30   PASAQSPFRVPKRSPLSHRIFRSPVEMSCC-VETMMPYHTATASALLNSMLSVSRRS-CW  87

Query  298  SLED  287
            + ED
Sbjct  88   TPED  91



>ref|XP_011096352.1| PREDICTED: uncharacterized protein LOC105175568 isoform X2 [Sesamum 
indicum]
Length=229

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ S SPFRI +QKPL+ARIFRSP+E+S V V +MLPYHTATA A+L SMLSVAPRS  
Sbjct  164  KPRASPSPFRISSQKPLSARIFRSPVEMSSVSVVSMLPYHTATASAVLTSMLSVAPRSHA  223

Query  301  WSLED  287
            W+LED
Sbjct  224  WTLED  228



>emb|CDO98620.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLS-VAPRSR  305
            K K+S S FRIPT+KPL+ARIFRSP+E+SC+   +M P+H+ATA ALLNSMLS V+P + 
Sbjct  29   KSKSSRSTFRIPTEKPLSARIFRSPVEMSCISAGSMFPFHSATASALLNSMLSEVSPWTC  88

Query  304  GWSLE  290
             W+ +
Sbjct  89   NWTQD  93



>ref|XP_002509436.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50823.1| conserved hypothetical protein [Ricinus communis]
Length=94

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFRIP Q  L+ RIFRSP+E+SC  VETMLPY+TATA ALL SMLSV+PR  GW+ E 
Sbjct  32   SPFRIPKQNALSRRIFRSPVEMSCS-VETMLPYYTATASALLTSMLSVSPRCYGWTPEG  89



>ref|NP_564308.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_849722.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973928.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM62524.1| unknown [Arabidopsis thaliana]
 gb|ABF58991.1| At1g28395 [Arabidopsis thaliana]
 dbj|BAF00098.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30968.1| uncharacterized protein AT1G28395 [Arabidopsis thaliana]
 gb|AEE30969.1| uncharacterized protein AT1G28395 [Arabidopsis thaliana]
 gb|AEE30970.1| uncharacterized protein AT1G28395 [Arabidopsis thaliana]
Length=95

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ + FR+P Q PLT RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+   RGW
Sbjct  30   PSSARTAFRMPKQSPLTNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVS--RRGW  86

Query  298  SLEDCND  278
             ++  ++
Sbjct  87   IVDGLDE  93



>ref|XP_008371409.1| PREDICTED: uncharacterized protein LOC103434827 isoform X4 [Malus 
domestica]
Length=95

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ E 
Sbjct  88   YGWTSEG  94



>ref|XP_008371407.1| PREDICTED: uncharacterized protein LOC103434827 isoform X2 [Malus 
domestica]
Length=99

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLEDCN  281
             GW+ E  +
Sbjct  88   YGWTSEGQD  96



>ref|XP_009109729.1| PREDICTED: uncharacterized protein LOC103835326 isoform X3 [Brassica 
rapa]
Length=91

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +S   FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSSRPAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLED  287
             +ED
Sbjct  87   IVED  90



>ref|XP_008371408.1| PREDICTED: uncharacterized protein LOC103434827 isoform X3 [Malus 
domestica]
Length=95

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ E 
Sbjct  88   YGWTSEG  94



>ref|XP_006415659.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
 gb|ESQ34012.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
Length=91

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +  S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PASPRSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLED  287
             +ED
Sbjct  87   IVED  90



>ref|XP_002881310.1| hypothetical protein ARALYDRAFT_902473 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57569.1| hypothetical protein ARALYDRAFT_902473 [Arabidopsis lyrata subsp. 
lyrata]
Length=99

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S F++P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+ RS  W
Sbjct  27   PYSARSSFKLPKQSPLSHRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVSGRSI-W  84

Query  298  SLEDCNDD  275
            +L+  + +
Sbjct  85   TLQGTSKE  92



>ref|XP_008225140.1| PREDICTED: uncharacterized protein LOC103324809 isoform X2 [Prunus 
mume]
Length=98

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP   Q   + RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  28   RPKPASSPFRIPKLNQSSTSPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  86

Query  307  RGWSLED  287
             GW+ E 
Sbjct  87   YGWTPEG  93



>ref|XP_008225141.1| PREDICTED: uncharacterized protein LOC103324809 isoform X3 [Prunus 
mume]
Length=94

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP   Q   + RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  28   RPKPASSPFRIPKLNQSSTSPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  86

Query  307  RGWSLED  287
             GW+ E 
Sbjct  87   YGWTPEG  93



>ref|XP_010499367.1| PREDICTED: uncharacterized protein LOC104776902 isoform X2 [Camelina 
sativa]
 ref|XP_010460631.1| PREDICTED: uncharacterized protein LOC104741451 isoform X1 [Camelina 
sativa]
 ref|XP_010460632.1| PREDICTED: uncharacterized protein LOC104741451 isoform X1 [Camelina 
sativa]
Length=95

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCND  278
             +E  ++
Sbjct  87   IVEGLDE  93



>ref|XP_007212290.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
 ref|XP_008225142.1| PREDICTED: uncharacterized protein LOC103324809 isoform X4 [Prunus 
mume]
 gb|EMJ13489.1| hypothetical protein PRUPE_ppa013893mg [Prunus persica]
Length=94

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFRIP   Q   + RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  28   RPKPASSPFRIPKLNQSSTSPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  86

Query  307  RGWSLED  287
             GW+ E 
Sbjct  87   YGWTPEG  93



>ref|XP_010052279.1| PREDICTED: uncharacterized protein LOC104440992 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010052281.1| PREDICTED: uncharacterized protein LOC104440992 isoform X2 [Eucalyptus 
grandis]
Length=107

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + SPFRIP QKPL+ RIFRSP+E+S   +E++LPYHTATA ALL SMLSV+ R+ G
Sbjct  39   KPRPARSPFRIPAQKPLSHRIFRSPVEMSSC-LESVLPYHTATASALLTSMLSVSRRASG  97

Query  301  WSLED  287
            W+ E 
Sbjct  98   WTPEG  102



>gb|EPS69777.1| hypothetical protein M569_04988, partial [Genlisea aurea]
Length=92

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
             P+ + SPFR  +QKP + RIFRS LE++CV   +MLPYHTATA A+L SMLSV+ R   
Sbjct  28   NPRNTASPFRTSSQKPCSTRIFRSHLEMNCVCAVSMLPYHTATASAILTSMLSVSSRRHA  87

Query  301  WSLED  287
            W+LE 
Sbjct  88   WTLEG  92



>ref|XP_011043432.1| PREDICTED: uncharacterized protein LOC105138897 isoform X3 [Populus 
euphratica]
Length=95

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+S   VETMLPYHTATA ALLNSMLSV+ RS GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSFC-VETMLPYHTATASALLNSMLSVSRRSYGWT  91

Query  295  LED  287
             E 
Sbjct  92   PEG  94



>ref|XP_009343471.1| PREDICTED: uncharacterized protein LOC103935279 isoform X2 [Pyrus 
x bretschneideri]
Length=99

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = -2

Query  478  PKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS 
Sbjct  30   PKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRSY  88

Query  304  GWSLEDCN  281
            GW+ E  +
Sbjct  89   GWTSEGQD  96



>ref|XP_004487201.1| PREDICTED: uncharacterized protein LOC101514825 isoform X2 [Cicer 
arietinum]
Length=96

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT+ SPFRI + KPL+    R P+ELS   VE+MLPYHTATA AL+ SML V+ R  G
Sbjct  28   EAKTARSPFRIASNKPLSQSALRCPVELSFC-VESMLPYHTATASALMTSMLVVSERRYG  86

Query  301  WSLEDCNDD  275
            W  EDCNDD
Sbjct  87   WLPEDCNDD  95



>ref|XP_006303425.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
 ref|XP_006303427.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
 gb|EOA36323.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
 gb|EOA36325.1| hypothetical protein CARUB_v10010643mg [Capsella rubella]
Length=127

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  62   PSSARSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  118

Query  298  SLEDCND  278
             +E  ++
Sbjct  119  IVEGLDE  125



>ref|XP_009343542.1| PREDICTED: uncharacterized protein LOC103935279 isoform X3 [Pyrus 
x bretschneideri]
Length=95

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -2

Query  478  PKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS 
Sbjct  30   PKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRSY  88

Query  304  GWSLED  287
            GW+ E 
Sbjct  89   GWTSEG  94



>ref|XP_011043431.1| PREDICTED: uncharacterized protein LOC105138897 isoform X2 [Populus 
euphratica]
Length=99

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+S   VETMLPYHTATA ALLNSMLSV+ RS GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSFC-VETMLPYHTATASALLNSMLSVSRRSYGWT  91

Query  295  LED  287
             E 
Sbjct  92   PEG  94



>ref|XP_009343674.1| PREDICTED: uncharacterized protein LOC103935279 isoform X5 [Pyrus 
x bretschneideri]
Length=95

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -2

Query  478  PKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            PK + SPFRIP  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS 
Sbjct  30   PKPASSPFRIPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRSY  88

Query  304  GWSLED  287
            GW+ E 
Sbjct  89   GWTSEG  94



>ref|XP_004293874.1| PREDICTED: uncharacterized protein LOC101297221 isoform 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293875.1| PREDICTED: uncharacterized protein LOC101297221 isoform 3 [Fragaria 
vesca subsp. vesca]
Length=98

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -2

Query  457  FRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            F IP Q   P++  +FRSP+ELSC  VET+LPYHTATA ALL SMLSV+ RS GW+ E C
Sbjct  36   FSIPKQNKNPISHALFRSPVELSCC-VETLLPYHTATASALLTSMLSVSQRSYGWTPEAC  94

Query  283  NDD  275
            NDD
Sbjct  95   NDD  97



>ref|XP_008358665.1| PREDICTED: uncharacterized protein LOC103422383 isoform X2 [Malus 
domestica]
 ref|XP_009352863.1| PREDICTED: uncharacterized protein LOC103944170 isoform X2 [Pyrus 
x bretschneideri]
Length=99

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 3/69 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLEDCN  281
             GW+ E  +
Sbjct  88   YGWTPEGQD  96



>ref|XP_010538176.1| PREDICTED: uncharacterized protein LOC104812615 isoform X2 [Tarenaya 
hassleriana]
Length=96

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ SPFR+P + PL+ RIFRSP+E+SC  VETM+PYHTATA ALLNSMLSV+ RS  W
Sbjct  30   PASAQSPFRVPKRSPLSHRIFRSPVEMSCC-VETMMPYHTATASALLNSMLSVSRRS-CW  87

Query  298  SLEDCND  278
            + E  ++
Sbjct  88   TPEGQDE  94



>ref|NP_001078002.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC08897.1| uncharacterized protein AT2G33847 [Arabidopsis thaliana]
Length=89

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S F++P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLSV+ RS  W
Sbjct  27   PSSARSSFKLPKQSPLSHRIFRSPVELSCC-VETMLPYHTATASALLNSMLSVSGRSI-W  84

Query  298  SLED  287
            + + 
Sbjct  85   TFQG  88



>ref|XP_008358669.1| PREDICTED: uncharacterized protein LOC103422383 isoform X5 [Malus 
domestica]
 ref|XP_009352866.1| PREDICTED: uncharacterized protein LOC103944170 isoform X5 [Pyrus 
x bretschneideri]
Length=95

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ E 
Sbjct  88   YGWTPEG  94



>ref|XP_008358667.1| PREDICTED: uncharacterized protein LOC103422383 isoform X4 [Malus 
domestica]
 ref|XP_009352864.1| PREDICTED: uncharacterized protein LOC103944170 isoform X3 [Pyrus 
x bretschneideri]
Length=95

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLED  287
             GW+ E 
Sbjct  88   YGWTPEG  94



>gb|KEH36562.1| hypothetical protein MTR_2g014370 [Medicago truncatula]
Length=91

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  23   KPRPTCSMFRIPKQTSISNRISRLPVEMSS-GVESLLPYHTATASALLTSMLSVSRHSYG  81

Query  301  WSLEDCNDD  275
            W+ EDCNDD
Sbjct  82   WTPEDCNDD  90



>ref|XP_008383893.1| PREDICTED: uncharacterized protein LOC103446533 [Malus domestica]
Length=107

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIP--TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            +PK + SPFR+P  TQ     RIFRSP+ELSC  VETMLPYHTATA ALL SMLSV+ RS
Sbjct  29   RPKPASSPFRVPKPTQSLSAPRIFRSPVELSCC-VETMLPYHTATASALLTSMLSVSQRS  87

Query  307  RGWSLE  290
             GW+ E
Sbjct  88   YGWTPE  93



>ref|XP_009109728.1| PREDICTED: uncharacterized protein LOC103835326 isoform X2 [Brassica 
rapa]
 emb|CDX90149.1| BnaA08g18350D [Brassica napus]
Length=95

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +S   FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSSRPAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCND  278
             +E  ++
Sbjct  87   IVEGLDE  93



>ref|XP_006415661.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
 gb|ESQ34014.1| hypothetical protein EUTSA_v10009195mg [Eutrema salsugineum]
Length=95

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P +  S FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PASPRSAFRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCND  278
             +E  ++
Sbjct  87   IVEGLDE  93



>ref|XP_006377406.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 gb|ERP55203.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
Length=94

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+SC  VETMLPYHTATA ALLNSMLSV+ R  GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSCC-VETMLPYHTATASALLNSMLSVS-RRYGWT  90

Query  295  LED  287
             E 
Sbjct  91   PEG  93



>ref|XP_010478214.1| PREDICTED: uncharacterized protein LOC104757185 isoform X3 [Camelina 
sativa]
Length=91

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELS   VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSSC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLED  287
             +ED
Sbjct  87   IVED  90



>ref|XP_006377405.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 gb|ERP55202.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
Length=98

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+SC  VETMLPYHTATA ALLNSMLSV+ R  GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSCC-VETMLPYHTATASALLNSMLSVS-RRYGWT  90

Query  295  LED  287
             E 
Sbjct  91   PEG  93



>ref|XP_011096349.1| PREDICTED: uncharacterized protein LOC105175568 isoform X1 [Sesamum 
indicum]
 ref|XP_011096350.1| PREDICTED: uncharacterized protein LOC105175568 isoform X1 [Sesamum 
indicum]
 ref|XP_011096351.1| PREDICTED: uncharacterized protein LOC105175568 isoform X1 [Sesamum 
indicum]
Length=233

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ S SPFRI +QKPL+ARIFRSP+E+S V V +MLPYHTATA A+L SMLSVAPRS  
Sbjct  164  KPRASPSPFRISSQKPLSARIFRSPVEMSSVSVVSMLPYHTATASAVLTSMLSVAPRSHA  223

Query  301  WSLE  290
            W+LE
Sbjct  224  WTLE  227



>ref|XP_011096353.1| PREDICTED: uncharacterized protein LOC105175568 isoform X3 [Sesamum 
indicum]
Length=229

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ S SPFRI +QKPL+ARIFRSP+E+S V V +MLPYHTATA A+L SMLSVAPRS  
Sbjct  164  KPRASPSPFRISSQKPLSARIFRSPVEMSSVSVVSMLPYHTATASAVLTSMLSVAPRSHA  223

Query  301  WSLE  290
            W+LE
Sbjct  224  WTLE  227



>ref|XP_004485820.1| PREDICTED: uncharacterized protein LOC101505154 isoform X6 [Cicer 
arietinum]
 ref|XP_004485821.1| PREDICTED: uncharacterized protein LOC101505154 isoform X7 [Cicer 
arietinum]
 ref|XP_004485822.1| PREDICTED: uncharacterized protein LOC101505154 isoform X8 [Cicer 
arietinum]
 ref|XP_004485824.1| PREDICTED: uncharacterized protein LOC101505154 isoform X10 [Cicer 
arietinum]
 ref|XP_004485825.1| PREDICTED: uncharacterized protein LOC101505154 isoform X11 [Cicer 
arietinum]
Length=94

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            S F+IP Q  ++ RI R P+E+SC  VE++LPYHTATA ALL SMLSV+  S GW+ EDC
Sbjct  32   SMFQIPKQSSISNRISRLPVEMSC-GVESLLPYHTATASALLTSMLSVSRHSYGWTPEDC  90

Query  283  NDD  275
            NDD
Sbjct  91   NDD  93



>ref|XP_002279363.2| PREDICTED: uncharacterized protein LOC100264194 isoform X3 [Vitis 
vinifera]
Length=93

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + S   I  QKPL+ RIFRSP+E+S   VE+MLP+H ATA ALLNSMLSV+ RS G
Sbjct  29   KPKRTFSSLGISNQKPLSRRIFRSPVEMSFC-VESMLPFHAATASALLNSMLSVSRRSYG  87

Query  301  WSLED  287
            W+ ED
Sbjct  88   WTPED  92



>ref|XP_006377402.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
 gb|ERP55199.1| hypothetical protein POPTR_0011s05620g [Populus trichocarpa]
Length=126

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFRI  + PL+ RIFRSP+E+SC  VETMLPYHTATA ALLNSMLSV+ R  GW+
Sbjct  33   KPASSPFRISKESPLSHRIFRSPVEMSCC-VETMLPYHTATASALLNSMLSVS-RRYGWT  90

Query  295  LE-DC  284
             E DC
Sbjct  91   PEVDC  95



>gb|KGN49250.1| hypothetical protein Csa_6G518070 [Cucumis sativus]
Length=190

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLEDCND  278
             GW+ EDC +
Sbjct  90   YGWTPEDCKE  99



>emb|CDY35740.1| BnaC03g58610D [Brassica napus]
Length=97

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            FR+P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +   RGW +E  ++
Sbjct  39   FRMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--RRGWIVEGLDE  95



>ref|XP_006592846.1| PREDICTED: uncharacterized protein LOC100788648 isoform X3 [Glycine 
max]
Length=96

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW 
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGWL  88

Query  295  LEDCNDD  275
             EDCNDD
Sbjct  89   PEDCNDD  95



>ref|XP_003543327.2| PREDICTED: uncharacterized protein LOC100777625 isoformX1 [Glycine 
max]
 ref|XP_006594838.1| PREDICTED: uncharacterized protein LOC100777625 isoform X6 [Glycine 
max]
Length=124

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+ + +PL+    R P+ELS   VE+MLPYHTATA AL+ SMLSV+  S G
Sbjct  56   EAKAARSPFRVASNQPLSQSTLRCPVELSFC-VESMLPYHTATASALMTSMLSVSRHSYG  114

Query  301  WSLEDCNDD  275
            W  EDCNDD
Sbjct  115  WLPEDCNDD  123



>ref|XP_010686409.1| PREDICTED: uncharacterized protein LOC104900632 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=97

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 7/70 (10%)
 Frame = -2

Query  478  PKTSGSP-----FRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVA  317
            PKT  +P     F +P Q PL+A RIFRSP+ELSC  VE+++PYHTATA ALL SMLS A
Sbjct  28   PKTKSNPSFNSTFHLPKQNPLSAPRIFRSPVELSCC-VESLMPYHTATASALLTSMLSGA  86

Query  316  PRSRGWSLED  287
            PR  GW+ ED
Sbjct  87   PRRFGWTPED  96



>ref|XP_010478213.1| PREDICTED: uncharacterized protein LOC104757185 isoform X2 [Camelina 
sativa]
Length=95

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FR+P Q PL+ RIFRSP+ELS   VETMLPYHTATA ALLNSMLS +   RGW
Sbjct  30   PSSARSAFRMPKQSPLSNRIFRSPVELSSC-VETMLPYHTATASALLNSMLSAS--RRGW  86

Query  298  SLEDCND  278
             +E  ++
Sbjct  87   IVEGLDE  93



>emb|CDY34102.1| BnaA09g27280D [Brassica napus]
Length=88

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = -2

Query  481  KPKTSGSP---FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPR  311
            KP  + SP   F +P Q PL+ RIFRSP+ELSC  VETMLPYHTATA ALLNSMLS +  
Sbjct  19   KPMPAASPRSAFGMPKQSPLSNRIFRSPVELSCC-VETMLPYHTATASALLNSMLSAS--  75

Query  310  SRGWSLEDCND  278
             RGW +E  ++
Sbjct  76   RRGWIIEGLDE  86



>ref|XP_010540465.1| PREDICTED: uncharacterized protein LOC104814228 [Tarenaya hassleriana]
Length=115

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            P ++ S FRI  Q PL+ RIFR P+E+SC  +ETM+PYHTATA ALL+SMLSV+ RS  W
Sbjct  53   PASARSTFRISKQSPLSHRIFRCPVEMSCC-LETMMPYHTATASALLDSMLSVSRRS-CW  110

Query  298  SLED  287
            +LED
Sbjct  111  TLED  114



>ref|XP_009143826.1| PREDICTED: uncharacterized protein LOC103867502 isoform X2 [Brassica 
rapa]
Length=95

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSV-APRSRG  302
            P ++ S F++P   PL+ R+FRSP+ LSC  VETMLPYHTATA ALLNSMLSV + R   
Sbjct  27   PSSARSSFKMPKPSPLSPRVFRSPVALSCC-VETMLPYHTATASALLNSMLSVSSSRCSV  85

Query  301  WSLEDCNDDA  272
            W+L D  DDA
Sbjct  86   WTLGDIIDDA  95



>ref|XP_007148131.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
 gb|ESW20125.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
Length=90

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+++ SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   KPRSARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ ED
Sbjct  85   WTPED  89



>emb|CDY17208.1| BnaA05g09800D [Brassica napus]
Length=96

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFR-SPLELSCVRVETMLPYHTATACALLNSMLSV-APRSR  305
            P ++ S F++P Q PL+ R+FR SP+ LSC  VETMLPYHTATA ALLNSMLSV + R  
Sbjct  27   PSSARSSFKMPKQSPLSPRVFRRSPVALSCC-VETMLPYHTATASALLNSMLSVSSSRCS  85

Query  304  GWSLEDCNDDA  272
             W+L D  DDA
Sbjct  86   VWTLGDIIDDA  96



>ref|XP_004134692.1| PREDICTED: uncharacterized protein LOC101221672 isoform 5 [Cucumis 
sativus]
 ref|XP_004134693.1| PREDICTED: uncharacterized protein LOC101221672 isoform 6 [Cucumis 
sativus]
Length=97

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLED  287
             GW+ ED
Sbjct  90   YGWTPED  96



>ref|XP_002279344.1| PREDICTED: uncharacterized protein LOC100264194 isoform X2 [Vitis 
vinifera]
 emb|CBI30605.3| unnamed protein product [Vitis vinifera]
Length=97

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK + S   I  QKPL+ RIFRSP+E+S   VE+MLP+H ATA ALLNSMLSV+ RS G
Sbjct  29   KPKRTFSSLGISNQKPLSRRIFRSPVEMSFC-VESMLPFHAATASALLNSMLSVSRRSYG  87

Query  301  WSLED  287
            W+ E 
Sbjct  88   WTPEG  92



>ref|XP_004134690.1| PREDICTED: uncharacterized protein LOC101221672 isoform 3 [Cucumis 
sativus]
Length=97

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLED  287
             GW+ ED
Sbjct  90   YGWTPED  96



>ref|XP_011027936.1| PREDICTED: uncharacterized protein LOC105128111 [Populus euphratica]
Length=99

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            S FRI  Q P +  IFRSP+E+SC  VETMLPYHTAT+ ALLNSMLSV+ RS GW+ E 
Sbjct  14   SSFRIFKQGPFSPHIFRSPVEMSCC-VETMLPYHTATSSALLNSMLSVSRRSYGWTPEG  71



>ref|XP_004134689.1| PREDICTED: uncharacterized protein LOC101221672 isoform 2 [Cucumis 
sativus]
Length=101

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLEDCND  278
             GW+ E  +D
Sbjct  90   YGWTPEGQDD  99



>ref|XP_003633235.1| PREDICTED: uncharacterized protein LOC100243665 isoform X2 [Vitis 
vinifera]
Length=96

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SP RI + KPL+ RIFR P+ELSCV  ETM+P+HTATA AL+ SMLS++ R  G
Sbjct  29   EAKAARSPLRISSNKPLSNRIFRCPVELSCV--ETMVPFHTATASALMTSMLSISRRGYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_003633234.1| PREDICTED: uncharacterized protein LOC100243665 isoform X4 [Vitis 
vinifera]
 ref|XP_010657000.1| PREDICTED: uncharacterized protein LOC100243665 isoform X4 [Vitis 
vinifera]
 ref|XP_010657001.1| PREDICTED: uncharacterized protein LOC100243665 isoform X4 [Vitis 
vinifera]
 emb|CBI21895.3| unnamed protein product [Vitis vinifera]
Length=92

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SP RI + KPL+ RIFR P+ELSCV  ETM+P+HTATA AL+ SMLS++ R  G
Sbjct  29   EAKAARSPLRISSNKPLSNRIFRCPVELSCV--ETMVPFHTATASALMTSMLSISRRGYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_003633237.1| PREDICTED: uncharacterized protein LOC100243665 isoform X5 [Vitis 
vinifera]
Length=92

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SP RI + KPL+ RIFR P+ELSCV  ETM+P+HTATA AL+ SMLS++ R  G
Sbjct  29   EAKAARSPLRISSNKPLSNRIFRCPVELSCV--ETMVPFHTATASALMTSMLSISRRGYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_010686408.1| PREDICTED: uncharacterized protein LOC104900632 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=101

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = -2

Query  478  PKTSGSP-----FRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVA  317
            PKT  +P     F +P Q PL+A RIFRSP+ELSC  VE+++PYHTATA ALL SMLS A
Sbjct  28   PKTKSNPSFNSTFHLPKQNPLSAPRIFRSPVELSCC-VESLMPYHTATASALLTSMLSGA  86

Query  316  PRSRGWSLED  287
            PR  GW+ E 
Sbjct  87   PRRFGWTPEG  96



>ref|NP_001240187.1| uncharacterized protein LOC100776551 [Glycine max]
 gb|ACU24059.1| unknown [Glycine max]
Length=95

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -2

Query  463  SPFRIPTQKPLTAR--IFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLE  290
            SPFRI + KPL+      R P+ELS   VE+M+PYHTATA AL+NSMLS++ R+  W  E
Sbjct  31   SPFRIASNKPLSQSQSTLRFPVELSSC-VESMMPYHTATASALMNSMLSISTRTSAWIPE  89

Query  289  DCNDD  275
            DCNDD
Sbjct  90   DCNDD  94



>ref|XP_010686410.1| PREDICTED: uncharacterized protein LOC104900632 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=97

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = -2

Query  478  PKTSGSP-----FRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVA  317
            PKT  +P     F +P Q PL+A RIFRSP+ELSC  VE+++PYHTATA ALL SMLS A
Sbjct  28   PKTKSNPSFNSTFHLPKQNPLSAPRIFRSPVELSCC-VESLMPYHTATASALLTSMLSGA  86

Query  316  PRSRGWSLED  287
            PR  GW+ E 
Sbjct  87   PRRFGWTPEG  96



>ref|XP_007198943.1| hypothetical protein PRUPE_ppa013910mg [Prunus persica]
 gb|EMJ00142.1| hypothetical protein PRUPE_ppa013910mg [Prunus persica]
Length=96

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+  ++P ++   RSP+ELS   VE+MLPYHTATA AL+ SMLS+  RS G
Sbjct  28   EAKAARSPFRMAGKRPSSSPALRSPVELSFC-VESMLPYHTATASALMTSMLSITRRSYG  86

Query  301  WSLEDCNDD  275
            W  E CNDD
Sbjct  87   WLPEACNDD  95



>ref|XP_007148132.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
 gb|ESW20126.1| hypothetical protein PHAVU_006G182900g [Phaseolus vulgaris]
Length=90

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+++ SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   KPRSARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>ref|XP_003546003.1| PREDICTED: uncharacterized protein LOC100806196 isoformX2 [Glycine 
max]
Length=90

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            +P+ + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RPRPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ ED
Sbjct  85   WTPED  89



>ref|XP_006388109.1| hypothetical protein POPTR_0335s00210g [Populus trichocarpa]
 gb|ERP47023.1| hypothetical protein POPTR_0335s00210g [Populus trichocarpa]
Length=76

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -2

Query  457  FRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCND  278
            F  P +   + RI RSP+E+SC  VETMLPY T T+ AL NSMLSV+ R+ GW+ EDCND
Sbjct  16   FASPNKARFSPRIVRSPVEMSCC-VETMLPYRTVTSSALRNSMLSVSRRTYGWTPEDCND  74

Query  277  D  275
            D
Sbjct  75   D  75



>ref|XP_004505543.1| PREDICTED: uncharacterized protein LOC101498969 isoform X1 [Cicer 
arietinum]
 ref|XP_004505544.1| PREDICTED: uncharacterized protein LOC101498969 isoform X2 [Cicer 
arietinum]
Length=95

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 3/71 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGWSLEDCNDD  275
              W  E C DD
Sbjct  84   YAWLSEGCIDD  94



>ref|XP_009357138.1| PREDICTED: uncharacterized protein LOC103947901 isoform X2 [Pyrus 
x bretschneideri]
Length=99

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIF---RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            K + SPFR+  ++P ++  F   RSP++LS   VE+MLPYHTATA AL+NSMLSV   S 
Sbjct  30   KAARSPFRMAGKRPSSSSPFPALRSPVQLSFC-VESMLPYHTATASALMNSMLSVTRHSY  88

Query  304  GWSLEDCNDDA  272
            GW  E CNDDA
Sbjct  89   GWLSEACNDDA  99



>ref|XP_010035780.1| PREDICTED: uncharacterized protein LOC104424937 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010035781.1| PREDICTED: uncharacterized protein LOC104424937 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010035782.1| PREDICTED: uncharacterized protein LOC104424937 isoform X3 [Eucalyptus 
grandis]
 gb|KCW47245.1| hypothetical protein EUGRSUZ_K01049 [Eucalyptus grandis]
Length=95

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -2

Query  445  TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCNDD  275
            T +PL+ RIFRSP+E+S    ETMLPYHTAT+ AL+ SMLS+  RS GW  + CNDD
Sbjct  39   TNRPLSHRIFRSPVEMSAC-AETMLPYHTATSSALMTSMLSITRRSYGWLPDACNDD  94



>ref|XP_007149815.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
 gb|ESW21809.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
Length=128

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K  GSPFR+ + KPL+    R P+ELS   VE+MLPYHTATA ALL SMLSV+ RS G
Sbjct  61   EAKAGGSPFRVASNKPLSQSTLRRPVELSFC-VESMLPYHTATASALLTSMLSVSRRSYG  119

Query  301  W  299
            W
Sbjct  120  W  120



>ref|XP_007149813.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
 ref|XP_007149814.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
 gb|ESW21807.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
 gb|ESW21808.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
Length=129

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K  GSPFR+ + KPL+    R P+ELS   VE+MLPYHTATA ALL SMLSV+ RS G
Sbjct  61   EAKAGGSPFRVASNKPLSQSTLRRPVELSFC-VESMLPYHTATASALLTSMLSVSRRSYG  119

Query  301  W  299
            W
Sbjct  120  W  120



>ref|XP_004134691.1| PREDICTED: uncharacterized protein LOC101221672 isoform 4 [Cucumis 
sativus]
Length=97

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLED  287
             GW+ E 
Sbjct  90   YGWTPEG  96



>ref|XP_007149812.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
 gb|ESW21806.1| hypothetical protein PHAVU_005G101000g [Phaseolus vulgaris]
Length=125

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K  GSPFR+ + KPL+    R P+ELS   VE+MLPYHTATA ALL SMLSV+ RS G
Sbjct  61   EAKAGGSPFRVASNKPLSQSTLRRPVELSFC-VESMLPYHTATASALLTSMLSVSRRSYG  119

Query  301  W  299
            W
Sbjct  120  W  120



>ref|XP_009143825.1| PREDICTED: uncharacterized protein LOC103867502 isoform X1 [Brassica 
rapa]
Length=96

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 3/71 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFR-SPLELSCVRVETMLPYHTATACALLNSMLSV-APRSR  305
            P ++ S F++P   PL+ R+FR SP+ LSC  VETMLPYHTATA ALLNSMLSV + R  
Sbjct  27   PSSARSSFKMPKPSPLSPRVFRRSPVALSCC-VETMLPYHTATASALLNSMLSVSSSRCS  85

Query  304  GWSLEDCNDDA  272
             W+L D  DDA
Sbjct  86   VWTLGDIIDDA  96



>ref|XP_004293876.1| PREDICTED: uncharacterized protein LOC101297221 isoform 4 [Fragaria 
vesca subsp. vesca]
Length=94

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 3/59 (5%)
 Frame = -2

Query  457  FRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            F IP Q   P++  +FRSP+ELSC  VET+LPYHTATA ALL SMLSV+ RS GW+ ED
Sbjct  36   FSIPKQNKNPISHALFRSPVELSCC-VETLLPYHTATASALLTSMLSVSQRSYGWTPED  93



>gb|AFK44475.1| unknown [Medicago truncatula]
 gb|KEH39180.1| hypothetical protein MTR_2g090650 [Medicago truncatula]
Length=96

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K++ +PFRI + KP++   FR P+ELS   +E+MLP+H+ATA AL+ S L V+ RS  
Sbjct  28   EAKSARTPFRIASNKPISQSAFRCPVELSFC-MESMLPFHSATASALMTSKLVVSQRSYA  86

Query  301  WSLEDCNDD  275
            W  EDCNDD
Sbjct  87   WLPEDCNDD  95



>ref|XP_006594573.1| PREDICTED: uncharacterized protein LOC100797119 isoform X4 [Glycine 
max]
Length=90

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RTKPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ ED
Sbjct  85   WTPED  89



>ref|XP_004155641.1| PREDICTED: uncharacterized protein LOC101231364 [Cucumis sativus]
Length=108

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTA--RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            K K++ SPF IP Q PL+   RI RSP+ELSC  +E++LPYH+ATA ALL SMLSV+ RS
Sbjct  31   KTKSAPSPFAIPKQNPLSQSHRILRSPVELSCC-LESLLPYHSATASALLTSMLSVSRRS  89

Query  307  RGWSLED  287
             GW+ E 
Sbjct  90   YGWTPEG  96



>ref|XP_008459322.1| PREDICTED: uncharacterized protein LOC103498488 isoform X2 [Cucumis 
melo]
Length=94

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            SPFRI +++P +   FR P+E+S   VE+MLP+H+AT+ AL+ SMLSV+P S GW  E  
Sbjct  32   SPFRIASKRPFSHSSFRIPIEMSFC-VESMLPFHSATSSALMTSMLSVSPHSYGWLSEVF  90

Query  283  NDD  275
            NDD
Sbjct  91   NDD  93



>ref|XP_009357137.1| PREDICTED: uncharacterized protein LOC103947901 isoform X1 [Pyrus 
x bretschneideri]
Length=99

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIF---RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            K + SPFR+  ++P ++  F   RSP++LS   VE+MLPYHTATA AL+NSMLSV   S 
Sbjct  30   KAARSPFRMAGKRPSSSSPFPALRSPVQLSFC-VESMLPYHTATASALMNSMLSVTRHSY  88

Query  304  GWSLEDCNDD  275
            GW  E CNDD
Sbjct  89   GWLSEACNDD  98



>ref|XP_003546005.1| PREDICTED: uncharacterized protein LOC100806196 isoformX4 [Glycine 
max]
Length=94

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            +P+ + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RPRPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>ref|XP_006597456.1| PREDICTED: uncharacterized protein LOC100806196 isoform X6 [Glycine 
max]
 ref|XP_006597457.1| PREDICTED: uncharacterized protein LOC100806196 isoform X7 [Glycine 
max]
Length=90

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            +P+ + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RPRPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>gb|KDP21004.1| hypothetical protein JCGZ_21475 [Jatropha curcas]
Length=101

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = -2

Query  475  KTSGSPFRIPTQKP--LTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KT+ SPFR    KP  L+ RIFRSP+E+SC  VETMLPYHTATA ALL SM+SV+ RS  
Sbjct  32   KTAFSPFRTSNSKPNTLSQRIFRSPMEISCC-VETMLPYHTATASALLTSMISVSRRS-C  89

Query  301  WSLED  287
            W+ E 
Sbjct  90   WTPEG  94



>ref|XP_008358242.1| PREDICTED: uncharacterized protein LOC103421980 isoform X2 [Malus 
domestica]
Length=99

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF---RSPLELSCVRVETMLPYHTATACALLNSMLSVAPR  311
            + K + SPFR+  ++  ++  F   RSP++LS   VE+MLPYHTATA AL+NSMLSV   
Sbjct  28   EAKAARSPFRMAAKRASSSSPFPALRSPVQLSFC-VESMLPYHTATASALMNSMLSVTRH  86

Query  310  SRGWSLEDCNDDA  272
            S GW  E CNDDA
Sbjct  87   SYGWLSEACNDDA  99



>ref|XP_010259168.1| PREDICTED: uncharacterized protein LOC104598662 isoform X1 [Nelumbo 
nucifera]
Length=99

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAP-RSR  305
            + K + S FRI  QK L+ R+FRSP+E+SC  VE+M+P+HTATA ALL SMLSV+  R  
Sbjct  29   ETKAARSSFRISKQKNLSHRLFRSPVEMSCC-VESMMPHHTATASALLTSMLSVSHRRGY  87

Query  304  GWSLEDCNDDA  272
            GW  E   ++A
Sbjct  88   GWLPEGQRNEA  98



>ref|XP_007043672.1| Nuclear fusion defective 6 isoform 2 [Theobroma cacao]
 gb|EOX99503.1| Nuclear fusion defective 6 isoform 2 [Theobroma cacao]
Length=97

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            K   S SPFR+ ++ PL+ RIFR P+E S   VE+MLPYHTATA AL+ SMLS++ RS G
Sbjct  29   KANASPSPFRVSSRIPLSNRIFRCPVEASFC-VESMLPYHTATASALMTSMLSISRRSYG  87

Query  301  W  299
            W
Sbjct  88   W  88



>ref|XP_007043671.1| Nuclear fusion defective 6 isoform 1 [Theobroma cacao]
 gb|EOX99502.1| Nuclear fusion defective 6 isoform 1 [Theobroma cacao]
Length=93

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            K   S SPFR+ ++ PL+ RIFR P+E S   VE+MLPYHTATA AL+ SMLS++ RS G
Sbjct  29   KANASPSPFRVSSRIPLSNRIFRCPVEASFC-VESMLPYHTATASALMTSMLSISRRSYG  87

Query  301  W  299
            W
Sbjct  88   W  88



>ref|XP_004148698.1| PREDICTED: uncharacterized protein LOC101214029 isoform 2 [Cucumis 
sativus]
 gb|KGN52462.1| hypothetical protein Csa_5G636540 [Cucumis sativus]
Length=94

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  469  SGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLE  290
            + SPFRI +++P +   FR P+ELS   VE+MLP+H+AT+ AL+ SMLSV+P S GW  E
Sbjct  30   ASSPFRIASKRPFSHCSFRLPIELSFC-VESMLPFHSATSSALMTSMLSVSPHSFGWLSE  88

Query  289  DCNDD  275
              NDD
Sbjct  89   VFNDD  93



>gb|KDP24089.1| hypothetical protein JCGZ_25746 [Jatropha curcas]
Length=103

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -2

Query  481  KPKTS-GSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            KPK+S  SPFR  + KPL+  I R P+E+S   +E+M+PYHTATA AL+ SMLS++PR  
Sbjct  27   KPKSSQASPFRAASNKPLSQSILRRPVEMS-FGLESMMPYHTATASALMTSMLSISPRCY  85

Query  304  GW  299
            GW
Sbjct  86   GW  87



>ref|XP_007132782.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04776.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
Length=93

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT  SPFRI + KPL+    R P+ELS   VE+M+PYHTATA AL+NSMLS++ R+ G
Sbjct  25   EAKTVRSPFRIASNKPLSQSTIRLPVELSSC-VESMMPYHTATASALMNSMLSISSRTCG  83

Query  301  W  299
            W
Sbjct  84   W  84



>ref|XP_007132781.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 ref|XP_007132783.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 ref|XP_007132784.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04775.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04777.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04778.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
Length=89

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT  SPFRI + KPL+    R P+ELS   VE+M+PYHTATA AL+NSMLS++ R+ G
Sbjct  25   EAKTVRSPFRIASNKPLSQSTIRLPVELSSC-VESMMPYHTATASALMNSMLSISSRTCG  83

Query  301  W  299
            W
Sbjct  84   W  84



>ref|XP_007132780.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
 gb|ESW04774.1| hypothetical protein PHAVU_011G124500g [Phaseolus vulgaris]
Length=89

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT  SPFRI + KPL+    R P+ELS   VE+M+PYHTATA AL+NSMLS++ R+ G
Sbjct  25   EAKTVRSPFRIASNKPLSQSTIRLPVELSSC-VESMMPYHTATASALMNSMLSISSRTCG  83

Query  301  W  299
            W
Sbjct  84   W  84



>ref|XP_004293274.1| PREDICTED: uncharacterized protein LOC101313580 [Fragaria vesca 
subsp. vesca]
Length=98

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -2

Query  457  FRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDC  284
            F IP Q   P++  +FRSP+ELSC  VE++LPYH+ATA ALL SMLSV+ RS GW+ +  
Sbjct  37   FSIPKQNNNPISHALFRSPVELSCC-VESLLPYHSATASALLTSMLSVSQRSYGWTPQG-  94

Query  283  NDDA  272
            NDD+
Sbjct  95   NDDS  98



>ref|XP_011100248.1| PREDICTED: uncharacterized protein LOC105178474 isoform X2 [Sesamum 
indicum]
Length=99

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = -2

Query  463  SPFRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFR+P + P+ A RI RSP+E+S   +E+M PYHTATA AL+ SML+V+    GW  E 
Sbjct  36   SPFRLPARAPVLANRILRSPVEMSAC-LESMQPYHTATASALMTSMLTVSRCGFGWLAEA  94

Query  286  CNDD  275
            CNDD
Sbjct  95   CNDD  98



>ref|XP_010259217.1| PREDICTED: uncharacterized protein LOC104598662 isoform X2 [Nelumbo 
nucifera]
Length=98

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAP-RSR  305
            + K + S FRI  QK L+ R+FRSP+E+SC  VE+M+P+HTATA ALL SMLSV+  R  
Sbjct  29   ETKAARSSFRISKQKNLSHRLFRSPVEMSCC-VESMMPHHTATASALLTSMLSVSHRRGY  87

Query  304  GW  299
            GW
Sbjct  88   GW  89



>ref|XP_011100249.1| PREDICTED: uncharacterized protein LOC105178474 isoform X3 [Sesamum 
indicum]
 ref|XP_011100251.1| PREDICTED: uncharacterized protein LOC105178474 isoform X3 [Sesamum 
indicum]
Length=99

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = -2

Query  463  SPFRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFR+P + P+ A RI RSP+E+S   +E+M PYHTATA AL+ SML+V+    GW  E 
Sbjct  36   SPFRLPARAPVLANRILRSPVEMSAC-LESMQPYHTATASALMTSMLTVSRCGFGWLAEA  94

Query  286  CNDD  275
            CNDD
Sbjct  95   CNDD  98



>ref|XP_004293877.1| PREDICTED: uncharacterized protein LOC101297221 isoform 5 [Fragaria 
vesca subsp. vesca]
Length=94

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -2

Query  457  FRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            F IP Q   P++  +FRSP+ELSC  VET+LPYHTATA ALL SMLSV+ RS GW+ E 
Sbjct  36   FSIPKQNKNPISHALFRSPVELSCC-VETLLPYHTATASALLTSMLSVSQRSYGWTPEG  93



>ref|XP_004293873.1| PREDICTED: uncharacterized protein LOC101297221 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=98

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -2

Query  457  FRIPTQK--PLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            F IP Q   P++  +FRSP+ELSC  VET+LPYHTATA ALL SMLSV+ RS GW+ E 
Sbjct  36   FSIPKQNKNPISHALFRSPVELSCC-VETLLPYHTATASALLTSMLSVSQRSYGWTPEG  93



>ref|XP_003543030.1| PREDICTED: uncharacterized protein LOC100797119 isoformX1 [Glycine 
max]
Length=94

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RTKPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>gb|KDO43069.1| hypothetical protein CISIN_1g0343852mg [Citrus sinensis]
Length=96

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            K K + SPF +  +KPL+    RSP+E+S   VE+MLPYHTATA AL  S+LS++    G
Sbjct  28   KTKAAPSPFGVSAKKPLSLAALRSPVEMSFC-VESMLPYHTATASALSTSLLSISQCGYG  86

Query  301  WSLEDCNDD  275
            W  E CNDD
Sbjct  87   WLPEACNDD  95



>ref|XP_008358241.1| PREDICTED: uncharacterized protein LOC103421980 isoform X1 [Malus 
domestica]
Length=99

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF---RSPLELSCVRVETMLPYHTATACALLNSMLSVAPR  311
            + K + SPFR+  ++  ++  F   RSP++LS   VE+MLPYHTATA AL+NSMLSV   
Sbjct  28   EAKAARSPFRMAAKRASSSSPFPALRSPVQLSFC-VESMLPYHTATASALMNSMLSVTRH  86

Query  310  SRGWSLEDCNDD  275
            S GW  E CNDD
Sbjct  87   SYGWLSEACNDD  98



>ref|XP_003543031.1| PREDICTED: uncharacterized protein LOC100797119 isoformX2 [Glycine 
max]
Length=90

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RTKPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>ref|XP_006594574.1| PREDICTED: uncharacterized protein LOC100797119 isoform X5 [Glycine 
max]
Length=89

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+P Q  ++ R+FR P+E S   VE+MLPYH+ATA ALLNSMLSV+  S G
Sbjct  26   RTKPARSPFRLPKQTSISNRVFRLPVEASFC-VESMLPYHSATASALLNSMLSVSRHSYG  84

Query  301  WSLED  287
            W+ E 
Sbjct  85   WTPEG  89



>gb|AFK47257.1| unknown [Lotus japonicus]
Length=93

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFRI + KPL+    RSP++LS   VE+M+P+HTATA AL+NSML V+ RS G
Sbjct  25   EAKAARSPFRIASNKPLSQSSLRSPVQLSFC-VESMMPFHTATASALMNSMLFVSSRSSG  83

Query  301  W  299
            W
Sbjct  84   W  84



>gb|AFK46480.1| unknown [Lotus japonicus]
Length=89

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFRI + KPL+    RSP++LS   VE+M+P+HTATA AL+NSML V+ RS G
Sbjct  25   EAKAARSPFRIASNKPLSQSSLRSPVQLSFC-VESMMPFHTATASALMNSMLFVSSRSSG  83

Query  301  W  299
            W
Sbjct  84   W  84



>ref|XP_004505545.1| PREDICTED: uncharacterized protein LOC101498969 isoform X3 [Cicer 
arietinum]
Length=94

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGWSLEDCNDDA  272
              W L +  D++
Sbjct  84   YAW-LSEAGDES  94



>ref|XP_009761838.1| PREDICTED: uncharacterized protein LOC104213960 [Nicotiana sylvestris]
 ref|XP_009761839.1| PREDICTED: uncharacterized protein LOC104213960 [Nicotiana sylvestris]
Length=97

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT  S FR  ++  L+ RIFR P E+S   VE++ PYHTATA AL+ SML+V+ RS G
Sbjct  29   ESKTVPSSFRAASRSALSNRIFRCPAEMSAC-VESLQPYHTATASALMTSMLTVSMRSYG  87

Query  301  WSLEDCNDD  275
            W  E  NDD
Sbjct  88   WLSEAQNDD  96



>ref|XP_004485828.1| PREDICTED: uncharacterized protein LOC101505154 isoform X14 [Cicer 
arietinum]
Length=90

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            S F+IP Q  ++ RI R P+E+SC  VE++LPYHTATA ALL SMLSV+  S GW+ ED
Sbjct  32   SMFQIPKQSSISNRISRLPVEMSC-GVESLLPYHTATASALLTSMLSVSRHSYGWTPED  89



>ref|XP_010111183.1| hypothetical protein L484_015066 [Morus notabilis]
 gb|EXC30574.1| hypothetical protein L484_015066 [Morus notabilis]
Length=133

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 8/69 (12%)
 Frame = -2

Query  463  SPFRIPTQK--PLTARIFR-SPLELS-CVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            SPFRIP +    L+   FR S +E+S CV  E+MLPYHTATACALLNSMLSV+ R++GW+
Sbjct  35   SPFRIPRENLNRLSRPTFRRSAVEMSRCV--ESMLPYHTATACALLNSMLSVSCRTQGWN  92

Query  295  LEDCN--DD  275
            LE  N  DD
Sbjct  93   LEGSNQVDD  101



>gb|KEH36564.1| hypothetical protein MTR_2g014370 [Medicago truncatula]
Length=111

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  23   KPRPTCSMFRIPKQTSISNRISRLPVEMS-SGVESLLPYHTATASALLTSMLSVSRHSYG  81

Query  301  WSLED  287
            W+ ED
Sbjct  82   WTPED  86



>ref|XP_004487204.1| PREDICTED: uncharacterized protein LOC101514825 isoform X5 [Cicer 
arietinum]
Length=95

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT+ SPFRI + KPL+    R P+ELS   VE+MLPYHTATA AL+ SML V+ R  G
Sbjct  28   EAKTARSPFRIASNKPLSQSALRCPVELSFC-VESMLPYHTATASALMTSMLVVSERRYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_004487200.1| PREDICTED: uncharacterized protein LOC101514825 isoform X1 [Cicer 
arietinum]
 ref|XP_004487202.1| PREDICTED: uncharacterized protein LOC101514825 isoform X3 [Cicer 
arietinum]
 ref|XP_004487203.1| PREDICTED: uncharacterized protein LOC101514825 isoform X4 [Cicer 
arietinum]
Length=96

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT+ SPFRI + KPL+    R P+ELS   VE+MLPYHTATA AL+ SML V+ R  G
Sbjct  28   EAKTARSPFRIASNKPLSQSALRCPVELSFC-VESMLPYHTATASALMTSMLVVSERRYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_004487205.1| PREDICTED: uncharacterized protein LOC101514825 isoform X6 [Cicer 
arietinum]
 ref|XP_004487206.1| PREDICTED: uncharacterized protein LOC101514825 isoform X7 [Cicer 
arietinum]
 ref|XP_004487207.1| PREDICTED: uncharacterized protein LOC101514825 isoform X8 [Cicer 
arietinum]
Length=92

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT+ SPFRI + KPL+    R P+ELS   VE+MLPYHTATA AL+ SML V+ R  G
Sbjct  28   EAKTARSPFRIASNKPLSQSALRCPVELSFC-VESMLPYHTATASALMTSMLVVSERRYG  86

Query  301  W  299
            W
Sbjct  87   W  87



>ref|XP_010274637.1| PREDICTED: uncharacterized protein LOC104609909 isoform X3 [Nelumbo 
nucifera]
Length=98

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAP-RSR  305
            + K + SP  I  +KP + R FRSP+E+S   VE++LPYHTATA ALL SMLSV+  R  
Sbjct  29   EAKAARSPCGILKRKPHSNRFFRSPVEMSFC-VESLLPYHTATASALLTSMLSVSHRRDY  87

Query  304  GWSLEDCNDD  275
             W  E CNDD
Sbjct  88   NWLSEACNDD  97



>ref|XP_009599604.1| PREDICTED: uncharacterized protein LOC104095228 isoform X1 [Nicotiana 
tomentosiformis]
Length=97

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + KT+ S FR  ++  L+ RIFR P E+S   VE++ PYHTATA AL+ SML+V+ RS G
Sbjct  29   ESKTAPSSFRAASRCALSNRIFRCPAEMSAC-VESLQPYHTATASALMTSMLTVSMRSYG  87

Query  301  WSLEDCNDD  275
            W  E  NDD
Sbjct  88   WLSEAQNDD  96



>ref|XP_006592851.1| PREDICTED: uncharacterized protein LOC100788648 isoform X8 [Glycine 
max]
Length=92

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWS  296
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW 
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGWL  88

Query  295  LED  287
             ED
Sbjct  89   PED  91



>ref|XP_006447226.1| hypothetical protein CICLE_v10017238mg [Citrus clementina]
 ref|XP_006469916.1| PREDICTED: uncharacterized protein LOC102614119 isoform X3 [Citrus 
sinensis]
 gb|ESR60466.1| hypothetical protein CICLE_v10017238mg [Citrus clementina]
Length=97

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLT-ARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            K K + SPF +  +KPL+ A + RSP+ELS   VE+MLPYHTATA AL  S+LS++    
Sbjct  28   KTKAAPSPFGVSAKKPLSLAALRRSPVELSFC-VESMLPYHTATASALSTSLLSISQCGY  86

Query  304  GWSLEDCNDD  275
            GW  E CNDD
Sbjct  87   GWLPEACNDD  96



>ref|XP_010100969.1| hypothetical protein L484_001331 [Morus notabilis]
 gb|EXB86494.1| hypothetical protein L484_001331 [Morus notabilis]
Length=121

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            K + +PFR+  +KPL+ R+ RSP+E+S   VE+MLPYHTAT+ AL+ SMLS+  RS GW
Sbjct  25   KAARAPFRMAARKPLSQRVLRSPVEMSFC-VESMLPYHTATSSALMTSMLSLTRRSCGW  82



>ref|XP_006594841.1| PREDICTED: uncharacterized protein LOC100777625 isoform X9 [Glycine 
max]
Length=120

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+ + +PL+    R P+ELS   VE+MLPYHTATA AL+ SMLSV+  S G
Sbjct  56   EAKAARSPFRVASNQPLSQSTLRCPVELSFC-VESMLPYHTATASALMTSMLSVSRHSYG  114

Query  301  WSLED  287
            W  ED
Sbjct  115  WLPED  119



>ref|XP_009610350.1| PREDICTED: uncharacterized protein LOC104104065 isoform X1 [Nicotiana 
tomentosiformis]
Length=123

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR  ++ PL+ RIFR P ELS   VE++ PYHTATA AL+ SML+ + RS  
Sbjct  25   EAKAARSPFRTASRTPLSNRIFRCPAELSAC-VESLQPYHTATASALMTSMLTDSLRSYS  83

Query  301  WSLEDCNDD  275
            W  E C++D
Sbjct  84   WLSEVCDND  92



>gb|KGN63195.1| hypothetical protein Csa_2G408410 [Cucumis sativus]
Length=96

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPK-TSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSR  305
            +PK +S SPFR+ T KPL+ R FR   E+S   +E+M+P+H+ ++ AL+ SMLS++  S 
Sbjct  27   QPKASSSSPFRMATNKPLSHRTFRCAPEMSFC-LESMMPFHSVSSSALMTSMLSISRHSC  85

Query  304  GWSLEDCNDD  275
            GW  E CNDD
Sbjct  86   GWLPEACNDD  95



>ref|XP_004505547.1| PREDICTED: uncharacterized protein LOC101498969 isoform X5 [Cicer 
arietinum]
Length=93

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGW  299
              W
Sbjct  84   YAW  86



>ref|XP_004505548.1| PREDICTED: uncharacterized protein LOC101498969 isoform X6 [Cicer 
arietinum]
 ref|XP_004505550.1| PREDICTED: uncharacterized protein LOC101498969 isoform X8 [Cicer 
arietinum]
Length=91

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGW  299
              W
Sbjct  84   YAW  86



>ref|XP_004505546.1| PREDICTED: uncharacterized protein LOC101498969 isoform X4 [Cicer 
arietinum]
Length=94

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGW  299
              W
Sbjct  84   YAW  86



>ref|XP_004505549.1| PREDICTED: uncharacterized protein LOC101498969 isoform X7 [Cicer 
arietinum]
Length=91

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIF--RSPLELSCVRVETMLPYHTATACALLNSMLSVAPRS  308
            + K++ SPFRI + KPL+   F  RSP+ELS   +E+M+PYHTATA AL+NSMLS++ R+
Sbjct  25   EAKSARSPFRIASNKPLSQSQFTLRSPVELSFC-LESMMPYHTATASALMNSMLSLSSRN  83

Query  307  RGW  299
              W
Sbjct  84   YAW  86



>ref|XP_009610358.1| PREDICTED: uncharacterized protein LOC104104065 isoform X2 [Nicotiana 
tomentosiformis]
Length=93

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR  ++ PL+ RIFR P ELS   VE++ PYHTATA AL+ SML+ + RS  
Sbjct  25   EAKAARSPFRTASRTPLSNRIFRCPAELSAC-VESLQPYHTATASALMTSMLTDSLRSYS  83

Query  301  WSLEDCNDD  275
            W  E  N+D
Sbjct  84   WLSEAQNED  92



>ref|XP_011100252.1| PREDICTED: uncharacterized protein LOC105178474 isoform X5 [Sesamum 
indicum]
Length=98

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -2

Query  463  SPFRIPTQKPLTA-RIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            SPFR+P + P+ A RI RSP+E+S   +E+M PYHTATA AL+ SML+V+    GW  E 
Sbjct  36   SPFRLPARAPVLANRILRSPVEMSAC-LESMQPYHTATASALMTSMLTVSRCGFGWLAEG  94

Query  286  CND  278
            C+D
Sbjct  95   CDD  97



>gb|AES63883.2| hypothetical protein MTR_2g014370 [Medicago truncatula]
Length=91

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  23   KPRPTCSMFRIPKQTSISNRISRLPVEMSSG-VESLLPYHTATASALLTSMLSVSRHSYG  81

Query  301  WSLED  287
            W+ E 
Sbjct  82   WTPEG  86



>gb|KEH36563.1| hypothetical protein MTR_2g014370 [Medicago truncatula]
Length=87

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  23   KPRPTCSMFRIPKQTSISNRISRLPVEMSS-GVESLLPYHTATASALLTSMLSVSRHSYG  81

Query  301  WSLED  287
            W+ E 
Sbjct  82   WTPEG  86



>ref|XP_003593632.1| hypothetical protein MTR_2g014370 [Medicago truncatula]
Length=90

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  22   KPRPTCSMFRIPKQTSISNRISRLPVEMSSG-VESLLPYHTATASALLTSMLSVSRHSYG  80

Query  301  WSLED  287
            W+ E 
Sbjct  81   WTPEG  85



>emb|CDY27930.1| BnaCnng05150D [Brassica napus]
Length=119

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -2

Query  478  PKTSGSPFRIPTQKPLTARIFR-SPLELSCVRVETMLPYHTATACALLNSMLSVAPR  311
            PK   S ++ P Q PL+ R+FR SP+ LSC  VETMLPYHTATA ALLNSMLSV+ R
Sbjct  23   PKPMRSSYKAPKQSPLSHRVFRRSPVALSCC-VETMLPYHTATASALLNSMLSVSSR  78



>gb|AFK42622.1| unknown [Medicago truncatula]
Length=91

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KP+ + S FRIP Q  ++ RI R P+E+S   VE++LPYHTATA ALL SMLSV+  S G
Sbjct  23   KPRPTCSMFRIPKQTSISNRISRLPVEMSSG-VESLLPYHTATASALLTSMLSVSRHSYG  81

Query  301  WSLED  287
            W+ E 
Sbjct  82   WTPEG  86



>ref|XP_003540376.1| PREDICTED: uncharacterized protein LOC100788648 isoformX2 [Glycine 
max]
Length=95

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGW  87



>ref|XP_003540375.1| PREDICTED: uncharacterized protein LOC100788648 isoformX1 [Glycine 
max]
 ref|XP_006592847.1| PREDICTED: uncharacterized protein LOC100788648 isoform X4 [Glycine 
max]
 ref|XP_006592848.1| PREDICTED: uncharacterized protein LOC100788648 isoform X5 [Glycine 
max]
 ref|XP_006592849.1| PREDICTED: uncharacterized protein LOC100788648 isoform X6 [Glycine 
max]
Length=96

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGW  87



>ref|XP_006592850.1| PREDICTED: uncharacterized protein LOC100788648 isoform X7 [Glycine 
max]
 ref|XP_006592852.1| PREDICTED: uncharacterized protein LOC100788648 isoform X9 [Glycine 
max]
 ref|XP_006592853.1| PREDICTED: uncharacterized protein LOC100788648 isoform X10 [Glycine 
max]
Length=92

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGW  87



>ref|XP_006594839.1| PREDICTED: uncharacterized protein LOC100777625 isoform X7 [Glycine 
max]
Length=123

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+ + +PL+    R P+ELS   VE+MLPYHTATA AL+ SMLSV+  S G
Sbjct  56   EAKAARSPFRVASNQPLSQSTLRCPVELSFC-VESMLPYHTATASALMTSMLSVSRHSYG  114

Query  301  W  299
            W
Sbjct  115  W  115



>ref|XP_004485826.1| PREDICTED: uncharacterized protein LOC101505154 isoform X12 [Cicer 
arietinum]
 ref|XP_004485827.1| PREDICTED: uncharacterized protein LOC101505154 isoform X13 [Cicer 
arietinum]
Length=90

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            S F+IP Q  ++ RI R P+E+SC  VE++LPYHTATA ALL SMLSV+  S GW+ E 
Sbjct  32   SMFQIPKQSSISNRISRLPVEMSC-GVESLLPYHTATASALLTSMLSVSRHSYGWTPEG  89



>ref|XP_004485816.1| PREDICTED: uncharacterized protein LOC101505154 isoform X2 [Cicer 
arietinum]
 ref|XP_004485817.1| PREDICTED: uncharacterized protein LOC101505154 isoform X3 [Cicer 
arietinum]
 ref|XP_004485818.1| PREDICTED: uncharacterized protein LOC101505154 isoform X4 [Cicer 
arietinum]
 ref|XP_004485819.1| PREDICTED: uncharacterized protein LOC101505154 isoform X5 [Cicer 
arietinum]
 ref|XP_004485823.1| PREDICTED: uncharacterized protein LOC101505154 isoform X9 [Cicer 
arietinum]
Length=94

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            S F+IP Q  ++ RI R P+E+SC  VE++LPYHTATA ALL SMLSV+  S GW+ E 
Sbjct  32   SMFQIPKQSSISNRISRLPVEMSC-GVESLLPYHTATASALLTSMLSVSRHSYGWTPEG  89



>ref|XP_008459321.1| PREDICTED: uncharacterized protein LOC103498488 isoform X1 [Cucumis 
melo]
Length=95

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            SPFRI +++P +   FR P+E+S   VE+MLP+H+AT+ AL+ SMLSV+P S GW
Sbjct  32   SPFRIASKRPFSHSSFRIPIEMSFC-VESMLPFHSATSSALMTSMLSVSPHSYGW  85



>ref|XP_006594840.1| PREDICTED: uncharacterized protein LOC100777625 isoform X8 [Glycine 
max]
 ref|XP_003543328.2| PREDICTED: uncharacterized protein LOC100777625 isoformX2 [Glycine 
max]
 ref|XP_006594842.1| PREDICTED: uncharacterized protein LOC100777625 isoform X10 [Glycine 
max]
Length=120

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+ + +PL+    R P+ELS   VE+MLPYHTATA AL+ SMLSV+  S G
Sbjct  56   EAKAARSPFRVASNQPLSQSTLRCPVELSFC-VESMLPYHTATASALMTSMLSVSRHSYG  114

Query  301  W  299
            W
Sbjct  115  W  115



>ref|XP_006594835.1| PREDICTED: uncharacterized protein LOC100777625 isoform X3 [Glycine 
max]
 ref|XP_006594836.1| PREDICTED: uncharacterized protein LOC100777625 isoform X4 [Glycine 
max]
 ref|XP_006594837.1| PREDICTED: uncharacterized protein LOC100777625 isoform X5 [Glycine 
max]
Length=124

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K + SPFR+ + +PL+    R P+ELS   VE+MLPYHTATA AL+ SMLSV+  S G
Sbjct  56   EAKAARSPFRVASNQPLSQSTLRCPVELSFC-VESMLPYHTATASALMTSMLSVSRHSYG  114

Query  301  W  299
            W
Sbjct  115  W  115



>ref|XP_010035779.1| PREDICTED: uncharacterized protein LOC104424937 isoform X1 [Eucalyptus 
grandis]
 gb|KCW47246.1| hypothetical protein EUGRSUZ_K01049 [Eucalyptus grandis]
Length=95

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  445  TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            T +PL+ RIFRSP+E+S    ETMLPYHTAT+ AL+ SMLS+  RS GW
Sbjct  39   TNRPLSHRIFRSPVEMSAC-AETMLPYHTATSSALMTSMLSITRRSYGW  86



>emb|CDP20531.1| unnamed protein product [Coffea canephora]
Length=93

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            K K S SPFR P+ KPL+ RIFR P+ELS   +++M PYH+ATA +L+ S L+V+    G
Sbjct  29   KSKPSTSPFRSPSSKPLSRRIFRRPVELSAC-LDSMQPYHSATASSLMISNLTVSRCGYG  87

Query  301  WSLED  287
            W  ED
Sbjct  88   WLFED  92



>ref|XP_010035783.1| PREDICTED: uncharacterized protein LOC104424937 isoform X4 [Eucalyptus 
grandis]
 ref|XP_010035784.1| PREDICTED: uncharacterized protein LOC104424937 isoform X4 [Eucalyptus 
grandis]
 ref|XP_010035785.1| PREDICTED: uncharacterized protein LOC104424937 isoform X4 [Eucalyptus 
grandis]
 gb|KCW47247.1| hypothetical protein EUGRSUZ_K01049 [Eucalyptus grandis]
 gb|KCW47248.1| hypothetical protein EUGRSUZ_K01049 [Eucalyptus grandis]
Length=91

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  445  TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            T +PL+ RIFRSP+E+S    ETMLPYHTAT+ AL+ SMLS+  RS GW
Sbjct  39   TNRPLSHRIFRSPVEMSAC-AETMLPYHTATSSALMTSMLSITRRSYGW  86



>ref|XP_008229020.1| PREDICTED: uncharacterized protein LOC103328405 [Prunus mume]
Length=59

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  442  QKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLEDCNDD  275
            ++P ++   RSP+ELS   VE+MLPYHTATA AL+ SMLS+  RS GW  E CNDD
Sbjct  4    KRPSSSPALRSPVELSFC-VESMLPYHTATASALMTSMLSITRRSYGWLPEACNDD  58



>gb|KHN27907.1| hypothetical protein glysoja_007639 [Glycine soja]
Length=99

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  475  KTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            K + SPFR+ + KPL+    R P+ELS   VE+MLPYH+ATA AL+ SMLSV+  S GW
Sbjct  30   KAARSPFRVASNKPLSQSTLRCPVELSFC-VESMLPYHSATASALMTSMLSVSRHSYGW  87



>ref|XP_010274636.1| PREDICTED: uncharacterized protein LOC104609909 isoform X2 [Nelumbo 
nucifera]
Length=98

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAP-RSR  305
            + K + SP  I  +KP + R FRSP+E+S   VE++LPYHTATA ALL SMLSV+  R  
Sbjct  29   EAKAARSPCGILKRKPHSNRFFRSPVEMSFC-VESLLPYHTATASALLTSMLSVSHRRDY  87

Query  304  GWSLEDCNDD  275
             W  E C DD
Sbjct  88   NWLSEACKDD  97



>ref|XP_010035786.1| PREDICTED: uncharacterized protein LOC104424937 isoform X5 [Eucalyptus 
grandis]
 gb|KCW47244.1| hypothetical protein EUGRSUZ_K01049 [Eucalyptus grandis]
Length=91

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  445  TQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            T +PL+ RIFRSP+E+S    ETMLPYHTAT+ AL+ SMLS+  RS GW
Sbjct  39   TNRPLSHRIFRSPVEMSAC-AETMLPYHTATSSALMTSMLSITRRSYGW  86



>ref|XP_009759398.1| PREDICTED: uncharacterized protein LOC104211950 isoform X1 [Nicotiana 
sylvestris]
Length=93

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            + K +  PFR  ++ PL+ RIFR P ELS   VE++ PYHTATA AL+ SML+ + RS  
Sbjct  25   EAKAARPPFRKASRTPLSNRIFRCPAELSAC-VESLQPYHTATASALMTSMLTDSLRSYS  83

Query  301  WSLEDCNDD  275
            W  E C++D
Sbjct  84   WLSEVCDND  92



>ref|XP_004485815.1| PREDICTED: uncharacterized protein LOC101505154 isoform X1 [Cicer 
arietinum]
Length=113

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGWSLED  287
            S F+IP Q  ++ RI R P+E+SC  VE++LPYHTATA ALL SMLSV+  S GW+ E 
Sbjct  32   SMFQIPKQSSISNRISRLPVEMSC-GVESLLPYHTATASALLTSMLSVSRHSYGWTPEG  89



>ref|XP_006372742.1| hypothetical protein POPTR_0017s04630g [Populus trichocarpa]
 ref|XP_006372743.1| hypothetical protein POPTR_0017s04630g [Populus trichocarpa]
 gb|ERP50539.1| hypothetical protein POPTR_0017s04630g [Populus trichocarpa]
 gb|ERP50540.1| hypothetical protein POPTR_0017s04630g [Populus trichocarpa]
Length=95

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = -2

Query  481  KPKTSGSPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRG  302
            KPK S       T KP+   + RSP+E+S   VE+M+PYHT TA AL+ SMLS++  S G
Sbjct  30   KPKASPFGLNSTTSKPI---LRRSPVEMS-FAVESMMPYHTVTASALMTSMLSISRCSCG  85

Query  301  WSLEDCNDD  275
            W LE CNDD
Sbjct  86   WLLEACNDD  94



>ref|XP_004148697.1| PREDICTED: uncharacterized protein LOC101214029 isoform 1 [Cucumis 
sativus]
Length=95

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            SPFRI +++P +   FR P+ELS   VE+MLP+H+AT+ AL+ SMLSV+P S GW
Sbjct  32   SPFRIASKRPFSHCSFRLPIELSFC-VESMLPFHSATSSALMTSMLSVSPHSFGW  85



>ref|XP_004170261.1| PREDICTED: uncharacterized protein LOC101225805, partial [Cucumis 
sativus]
Length=88

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  463  SPFRIPTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPRSRGW  299
            SPFRI +++P +   FR P+ELS   VE+MLP+H+AT+ AL+ SMLSV+P S GW
Sbjct  32   SPFRIASKRPFSHCSFRLPIELSFC-VESMLPFHSATSSALMTSMLSVSPHSFGW  85



>ref|XP_002517865.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44383.1| conserved hypothetical protein [Ricinus communis]
Length=99

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 4/71 (6%)
 Frame = -2

Query  481  KPK--TSGSPFRI-PTQKPLTARIFRSPLELSCVRVETMLPYHTATACALLNSMLSVAPR  311
            KP+  TS SPFR     KPL+  I R P+E+S   VE+M+PYHT TA AL+ SMLS++  
Sbjct  28   KPRAPTSASPFRNSANNKPLSQSILRRPVEMSFA-VESMMPYHTVTASALMTSMLSISRG  86

Query  310  SRGWSLEDCND  278
            S GW LE  ++
Sbjct  87   SYGWLLEGRDE  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 814135294960