BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2147_g1_i1 len=1132 path=[1:0-361 363:362-1131]

Length=1132
                                                                      Score     E

ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    371   9e-124   
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    371   1e-123   
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    365   1e-121   
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    364   3e-121   
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    363   1e-120   
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    360   8e-120   
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                357   2e-118   
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                356   3e-118   
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                352   2e-116   
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                348   4e-115   
emb|CDP21121.1|  unnamed protein product                                346   3e-114   
gb|EPS64389.1|  hypothetical protein M569_10392                         342   4e-113   
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    343   6e-113   
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    342   2e-112   
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    342   3e-112   
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    340   1e-111   
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    338   7e-111   
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    336   4e-110   
emb|CDP21733.1|  unnamed protein product                                334   7e-110   
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    335   8e-110   
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    334   2e-109   
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    333   7e-109   
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    331   4e-108   
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    331   4e-108   
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    330   9e-108   
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    330   1e-107   
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    328   3e-107   
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    328   4e-107   
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    328   5e-107   
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    326   4e-106   
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    326   4e-106   
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    325   6e-106   
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    325   6e-106   
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    332   1e-105   
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      324   2e-105   
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    324   2e-105   
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    332   1e-104   
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    321   3e-104   
gb|ACV71016.1|  UPA16                                                   322   3e-104   Capsicum annuum
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    320   8e-104   
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    319   1e-103   
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    319   2e-103   
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    319   2e-103   
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    318   2e-103   
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    318   6e-103   
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    317   7e-103   Vitis vinifera
emb|CAN71371.1|  hypothetical protein VITISV_023352                     317   9e-103   Vitis vinifera
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    317   2e-102   
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    312   5e-101   
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    313   5e-101   
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    312   9e-101   
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    310   8e-100   
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            307   7e-99    
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    305   3e-98    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    298   4e-95    
emb|CDP21120.1|  unnamed protein product                                295   1e-94    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    295   2e-94    
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             295   3e-94    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    294   9e-94    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             293   2e-93    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    292   5e-93    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    290   3e-92    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    290   4e-92    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          287   3e-91    
ref|XP_002511128.1|  conserved hypothetical protein                     287   3e-91    Ricinus communis
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    287   5e-91    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    286   1e-90    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    286   2e-90    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    284   5e-90    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    283   1e-89    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    281   2e-89    
ref|XP_002321730.2|  N3 like family protein                             282   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    282   3e-89    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    283   3e-89    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    282   4e-89    
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    281   1e-88    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    281   2e-88    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    280   2e-88    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    280   3e-88    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      280   4e-88    
ref|XP_002511126.1|  conserved hypothetical protein                     279   7e-88    Ricinus communis
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    278   9e-88    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 277   1e-87    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            279   1e-87    
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             278   1e-87    
ref|XP_002321731.1|  N3 like family protein                             278   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    277   2e-87    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    278   3e-87    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      277   3e-87    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    277   3e-87    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    277   3e-87    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    276   4e-87    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             276   4e-87    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    276   6e-87    Vitis vinifera
emb|CDX84877.1|  BnaA03g13530D                                          276   6e-87    
ref|XP_002511127.1|  conserved hypothetical protein                     276   7e-87    Ricinus communis
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    276   8e-87    
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    276   8e-87    
ref|NP_001237418.1|  N3 protein                                         275   9e-87    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    276   9e-87    
emb|CBI32263.3|  unnamed protein product                                278   1e-86    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    276   1e-86    
ref|XP_002322281.2|  N3 like family protein                             276   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    275   1e-86    
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    276   2e-86    
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    275   2e-86    
ref|XP_007050795.1|  Medicago truncatula MTN3                           275   3e-86    
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    273   5e-86    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    274   6e-86    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    274   6e-86    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    273   7e-86    
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    276   7e-86    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             274   8e-86    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    273   9e-86    
gb|ACU23483.1|  unknown                                                 272   1e-85    Glycine max [soybeans]
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    273   1e-85    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               272   1e-85    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    273   1e-85    
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    273   1e-85    
ref|XP_002865823.1|  nodulin MtN3 family protein                        273   1e-85    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    273   2e-85    
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    273   2e-85    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    272   2e-85    
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    273   2e-85    
emb|CDY69440.1|  BnaCnng63490D                                          270   3e-85    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    272   3e-85    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               272   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             271   4e-85    Populus trichocarpa [western balsam poplar]
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             271   4e-85    Populus trichocarpa [western balsam poplar]
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   270   4e-85    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    272   4e-85    
ref|XP_002514863.1|  conserved hypothetical protein                     271   5e-85    Ricinus communis
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      272   5e-85    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    271   5e-85    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    271   6e-85    
ref|NP_001067955.1|  Os11g0508600                                       272   7e-85    Oryza sativa Japonica Group [Japonica rice]
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    271   7e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    271   1e-84    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    271   1e-84    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    272   1e-84    
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    272   1e-84    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    270   1e-84    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    271   1e-84    
gb|AFK47472.1|  unknown                                                 270   1e-84    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             270   1e-84    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    271   2e-84    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    270   2e-84    
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    269   3e-84    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             269   3e-84    Populus trichocarpa [western balsam poplar]
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             269   3e-84    
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    268   4e-84    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               268   7e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    268   1e-83    
ref|NP_196821.1|  senescence-associated protein 29                      268   2e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AFK48645.1|  unknown                                                 266   2e-83    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    268   2e-83    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    266   3e-83    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             267   3e-83    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    266   5e-83    Petunia x hybrida [garden petunia]
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             266   6e-83    
gb|AAM65389.1|  senescence-associated protein (SAG29)                   266   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    267   6e-83    
emb|CDX77928.1|  BnaC03g52910D                                          266   6e-83    
gb|AGL98401.1|  sucrose transporter SWEET9                              266   7e-83    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    265   7e-83    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    267   7e-83    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               265   9e-83    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 266   9e-83    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    265   1e-82    
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             264   1e-82    
emb|CDX88041.1|  BnaA06g26320D                                          265   1e-82    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    265   1e-82    
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         265   1e-82    
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    264   2e-82    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    265   2e-82    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    264   2e-82    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          265   2e-82    Sorghum bicolor [broomcorn]
emb|CDY05867.1|  BnaC08g20440D                                          265   3e-82    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    264   3e-82    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    264   3e-82    
emb|CDX80379.1|  BnaC07g30650D                                          264   3e-82    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    264   4e-82    
emb|CDY08093.1|  BnaA06g16330D                                          264   4e-82    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    264   4e-82    
emb|CDX83046.1|  BnaA01g20460D                                          264   5e-82    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             265   5e-82    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         263   6e-82    
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 264   6e-82    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               263   6e-82    
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    264   7e-82    
emb|CDX87161.1|  BnaC09g04760D                                          263   7e-82    
ref|NP_001149028.1|  LOC100282648                                       264   9e-82    Zea mays [maize]
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    263   9e-82    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             263   9e-82    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    262   1e-81    
ref|NP_001131289.1|  mtN3-like protein                                  263   1e-81    Zea mays [maize]
ref|XP_002873602.1|  nodulin MtN3 family protein                        263   1e-81    
ref|XP_002877629.1|  nodulin MtN3 family protein                        263   1e-81    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      262   2e-81    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    262   2e-81    
ref|XP_002511125.1|  conserved hypothetical protein                     262   2e-81    Ricinus communis
dbj|BAJ85621.1|  predicted protein                                      262   2e-81    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    262   3e-81    
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      261   4e-81    
emb|CDY16863.1|  BnaA09g05190D                                          261   4e-81    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    263   4e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    262   4e-81    
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    261   4e-81    
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      261   4e-81    Vitis vinifera
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    261   5e-81    
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                262   5e-81    
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         261   5e-81    
gb|KEH21559.1|  bidirectional sugar transporter                         260   6e-81    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    261   6e-81    
emb|CDX68492.1|  BnaC01g25700D                                          261   6e-81    
dbj|BAJ94651.1|  predicted protein                                      261   8e-81    
ref|NP_001046944.1|  Os02g0513100                                       262   8e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    261   8e-81    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 261   9e-81    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-80    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-80    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    260   1e-80    
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-80    
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    261   1e-80    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          261   1e-80    Sorghum bicolor [broomcorn]
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         260   1e-80    
emb|CDX91144.1|  BnaC02g04530D                                          260   1e-80    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    259   2e-80    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         260   2e-80    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             260   2e-80    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    259   2e-80    
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               259   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    259   2e-80    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             258   2e-80    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             259   3e-80    
ref|XP_007043874.1|  Senescence-associated gene 29                      259   3e-80    
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    258   3e-80    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         259   3e-80    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    258   3e-80    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         259   4e-80    
emb|CDP03543.1|  unnamed protein product                                258   4e-80    
ref|NP_001132836.1|  hypothetical protein                               261   5e-80    Zea mays [maize]
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             259   5e-80    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               258   5e-80    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    258   5e-80    
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             258   5e-80    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   258   6e-80    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    257   6e-80    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    257   7e-80    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    259   7e-80    
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             258   1e-79    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             257   1e-79    
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         258   1e-79    
emb|CDX85668.1|  BnaA02g01450D                                          258   1e-79    
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      258   1e-79    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 258   2e-79    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             257   2e-79    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    257   2e-79    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             256   2e-79    
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 261   2e-79    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    256   2e-79    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    257   3e-79    
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    256   3e-79    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    257   3e-79    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    257   3e-79    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    256   3e-79    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    257   3e-79    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    256   3e-79    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    256   3e-79    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          257   4e-79    Sorghum bicolor [broomcorn]
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    256   4e-79    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    256   4e-79    
emb|CDX97233.1|  BnaC09g43920D                                          257   4e-79    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    256   4e-79    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    256   5e-79    
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          258   5e-79    Sorghum bicolor [broomcorn]
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    256   5e-79    
gb|KHN24976.1|  Bidirectional sugar transporter N3                      256   5e-79    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    258   5e-79    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    256   6e-79    
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    256   8e-79    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    256   8e-79    
gb|EAY83053.1|  hypothetical protein OsI_38270                          256   8e-79    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      255   8e-79    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    254   9e-79    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    256   9e-79    
dbj|BAJ99068.1|  predicted protein                                      256   9e-79    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    255   9e-79    
ref|XP_002520679.1|  conserved hypothetical protein                     255   1e-78    
emb|CAC44123.1|  N3 like protein                                        254   1e-78    
gb|KEH20983.1|  bidirectional sugar transporter                         254   1e-78    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         255   1e-78    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    254   1e-78    
emb|CDX69663.1|  BnaA10g20120D                                          255   1e-78    
emb|CDX92666.1|  BnaC07g39240D                                          254   2e-78    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    254   2e-78    
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      256   2e-78    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         254   2e-78    
emb|CDY24854.1|  BnaA08g14560D                                          253   3e-78    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                254   3e-78    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    253   4e-78    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   253   5e-78    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         254   5e-78    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    254   5e-78    
ref|NP_001149087.1|  MTN3                                               254   5e-78    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    255   5e-78    
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    253   6e-78    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                252   6e-78    
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    253   6e-78    
gb|AHL43546.1|  nodule-specific sucrose transporter                     253   6e-78    
gb|AFK35161.1|  unknown                                                 252   7e-78    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    252   9e-78    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    252   1e-77    
emb|CDX78511.1|  BnaA03g04230D                                          253   1e-77    
ref|NP_001141106.1|  uncharacterized protein LOC100273190               253   1e-77    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    252   1e-77    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    252   2e-77    
gb|ACG28570.1|  MTN3                                                    253   2e-77    
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          253   2e-77    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       251   2e-77    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 254   2e-77    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    253   2e-77    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             251   2e-77    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      251   3e-77    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    252   3e-77    
emb|CDY03395.1|  BnaC01g16870D                                          251   3e-77    
emb|CDY34333.1|  BnaA01g14360D                                          251   3e-77    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    251   4e-77    
emb|CDP13388.1|  unnamed protein product                                251   4e-77    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    252   4e-77    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 252   5e-77    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 258   5e-77    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    251   5e-77    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      250   6e-77    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    250   6e-77    
ref|NP_001141654.1|  hypothetical protein                               250   1e-76    
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    249   2e-76    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    249   2e-76    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    249   2e-76    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    249   2e-76    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    249   2e-76    
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    250   3e-76    
emb|CDY53626.1|  BnaC03g71480D                                          249   3e-76    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    248   3e-76    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    249   3e-76    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    249   3e-76    
dbj|BAK04274.1|  predicted protein                                      249   4e-76    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    249   4e-76    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    249   6e-76    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         246   6e-76    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             248   6e-76    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      249   6e-76    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             248   7e-76    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    248   7e-76    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    248   8e-76    
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      248   9e-76    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    246   1e-75    
emb|CDP09549.1|  unnamed protein product                                247   1e-75    
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             247   1e-75    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 246   2e-75    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              247   3e-75    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         247   4e-75    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     245   4e-75    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    246   4e-75    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               246   5e-75    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    245   5e-75    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    244   6e-75    
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      245   6e-75    
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      246   7e-75    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    245   9e-75    
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    245   9e-75    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 245   1e-74    
gb|EMS67211.1|  Bidirectional sugar transporter SWEET12                 246   1e-74    
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    244   1e-74    
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    244   1e-74    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             244   1e-74    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 245   1e-74    
ref|XP_002867630.1|  nodulin MtN3 family protein                        244   2e-74    
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    244   2e-74    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      243   2e-74    
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             243   3e-74    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    243   4e-74    
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    244   4e-74    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    243   4e-74    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     242   4e-74    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    243   4e-74    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    242   6e-74    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   244   6e-74    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    243   7e-74    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     242   8e-74    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    243   8e-74    
gb|AFK39311.1|  unknown                                                 241   2e-73    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    240   2e-73    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    241   2e-73    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             242   2e-73    
gb|KEH21448.1|  bidirectional sugar transporter                         241   2e-73    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    242   2e-73    
ref|NP_001050099.1|  Os03g0347500                                       241   3e-73    
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 243   4e-73    
gb|EYU24137.1|  hypothetical protein MIMGU_mgv1a022637mg                237   4e-73    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    241   4e-73    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     240   4e-73    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    238   5e-73    
gb|EYU43028.1|  hypothetical protein MIMGU_mgv1a019383mg                236   7e-73    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    240   7e-73    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    239   8e-73    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    239   9e-73    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    240   1e-72    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    239   1e-72    
sp|A2XGM7.1|SWT12_ORYSI  RecName: Full=Bidirectional sugar transp...    240   1e-72    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    240   1e-72    
ref|XP_010322967.1|  PREDICTED: bidirectional sugar transporter S...    238   2e-72    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             239   3e-72    
dbj|BAK07340.1|  predicted protein                                      238   3e-72    
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    237   4e-72    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 238   4e-72    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 240   4e-72    
gb|EPS72542.1|  hypothetical protein M569_02215                         236   5e-72    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    238   6e-72    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    238   6e-72    
gb|AAM65058.1|  MtN3-like protein                                       238   6e-72    
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-72    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    238   6e-72    
emb|CDX71659.1|  BnaC09g27000D                                          238   7e-72    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    238   8e-72    
emb|CDP14988.1|  unnamed protein product                                236   1e-71    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               237   1e-71    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    238   1e-71    
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          238   1e-71    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-71    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             233   2e-71    
ref|XP_002862913.1|  nodulin MtN3 family protein                        236   2e-71    
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    235   3e-71    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    236   3e-71    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         235   4e-71    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         235   5e-71    
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    234   6e-71    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              235   6e-71    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    234   1e-70    
ref|XP_006651370.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-70    
ref|XP_002865824.1|  nodulin MtN3 family protein                        234   2e-70    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    234   3e-70    
emb|CBI15715.3|  unnamed protein product                                233   3e-70    
emb|CDY70861.1|  BnaCnng70080D                                          230   3e-70    
ref|XP_010045484.1|  PREDICTED: bidirectional sugar transporter S...    231   5e-70    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    231   5e-70    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             232   6e-70    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    233   7e-70    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69    
ref|XP_002267792.1|  PREDICTED: bidirectional sugar transporter NEC1    231   2e-69    
gb|EEE59052.1|  hypothetical protein OsJ_10824                          249   2e-69    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-69    
ref|NP_001136928.1|  hypothetical protein                               232   2e-69    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    230   2e-69    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-69    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    231   3e-69    
gb|AFK36312.1|  unknown                                                 230   4e-69    
ref|XP_002881628.1|  nodulin MtN3 family protein                        229   5e-69    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    229   1e-68    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             229   1e-68    
gb|AAM63257.1|  similar to MtN3 protein                                 228   2e-68    
gb|KHN47229.1|  Bidirectional sugar transporter NEC1-like protein       227   2e-68    
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                228   2e-68    
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    227   2e-68    
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                227   2e-68    
gb|ACJ84828.1|  unknown                                                 228   3e-68    
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             227   3e-68    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    226   5e-68    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    227   7e-68    
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     226   9e-68    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-67    
gb|EYU34244.1|  hypothetical protein MIMGU_mgv1a022710mg                225   1e-67    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      226   1e-67    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    226   2e-67    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             224   7e-67    
gb|KCW83110.1|  hypothetical protein EUGRSUZ_B00066                     223   8e-67    
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-66    
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    221   1e-66    
ref|XP_003561640.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-66    
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    222   3e-66    
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    221   4e-66    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         223   9e-66    
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-65    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     221   1e-65    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    221   1e-65    
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    221   1e-65    
gb|EAZ09693.1|  hypothetical protein OsI_31976                          221   1e-65    
emb|CDY08964.1|  BnaC08g11940D                                          221   2e-65    
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          221   2e-65    
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 220   3e-65    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    221   9e-65    
ref|XP_006371147.1|  hypothetical protein POPTR_0019s04590g             217   1e-64    
gb|KDP32879.1|  hypothetical protein JCGZ_12171                         218   1e-64    
ref|XP_008661142.1|  PREDICTED: bidirectional sugar transporter S...    218   3e-64    
ref|NP_001149496.1|  MTN3                                               218   3e-64    
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    216   6e-64    
gb|AFW88409.1|  hypothetical protein ZEAMMB73_649491                    218   6e-64    
ref|XP_006388397.1|  hypothetical protein POPTR_0198s00220g             214   2e-63    



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   371 bits (952),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 211/254 (83%), Gaps = 6/254 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNIVSFMVYLAPVPTF KIYKKKSTEG+QSVPYVVGLFSAMLWIYYAFL P
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            DTTLLITINSVGCFIQT YI FFLFYATKKAK+DTMK LL +NV G GLII +TQF AK 
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQFFAKG  123

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+RA IVGWICL+F+ CVFVAPL ++RQVI+TKSVEYMPF LSFFLTLSAVMWF YGLL
Sbjct  124  -SNRAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLYGLL  182

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            RKDYNIAIPN+LGF  G++QM LY++YKN KK   T E KL         D  E K+ EE
Sbjct  183  RKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK--VTKEVKLEVTEIV--ADDKELKLSEE  238

Query  819  -LKEQVIDVVKLSA  857
             LK+Q+IDVVKLSA
Sbjct  239  ILKDQIIDVVKLSA  252



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 215/254 (85%), Gaps = 7/254 (3%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNIVSFMVYLAPVPTF KIYKKKSTEG+QSVPYVVGLFSAMLWIYYAFL P
Sbjct  4    HLAFVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  63

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            DTTLLITINSVGCFIQT YI FFLFYATKKAK+DT+K LL +NV G GLIIL+TQF +K 
Sbjct  64   DTTLLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQFFSKG  123

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+RA IVGWICL+F+ CVFVAPL ++RQVI++KSVEYMPF LSFFLTLSAVMWFFYGLL
Sbjct  124  -SNRAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLL  182

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            RKDYNIAIPN+LGF  G++QM LY++YKN KK   T E +L EN      +  E K+ EE
Sbjct  183  RKDYNIAIPNVLGFSLGVIQMTLYLIYKNAKK--VTKEVRL-ENTETVVDE--ELKLSEE  237

Query  819  -LKEQVIDVVKLSA  857
             LKEQ+IDVVKLSA
Sbjct  238  MLKEQIIDVVKLSA  251



>ref|XP_011073105.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=290

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/256 (72%), Positives = 215/256 (84%), Gaps = 5/256 (2%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            +  +L F FGLLGNI+SFMV+LAP+PTF +IYK+KSTEG+QS+PYVVGLFSAML IYYAF
Sbjct  1    MSANLAFVFGLLGNIISFMVFLAPIPTFYQIYKRKSTEGFQSLPYVVGLFSAMLLIYYAF  60

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L PD+TLLITINS GCFI+T YI F+LFYA K A++ T   LLLLNV G GLI+++T F+
Sbjct  61   LLPDSTLLITINSFGCFIETLYICFYLFYAPKTARLQTATLLLLLNVVGMGLIVVLTHFL  120

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            AKD S+RAHIVGWICLVF++ VFVAPLC+VRQVI+TKSVEYMPFLLSFFLTLSAVMWFFY
Sbjct  121  AKD-STRAHIVGWICLVFSVSVFVAPLCVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFY  179

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLLRKDYNIAIPNILGFIFG+LQM LY+VYKN KK     ++KLPE        Q    +
Sbjct  180  GLLRKDYNIAIPNILGFIFGVLQMALYLVYKNAKK---AIQEKLPEIIEMEEEKQ-NNTI  235

Query  810  PEELKEQVIDVVKLSA  857
            P ELKEQ+IDV+KLSA
Sbjct  236  PAELKEQIIDVMKLSA  251



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/254 (77%), Positives = 218/254 (86%), Gaps = 3/254 (1%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L F FGLLGNIVSFMVYLAPVPTF KI+KKKSTEG+QSVPYVVGLFSAMLWIYYAFL 
Sbjct  2    IHLAFTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
            PDTTLLITINSVGC IQ+ YI FFLFYATKKAK+DT+K LLLLN  G GLIIL+TQF+AK
Sbjct  62   PDTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAK  121

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
             +S+RA IVGWICL+F+LCVFVAPL IVRQVIKT+SVEYMPFLLSFFLTLSAVMWFFYGL
Sbjct  122  -SSNRAQIVGWICLIFSLCVFVAPLGIVRQVIKTRSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPE  815
            LRKDYNIAIPN+LGF  G+LQMVLYV+YKN KK   T E K+ E  +     +  +   +
Sbjct  181  LRKDYNIAIPNVLGFTLGVLQMVLYVIYKNAKK--VTKEVKIAEKENTVTIVEEHKLSED  238

Query  816  ELKEQVIDVVKLSA  857
            +LKEQ+IDVVKLSA
Sbjct  239  KLKEQIIDVVKLSA  252



>ref|XP_009605548.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
tomentosiformis]
Length=294

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 198/255 (78%), Positives = 219/255 (86%), Gaps = 5/255 (2%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L F FGLLGNIVSFMVYLAP PTF KIYKKKSTEG+QSVPYVVGLFSAMLWIYYAFL 
Sbjct  2    IHLAFTFGLLGNIVSFMVYLAPAPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLK  61

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
            PDTTLLITINSVGC IQ+ YI FFLFYATKKAK+DT+K LLLLN  G GLIIL+TQF+AK
Sbjct  62   PDTTLLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAK  121

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
             +S+RA IVGWICL+F+LCVFVAPL IVRQVIKT+SVEYMPFLLSFFLTLSAVMWFFYGL
Sbjct  122  -SSNRAQIVGWICLIFSLCVFVAPLGIVRQVIKTQSVEYMPFLLSFFLTLSAVMWFFYGL  180

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPE  815
            LRKDYNIAIPN+LGF  G+LQMVLYV+YKN KK   T E K+ E  +     + E K+ E
Sbjct  181  LRKDYNIAIPNVLGFTLGVLQMVLYVIYKNAKK--VTKEIKIAEKENTVTIVE-EHKLSE  237

Query  816  E-LKEQVIDVVKLSA  857
            + LKEQ+IDVVKLSA
Sbjct  238  DLLKEQIIDVVKLSA  252



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   360 bits (924),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 217/255 (85%), Gaps = 6/255 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGN+VSFMV+LAP+PTF +IYKKKSTEG+QSVPYVVGLFSAMLWIYYAFL P
Sbjct  3    QLAFVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            DTTLLITINSVGCFIQ++YI F+LF+A + A++ T+K LLLLN  G+GLI+++T F+AK 
Sbjct  63   DTTLLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAKG  122

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+RA+ VGWICLVF+LCVFVAPLC+VRQV++TKS EYMPFLLSFFLT+SA++WFFYG L
Sbjct  123  -SNRANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGFL  181

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            RKDYNIAIPN+LGFIFG+LQMVLY++Y+NGK       Q+LP  G     D  E+++P E
Sbjct  182  RKDYNIAIPNVLGFIFGVLQMVLYLIYRNGKTL-VQENQQLPA-GIIAVED--EKQLP-E  236

Query  819  LKEQVIDVVKLSAAL  863
            L++Q+IDVVKL   L
Sbjct  237  LRDQIIDVVKLQGGL  251



>gb|EYU43032.1| hypothetical protein MIMGU_mgv1a010677mg [Erythranthe guttata]
Length=305

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 218/258 (84%), Gaps = 11/258 (4%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGN++SFMV+LAP+PTF  I+KKKSTEG+QSVPYVVGLFSA LWIYYAFL P
Sbjct  32   QLAFVFGLLGNVISFMVFLAPIPTFYTIFKKKSTEGFQSVPYVVGLFSAQLWIYYAFLKP  91

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +TTLLITIN+VGCF+Q++YI F+LF+ATK A+I T+K +LLLNV G+GLII++T F A D
Sbjct  92   ETTLLITINTVGCFVQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWAND  151

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+R  IVGWICLVF+LCVFVAPL +VRQVI+TKSVEYMPFLLSFFLTLSAVMWFFYGLL
Sbjct  152  -SNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLL  210

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV----EQK  806
            RKDYNIAIPN+LGF+FG++QMVLYV+YKN KK     +QKLPE  +     Q+    E K
Sbjct  211  RKDYNIAIPNVLGFLFGVIQMVLYVMYKNPKKVVQEKKQKLPEIET-----QIIVIDENK  265

Query  807  VPEELKEQVIDVVKLSAA  860
            +P EL+EQ+IDVVKL  A
Sbjct  266  LP-ELREQIIDVVKLGGA  282



>gb|EYU43031.1| hypothetical protein MIMGU_mgv1a011488mg [Erythranthe guttata]
Length=280

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/258 (72%), Positives = 218/258 (84%), Gaps = 11/258 (4%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGN+VSFMV+LAP+PTF +I+KKKSTEG+QSVPY VGLFSAMLWIYYAFL P
Sbjct  3    QLAFVFGLLGNVVSFMVFLAPIPTFYQIFKKKSTEGFQSVPYAVGLFSAMLWIYYAFLKP  62

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +TTLLITINSVGC IQ++YI F+LF+ATK A+I T+K +LLLNV G+GLII++T F A D
Sbjct  63   ETTLLITINSVGCVIQSAYICFYLFFATKNARIQTVKLILLLNVVGFGLIIVLTHFWAND  122

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+R  +VGWICLVF+LCVFVAPL +VRQVI+TKSVEYMPFLLSFFLTLSAVMWFFYGLL
Sbjct  123  -SNRDDVVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV----EQK  806
            RKDYNIAIPN+LGF+FG++QMVLYV+YKN KK     +QKLPE  +     Q+    E K
Sbjct  182  RKDYNIAIPNVLGFMFGVIQMVLYVMYKNPKKVVQEKKQKLPEIET-----QIIVIDENK  236

Query  807  VPEELKEQVIDVVKLSAA  860
            +P ELKEQ+IDV+KL  A
Sbjct  237  LP-ELKEQIIDVMKLGGA  253



>gb|EYU43030.1| hypothetical protein MIMGU_mgv1a011435mg [Erythranthe guttata]
Length=282

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 214/257 (83%), Gaps = 2/257 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGN+VSFMV+LAP+PTF  I+KKKST+G+QSVPYVVGLFSAMLWIYYAFL P
Sbjct  3    QLAFVFGLLGNVVSFMVFLAPIPTFYTIFKKKSTQGFQSVPYVVGLFSAMLWIYYAFLKP  62

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +TTLLITIN+VGCF+Q++YI F+LF+A+K A+I T+K +LLLNV G+GLII++T F A D
Sbjct  63   ETTLLITINTVGCFVQSTYICFYLFFASKNARIQTVKLILLLNVVGFGLIIVLTHFWAND  122

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S+R  IVGWICLVF+LCVFVAPL +VRQVI+TKSVEYMPFLLSFFLTLSAVMWFFYGLL
Sbjct  123  -SNRDDIVGWICLVFSLCVFVAPLGVVRQVIRTKSVEYMPFLLSFFLTLSAVMWFFYGLL  181

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            RKDYNIAIPN+LGF+FG++QMVLYV+YKN   K+   E+K             E K+P E
Sbjct  182  RKDYNIAIPNVLGFLFGVVQMVLYVMYKNTNSKKVVKEKKEISEIETKIIVLDENKLP-E  240

Query  819  LKEQVIDVVKLSAALAL  869
            LKEQ+IDV+KL  A  L
Sbjct  241  LKEQIIDVMKLGGAAVL  257



>gb|EYU23059.1| hypothetical protein MIMGU_mgv1a019104mg [Erythranthe guttata]
Length=278

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 207/247 (84%), Gaps = 13/247 (5%)
 Frame = +3

Query  126  GNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLITIN  305
            GNIVSFMV+LAP+PTF +IYK+KS+EG+QSVPYVVGLFSAMLWIYYA L PDTTLLITIN
Sbjct  5    GNIVSFMVFLAPLPTFHQIYKRKSSEGFQSVPYVVGLFSAMLWIYYALLKPDTTLLITIN  64

Query  306  SVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHIVG  485
            SVGCFIQT+YI F+LFYA K A++ T+  + LLNV G GLI+++TQFVAK   +RA IVG
Sbjct  65   SVGCFIQTTYICFYLFYAPKSARLQTLALVFLLNVVGMGLIVVLTQFVAKGY-NRAAIVG  123

Query  486  WICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYNIAIP  665
            WICLVF+LCVF+APLC+VRQV++TKSVEYMPFLLSFFLTLSAVMWFFYGL+RKDYNIAIP
Sbjct  124  WICLVFSLCVFIAPLCVVRQVVRTKSVEYMPFLLSFFLTLSAVMWFFYGLIRKDYNIAIP  183

Query  666  NILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKEQVIDVV  845
            N+LGFIFG++QM+LYV+YKN KK     E+KL E         ++ +   ++ EQ+IDV 
Sbjct  184  NVLGFIFGVIQMMLYVMYKNTKK---VVEEKLQE---------IQMEDHHKIPEQIIDVE  231

Query  846  KLSAALA  866
            KLSA + 
Sbjct  232  KLSAVVC  238



>emb|CDP21121.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 206/257 (80%), Gaps = 14/257 (5%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNIVSFMVYLAP+PTF  IYKKKSTEG+QSVPYVVGLFSAML IYYAFL P
Sbjct  3    QLAFIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFLKP  62

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            DTTL ITINSVGCF QT Y+ ++LFYA ++A+I T K L LL V G+G IIL+TQ ++  
Sbjct  63   DTTLRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLSTG  122

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
              +RA IVGWI LV +LCVFVAPL IVRQVI TKSVEYMPFL SFFLTLSA+MWFFYG L
Sbjct  123  -KTRARIVGWIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFL  181

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV----EQK  806
            R+DYNIAIPNILGF FGILQMVLY++YKN KK     EQKLPE       +QV    E K
Sbjct  182  RQDYNIAIPNILGFFFGILQMVLYLIYKNAKK---AVEQKLPEI-----QNQVIVLEEHK  233

Query  807  VPEELKEQVIDVVKLSA  857
            +P EL+EQVI+VVKLSA
Sbjct  234  LP-ELQEQVIEVVKLSA  249



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 209/257 (81%), Gaps = 18/257 (7%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGN +SFMV+LAP+PTF KIYKKKSTEG+Q VPY+VGLFSAMLWIYYAFL P
Sbjct  2    QLAFVFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLKP  61

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            DTTLL+TINSVGCF Q+ YI F+L++++KK ++ T K L +LNV  +G+II +T+FV   
Sbjct  62   DTTLLVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVV-S  120

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S +A +VGWICLVF+LCVFVAPLC+VRQVI+TKSVE MPFLLSFFLTLSAVMWFFYGLL
Sbjct  121  PSQQASVVGWICLVFSLCVFVAPLCVVRQVIRTKSVECMPFLLSFFLTLSAVMWFFYGLL  180

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            RKDYNIA+PN+LGFIFG+LQM+LY++Y+  K  E +A++KLP                 E
Sbjct  181  RKDYNIALPNVLGFIFGVLQMLLYMMYR--KVDEDSAKKKLPL---------------PE  223

Query  819  LKEQVIDVVKLSAALAL  869
            L++Q++D VKL++A+A+
Sbjct  224  LQDQILDAVKLNSAIAV  240



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   343 bits (881),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 210/257 (82%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINS GCFI+T Y+ F+LFYA KKA++ T+K LLL  VGG+G+I+L+TQF+ K  +
Sbjct  69   TLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   VGWICLVF+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQKVPE  815
            D NIAIPN+LGFI GI QMVLY++Y N K+K +  EQKLPE   N      +   QK+PE
Sbjct  188  DINIAIPNVLGFILGIFQMVLYIIY-NKKEKANLKEQKLPEKIQNHVIIVDENNSQKLPE  246

Query  816  ELKEQVIDVVKLSAALA  866
              +E++ID+VKL + ++
Sbjct  247  LTEERIIDIVKLGSLIS  263



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/257 (68%), Positives = 210/257 (82%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINS GCFI+T Y+SF+LFYA KKA++ T+K L+L  VGG+G I+L+TQF+ K  +
Sbjct  69   TLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   VGWICLVF+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLP---ENGSCGGGDQVEQKVPE  815
            D NIAIPN+LGFI GILQ+VLYV+Y N K+K    EQKLP   +N      +   QK+PE
Sbjct  188  DINIAIPNVLGFILGILQIVLYVIY-NKKEKAILKEQKLPAKIQNHVIIVDENNNQKLPE  246

Query  816  ELKEQVIDVVKLSAALA  866
              +EQ+ID+VKL + ++
Sbjct  247  LTEEQIIDIVKLGSLIS  263



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 209/257 (81%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNI+SF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINS GCFI+T Y+ F+LFYA KKA++ T+K LLL  VGG+G+I+L+TQF+ K  +
Sbjct  69   TLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   VGWICLVF+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQKVPE  815
            D NIAIPNILGFI GILQ+VLY++Y N K+K    EQKLPE   N      +   QK+PE
Sbjct  188  DINIAIPNILGFILGILQIVLYIIY-NKKEKAILKEQKLPEKIQNHVIIVDENNNQKLPE  246

Query  816  ELKEQVIDVVKLSAALA  866
              +E +ID+VKL + ++
Sbjct  247  LTEEHIIDIVKLGSLIS  263



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 210/257 (82%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLW+YYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWVYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINS GCFI+T Y+ F+LFYA KKA+I T+K L+L  VGG+G+I+L+TQF+ K  +
Sbjct  69   TLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   VGWICLVF+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQKVPE  815
            D NIAIPN+LGF+ GILQ+VLYV+Y N K+K    E+K+PE   N      D   QK+PE
Sbjct  188  DINIAIPNVLGFVLGILQIVLYVIY-NKKEKAILKEEKVPEKIQNHVIIVDDYNNQKLPE  246

Query  816  ELKEQVIDVVKLSAALA  866
              +EQ+ID+VKL + ++
Sbjct  247  LTEEQIIDIVKLGSLIS  263



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 208/257 (81%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINS GCFI+T Y+ F+LFYA KKA++ T+K LLL  VGG+G+I+L+TQF+ K  +
Sbjct  69   TLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQKVPE  815
            D NIAIPN+LGFI GI QMVLY++Y N K+K    EQKL E   N      +   QK+PE
Sbjct  188  DINIAIPNVLGFILGIFQMVLYIIY-NKKEKAILKEQKLSEKIQNHVIIVDENNNQKLPE  246

Query  816  ELKEQVIDVVKLSAALA  866
              +EQ+ID+VKL + ++
Sbjct  247  LTEEQIIDIVKLGSLIS  263



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 211/252 (84%), Gaps = 3/252 (1%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            TFAFG+LGNI+SF V+L+P+PTF  IYKKKSTEGYQS+PYVV LFSAMLWIYYAFL  +T
Sbjct  9    TFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLL+TIN+ GCFI+T Y+ F+LFYA KKA++ T+K LLLL VGG+G IILITQF+ K  +
Sbjct  69   TLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILITQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             RA IVGWICLVF+LCVFVAPLCIVRQVIKTKSVEYMPFLLS FLTLSAVMWFFYGLL K
Sbjct  128  IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE-NGSCGGGDQVEQKVPEEL  821
            D+NIAIPN+LGFIFGILQM+LYV+Y N K+K    EQ LPE        +  ++K+PE  
Sbjct  188  DFNIAIPNVLGFIFGILQMILYVMY-NKKEKVVIKEQNLPELKDHVIIIEDDKKKLPELS  246

Query  822  KEQVIDVVKLSA  857
            +EQ+I+++KL +
Sbjct  247  EEQIINIIKLGS  258



>emb|CDP21733.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   334 bits (857),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 199/248 (80%), Gaps = 14/248 (6%)
 Frame = +3

Query  126  GNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLITIN  305
            GNIVSF  YLAP+PTF  IYKKKSTEG+QSVPYVVGLF AMLWIYYAFL PDTTLLITIN
Sbjct  7    GNIVSFTDYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFRAMLWIYYAFLKPDTTLLITIN  66

Query  306  SVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHIVG  485
            SVGCF QT Y+ ++LFYA ++A+I T K L LL V G+G IIL+TQ ++    +RA IVG
Sbjct  67   SVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLSTG-KTRARIVG  125

Query  486  WICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYNIAIP  665
            WI LV +LCVFVAPL IVRQVI TKSVEYMPFL SFFLTLSA+MWFFYG LRKDYN+AIP
Sbjct  126  WIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGFLRKDYNVAIP  185

Query  666  NILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV----EQKVPEELKEQV  833
            NILGF FGILQMVLY++YKN KK     EQKLPE       +QV    E K+P EL+EQV
Sbjct  186  NILGFFFGILQMVLYLIYKNAKK---AVEQKLPEI-----QNQVMVLEEHKLP-ELQEQV  236

Query  834  IDVVKLSA  857
            I+VVKLSA
Sbjct  237  IEVVKLSA  244



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   335 bits (860),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 207/257 (81%), Gaps = 6/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKAK+ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  69   TLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVF+APL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGILQ+VLYV+Y   K+K    EQKLPE         G +  ++K+P
Sbjct  188  DINIAAPNVLGFIFGILQIVLYVIYSK-KEKAILKEQKLPEIQKPAVIVVGENMNKKKLP  246

Query  813  EELKEQVIDVVKLSAAL  863
            E  +EQ+ID+VKL+  L
Sbjct  247  ELTQEQIIDIVKLAGLL  263



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 204/256 (80%), Gaps = 2/256 (1%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNIVSF V+L+P+PTF KIY+KKSTEGYQS+PYVV LFSAMLWIYYAFL  +T
Sbjct  9    AFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYAFLKSNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS GCF++T Y+ F+LFYA KKA++ T+K LLL    G+G I+L+TQF+ K   
Sbjct  69   TLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQFLFKGV-  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFV+PLCI+RQVIKTKS EYMPF LS FLTLSAVMWFFYGLL K
Sbjct  128  VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D+NIAIPN+LGFI GILQMVLYV+Y N K++    E K PE  +       ++ +PE  +
Sbjct  188  DFNIAIPNVLGFILGILQMVLYVMY-NKKEEVIVKEHKFPELQNHVIILHNDKNLPELTE  246

Query  825  EQVIDVVKLSAALALT  872
            EQ+ID+VKL++ ++ T
Sbjct  247  EQIIDIVKLASLISCT  262



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   333 bits (853),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 174/252 (69%), Positives = 211/252 (84%), Gaps = 3/252 (1%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            TFAFG+LGNI+SF V+L+P+PTF  IYKKKSTEGYQS+PYVV LFSAMLWIYYAFL  +T
Sbjct  9    TFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLL+TIN+ GCFI+T Y+ F+LFYA KKA++ T+K LLLL VGG+G I+L+TQF+ K  +
Sbjct  69   TLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             RA IVGWICLVF+LCVFVAPLCIVRQVIKTKSVEYMPFLLS FLTLSAVMWFFYGLL K
Sbjct  128  IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE-NGSCGGGDQVEQKVPEEL  821
            D+NIAIPN+LGFIFGILQM+LYV+Y N K++    EQ LPE        +  ++K+PE  
Sbjct  188  DFNIAIPNVLGFIFGILQMILYVMY-NKKEEVVIKEQNLPELKDHVIILEDDKKKLPELS  246

Query  822  KEQVIDVVKLSA  857
            +EQ+I+++KL +
Sbjct  247  EEQIINIMKLGS  258



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 204/253 (81%), Gaps = 6/253 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF +IYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  6    AFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  65

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKA++ TMK LLL  VGG+G I+L+TQF+ K  +
Sbjct  66   TLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFLFKG-A  124

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  125  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  184

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGI+Q+VLYV+Y   K+K +  E KLPE           +  ++K+P
Sbjct  185  DINIAAPNVLGFIFGIVQIVLYVIYSK-KEKANLKEPKLPEIQKPAVIVVDENMNKKKIP  243

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+VKL
Sbjct  244  ELTQEQIIDIVKL  256



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 211/255 (83%), Gaps = 1/255 (0%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNIVSF V+L+P+PTF K+YKK STEGYQS+PYVV LFSAMLWIYYAFL  +TT
Sbjct  10   FAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWIYYAFLKTNTT  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ GCF++  Y+ F+LFYA+K+A++ T+K LLLL VGG+G I+L++QF+  + + 
Sbjct  70   LLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLVSQFLF-EGAV  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWICLV +LCVFVAPLCIV+QVIKTKSVEYMPFLLS FLTLSAVMWFFYGLL KD
Sbjct  129  RVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLLLKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
            +NIAIPN+LGFIFGILQMVLYV+Y N K++E   EQ LPE  +       ++K PE  +E
Sbjct  189  FNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPELKNHVIILHNDKKFPELSEE  248

Query  828  QVIDVVKLSAALALT  872
            Q+I++VKL + ++ T
Sbjct  249  QIIEIVKLGSLISCT  263



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 203/254 (80%), Gaps = 6/254 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKS EGYQS+PYV+ LFS+MLWIYYAFL  +T
Sbjct  10   AFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFLKTNT  69

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKA++ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  70   TLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  129  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGILQ+VLYV+Y   K+K    EQKLPE           +   +K+P
Sbjct  189  DINIAAPNVLGFIFGILQIVLYVIYSK-KEKAILKEQKLPEIQKPSVILLDENMNNKKLP  247

Query  813  EELKEQVIDVVKLS  854
            E  +EQ+ID+VKLS
Sbjct  248  ELTQEQIIDIVKLS  261



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 205/257 (80%), Gaps = 6/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF +IYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+  +LFYA KKA++ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  69   TLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGILQ+VLYV+Y   K+K    EQKLPE           +  ++K+P
Sbjct  188  DINIAAPNVLGFIFGILQIVLYVIYSK-KEKAILKEQKLPEIQKPAVIVVDENMNKKKLP  246

Query  813  EELKEQVIDVVKLSAAL  863
            E  +EQ+ID+VKL+  L
Sbjct  247  ELTQEQIIDIVKLAGLL  263



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/261 (66%), Positives = 202/261 (77%), Gaps = 13/261 (5%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYV+ LFS+MLWIYYAFL  +T
Sbjct  8    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTNT  67

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKA+I T+K L L  VGG+G IILI QF+ K   
Sbjct  68   TLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV-  126

Query  465  SRAHIVGWICLVFALCVFVAPLCIV-----------RQVIKTKSVEYMPFLLSFFLTLSA  611
            +R  +VGW+CLVF+LCVFVAPLCIV           R+VIKTKSVEYMP LLS FLTLSA
Sbjct  127  ARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSA  186

Query  612  VMWFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGD  791
            VMWFFYGLL KD NIA PNILGFIFGILQ+VLYV+Y N K+K    EQ LPE  +     
Sbjct  187  VMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIY-NKKEKHILKEQNLPELQNHVIIL  245

Query  792  QVEQKVPEELKEQVIDVVKLS  854
               +K+PE  +EQ ID++KLS
Sbjct  246  DDNKKLPELTEEQKIDIMKLS  266



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 199/249 (80%), Gaps = 2/249 (1%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYV+ LFS+MLWIYYAFL  +T
Sbjct  8    AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTNT  67

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKA++ T+K LLL  V G+G IILI QF+ K   
Sbjct  68   TLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQFLFKGV-  126

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R  +VGW+CLVF+LCVFVAPLCIVR+VIKTKSVE+MP LLS FLTLSAVMWFFYGLL K
Sbjct  127  ARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMWFFYGLLLK  186

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D NIA PNILG IFGILQ+VLYV+Y N K+K    EQ LPE  +        +K+PE  +
Sbjct  187  DINIAAPNILGLIFGILQIVLYVIY-NKKEKHILKEQNLPELQNHVIILDDNKKLPELTE  245

Query  825  EQVIDVVKL  851
            E  ID++KL
Sbjct  246  EHKIDILKL  254



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 204/260 (78%), Gaps = 6/260 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPV----PTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
             F FG+LGNIVSF V+L+P+    PTF KIY+KKSTEGYQS+PYVV LFSAMLWIYYAFL
Sbjct  9    AFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYAFL  68

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
              +TTLLITINS GCF++T Y+ F+LFYA KKA++ T+K LLL    G+G I+L+TQF+ 
Sbjct  69   KSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQFLF  128

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
            K    R  +VGWICLVF+LCVFV+PLCI+RQVIKTKS EYMPF LS FLTLSAVMWFFYG
Sbjct  129  KGVV-RVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFYG  187

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
            LL KD+NIAIPN+LGFI GILQMVLYV+Y N K++    E K PE  +       ++ +P
Sbjct  188  LLLKDFNIAIPNVLGFILGILQMVLYVMY-NKKEEVIVKEHKFPELQNHVIILHNDKNLP  246

Query  813  EELKEQVIDVVKLSAALALT  872
            E  +EQ+ID+VKL++ ++ T
Sbjct  247  ELTEEQIIDIVKLASLISCT  266



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 201/253 (79%), Gaps = 6/253 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNI+SF+V+L+P+PTF +IYKKKSTEGYQS+PYVV LFS+MLWIYYA L  +T
Sbjct  9    AFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKAK+ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  69   TLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGILQ+VLY +Y   K+K    EQKLPE           +   +K+P
Sbjct  188  DINIAAPNVLGFIFGILQIVLYAIYSK-KEKAILKEQKLPEIQKPEVIVVDENMNSKKLP  246

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+VKL
Sbjct  247  ELTQEQIIDIVKL  259



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 202/256 (79%), Gaps = 11/256 (4%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKS EGYQS+PYV+ LFS+MLWIYYAFL  +T
Sbjct  10   AFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLWIYYAFLKTNT  69

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKA++ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  70   TLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  129  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKEST--AEQKLPENGS-----CGGGDQVEQ  803
            D NIA PN+LGFIFGILQ+VLYV+Y    KKE+    EQKLPE                +
Sbjct  189  DINIAAPNVLGFIFGILQIVLYVIY---SKKENAILKEQKLPEIQKQAVILLDENMNNNK  245

Query  804  KVPEELKEQVIDVVKL  851
            K+PE  +EQ+ID+VKL
Sbjct  246  KLPELTQEQIIDIVKL  261



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 200/253 (79%), Gaps = 6/253 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF  I+KKKSTEGYQS+PYVV LFS+MLWIYYA L  +T
Sbjct  9    AFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KKAK+ T+K LLL  VGG+G I+L+TQF+ K  +
Sbjct  69   TLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  IVGWICLVF+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG----GGDQVEQKVP  812
            D NIA PN+LGFIFGILQ+VLY +Y   K+K    EQKLPE           +   +K+P
Sbjct  188  DINIAAPNVLGFIFGILQIVLYAIYSK-KEKAILKEQKLPEIQKPAVIVVDENMNSKKLP  246

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+VKL
Sbjct  247  ELTQEQIIDIVKL  259



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 200/258 (78%), Gaps = 2/258 (1%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNIVSF V+L+P+PTF KIYKKKSTE YQS+PYVV LFSAM WIYYAFL  +T
Sbjct  9    AFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS GCFI+T Y+ F+LFYA KKA++ T+K LLL   GG+G I+L+TQ + K   
Sbjct  69   TLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGV-  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICLVF+LCVFV+PLCI+RQVIKTKSVEYMPF +S FLTLSAV WFFYGLL K
Sbjct  128  VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D+NIAIPN+LGFI GILQMV YV+Y   K++    E K PE  +       ++ +PE  +
Sbjct  188  DFNIAIPNVLGFIVGILQMVFYVIYYK-KEEVIVKEHKFPEIQNHVIILHNDKNLPELTE  246

Query  825  EQVIDVVKLSAALALTGI  878
            EQ+ID+VKL + ++ T I
Sbjct  247  EQIIDIVKLGSLISCTEI  264



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 206/262 (79%), Gaps = 8/262 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNI+SF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  9    AFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITIN+ G FI+T Y+ F+LFYA KKA++ T+K L L  VGG+G II++TQF+ K  +
Sbjct  69   TLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQFLFKG-A  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  IRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG------SCGGGDQVEQK  806
            D NIA PN+LGF FGILQ+VLYV+Y   K+K    EQKLPE        S    +   +K
Sbjct  188  DINIAAPNVLGFFFGILQIVLYVIYSK-KEKAILKEQKLPEIQKAAVIVSDDNTNVANKK  246

Query  807  VPEELKEQVIDVVKLSAALALT  872
            +PE  +EQ+ID+V+L+  LA T
Sbjct  247  LPELTQEQIIDIVRLAGLLANT  268


 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = +3

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T+F+ K  + R  +VGWICL+F+LCVFVAPL I RQVIKTKSVEYMP LLS FLTLSAV+
Sbjct  306  TEFLFKG-AVRGQVVGWICLIFSLCVFVAPLGI-RQVIKTKSVEYMPLLLSIFLTLSAVV  363

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGG  788
            WFFYGLL KD NIAIPN+LGFI GILQMVLYV+Y N K+K    EQKLPE   N      
Sbjct  364  WFFYGLLLKDINIAIPNVLGFILGILQMVLYVIY-NKKEKAILKEQKLPEKLQNHMIISI  422

Query  789  DQVEQKVPEELKEQVIDVVKLSAALA  866
            D+  +  PE  +EQ+ID+VKL + ++
Sbjct  423  DEKNKNFPELTEEQIIDIVKLGSLIS  448



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 200/261 (77%), Gaps = 7/261 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNI+SF+V+L+P+PTF  IYKKKSTEGYQS+PYVV LFS+MLWIYYA L  + 
Sbjct  9    AFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNM  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINS G FI+T Y+ F+LFYA KKA++ T+K L+L  VGG+G I+L+T+F+ K   
Sbjct  69   PLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKGV-  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  IVGWICL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSC-----GGGDQVEQKV  809
            D NIA PN+LGFIFGILQ++LY +Y   K+K    EQKLPE                +K+
Sbjct  188  DINIAAPNVLGFIFGILQIILYAIYSK-KEKSIIKEQKLPEIQKTEVIVKDENMNANKKL  246

Query  810  PEELKEQVIDVVKLSAALALT  872
            PE  +EQ+ID+VKL+  L +T
Sbjct  247  PELTQEQIIDIVKLAGLLVVT  267



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 200/261 (77%), Gaps = 7/261 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF  IYKKKSTEGYQS+PYVV LFS+MLWIYYA L  + 
Sbjct  9    AFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNM  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINS G FI+T Y+ F+LFYA KKA++ T+K L+L  VGG+G I+L+T+F+ K   
Sbjct  69   PLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKGV-  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  IVGW+CL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL K
Sbjct  128  VRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSC-----GGGDQVEQKV  809
            D NIA PN+LGFIFGILQ++LY +Y   K+K    EQKLPE                +K+
Sbjct  188  DINIAAPNVLGFIFGILQIILYAIYSK-KEKSIIKEQKLPEMQKPEVIVKDENMNANKKL  246

Query  810  PEELKEQVIDVVKLSAALALT  872
            PE  +EQ+ID+VKL+  L +T
Sbjct  247  PELTQEQIIDIVKLAGLLVVT  267



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 205/261 (79%), Gaps = 7/261 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNI+SF+V+L+P+PTF KIYKKKSTEGYQS+PYVV LFS+MLWIYYA L  +T
Sbjct  9    AFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KK ++ T+K L+L  VGG+G I+L+T+F+ K   
Sbjct  69   TLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEFLFKGV-  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  +VGWICL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLTLSAV+WFFYGLL K
Sbjct  128  VRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWFFYGLLLK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG-----GGDQVEQKV  809
            D NIA PN+LGFIFGILQ+VLYV+Y N K+K    EQKLPE              V +K+
Sbjct  188  DINIAAPNVLGFIFGILQIVLYVIY-NKKEKVILKEQKLPEIQKAAVIVSDDNTNVNKKL  246

Query  810  PEELKEQVIDVVKLSAALALT  872
            PE  +EQ+ID+V+L+  LA T
Sbjct  247  PELTQEQIIDIVRLAGLLANT  267


 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 204/257 (79%), Gaps = 5/257 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFG+LGNIVSF+V+L+P+PTF KIYKKKST+GYQS+PYVV LFS+MLWIYYAFL  +T
Sbjct  311  AFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSMLWIYYAFLKTNT  370

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TLLITINS G FI+T Y+ F+LFYA KK ++ T+K L+L  VGG+G I+LIT+F+ K   
Sbjct  371  TLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLITEFLFKGV-  429

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  IVGWICL+F+LCVFVAPL IV+QVIKTKSVEYMP LLS FLTLSAV+WFFYGLL K
Sbjct  430  VRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPLLLSIFLTLSAVVWFFYGLLLK  489

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQKVPE  815
            D NIAIPN+LGFI GILQMVLYV+Y N K+K    EQKLPE   N      D+  +  P 
Sbjct  490  DINIAIPNVLGFILGILQMVLYVIY-NKKEKAILKEQKLPEKLQNHMIISMDEKNKNSPG  548

Query  816  ELKEQVIDVVKLSAALA  866
              +EQ+ID+VKL + ++
Sbjct  549  LTEEQIIDIVKLGSLIS  565



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 202/253 (80%), Gaps = 4/253 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            T AFG+LGNIVSFMV+L+P+PTF  IYKKKSTEGYQS+PYVV LFS +LWIYYA L P +
Sbjct  10   TSAFGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLMPQS  69

Query  285  TLL--ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
             L+  ITIN++GCFI+T Y+  +LFYA KKA++ T+K LLLL VGG+G ++L+ QF+ K 
Sbjct  70   NLIFIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFLFKG  129

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             + R  IVGWICLVF++C F APLCI+R+VIKTKSVEYMPFLLS FLTL+AVMWFFYGLL
Sbjct  130  -AVRGQIVGWICLVFSVCTFAAPLCILRKVIKTKSVEYMPFLLSLFLTLNAVMWFFYGLL  188

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            +++  +AIPNILGF FGILQM+LYVVY N K+K    EQKL E  +       ++K+P+ 
Sbjct  189  KRNKIVAIPNILGFTFGILQMILYVVY-NKKEKNVIKEQKLRELQNHVIISDEQKKLPQL  247

Query  819  LKEQVIDVVKLSA  857
             +EQ+ID+VKL A
Sbjct  248  TEEQIIDIVKLGA  260



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 197/260 (76%), Gaps = 7/260 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNI+SF+V+L+P+PTF  IYKKK+ EGYQS+PYV+ LFS+MLWIYYAFL  + T
Sbjct  10   FAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYAFLKTNVT  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINS G FI+T Y+  +LFYA KKA++ T+K LLL  VGG+G I+L+TQF+ K    
Sbjct  70   LLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQFLFKGV-V  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  IVGWICL+FAL VFVAPL IVRQVIKTKSVEYMP LLS FLTLSAVMWFFYGLL KD
Sbjct  129  RGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS-----CGGGDQVEQKVP  812
             NIA PN+LGFIFG+LQ+VLY +Y   K+K    EQKLPE                +K+P
Sbjct  189  INIAAPNVLGFIFGVLQIVLYAIYSK-KEKVILKEQKLPEIQKPAVIVADDNTNANKKLP  247

Query  813  EELKEQVIDVVKLSAALALT  872
            E   EQ+ID+VKL+  L  T
Sbjct  248  ELTHEQIIDIVKLAGLLTCT  267



>ref|XP_009794853.1| PREDICTED: bidirectional sugar transporter SWEET9-like, partial 
[Nicotiana sylvestris]
Length=282

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 197/256 (77%), Gaps = 13/256 (5%)
 Frame = +3

Query  120  LLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLIT  299
            L GNIVSF+V+L+P+PTF KIYKKKSTEGYQS+PYV+ LFS+MLWIYYAFL  +TTLLIT
Sbjct  2    LAGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTNTTLLIT  61

Query  300  INSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHI  479
            INS G FI+T Y+ F+LFYA KKA+I T+K L L  VGG+G IILI QF+ K   +R  +
Sbjct  62   INSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV-ARGQV  120

Query  480  VGWICLVFALCVFVAPLCIV-----------RQVIKTKSVEYMPFLLSFFLTLSAVMWFF  626
            VGW+CLVF+LCVFVAPLCIV           R+VIKTKSVEYMP LLS FLTLSAVMWFF
Sbjct  121  VGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  180

Query  627  YGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQK  806
            YGLL KD NIA PNILGFIFGILQ+VLYV+Y N K+K    EQ LPE  +        +K
Sbjct  181  YGLLLKDINIAAPNILGFIFGILQIVLYVIY-NKKEKHILKEQNLPELQNHVIILDDNKK  239

Query  807  VPEELKEQVIDVVKLS  854
            +PE  +EQ ID++KLS
Sbjct  240  LPELTEEQKIDIMKLS  255



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 196/248 (79%), Gaps = 4/248 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNI+SF+V+L+P+PTF KIYKKKSTEGYQS+PYV+ LFS MLWIYYAFL  +TT
Sbjct  9    FVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTNTT  68

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINS G  I+T Y+S FL+YA KKA+++T+K LLL  VGG+G IIL+TQF+ K    
Sbjct  69   LLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQFLFKGV-V  127

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  IVGWICL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLT+SAVMWFFYGLL KD
Sbjct  128  RGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLKD  187

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
             NIA PNILGFIFGILQM+LY +Y+   K       ++ +N      D   +K+PE  +E
Sbjct  188  VNIAAPNILGFIFGILQMILYAMYRKKHKPIVNVNVEV-QNPVIILDD--NKKIPELTEE  244

Query  828  QVIDVVKL  851
            Q+ID+VKL
Sbjct  245  QIIDIVKL  252



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNIVSF+V+L+P+PTF  IYKKK+ EGYQS+PYVV LFS+MLWIYYAFL  +TT
Sbjct  10   FVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAFLKTNTT  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ G FI+T Y+ F+LFYA KK+++ T+K L L  VGG+G IIL+T+F+ K  + 
Sbjct  70   LLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVTEFLFKG-AI  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWICL+F+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL KD
Sbjct  129  RGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSC-----GGGDQVEQKVP  812
             NIA PNILGFIFGILQM+LYV+Y   K+K    EQKLPE                +K P
Sbjct  189  INIAAPNILGFIFGILQMILYVIYSK-KEKAILKEQKLPEIQKAEVIVKDENMNTNKKFP  247

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+V+L
Sbjct  248  ELTQEQIIDIVRL  260



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 199/261 (76%), Gaps = 3/261 (1%)
 Frame = +3

Query  99   DLTF-AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            D +F  F   GNIVSF V+L+P+PTF KIYKKKSTE YQS+PYVV LFSAM WIYYAFL 
Sbjct  5    DFSFLGFPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLK  64

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             +TTLLITINS GCFI+T Y+ F+LFYA KKA++ T+K LLL   GG+G I+L+TQ + K
Sbjct  65   SNTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFK  124

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
                R  +VGWICLVF+LCVFV+PLCI+RQVIKTKSVEYMPF +S FLTLSAV WFFYGL
Sbjct  125  GV-VRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGL  183

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPE  815
            L KD+NIAIPN+LGFI GILQMV YV+Y   K++    E K PE  +       ++ +PE
Sbjct  184  LLKDFNIAIPNVLGFIVGILQMVFYVIYYK-KEEVIVKEHKFPEIQNHVIILHNDKNLPE  242

Query  816  ELKEQVIDVVKLSAALALTGI  878
              +EQ+ID+VKL + ++ T I
Sbjct  243  LTEEQIIDIVKLGSLISCTEI  263



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 193/248 (78%), Gaps = 3/248 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNI+SF+V+L+P+PTF KIYKKKSTEGYQS+PYV+ LFS MLWIYYAFL  +TT
Sbjct  9    FVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTNTT  68

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINS G  I+T Y+  FL+YA KKA+++T+K LLL  VGG+G II++TQFV K    
Sbjct  69   LLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQFVFKGV-V  127

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  IVGWICL+F+LCVFVAPL IVRQVIKTKSVEYMP LLS FLT+SAVMWFFYGLL KD
Sbjct  128  RGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLKD  187

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
             NIA PNILGFIFGILQM+LY +Y+    K         +N      D   +K+PE  +E
Sbjct  188  VNIAAPNILGFIFGILQMILYAMYRKKDNKPIVNVNVEVQNPVIILDDN--KKIPELTEE  245

Query  828  QVIDVVKL  851
            Q+ID+VKL
Sbjct  246  QIIDIVKL  253



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 199/253 (79%), Gaps = 7/253 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNIVSF+V+L+P+PTF  IYKKK+ EGYQS+PYVV LFS+MLWIYYAFL  +TT
Sbjct  10   FVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAFLKTNTT  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ G F++T Y+ F+L YA KK+++ T+K L L  VGG+G IIL+TQF+ K    
Sbjct  70   LLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVTQFLFKGV-I  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWICL+F+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL KD
Sbjct  129  RGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE--NGSCGGGDQ---VEQKVP  812
             NIA PNILGFIFG+LQM+LYV+Y   K+K    EQKLPE   G     D+    ++K P
Sbjct  189  INIAAPNILGFIFGVLQMILYVIYSK-KEKAILKEQKLPEIQKGEVIVKDENMNADKKFP  247

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+V+L
Sbjct  248  ELTQEQIIDIVRL  260



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   317 bits (811),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 201/256 (79%), Gaps = 20/256 (8%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            +   L F FG+LGN++SFMVYLAP+PTF +IYK+KSTEG+QSVPYVV LFSAMLWIYYAF
Sbjct  6    IHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAF  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D +LLITINSVGC I+TSYI  FL YA KKA+I T+K + L+N+ G+G I+L+T  +
Sbjct  66   LNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A + ++R  I+GW+CLVF+L VF+APLCI+RQVI+TKSVEYMPFLLSFFLTLSAVMWFFY
Sbjct  126  A-EGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GL+ KD+ IA PNILGF+FGI+QMVLY++Y+N  +K+    +KLP               
Sbjct  185  GLMLKDFYIAGPNILGFVFGIVQMVLYLIYRN--RKKVLENEKLP---------------  227

Query  810  PEELKEQVIDVVKLSA  857
              EL EQ+IDVVKLS 
Sbjct  228  --ELSEQIIDVVKLST  241



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 201/256 (79%), Gaps = 20/256 (8%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            +   L F FG+LGN++SFMVYLAP+PTF +IYK+KSTEG+QSVPYVV LFSAMLWIYYAF
Sbjct  6    IHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLWIYYAF  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D +LLITINSVGC I+TSYI  FL YA KKA+I T+K + L+N+ G+G I+L+T  +
Sbjct  66   LNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A + ++R  I+GW+CLVF+L VF+APLCI+RQVI+TKSVEYMPFLLSFFLTLSAVMWFFY
Sbjct  126  A-EGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVMWFFY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GL+ KD+ IA PNILGF+FGI+QMVLY++Y+N  +K+    +KLP               
Sbjct  185  GLMLKDFYIAGPNILGFVFGIVQMVLYLIYRN--RKKVLENEKLP---------------  227

Query  810  PEELKEQVIDVVKLSA  857
              EL EQ+IDVVKLS 
Sbjct  228  --ELSEQIIDVVKLST  241



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNIVSF+V+L+P+PTF  IYKKKSTEGYQS+PYVV LFS+MLWIYYA L  +  
Sbjct  10   FAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTNMP  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINS G FI+T Y+  +LFYA KKA++ T+K L+L  VGG+G IIL+T+ + K  + 
Sbjct  70   LLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTELLFKG-AI  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWICL+F+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL KD
Sbjct  129  RGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG-----GGDQVEQKVP  812
             NIA PN+LGFIFGILQ+VLY +Y   K+K    EQKLPE  + G           +K+P
Sbjct  189  INIAAPNVLGFIFGILQIVLYAIYSK-KEKVILKEQKLPEIQTPGVIVKDENMHTNKKLP  247

Query  813  EELKEQVIDVVKL  851
            E  +EQ+ID+VKL
Sbjct  248  ELTQEQIIDIVKL  260



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 202/249 (81%), Gaps = 2/249 (1%)
 Frame = +3

Query  111  AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTL  290
            AFG+LG+IVSF+V+L+P+PTF  IYKKKSTEGYQS+PYVV LFS +LWIYYA L  +   
Sbjct  12   AFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYYALLMSNMIF  71

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            +ITIN+ GCFI+T Y+ F+LFYA KKA++ T+K LLLL +GG+G I+L+TQF+ K  + R
Sbjct  72   IITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVTQFLFKG-AVR  130

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              IVGWICLVF+LC F APLCIVR+VIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL KD 
Sbjct  131  GQIVGWICLVFSLCTFAAPLCIVRKVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLIKDK  190

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKEQ  830
            N+AIPNILGFIFGILQM+LYV+Y N K+K    EQKL E  +     + ++ +P+  +EQ
Sbjct  191  NVAIPNILGFIFGILQMILYVIY-NKKEKNIIKEQKLRELQNHVVISEEQKNLPQLTEEQ  249

Query  831  VIDVVKLSA  857
            +ID+VKL A
Sbjct  250  IIDIVKLGA  258



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 211/255 (83%), Gaps = 1/255 (0%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNI+SF V+L+P+PTF K+YKKKSTEGYQS+PY+V LFSAMLWIYYAFL  +TT
Sbjct  10   FAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLWIYYAFLKTNTT  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ GCF++  YI F+LFYA+K+A++ T+K LLLL VGG+G I+L++QF+  + + 
Sbjct  70   LLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVLVSQFLF-EGAV  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VG ICL+ +LCVFVAPLCIVRQVIKTKSVEYMPFLLS FLTLSAVMWFFYG+L +D
Sbjct  129  RVQVVGCICLICSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGILLED  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
            +NIAIPN+LGFIFGILQMVLYV+Y N K++E   E+ LP+  +       ++K PE  +E
Sbjct  189  FNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEKNLPDLKNHVIILHNDKKFPELSEE  248

Query  828  QVIDVVKLSAALALT  872
            Q+I++VKL + ++ T
Sbjct  249  QIIEIVKLGSLISCT  263



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 194/254 (76%), Gaps = 8/254 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNIVSF+V+L+P+PTF  IYKKKSTEGYQS+PYVV LFS+MLWIYYA L  +  
Sbjct  8    FAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNMP  67

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINS G FI+T Y+  +L YA  KA++ T+K L+L  VGG+G I+LIT+F+ K    
Sbjct  68   LLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFKGV-V  126

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  IVGWICL+F+LCVFVAPL IVR+VIKTKSVEYMP LLS FLTLSAVMWFFYGLL KD
Sbjct  127  RGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLKD  186

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCG------GGDQVEQKV  809
             NIA PN+LGFIFGILQ+VLY +Y   K+K    EQKLPE  +              +K+
Sbjct  187  INIAAPNVLGFIFGILQIVLYAIYSK-KEKVILKEQKLPEIQTPAVIVKNENMMNTTKKL  245

Query  810  PEELKEQVIDVVKL  851
            PE  +EQ+ID+VKL
Sbjct  246  PELTQEQIIDIVKL  259



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 193/255 (76%), Gaps = 17/255 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            +   LT AFGLLGNI+SFMV+LAP+PTF KIYKKK+TEG+Q++PY V LFS MLWIYYA 
Sbjct  3    IHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D T LITINSVGC I+T Y++ FLFY+ KKA+I T+K LLLLNV GYGL++++T F+
Sbjct  63   LKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTLFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            AK    R  +VGWICLVF L VF APLCI+++VI+TKSVE+MPF LSFFLTL AVMWFFY
Sbjct  123  AKG-EIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L KDYNIA PNILGF+FGI QMVLY+VYKN KK     E                 KV
Sbjct  182  GFLLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKKVVLLEE---------------PSKV  226

Query  810  PEELKEQVIDVVKLS  854
             +EL + +I+V+K+S
Sbjct  227  -QELSDHIIEVMKIS  240



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 194/260 (75%), Gaps = 19/260 (7%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            LT AFGLLGNIVSFMV+LAP+PTF KIYKKKS EG+QS+PYV+ L S+MLWIYYA L  D
Sbjct  7    LTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYYALLKKD  66

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINSVGC I+T YI+ FLFYA KK +I+T+K LL+LNV GYGL++++T F+A + 
Sbjct  67   ALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTIFLA-EG  125

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R   VGWICL F L VF APLCI+RQVI+TKSVE+MPF LSFFLTL AVMWFFYGLL 
Sbjct  126  EKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFFYGLLL  185

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KDYNIA PN+LGF FGI QM LY+VYKN KK     E KL                 +EL
Sbjct  186  KDYNIAFPNVLGFFFGIAQMALYIVYKNAKKT-ILLEPKL-----------------QEL  227

Query  822  KEQVIDVVKLSAALALTGIS  881
             E VIDVVK+SA +  T ++
Sbjct  228  SEHVIDVVKISALVCPTELN  247



>ref|XP_011073577.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
 ref|XP_011073579.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=270

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 200/252 (79%), Gaps = 19/252 (8%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFGLLGNIVSFMV+L+P+PTF +IYKKK++EG+QSVPYVV LFSAMLWIYYAFL  +T
Sbjct  9    AFAFGLLGNIVSFMVFLSPIPTFYQIYKKKTSEGFQSVPYVVALFSAMLWIYYAFLKSNT  68

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            TL+ITINSVGCFIQT YI F+LFYA KK ++ T+K L LL V G+G I++ T F+ K  S
Sbjct  69   TLIITINSVGCFIQTIYICFYLFYAPKKQRVQTLKLLFLLIVCGFGFILVSTHFLVK-AS  127

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             +A++VGWICLVF+LCVF+APLCIVR+VI+TKSVEYMPFLLS FLTLSAVMWFFYG L K
Sbjct  128  LQANVVGWICLVFSLCVFIAPLCIVRKVIRTKSVEYMPFLLSLFLTLSAVMWFFYGFLIK  187

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DYNIAIPN+LGF FG+LQM LYV YKN       A + + E+G          K+ E   
Sbjct  188  DYNIAIPNVLGFSFGVLQMALYVKYKN-------AAKMILEDG----------KISELTA  230

Query  825  EQVI-DVVKLSA  857
            EQ++ D+VK+SA
Sbjct  231  EQIMDDIVKISA  242



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 190/260 (73%), Gaps = 23/260 (9%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            ++  LT AFGLLGNI+SF+V+LAPVPTF  +YK+K+ EG+Q++PYV+ L S+ML+IYYA 
Sbjct  3    IQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYYAL  62

Query  270  LTP----DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            L      D T LITINS GC ++T YIS FLFYA KKA+I T+  + LLNV GYGL++++
Sbjct  63   LKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMMML  122

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T F+A     R  IVGWICLVF+L VFVAPL ++RQVI+TKSVE+MPF LSFFLTL AV 
Sbjct  123  THFLATG-EIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAVT  181

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            WFFYGLL KDYNIA PNILGF+FGI QMVLY+VYKN KK                     
Sbjct  182  WFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLE------------------  223

Query  798  EQKVPEELKEQVIDVVKLSA  857
            EQ   +EL E +IDVVK+S+
Sbjct  224  EQPKVQELSEHIIDVVKISS  243



>emb|CDP21120.1| unnamed protein product, partial [Coffea canephora]
Length=264

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 182/238 (76%), Gaps = 8/238 (3%)
 Frame = +3

Query  147  VYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLITINSVGCFIQ  326
            ++LAPVPTF +IYKKKSTEG+QS+PYV+ LFSAMLWIYYAFL P TT LITINS GCFI+
Sbjct  1    MFLAPVPTFYQIYKKKSTEGFQSIPYVIALFSAMLWIYYAFLKPKTTFLITINSFGCFIE  60

Query  327  TSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHIVGWICLVFA  506
            T YI  FLFY TKKA+++T+K L+LL   G+GL +L+T F+AKD S+R  IVGWICLVFA
Sbjct  61   TIYICLFLFYTTKKARVETVKLLVLLLACGFGLNVLLTHFLAKD-STRVRIVGWICLVFA  119

Query  507  LCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYNIAIPNILGFIF  686
            L VFVAPL IV QVI+TKS EYMP  LS FLTL+AV WFFYGLL KD+NIAIPN+LGF+F
Sbjct  120  LLVFVAPLRIVIQVIRTKSAEYMPLPLSAFLTLNAVAWFFYGLLLKDFNIAIPNVLGFVF  179

Query  687  GILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQ---VEQKVPEELKEQVIDVVKL  851
            G+LQMVLY +Y   +K     +Q+          DQ   VE+    ++ EQ+ID+ KL
Sbjct  180  GVLQMVLYKIYSKSEKDNDLEKQR----KVSQLADQIIIVEENKLSDITEQIIDIAKL  233



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 191/251 (76%), Gaps = 21/251 (8%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            TF FGLLGN++SFMVYLAP+PTF +IYKKKSTEG+QSVPYVV LFSAMLWIYYAFL PD 
Sbjct  11   TFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLWIYYAFLKPDA  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINS GCFI+T YI  F+ YA+KK +I+T+K LLLLNVG + LI+L+T F+A  T 
Sbjct  71   HLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILLLTLFLAHGT-  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             RA IVGW+C+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSAVMWF YG L+K
Sbjct  130  KRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVMWFSYGFLQK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D  +A+PNILGFIFGILQM+LYV+YK+ KK                     EQKV     
Sbjct  190  DLYVALPNILGFIFGILQMLLYVIYKDSKKVIIE-----------------EQKVN---N  229

Query  825  EQVIDVVKLSA  857
            E +IDV KL++
Sbjct  230  EHIIDVRKLNS  240



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 190/260 (73%), Gaps = 23/260 (9%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            ++  LT +FGLLGNI+SF+V+LAPVPTF  IYK+K+ EG+Q++PYV+ L S+ML+IYYA 
Sbjct  3    IQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYYAL  62

Query  270  LTP----DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            L      D T LITINS GC ++T YIS FLFYA KKA+I T+  + LLN+ G+GL++L+
Sbjct  63   LKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMMLL  122

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T F+A     R  IVGWICLVF+L VFVAPL ++R+VI+TKSVE+MPF LSFFLTL AV 
Sbjct  123  THFLATG-EMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAVT  181

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            WFFYGLL KDYNIA PNILGF+FGI QMVLY+VYKN KK                     
Sbjct  182  WFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLE------------------  223

Query  798  EQKVPEELKEQVIDVVKLSA  857
            EQ   +EL E +IDVVK+S+
Sbjct  224  EQPKVQELSEHIIDVVKISS  243



>ref|XP_008464393.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
melo]
Length=296

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 180/250 (72%), Gaps = 6/250 (2%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FGLLGNI+SFMV+LAP+PTF KIYKKKS EGYQSVPYVV LFSAMLWIYYA L  +
Sbjct  8    LAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYALLKTN  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             T LITINS GC I++ YI  F+ YA  K +  T K + LLNV G+GL++ +T  +AK  
Sbjct  68   ATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLVLAKG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++GWICLVF L VF APL I+ +VIKTKSVEYMPF LSFFLTL+AVMWFFYGLL 
Sbjct  127  EKRLKVLGWICLVFNLSVFAAPLLIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KDY IA+PN++GF+FGI+QM+LYV+ KN   K      ++P     G           EL
Sbjct  187  KDYYIALPNVVGFVFGIIQMILYVIVKNIGNKS-----RIPVKDELGAAKAAAPPQLHEL  241

Query  822  KEQVIDVVKL  851
             EQ+ID VKL
Sbjct  242  SEQIIDAVKL  251



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 185/248 (75%), Gaps = 19/248 (8%)
 Frame = +3

Query  111  AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTL  290
            AFGLLGNI SF+V LAP+PTF KIYKKKSTEG+QSVPYV+ LFSAM+WIYYA L  +   
Sbjct  10   AFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYYALLKQNAIF  69

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            L+TIN+  C +QT YI+ ++FYA KK +I T+K LLLLN+ G+G I L+T F++K  + R
Sbjct  70   LMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTFFLSKG-AIR  128

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              I+G+IC+ FAL VF APL IVR+VIKTKSVEYMPF LSFFLT+ AV WFFYGLL KD 
Sbjct  129  EKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFFYGLLIKDL  188

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKEQ  830
            N+AIPN+LGFIFG+LQM+LYV+YKN  KK                   VEQ   +EL E 
Sbjct  189  NVAIPNVLGFIFGVLQMILYVIYKNPNKK------------------IVEQTKLQELSEH  230

Query  831  VIDVVKLS  854
            V+DVVKLS
Sbjct  231  VVDVVKLS  238



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/251 (61%), Positives = 187/251 (75%), Gaps = 20/251 (8%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            TFAFGLLGNI+S MVYLAPVPTFI+IYKKKSTEG+QSVPYVV LFSAMLWIYY  L PD 
Sbjct  11   TFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLWIYYGLLKPDA  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINSVGC I+TSYI+ F+ YA KKA++  +K LLLLNVG +  I+L T F+AK  S
Sbjct  71   HLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILLFTLFLAKG-S  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R  ++G IC+ F++ VF APL I+R VI++KSVE+MPF LSFFLTLSAVMWF YG L K
Sbjct  130  NRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVMWFSYGFLLK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D+ IA+PNILGFIFG+ QMVLY +YK+  +     +Q                   +++ 
Sbjct  190  DFYIALPNILGFIFGVAQMVLYAIYKDANRSNIEEQQ-------------------QKVN  230

Query  825  EQVIDVVKLSA  857
            E VIDV+KL++
Sbjct  231  EHVIDVIKLNS  241



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/254 (58%), Positives = 185/254 (73%), Gaps = 19/254 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FG+LGN+VSF+V LAP+PTF +IYKK+++EG+QS+PYVV LFSAMLWIYYA 
Sbjct  3    LHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITIN+  CFIQT YI  + +YA KK K+ T+K +LL N+ G+G+I L T F+
Sbjct  63   LKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             ++  +R H++G+IC+ FAL VF APLCI+R+VIKTKSVEYMPF LS FLTL AVMWFFY
Sbjct  123  -QNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD NIA+PN++GFIFGILQM+LY +YKN  KK                   VE   
Sbjct  182  GLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKK------------------MVEDPK  223

Query  810  PEELKEQVIDVVKL  851
              +L E ++DVVKL
Sbjct  224  LHQLSEHIVDVVKL  237



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNI+SFMVYLAP+PTF ++YKKKSTEG+QSVPYVV LFSAMLWIYYAF+  D  
Sbjct  12   FTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLWIYYAFIKADAY  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS+GC I+T YI  +L YA KKA+I T + LLLLNVG +GLI+L+T  VAK    
Sbjct  72   LLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVLVTLMVAKG-PE  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R H++GW+C+ F++ VFVAPL I+R VI+TKSVE+MPF LSFFLT+SA+ WF YGLL KD
Sbjct  131  RVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIAWFSYGLLTKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
              +A+PNILGFIFG++QM +Y+ YK G +K +   QK+ E+
Sbjct  191  IYVALPNILGFIFGVVQMGIYIAYK-GTEKVAYDHQKVAEH  230



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 194/272 (71%), Gaps = 22/272 (8%)
 Frame = +3

Query  78   SFILLRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWI  257
            +F+ +     F FGLLGNI+SFMVYL+P+PTF ++YKKKSTEG+QSVPYVV LFSAMLWI
Sbjct  2    AFLSVHHPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLWI  61

Query  258  YYAFLTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            YYA L  D  LLITIN++GC I++ YI+ ++ YA KKAKI T K ++LLN+G + +I+L+
Sbjct  62   YYALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILLL  121

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T F  +    R  ++GW+C+ F++CVF APL I+R VI+TKSVE+MPF LSF LTLSAVM
Sbjct  122  TLFFVQG-PKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVM  180

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE----------  767
            WF YGLL KD+ IA+PN+LGFIFGI+QMVLY++YK  KK  +  ++KLPE          
Sbjct  181  WFSYGLLTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKK--AFIDKKLPEQVVNIVKIST  238

Query  768  ---------NGSCGGGDQVEQKVPEELKEQVI  836
                     NG    G+ V   V + L++ VI
Sbjct  239  LGSSDVFPINGQAVSGECVTDSVEKSLEQVVI  270



>ref|XP_002511128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51730.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 187/258 (72%), Gaps = 17/258 (7%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
             + L FAFGLLGNI+SF+V LAP+PTF +I KKK++EG+QS+PYV+ LFSA LW++YA  
Sbjct  4    HLTLAFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFYAIF  63

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
              D TLLITINS   F++T+YI+ +LFYA KK ++ T K +L LN+  +G I +I  F+ 
Sbjct  64   ANDATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAMFLT  123

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
                 R  ++GWIC+VFALCVFVAPL IVR+VIKTKSVE+MPF LSFFLTLSAVMWFFYG
Sbjct  124  HG-QKRVQLLGWICMVFALCVFVAPLAIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYG  182

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
             L+KD  +A+PNILGF+FG+LQM+LY++Y+N KK               G  DQ   ++P
Sbjct  183  FLKKDLYVAVPNILGFMFGVLQMILYLIYRNPKKT--------------GDDDQKANELP  228

Query  813  EELKEQVIDVVKLSAALA  866
             +    +IDV KL+  ++
Sbjct  229  NQ--HSIIDVAKLNTRVS  244



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 187/259 (72%), Gaps = 23/259 (9%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L   L+ AFGLLGNI+S +V+LAPVPTF  +YKKK+TEG+Q++PYV+GL S+M+++YYA 
Sbjct  3    LHHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYYAL  62

Query  270  LTP----DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            L      D TL+ITINSVGC I+T YI  FLFYA KKA+I T   L LLN+  YG+++++
Sbjct  63   LKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMVVL  122

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T+F+A    +R  IVGWICLVF+L VFVAPL ++RQVI+TKSVE+MPF LSFFLTL AV 
Sbjct  123  TRFLATG-ETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAVA  181

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            WFFYG L KDY IA PNILGF FG++QM +YVVYKN KK                     
Sbjct  182  WFFYGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAKKFLE------------------  223

Query  798  EQKVPEELKEQVIDVVKLS  854
            +Q   +EL E +IDV+K+S
Sbjct  224  DQPKVQELSEHIIDVMKIS  242



>ref|XP_007038076.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22577.1| Nodulin MtN3 family protein, putative isoform 2 [Theobroma cacao]
Length=281

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 185/255 (73%), Gaps = 20/255 (8%)
 Frame = +3

Query  90   LRMDLTFAFGLL-GNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYA  266
            L +   F FG+L GN+VSF+V LAP+PTF +IYKK+++EG+QS+PYVV LFSAMLWIYYA
Sbjct  3    LHLSWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYA  62

Query  267  FLTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQF  446
             L  D  LLITIN+  CFIQT YI  + +YA KK K+ T+K +LL N+ G+G+I L T F
Sbjct  63   LLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFF  122

Query  447  VAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFF  626
            + ++  +R H++G+IC+ FAL VF APLCI+R+VIKTKSVEYMPF LS FLTL AVMWFF
Sbjct  123  L-QNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFF  181

Query  627  YGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQK  806
            YGLL KD NIA+PN++GFIFGILQM+LY +YKN  KK                   VE  
Sbjct  182  YGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKK------------------MVEDP  223

Query  807  VPEELKEQVIDVVKL  851
               +L E ++DVVKL
Sbjct  224  KLHQLSEHIVDVVKL  238



>ref|XP_004138032.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 ref|XP_004161361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Cucumis 
sativus]
 gb|KGN63458.1| hypothetical protein Csa_1G001300 [Cucumis sativus]
Length=292

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 183/251 (73%), Gaps = 12/251 (5%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FGLLGNI+SFMV+LAP+PTF KIYKKKS EGYQSVPYVV LFSAMLWIYYA L  +
Sbjct  8    LAFVFGLLGNIISFMVFLAPLPTFYKIYKKKSAEGYQSVPYVVALFSAMLWIYYALLKTN  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             T LITINS GC I++ YI  F+ YA  K +  T K + LLNV G+GL++ +T  +AK  
Sbjct  68   ATFLITINSFGCVIESLYILLFIIYAPTKLRFQTAKVIFLLNVLGFGLMLALTLVLAKG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++GWICLVF L VF APL I+ +VIKTKSVEYMPF LSFFLTL+AVMWFFYGLL 
Sbjct  127  EKRLKVLGWICLVFNLSVFAAPLFIMGKVIKTKSVEYMPFALSFFLTLNAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLP-ENGSCGGGDQVEQKVPEE  818
            KDY IA+PN++GF+FGI+QM+LYV+ K+   K      ++P ++       Q+      E
Sbjct  187  KDYYIALPNVVGFVFGIIQMILYVIVKHIGNKS-----RIPVKDEKAAAPPQL-----HE  236

Query  819  LKEQVIDVVKL  851
            L EQ+ID VKL
Sbjct  237  LSEQIIDAVKL  247



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 188/252 (75%), Gaps = 13/252 (5%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNI+SFMVYLAP+PTF ++ ++KSTEG+ SVPYVV LFSA LWI+YAFL  + 
Sbjct  11   AFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLWIFYAFLKTNA  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITIN+VGC I+T+Y+  +  YA K AK+ T K +LL+NVG +GLI+++T   A+  +
Sbjct  71   GLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILVLTLLFARG-A  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWIC+ F++ VFVAPL I+R VI+TKSVE+MPF LSFFLT SAV+WF YGLL K
Sbjct  130  KRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVVWFGYGLLTK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN--GSCGGGDQ--------  794
            D  +A+PN+LGFIFG+LQMVLYV Y+N  K ++  EQKLPE+     G  ++        
Sbjct  190  DLYVALPNVLGFIFGVLQMVLYVAYRN--KDKAMVEQKLPEHIASKLGTAEKVLEIYAIG  247

Query  795  VEQKVPEELKEQ  830
            VE+KVP   +E+
Sbjct  248  VEEKVPNRAQEE  259



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN VSF+V+LAP+PTF +I +KKSTEG+QS+PYVV LFSAM+W+YYA L  D  
Sbjct  12   FTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIWLYYASLKSDAL  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGCFI+  YI+ ++ YA K+A+I T++ L+LLN GG+  ++L++ F  K  S+
Sbjct  72   LLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLLLSHFFVKG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  ++GW+C++F++ VF APL I+R VI+T+SVE+MPF LSFFLTLSA+MW FYG+L KD
Sbjct  131  RVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIMWLFYGVLLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS  776
            + IAIPNILGFIFG+LQMVLYV+YKN K      E  LP+N +
Sbjct  191  FYIAIPNILGFIFGVLQMVLYVIYKNSKTAVPM-EPTLPQNSN  232



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 181/234 (77%), Gaps = 8/234 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNIVSF+V+LAP+PTF ++YKKKSTEG+QSVPYV  LFSAM+WIYYAFL   
Sbjct  10   LAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSH  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I+T YI+ +L YATK A++ T++ LLL+N GG+ LI+L++ F+++  
Sbjct  70   VILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
             +R  ++GW+C+ F++ VF APL ++R VI+TKSVE+MPF LSFFLTLSAVMW  YGLL 
Sbjct  129  PTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
            KD  +A PNILGF FG++QM LY  Y+N K   +  E+KLPE+ +    D V+Q
Sbjct  189  KDLYVATPNILGFSFGVVQMALYAKYRNTK---TIVEEKLPEHKA----DVVKQ  235



>ref|XP_002321730.2| N3 like family protein [Populus trichocarpa]
 gb|EEF05857.2| N3 like family protein [Populus trichocarpa]
Length=269

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 188/266 (71%), Gaps = 14/266 (5%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L     F FGLLGNI+S +V LAP+PTF +I KKK+++G+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHFTWVFGFGLLGNIISCLVCLAPLPTFYQICKKKTSQGFQSIPYVIALFSAMLWLFYAS  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
             + +  LLITINS   F++  YI+ +LFYATKK KI T K LLL N+ G+GLI  ++  +
Sbjct  63   FSENAMLLITINSFAFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALSLLL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             + T  R H++GWIC+VFALCVFVAPL +VR+VI+TKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TEGTK-RVHVLGWICMVFALCVFVAPLGVVRKVIRTKSVEFMPFALSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKE--STAEQKLPENGSC--------  779
            G L+KD  +AIPNILGFIFGILQMVLY++Y+N KK E      Q+L E            
Sbjct  182  GYLKKDKFVAIPNILGFIFGILQMVLYLIYRNPKKNEVAEPRTQELSEQYCSDINIAMPK  241

Query  780  ---GGGDQVEQKVPEELKEQVIDVVK  848
               GG +  E    ++  ++ +DV  
Sbjct  242  LNEGGNEVFEAHSAKDQTKEAMDVTN  267



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 186/250 (74%), Gaps = 22/250 (9%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKKS+EG+QS+PYVV LFS+MLWIYYAF+  D +
Sbjct  10   FVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T Y++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLVF + VF APLCI+++VIKTKSVE+MPF LSF LT++AVMWFFYGLL K
Sbjct  129  KRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QMVLY++Y+N KK E     KL                 EEL 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKKDEP---MKL-----------------EELN  228

Query  825  EQVIDVVKLS  854
              +I+V KLS
Sbjct  229  SHIINVGKLS  238



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGNI+SF+V+LAPVPTF++IYKKKSTEG+QS+PYVV LFSAMLW+YYA   P+ T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T Y++ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA  W  YG+  KD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS  776
              IA+PNI GF+FGI QM+LY++Y   KK+E+  E +LP++ +
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIY---KKRETAMEMQLPQHST  231



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGNI+SF+V+LAPVPTF++IYKKKSTEG+QS+PYVV LFSAMLW+YYA   P+ T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T Y++ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA  W  YG+  KD
Sbjct  132  RVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS  776
              IA+PNI GF+FGI QM+LY++Y   KK+E+  E +LP++ +
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIY---KKRETAMEMQLPQHST  231



>gb|KFK26707.1| hypothetical protein AALP_AA8G282900 [Arabis alpina]
Length=281

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 185/253 (73%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FGLLG+I+SF V LAP+PTF++IYK+KS+EGYQS+PYV+ LFSAMLWIYYA +   
Sbjct  8    LVTVFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIYYALVRKH  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITIN+  C IQ  YISF+LFYA KK K  T+K +L ++V  +GLI L+T F+    
Sbjct  68   AVLLITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLTYFLTHGI  127

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++G+IC+VFALCVFVAPL I+R+VIKTKS E+MPF LSFFLTLSAVMWFFYGLL 
Sbjct  128  -KRVQVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD N+A+PN+LGFIFG+LQM+LY++YK  G K    +  KL                 ++
Sbjct  187  KDMNVALPNVLGFIFGVLQMILYMIYKKPGTKVLEPSGIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + E V+DVV+LS+
Sbjct  230  ISEHVVDVVRLSS  242



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 179/240 (75%), Gaps = 5/240 (2%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLL  293
            FGLLGN +SFMV+L+P+PTF +IYKKKSTE +QS+PYVV  FSAMLW+ YA++  D   L
Sbjct  16   FGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAMLWLLYAYVKTDVIFL  75

Query  294  ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRA  473
            +TIN  G FI+T Y+  FL YA K+A+I  +K LLL NV G+G+I+  T  +AK T  R 
Sbjct  76   VTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVIVFFTAVIAKTTRVRL  135

Query  474  HIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYN  653
             I+GW+CLVF+ CVFVAPL ++R+VI+TKSVEYMPF LSFFLTLSAV+WFFYGLL++D  
Sbjct  136  LILGWVCLVFSFCVFVAPLGVMRKVIRTKSVEYMPFFLSFFLTLSAVVWFFYGLLKRDVY  195

Query  654  IAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQ--VEQKVPEELKE  827
            +A+PN+LGF FGI+QM+LY++Y+N K  E   E    ++ S    DQ  VE+ V  + K 
Sbjct  196  VAVPNVLGFTFGIVQMILYMMYRNAKPVEKDIEVGKTKDSST---DQIFVEEPVKPQPKN  252



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 187/265 (71%), Gaps = 27/265 (10%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L F FG+LGNI+S MV+LAPVPTFI+I+KKKSTE +QS+PY++ LFS+MLW+YYA L 
Sbjct  7    LHLAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLK  66

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             DT LL+TINS GC I+T+YI+ ++ YAT+++++ T+K L+ +N+G + LI+L+  F+  
Sbjct  67   KDTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILLLAHFLVS  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              S R  ++GW+C+  ++CVF APL I++QVI+TKSVE+MPF LSFFLTLSAVMWF YGL
Sbjct  127  G-SVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMWFAYGL  185

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE----------------  767
            L KD  +A+PNILGFI G+LQMVLY +Y+N +K E   ++KLP                 
Sbjct  186  LLKDLCVALPNILGFILGLLQMVLYGIYRNAQKVEE--KKKLPALKSIVILSAVGGPGIY  243

Query  768  --------NGSCGGGDQVEQKVPEE  818
                    NG     DQ E+   +E
Sbjct  244  PVDAEPDVNGGAEEHDQTEESKEDE  268



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGNI+SF+V+LAPVPTF++IYKKKSTEG+QS+PYVV LFSAMLW+YYA   P+ T
Sbjct  13   FTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYASFNPNET  72

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T Y++ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  73   LLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            +  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA  W  YG+  KD
Sbjct  132  QVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLYGVFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS  776
              IA+PNI GF+FGI QM+LY++Y   KK+E+  E +LP++ +
Sbjct  192  IYIAVPNIPGFMFGIAQMILYLIY---KKRETAMEMQLPQHST  231



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 183/234 (78%), Gaps = 8/234 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNIVSF+V+LAP+PTF ++YK+KSTEG+QSVPYV  LFSAM+WIYYAFL   
Sbjct  10   LAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWIYYAFLKSH  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I+T YI+ +L YATK+A++ T++ LLL+N GG+ LI+L+++F+++  
Sbjct  70   VILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILLLSRFLSQG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
             +R  ++GW+C+ F++ VF APL ++R VI+TKSVE+MPF LSFFLTLSAVMW  YGLL 
Sbjct  129  PTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
            KD  +A PNI+GF FG++QM LY  Y+N K   +  E+KLPE+ +    D V+Q
Sbjct  189  KDLYVATPNIIGFSFGVVQMALYTKYRNTK---TIGEEKLPEHKA----DVVKQ  235



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 180/222 (81%), Gaps = 3/222 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGNIVSF+V+LAPVPTF+++ KKKSTEG+QS PYVV LFSAMLW+YYA L  D  
Sbjct  12   FVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLWLYYASLKSDAF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T YI+ F+ YA K+A+I T+K LLLLN GG+ LI+L++ F+AK  S 
Sbjct  72   LLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILLLSHFLAKG-SE  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+GW+C++F++ VF APL ++R VI+TKSVE+MPF LSFFLTLSA+MW FYGLL KD
Sbjct  131  RATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIMWLFYGLLLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG  773
              IA+PNILG +FG+LQM+LYV+YKN   K    E KLPE+ 
Sbjct  191  LYIAVPNILGLVFGVLQMILYVIYKN--VKTVVEEPKLPEHN  230



>gb|KHG02402.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=273

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 172/226 (76%), Gaps = 3/226 (1%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FG+LGN VSFMV LAP+PTF +I+KKK++EG+QS+PYVV LFSAMLWIYYA 
Sbjct  3    LHLSWVFVFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D   LITIN+   FIQT YI  + +Y  KK KI T+K +LL NV G+G+I L T F+
Sbjct  63   LKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATYFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             K+ S R  I+G+IC+ FAL VFVAPL IVR+VIKTKSVEYMPF LS FLTL AVMWFFY
Sbjct  123  -KNPSLRLLILGYICMAFALAVFVAPLAIVRKVIKTKSVEYMPFTLSVFLTLGAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
            GL  KD N+A+PNILGFIFG+LQM+LY VYKN  KK  T E+  P+
Sbjct  182  GLCLKDMNVAVPNILGFIFGVLQMILYAVYKNHPKK--TVEESDPK  225



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 185/248 (75%), Gaps = 19/248 (8%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKKST+G+QS+PY+V LFS+MLWIYYA +  D +
Sbjct  10   FIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T Y++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLV  + VF APLCI+++VIKTKSVE+MPF LSFFLT++AVMWFFYGLL K
Sbjct  129  KRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QMVLY++Y+N K +                G +   KV +EL 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKPQ----------------GLEEPTKV-QELN  231

Query  825  EQVIDVVK  848
              +IDVVK
Sbjct  232  GHIIDVVK  239



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN+ S +V+LAPVPTF ++YKKKSTEG+QSVPYVV LFSAM+W+YYA L  D  
Sbjct  12   FIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMWLYYATLKSDLI  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T YI+ ++ YATK+A+I T++ +LLLN GG+ LI+L++ F+AK  S 
Sbjct  72   LLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILLLSHFLAKG-SL  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA ++GW+C  FA+ VF APL I+R VI+TKSVE+MP  LSFFLTLSA MW  YGL+ KD
Sbjct  131  RATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATMWLMYGLMLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
              +AIPN++G IFG+LQMVLYV+Y+  K      EQK+ E
Sbjct  191  LCVAIPNVMGLIFGVLQMVLYVIYRKNKTV-LVEEQKVQE  229



>ref|XP_006402062.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
 gb|ESQ43515.1| hypothetical protein EUTSA_v10014273mg [Eutrema salsugineum]
Length=289

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 187/253 (74%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF+V LAP+PTFI+IYK+KS+EGYQS+PYV+GLFSAMLWIYYA +  +
Sbjct  8    LATVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIGLFSAMLWIYYAMIKKN  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITIN+V   IQ  YI+ +LFYA KK K  T+K +L +NV  +GLI ++T F+    
Sbjct  68   VMILITINAVSFVIQIFYIAVYLFYAPKKEKTLTVKLVLFVNVFAFGLIFVLTYFLLHG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G++C+VFALCVFVAPL I+R+VIKTKS E+MPF LSFFLTLSAVMWFFYGLL 
Sbjct  127  NKRVTVLGYVCMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLN  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD N+A+PN+LGF+FG+LQMVLY++YK  G K       KL                 ++
Sbjct  187  KDMNVALPNVLGFVFGVLQMVLYLIYKKPGTKVLEPPGIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + + V+DVV+LS+
Sbjct  230  ISDHVVDVVRLSS  242



>ref|XP_002321731.1| N3 like family protein [Populus trichocarpa]
 gb|EEF05858.1| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 185/259 (71%), Gaps = 18/259 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +    AFGLLGN++S +V LAP+PTF +IYKKK++EG+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
             + D  LLITIN+   F++  YI+ +L YATKK KI T K LLL N  G+GLI ++T F+
Sbjct  63   FSEDAILLITINTFAFFMEFGYITVYLLYATKKDKILTFKLLLLFNSFGFGLICVLTLFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC++F+LCVFVAPL IVR+VIKTKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TQG-QKRVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L+KD  +A+PNILGF+FGI+QMVLYV+Y+N  K                    VE K+
Sbjct  182  GYLKKDQFVAVPNILGFLFGIIQMVLYVIYRNPMKILV-----------------VEPKL  224

Query  810  PEELKEQVIDVVKLSAALA  866
             E   E ++D+ KL  A+ 
Sbjct  225  QELSHEHIVDIRKLGTAIC  243



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L  AFG+LGN++SFMVYLAP+PTF +IYKKKSTEG+QS+PY+V LFS+MLW+YYA L P
Sbjct  8    HLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLKP  67

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             D TLLITINS+GC I+  YI  F  YATK A+  T+K  +++NVG + LI L+T F A 
Sbjct  68   ADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYF-AI  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              S R  +VGW+C+  A+ VF APL IV QVI+TK+VE+MPF LS FLTLSAVMWFFYGL
Sbjct  127  HGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGK---KKESTAEQKLPE  767
            L KD  IAIPNILGF  G+LQM+LY +Y+NGK   K+ +T E+K  E
Sbjct  187  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALE  233



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 180/234 (77%), Gaps = 4/234 (2%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNIVSF+V+LAPVPTF ++YKKKSTEG+QS+PY+  LFSA +WIYYA L  D
Sbjct  8    LAFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASLKSD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITIN  GC I+T YI+ ++ YA KKA+++T++ LLL+N GG+ LI+ ++ F+ +  
Sbjct  68   EMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFLTQG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
             +R  ++GW+C+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA+MW FYGLL 
Sbjct  127  PTRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
            KD  +A PNILGF FG++QM+LY  Y+N KK     E+K+PE+ +    D V+Q
Sbjct  187  KDLYVAAPNILGFSFGVVQMILYAAYRN-KKTVLVDEEKVPEHKT--ADDFVKQ  237



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L  AFG+LGN++SFMVYLAP+PTF +IYKKKSTEG+QS+PY+V LFS+MLW+YYA L P
Sbjct  8    HLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLKP  67

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             D TLLITINS+GC I+  YI  F  YATK A+  T+K  +++NVG + LI L+T F A 
Sbjct  68   ADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYF-AI  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              S R  +VGW+C+  A+ VF APL IV QVI+TK VE+MPF LS FLTLSAVMWFFYGL
Sbjct  127  HGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGK---KKESTAEQKLPE  767
            L KD  IAIPNILGF  G+LQM+LY +Y+NGK   K+ +T E+K  E
Sbjct  187  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALE  233



>ref|XP_010482380.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Camelina 
sativa]
Length=288

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 184/253 (73%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF V LAP+PTFI+IYK+KS+EGYQSVPYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    +Q  YIS + FYA KK KI T+K +L ++V  +GLI L+T F+    
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G+IC+VFAL VFVAPL I+R+VIKTKS E+MPF LSFFLTLSA+MWFFYGLL 
Sbjct  127  NKRGQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PNILGFIFG+LQM+L+V+YK  G K    +  KL                 ++
Sbjct  187  KDMNIALPNILGFIFGVLQMILFVIYKKPGTKVLEPSVIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + E V+DVV+LS+
Sbjct  230  ISEHVVDVVRLSS  242



>gb|KHG27148.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=278

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 181/257 (70%), Gaps = 18/257 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FG+LGN+VSF+V LAP+PTF +IYKK+++EGYQS+PYVV LFSAMLWIYYA 
Sbjct  3    LHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITIN+   FIQT YI  + +Y  KK K+ T+K +LL NV G+G +I  + F 
Sbjct  63   LKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFG-VIFFSTFF  121

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             K+   R  I+G+IC+ FALCVFVAPL I+R+VIKTKSVEYMPF LS FLTL AVMWFFY
Sbjct  122  LKNPLIRLQILGYICMGFALCVFVAPLGILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD NIA+PN+LGFIFGILQM+LY +YKN  KK                    + K+
Sbjct  182  GLLLKDMNIAVPNVLGFIFGILQMILYAIYKNYPKKMVE-----------------DPKL  224

Query  810  PEELKEQVIDVVKLSAA  860
                ++ V+DVVKL + 
Sbjct  225  QLSAQQVVVDVVKLGST  241



>ref|XP_011023931.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
 ref|XP_011023932.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=258

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 183/259 (71%), Gaps = 18/259 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FGLLGNI+S +V LAP+PTF +I KKK+++G+ S+PYV+ LFSAMLW++YA 
Sbjct  3    LHLTWVFGFGLLGNIISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
               D  LLITINS   F++  YI  +LFYATKK KI T K LLL NV G+GLI ++T+F+
Sbjct  63   YKEDALLLITINSFTFFMEIGYIFMYLFYATKKDKILTFKLLLLFNVFGFGLICVLTRFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC+ F+LCVFVAPL IVR+VIKTKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TQR-QKRVQVLGWICMTFSLCVFVAPLFIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L+KD  +A+PNILG +FGILQMVLY++Y+N KK                    VE K+
Sbjct  182  GFLKKDQFVAVPNILGLLFGILQMVLYMIYRNSKKVVV-----------------VEPKL  224

Query  810  PEELKEQVIDVVKLSAALA  866
              ++ E V+D+ K  A + 
Sbjct  225  QLDISEHVVDLEKFGATIC  243



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 183/249 (73%), Gaps = 19/249 (8%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKK+ EG+QS+PYVV LFS+MLWIYYA +  D +
Sbjct  10   FVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I++ Y++ FL YA  K ++ T+K LLLLNV G+G ++L T +     S
Sbjct  70   LLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLSTLYFTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLVF + VF APLCI+++VIKTKSVEYMPF LSFFLT++AVMWFFYGLL K
Sbjct  129  KRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QM+LY+VY+N K K      KL                 +EL 
Sbjct  189  DYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKL-----------------QELN  231

Query  825  EQVIDVVKL  851
              ++DVVKL
Sbjct  232  GHIVDVVKL  240



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 178/255 (70%), Gaps = 17/255 (7%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             + FAFG+LGNIVSF+VYL+P+PTF +IYK+KSTEG+QS+PY V LFSAML +YYAFL  
Sbjct  8    HMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYAFLKT  67

Query  279  DTT-LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
            D   +LITINSVG  I+ +Y+  ++ YA + AKI T K LLL N G YG I+L T F++K
Sbjct  68   DNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLSTFFLSK  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
                RA IVGW+C  F+LCVF APL I+R VI+TKSVEYMPF LSFFLT+ AVMWFFYGL
Sbjct  128  G-HRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAE---QKLP-----------ENG  773
            L +D+ IA PNILGF FGI QM+LY +YKN KK    AE   Q+LP           EN 
Sbjct  187  LIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKG-VLAEFKLQELPNGLVFPTLKKAENT  245

Query  774  SCGGGDQVEQKVPEE  818
                 DQ E     E
Sbjct  246  DTNPNDQPEDTAMTE  260



>emb|CDX84877.1| BnaA03g13530D [Brassica napus]
Length=272

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 183/251 (73%), Gaps = 21/251 (8%)
 Frame = +3

Query  111  AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTL  290
             FG+LGNI+SF+V LAP+PTFI+IYK+KS+EGYQS+PYV+ LFSAMLWIYYA +  +  +
Sbjct  11   VFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVI  70

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            +ITIN+V   IQ  YISF+LFYA KK K  T+K +L ++V  +G I  +T F+      R
Sbjct  71   MITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHG-QKR  129

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              I+G+IC+VF+LCVFVAPL I+R+VIKT+S E+MPF LSFFLTLSAVMWFFYGLL KD 
Sbjct  130  VQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDM  189

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP--EELK  824
            NIA+PN+LGFIFG+LQM+LY++YK                    G   +E  V   +E+ 
Sbjct  190  NIALPNVLGFIFGVLQMILYMIYKK------------------PGTKVLEPPVINLQEIS  231

Query  825  EQVIDVVKLSA  857
            + V+DVV+LS+
Sbjct  232  DHVVDVVRLSS  242



>ref|XP_002511127.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51729.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 182/257 (71%), Gaps = 20/257 (8%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
             + L F FG+L NI+S MV LAP+PTF +I KKK++EG+QSVPYV+ LFSAMLW++YA  
Sbjct  4    HLSLEFLFGVLANIISSMVCLAPLPTFYQICKKKTSEGFQSVPYVIALFSAMLWLFYATF  63

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
              + TLLITINS   F++  Y+S +LFY T+K ++ T K +L  NV G+G+I ++T F+ 
Sbjct  64   DDNATLLITINSFTFFMEVGYLSVYLFYGTRKDRMLTTKLVLFFNVFGFGMIAILTLFLT  123

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
                 R  ++GWIC++FALCVFVAPL I+R+VIKTKSVE+MPF LSFFLTLSAVMWFFYG
Sbjct  124  HG-RKRVDVLGWICMIFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLSAVMWFFYG  182

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
             L+KD  + IPN+LGF FGI+QM+LY++Y+N KK                    VE+   
Sbjct  183  FLKKDIYVYIPNVLGFFFGIVQMILYLIYRNSKK-------------------PVEEPKS  223

Query  813  EELKEQVIDVVKLSAAL  863
            +E  E ++DV KLSA +
Sbjct  224  QEFSEHIVDVAKLSAVI  240



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 185/244 (76%), Gaps = 4/244 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI+SF+V+LAPVPTF++IYKKKSTEG+QSVPYVV LFSAMLW+YYA    + T
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T YI+ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            +  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA+ W  YG+  KD
Sbjct  131  QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTA-EQKLPENGSCGGGDQVEQKVPEELK  824
              +A+PN+LGFIFG+ QM+LY++Y+  K + + A E KLPE  +     + +Q    E  
Sbjct  191  IYVALPNVLGFIFGVAQMILYLIYR--KYEIAIAKEMKLPEQTTVDIVMKQKQDSSVEAI  248

Query  825  EQVI  836
            E +I
Sbjct  249  EVII  252



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 184/253 (73%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF V LAP+PTFI+IYK+KS+EGYQSVPYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    +Q  YIS + FYA KK KI T+K +L ++V  +GLI L+T F+    
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G+IC+VFAL VFVAPL I+R+VIKTKS E+MPF LSFFLTLSA+MWFFYGLL 
Sbjct  127  NKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PN+LGFIFG+LQM+L+V+YK  G K    +  KL                 ++
Sbjct  187  KDKNIALPNVLGFIFGVLQMILFVIYKKPGTKVLEPSVIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + E V+DVV+LS+
Sbjct  230  ISEHVVDVVRLSS  242



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   275 bits (703),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 182/246 (74%), Gaps = 8/246 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKKSTE +QS+PYVV LFS+MLWIYYA +  D +
Sbjct  10   FVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T Y++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLVF + VF APLCI+++VIKTKSVE+MPF LSFFLT++AVMWFFYGLL K
Sbjct  129  KRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS----CGGGDQVEQKVP  812
            DY +A+PN LGF+F I+QMVLY++Y+N K  +     KL E  S     G   ++E   P
Sbjct  189  DYYVALPNTLGFLFSIIQMVLYLIYRNAKTPD--LPMKLQELNSHTIDVGKLSRMEPSEP  246

Query  813  EELKEQ  830
              + + 
Sbjct  247  NHVTKN  252



>ref|XP_011023934.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=283

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 184/259 (71%), Gaps = 18/259 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +    AFGLLGN++S +V LAP+PTF +IYKKK++EG+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHLTWMLAFGLLGNLISCLVCLAPLPTFYQIYKKKTSEGFQSIPYVIALFSAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
             + D  LLITIN+   F++  YI  +L YATKK KI T K LLL N  G+GLI L+T F+
Sbjct  63   FSEDAILLITINTFAFFMEFGYIVVYLLYATKKDKILTFKLLLLFNSFGFGLICLLTLFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC++F+LCVFVAPL IVR+VIKTKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TQG-QKRVQVLGWICMIFSLCVFVAPLFIVREVIKTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L+KD+ +A+PNILGF+FGI+QMVLYV+Y+   K                    VE K+
Sbjct  182  GYLKKDHFVAVPNILGFLFGIIQMVLYVIYRKPMKILV-----------------VEPKL  224

Query  810  PEELKEQVIDVVKLSAALA  866
             +   E ++D+ KL  A+ 
Sbjct  225  QDLSHEHIVDIRKLGTAIC  243



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 178/255 (70%), Gaps = 17/255 (7%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             + FAFG+LGNIVSF+VYL+P+PTF +IYK+KSTEG+QS+PY V LFSAML +YYAFL  
Sbjct  8    HMAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLLLYYAFLKT  67

Query  279  DTT-LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
            D   +LITINSVG  I+ +Y+  ++ YA + AKI T K LLL N G YG I+L T F++K
Sbjct  68   DNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIVLSTFFLSK  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
                RA IVGW+C  F+LCVF APL I+R VI+TKSVEYMPF LSFFLT+ AVMWFFYGL
Sbjct  128  G-HRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAE---QKLP-----------ENG  773
            L +D+ IA PNILGF FGI QM+LY +YKN KK    AE   Q+LP           EN 
Sbjct  187  LIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKG-VLAEFKLQELPNGLVFPTLKKAENT  245

Query  774  SCGGGDQVEQKVPEE  818
                 DQ E     E
Sbjct  246  DTNPNDQPEDTAMTE  260



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 183/250 (73%), Gaps = 21/250 (8%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLL  293
            FG+LGNI+SF+V LAP+PTFI+IYK+KS+EGYQS+PYV+ LFSAMLWIYYA +  +  ++
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVIM  71

Query  294  ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRA  473
            ITIN+V   IQ  YISF+LFYA KK K  T+K +L ++V  +G I  +T F+      R 
Sbjct  72   ITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHG-QKRV  130

Query  474  HIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYN  653
             I+G+IC+VF+LCVFVAPL I+R+VIKT+S E+MPF LSFFLTLSAVMWFFYGLL KD N
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  654  IAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP--EELKE  827
            IA+PN+LGFIFG+LQM+LY++YK                    G   +E  V   +E+ +
Sbjct  191  IALPNVLGFIFGVLQMILYMIYKK------------------PGTKVLEPPVINLQEISD  232

Query  828  QVIDVVKLSA  857
             V+DVV+LS+
Sbjct  233  HVVDVVRLSS  242



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 183/259 (71%), Gaps = 18/259 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FGLLGN +S +V LAP+PTF +I KKK+++G+ S+PYV+ LFSAMLW++YA 
Sbjct  3    LHLTWVFGFGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFYAL  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
               D  LLITINS   F++  YI  +L YATKK KI T K LLL NV G+GLI ++T+F+
Sbjct  63   FKEDALLLITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTRFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC+ F+LCVFVAPL IVR+VI+TKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TQ-RQKRVQVLGWICMTFSLCVFVAPLFIVRKVIRTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L+KD  +A+PNILG +FGILQMVLY++Y+N KK                    VE K+
Sbjct  182  GFLKKDQFVAVPNILGLLFGILQMVLYMIYRNSKKVVV-----------------VEPKL  224

Query  810  PEELKEQVIDVVKLSAALA  866
              ++ E V+D+ KL AA+ 
Sbjct  225  KLDISEHVVDLEKLGAAIC  243



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 184/252 (73%), Gaps = 19/252 (8%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKKS+EG+QS+PYVV LFS+MLWIYYA +  D +
Sbjct  10   FIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T Y++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLVF + VF APLCI+++VIKT+SVE+MPF LS  LT++AVMWFFYGLL K
Sbjct  129  KRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QMVLY+VY+N K +      K+                 +EL 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKV-----------------QELN  231

Query  825  EQVIDVVKLSAA  860
              +IDVVK + A
Sbjct  232  GHIIDVVKPNHA  243



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 183/259 (71%), Gaps = 23/259 (9%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+  L+ AFGLLGNI+S +V+LAPVPTF  IYKKK+TEG+Q++PYV+GL S+ML+IYYA 
Sbjct  3    LQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYYAL  62

Query  270  LTP----DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            L      D TLLITINSVG  I+T YIS FLFYA KKA+I     L LLN   Y +++++
Sbjct  63   LKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMVVL  122

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T+F+A     R  IVGWICLVF++ VFVAPL ++RQV +TKSVE+MPF LSFFLTL AV 
Sbjct  123  TRFLATG-EMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGAVA  181

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            WFFYG L KD+ IA+PNILGF  G++QMV+Y+VYKN K+                     
Sbjct  182  WFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKEVLE------------------  223

Query  798  EQKVPEELKEQVIDVVKLS  854
            +Q   +EL E +IDV K+S
Sbjct  224  DQPKGQELSEHIIDVRKIS  242



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 184/253 (73%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF V LAP+PTFI+IYK+KS+EGYQSVPYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    +Q  YIS + FYA KK KI T+K +L ++V  +GLI L+T F+    
Sbjct  68   AMMLITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLLTYFLTHG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G+IC+VF+L VFVAPL I+R+VIKTKS E+MPF LSFFLTLSA+MWFFYGLL 
Sbjct  127  NKRVQVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PN+LGFIFG+LQM+L+V+YK  G K    +  KL                 ++
Sbjct  187  KDKNIALPNVLGFIFGVLQMILFVIYKKPGTKVLEPSVIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + E V+DVV+LS+
Sbjct  230  ISEHVVDVVRLSS  242



>ref|XP_007050795.1| Medicago truncatula MTN3 [Theobroma cacao]
 gb|EOX94952.1| Medicago truncatula MTN3 [Theobroma cacao]
Length=306

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 180/243 (74%), Gaps = 6/243 (2%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP-DTTL  290
            FGLLGNI+SF+VYLAP+PTF +I+KKKSTEG+QS+PY V LFSAML +YYAFL   D  +
Sbjct  41   FGLLGNILSFLVYLAPLPTFYRIFKKKSTEGFQSIPYSVALFSAMLLLYYAFLKKHDAFM  100

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            LITINS+GCFI++ Y+  ++ YATK A++ T K L+  N+G  G IIL+T F+    SSR
Sbjct  101  LITINSIGCFIESIYLLLYMVYATKSARVYTTKLLIFFNLGALGSIILLT-FIFSKGSSR  159

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              +VGWIC VF++CVF APL I+R VIKTK+VEYMPF LSFFLTL AV WF YG   +DY
Sbjct  160  ISVVGWICAVFSVCVFAAPLSIIRLVIKTKTVEYMPFPLSFFLTLCAVTWFLYGFSLRDY  219

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKK----ESTAEQKLPENGSCGGGDQVEQKVPEE  818
             IA PNILGFIFGI QM+LY++Y+ G+K+    E  A++ LPE+ +    + V+     +
Sbjct  220  YIATPNILGFIFGITQMILYLLYRGGRKEQILPEIKAQETLPESKAKEQANGVQLSTLNQ  279

Query  819  LKE  827
             +E
Sbjct  280  HQE  282



>ref|XP_011023933.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   273 bits (699),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 186/265 (70%), Gaps = 16/265 (6%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L     F FGLLGNI+S +V LAP+PTF +I +KK+++G+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
             + +  LLITINS   F++  YI+ +LFY+TKK KI T K LLL N+ G+GLI  +T  +
Sbjct  63   FSENAMLLITINSFTFFMEIGYIAVYLFYSTKKDKILTFKLLLLFNIFGFGLICALTLLL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC+VFALCVFVAPL +VR+VIKTKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TEGIK-RVQVLGWICMVFALCVFVAPLGVVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE--NGSC--------  779
            G L+KD  +AIPNILGFIFG+LQM LY++Y+N KK E  AE K  E     C        
Sbjct  182  GYLKKDKFVAIPNILGFIFGMLQMALYLIYRNPKKNE-VAEPKTQELSEQYCSDINIAMP  240

Query  780  ----GGGDQVEQKVPEELKEQVIDV  842
                GG +  E    ++  ++ +DV
Sbjct  241  QLNEGGNEVFEAHSAKDQTKEAMDV  265



>ref|XP_011084749.1| PREDICTED: bidirectional sugar transporter N3-like [Sesamum indicum]
Length=292

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 197/256 (77%), Gaps = 5/256 (2%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            ++  L F FG+LGN+VSF VYLAP+PTF +I+KKKSTEG+QSVPYVV L S+MLWIYYA 
Sbjct  6    IQNPLVFTFGILGNLVSFAVYLAPMPTFYRIFKKKSTEGFQSVPYVVALLSSMLWIYYAT  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  + TLLITINS GCFI++ YI+ ++ YA KK ++  +K L LLN  G+GLI++ T F+
Sbjct  66   LKSNETLLITINSAGCFIESIYIAIYIAYAPKKPRMGALKLLSLLNFVGFGLIVIFTHFL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             K    R  ++GWI +  +  V++APL I+RQVI+TKSV++MPFLLS FLTLSAVMWFFY
Sbjct  126  VKG-PERVQVLGWISVTLSASVYIAPLSIMRQVIRTKSVQHMPFLLSLFLTLSAVMWFFY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD+NIAIPN+LGF FG+LQMVLY++Y+N +K   T E+KLPE          EQK+
Sbjct  185  GLLLKDFNIAIPNVLGFSFGVLQMVLYLMYRNAEK---TKEEKLPEILQKQIIILDEQKI  241

Query  810  PEELKEQVIDVVKLSA  857
            P EL +Q+ID++KLSA
Sbjct  242  P-ELTQQIIDIIKLSA  256



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 186/247 (75%), Gaps = 7/247 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI+SF+V+LAPVPTF++I KKKSTEG+QSVPYVV LFSAMLW+YYA    + T
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T YI+ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            +  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA+ W  YG+  KD
Sbjct  131  QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTA-EQKLPENGSCGGGDQVEQKVPEELK  824
              +A+PN+LGFIFG+ QM+LY++Y+  K + + A E KLPE       D +  K  ++  
Sbjct  191  IYVALPNVLGFIFGVAQMILYLIYR--KYEIAIAKEMKLPEQTKM---DDIAMKQKQDSS  245

Query  825  EQVIDVV  845
             + I+V+
Sbjct  246  VEAIEVI  252



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 173/224 (77%), Gaps = 2/224 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FG+LGN VSF+VYL+P+PTF +IYK+KSTEG+QS+PY V LFSAML++YYA+L  
Sbjct  8    QLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYLKE  67

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             +  LL+TINS G  I+  Y++ FL YAT++AKI T K +LLLN+G YG I+ +T   AK
Sbjct  68   KNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIVALTYIFAK  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
            D  +R  IVGWIC VF++CVF APL I+R+VI+T+SVE+MPF LSFFLT+ AVMWFFYGL
Sbjct  128  D-ETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
            L KD  IA PNILGF FGI QM+LY +++N K++   A+  L +
Sbjct  187  LIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKD  230



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 183/244 (75%), Gaps = 7/244 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN+VSFMV++APVPTF +I KKKS+EG+ S+PYVVGLFSAMLWIYYA +  +
Sbjct  10   LVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TLLITINS GC  +T Y++ +  YATKKA++ T+  +LLLN G +GLI+ +TQ + + T
Sbjct  70   VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGT  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              RA ++GWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LT+SAVMWF YGLL 
Sbjct  130  -KRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KD+ +A+PNI G I G+LQM+LY +Y+N K      E++LP         +V+Q++P ++
Sbjct  189  KDFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKELPT------VVKVDQELPPKV  242

Query  822  KEQV  833
              +V
Sbjct  243  NCEV  246



>ref|XP_006281748.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
 gb|EOA14646.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
Length=290

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 181/253 (72%), Gaps = 19/253 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGN++SF V LAP+PTFI+IYK+KS+EGYQSVPYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    IQ  YIS F FYA KK KI T+K +L ++V  +GLI   T F     
Sbjct  68   AVMLITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFSTYF-PIHG  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G+IC+VFAL VFVAPL I+R+VIKTKS E+MPF LSFFLTLSAVMWFFYGLL 
Sbjct  127  NKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PN+LGFIFG+LQMVL+V+YK  G K    +  KL                 ++
Sbjct  187  KDKNIALPNVLGFIFGVLQMVLFVIYKKPGTKVLEPSVIKL-----------------QD  229

Query  819  LKEQVIDVVKLSA  857
            + E V+DVV+LS+
Sbjct  230  ISEHVVDVVRLSS  242



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 182/247 (74%), Gaps = 7/247 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L + FG+LGN+VSFMV++APVPTF +I KKKS+EG+ S+PYVVGLFSAMLWIYYA +  +
Sbjct  10   LVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TLLITINS GC  +T Y++ +  YATKKA++ T+  +LLLN G +GLI+ +TQ + + T
Sbjct  70   VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGT  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              RA ++GWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LT+SAVMWF YGLL 
Sbjct  130  -KRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KD  +A+PNI G I G+LQM+LY +Y+N K      E++LP         +V+Q+ P ++
Sbjct  189  KDVYVAVPNIPGMILGVLQMILYGIYRNSKSNNVATEKELPI------VVKVDQEQPTKV  242

Query  822  KEQVIDV  842
              +V  V
Sbjct  243  NSEVYPV  249



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 184/252 (73%), Gaps = 19/252 (8%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LAP+PTF +IYKKKS+EG+QS+PYVV LFS+MLWIYYA +  D +
Sbjct  10   FIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T +++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLVF + VF APLCI+++VIKT+SVE+MPF LS  LT++AVMWFFYGLL K
Sbjct  129  KRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QMVLY+VY+N K +      K+                 +EL 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKV-----------------QELN  231

Query  825  EQVIDVVKLSAA  860
              +IDVVK + A
Sbjct  232  GHIIDVVKPNHA  243



>ref|XP_011015361.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Populus 
euphratica]
Length=269

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 185/265 (70%), Gaps = 16/265 (6%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L     F FGLLGNI+S +V LAP+PTF +I +KK+++G+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHFTWVFGFGLLGNIISCLVCLAPLPTFYQICRKKTSQGFQSIPYVIALFSAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
             + +  LLITINS   F++  YI+ +LFYATKK KI T K LLL N+ G+GLI  +T  +
Sbjct  63   FSENAMLLITINSFTFFMEIGYIAVYLFYATKKDKILTFKLLLLFNIFGFGLICALTLLL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC+VFALCVFVAPL +VR+VIKTKSVE+MPF LSFFLTLSAVMWFFY
Sbjct  123  TEGIK-RVQVLGWICMVFALCVFVAPLGVVRKVIKTKSVEFMPFSLSFFLTLSAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE--NGSC--------  779
            G  +KD  +AIPNILGFIFG+LQM LY++Y+N KK E  AE K  E     C        
Sbjct  182  GYQKKDKFVAIPNILGFIFGMLQMALYLIYRNPKKNE-VAEPKTQELSEQYCSDINIAMP  240

Query  780  ----GGGDQVEQKVPEELKEQVIDV  842
                GG +  E    ++  ++ +DV
Sbjct  241  QLNEGGNEVFEAHSAKDQTKEAMDV  265



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 183/248 (74%), Gaps = 19/248 (8%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SFMV+LA +PT  +IYKKKST+G+QS+PY+V LFS+MLWIYYA +  D +
Sbjct  10   FIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKDAS  69

Query  288  LL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
            LL ITINS GC I+T Y++ FL YA  K ++ T+K LL+LNV G+G ++L T ++    S
Sbjct  70   LLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTG-S  128

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWICLV  + VF APLCI+++VIKTKSVE+MPF LSFFLT++AVMWFFYGLL K
Sbjct  129  KRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLK  188

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            DY IA+PN LGF+FGI+QMVLY++Y+N K +                G +   KV +EL 
Sbjct  189  DYYIALPNTLGFLFGIIQMVLYLIYRNAKPQ----------------GLEEPTKV-QELN  231

Query  825  EQVIDVVK  848
              +IDVVK
Sbjct  232  GHIIDVVK  239



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 182/247 (74%), Gaps = 7/247 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN+VSFMV++APVPTF +I KKKS+EG+ S+PYVVGLFSAMLWIYYA +  +
Sbjct  10   LVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TLLITINS GC  +T Y++ +  YATKKA++ T+  +LLLN G +GLI+ +TQ + + T
Sbjct  70   VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGT  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              RA ++GWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LT+SAVMWF YGLL 
Sbjct  130  -KRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KD  +A+PNI G I G+LQM+LY +Y+N K      +++LP         +V+Q+ P ++
Sbjct  189  KDVYVAVPNISGMILGVLQMILYGIYRNSKSNNVATKKELPTV------VKVDQEQPTKV  242

Query  822  KEQVIDV  842
              +V  V
Sbjct  243  NCEVYPV  249



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 182/247 (74%), Gaps = 7/247 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN+VSFMV++APVPTF +I KKKS+EG+ S+PYVVGLFSAMLWIYYA +  +
Sbjct  10   LVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVKTN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TLLITINS GC  +T Y++ +  YATKKA++ T+  +LLLN G +GLI+ +TQ + + T
Sbjct  70   VTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQGT  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              RA ++GWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LT+SAVMWF YGLL 
Sbjct  130  -KRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KD  +A+PNI G I G+LQM+LY +Y+N K      E++LP         +V+Q+ P ++
Sbjct  189  KDIYVAVPNIPGMILGVLQMILYGIYRNFKSNNVATEKELPT------VVKVDQEQPTKV  242

Query  822  KEQVIDV  842
              +V  V
Sbjct  243  NCEVYPV  249



>ref|XP_002865823.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42082.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 182/252 (72%), Gaps = 19/252 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF V LAP+PTF++IYK+KS+EGYQS+PYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    IQ  YIS + FYA KK K  T+K +L ++V G+G I ++T F+    
Sbjct  68   AMMLITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVLTYFLIH-A  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R H++G+IC+VFAL VF+APL I+R+VIKTKS E+MPF LSFFLTLSAVMWFFYGLL 
Sbjct  127  NKRVHVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PN+LGFIFG+LQM+L+++YK  G K       KL                 ++
Sbjct  187  KDMNIALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKL-----------------QD  229

Query  819  LKEQVIDVVKLS  854
            + E V+DVV+LS
Sbjct  230  ISEHVVDVVRLS  241



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%), Gaps = 2/224 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FG+LGN VSF+VYL+P+PTF +IYK+KSTEG+QS+PY V LFSAML++YYA+L  
Sbjct  8    HLAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLYLYYAYLKE  67

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             +  LLITINS G  I+  Y++ FL YAT++AKI T K +LLLN+G +G I+ +T   AK
Sbjct  68   KNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIVALTYIFAK  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
            D  +R  IVGWIC VF++CVF APL I+R+VIKT+SVE+MPF LSFFLT+ AVMWFFYGL
Sbjct  128  D-KTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
            L KD  IA PNILGF FGI QM+LY +++N K++   A+  L +
Sbjct  187  LIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKD  230



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 182/240 (76%), Gaps = 5/240 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNI+SFMVY+AP+PTF ++Y KKSTEG+QSVPYVV LFSAMLWIYYA +  D+
Sbjct  11   AFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLWIYYALIKTDS  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LL+TINS+GC I+T YI  +L YA KKA+I T + LLLLNVG +GLI+L+T  +AK   
Sbjct  71   YLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVLLTLLLAKGPR  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             +  ++GW+C+ F++ VFVAPL I+R VI+TKSVE+MPF LSFFLTLSA+ WF YGLL K
Sbjct  131  EQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAIAWFSYGLLTK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN----GSCGGGDQVEQKVP  812
            D  +A+PNILGFIFG++QM +Y+ YK G K+ +  + K+ E+       G G++  +  P
Sbjct  191  DIYVALPNILGFIFGVVQMGIYIAYK-GAKRAAYDQNKVAEHIITMAKLGTGERSSEVHP  249



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 170/221 (77%), Gaps = 2/221 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNI SFMV+++PVPTF  I KKKS EG+QSVPYVV LFS+MLWIYYA +  +
Sbjct  6    LIFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMVKTN  65

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TL+ITINS GC  +T Y++ +  YATK A++ T++ +LLLN GG+GLI+ +TQ + K  
Sbjct  66   ETLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQILCKG-  124

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              RA +VGWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LTLSAVMWF YGLL 
Sbjct  125  PKRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLL  184

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLP  764
            +D  + +PNI G I G+LQMVLY +Y+N K  E+  E+KLP
Sbjct  185  RDIYVTVPNIAGIILGMLQMVLYGIYRNAKPNEA-EEKKLP  224



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 184/244 (75%), Gaps = 4/244 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI+SF+V+LAPVPTF++I KKKSTEG+QSVPYVV LFSAMLW+YYA    + T
Sbjct  12   FAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLWLYYASFNSNET  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGC I+T YI+ F+ +A K+ ++ T++ +LLLN GG+ +I+L+T F+    S+
Sbjct  72   LLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHFLVHG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            +  +VGWIC+ F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA+ W  YG+  KD
Sbjct  131  QVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAITWLLYGVFLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTA-EQKLPENGSCGGGDQVEQKVPEELK  824
              +A+PN+LGFIFG+ QM+LY++Y+  K + + A E KLPE  +     + +Q    E  
Sbjct  191  IYVALPNVLGFIFGVAQMILYLIYR--KYEIAIAKEMKLPEQTTVDIVMKQKQDSSVEAI  248

Query  825  EQVI  836
            E +I
Sbjct  249  EVII  252



>emb|CDY69440.1| BnaCnng63490D, partial [Brassica napus]
Length=214

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 166/204 (81%), Gaps = 1/204 (0%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLL  293
            FG+LGNI+SF+V LAP+PTFI+IYK+KS+EGYQS+PYV+ LFSAMLWIYYA +  +  ++
Sbjct  12   FGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVIM  71

Query  294  ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRA  473
            ITIN+V   IQ  YISF+LFYA KK K  T+K +L ++V  +G I  +T F+      R 
Sbjct  72   ITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHG-QKRV  130

Query  474  HIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYN  653
             I+G+IC+VF+LCVFVAPL I+R+VIKT+S E+MPF LSFFLTLSAVMWFFYGLL KD N
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  654  IAIPNILGFIFGILQMVLYVVYKN  725
            IA+PN+LGFIFG+LQM+LY++YK 
Sbjct  191  IALPNVLGFIFGVLQMILYMIYKK  214



>ref|XP_011036129.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Populus 
euphratica]
Length=282

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 178/221 (81%), Gaps = 1/221 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            ++  L F FG+LGNI+SFMVYLAPVPTFI+I +KKSTE +QS+PY+V LFS+MLW+YYA 
Sbjct  6    MQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYYAM  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LL+TINS GC I++ YI+ ++ YAT+++++ T+K L+ +N+G + LI+L+T F+
Sbjct  66   LKNDAILLVTINSFGCVIESIYIAIYIAYATRESRVSTIKLLVSMNMGLFSLILLLTHFL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A   S+R   +GW+C+ F++CVF APL IV+Q+I+TKSVE+MPF LSFFLTLSAVMWF Y
Sbjct  126  ASG-STRVKALGWLCVAFSVCVFAAPLSIVKQIIRTKSVEFMPFTLSFFLTLSAVMWFAY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAE  752
            GL  KD  +A+PNILGF+ G+LQM+LY +Y+N KKK+  AE
Sbjct  185  GLFIKDLCVALPNILGFVLGLLQMLLYGIYRNAKKKKIPAE  225



>ref|NP_199892.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
 sp|Q9LUE3.1|SWT10_ARATH RecName: Full=Bidirectional sugar transporter SWEET10; Short=AtSWEET10 
[Arabidopsis thaliana]
 dbj|BAA96992.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAK96739.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL47380.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAM61234.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95992.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
Length=289

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 181/252 (72%), Gaps = 19/252 (8%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF V LAP+PTF++IYK+KS+EGYQS+PYV+ LFSAMLW+YYA +  D
Sbjct  8    LATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +LITINS    +Q  YIS F FYA KK K  T+K +L ++V G+G I ++T F+    
Sbjct  68   AMMLITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVLTYFIIH-A  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++G+IC+VFAL VFVAPL I+R+VIKTKS E+MPF LSFFLTLSAVMWFFYGLL 
Sbjct  127  NKRVQVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-GKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD NIA+PN+LGFIFG+LQM+L+++YK  G K       KL                 ++
Sbjct  187  KDMNIALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKL-----------------QD  229

Query  819  LKEQVIDVVKLS  854
            + E V+DVV+LS
Sbjct  230  ISEHVVDVVRLS  241



>ref|XP_002299333.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
 gb|EEE84138.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
Length=282

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            ++  L F FG+LGNI+SFMVYLAPVPTFI+I +KKSTE +QS+PY+V LFS+MLW+YYA 
Sbjct  6    MQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLWLYYAM  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LL+TINS GC I+T YI+ ++ YAT+++K+ T+K LL +N+G + LIIL+T F+
Sbjct  66   LKNDEILLVTINSFGCVIETIYIAIYIAYATRESKVSTIKLLLSMNMGLFSLIILLTHFL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A   S+R   +GW+C+ F++CVF APL IV+Q+I+TKSVE+MPF LSFFLTLSAV+WF Y
Sbjct  126  ASG-STRVKALGWLCVAFSVCVFAAPLNIVKQIIRTKSVEFMPFTLSFFLTLSAVIWFAY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ  755
            GL  KD  +A+PNILGF+ G+LQM+LY +Y+N +KK+  AE 
Sbjct  185  GLFIKDMCVALPNILGFVLGLLQMLLYGIYRNAEKKKIPAEN  226



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 173/219 (79%), Gaps = 2/219 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN VSF+V+LAP+PTF++I +KK+TEG+QS+PYVV LFSAM+W+YYA L  D  
Sbjct  12   FTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIWLYYASLKSDVL  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITINSVGCFI+  YI+ ++ YA K+A+I T++ L+L N GG+  I+L++ F  K  S+
Sbjct  72   LLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILLLSHFFVKG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  ++GW C++F++ VF APL I+R VI+TKSVE+MPF LSFFLTLSA+ W  YG+L KD
Sbjct  131  RVKVLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAITWLVYGVLVKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLP  764
            Y IAIPNI+GFIFG+LQMVLYV+YKN K      E KLP
Sbjct  191  YYIAIPNIVGFIFGVLQMVLYVIYKNFKTAVPM-EPKLP  228



>gb|KDO64482.1| hypothetical protein CISIN_1g047365mg, partial [Citrus sinensis]
Length=243

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 171/242 (71%), Gaps = 31/242 (13%)
 Frame = +3

Query  129  NIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLITINS  308
            NI SF+V LAP+PTF KIYKKKSTEG+QSVPYV+ LFSAM+WIYYA L  +   L+TIN+
Sbjct  1    NITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYYALLKQNAIFLMTINT  60

Query  309  VGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHIVGW  488
              C +QT YI+ ++FYA KK +I T+K LLLLN+ G+G I             R  I+G+
Sbjct  61   FCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAI-------------REKILGY  107

Query  489  ICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYNIAIPN  668
            IC+ FAL VF APL IVR+VIKTKSVEYMPF LSFFLT+ AV WFFYGLL KD N+AIPN
Sbjct  108  ICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFFYGLLIKDLNVAIPN  167

Query  669  ILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKEQVIDVVK  848
            +LGFIFG+LQM+LYV+YKN  KK                   VEQ   +EL E V+DVVK
Sbjct  168  VLGFIFGVLQMILYVIYKNPNKKI------------------VEQTKLQELSEHVVDVVK  209

Query  849  LS  854
            LS
Sbjct  210  LS  211



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGN++SF V+L+PVPTF +I+KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS F+ +A KKA++ T+K LLL+N GG+ LI+L+ QF+AK  S+
Sbjct  72   LLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILLLCQFLAKG-ST  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+WF YGL  +D
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWFLYGLALRD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF+ G LQM+LYVVYK  K      EQ     KLPE
Sbjct  191  IYVAFPNVLGFVLGALQMILYVVYKYCKTSSDLVEQELEAAKLPE  235



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNI+S +VYLAPVPTF +IY+KKSTEG+QS+PY+V LFS+MLW+YYA L  D
Sbjct  10   LAFAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFSSMLWLYYAMLKKD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LL+TIN+ GC I+T YI  ++ YATKK ++ T K L  +N+G +  IIL + F+ K +
Sbjct  70   VFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFAFIILFSHFLVK-S  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S RA ++GWIC+  ++CVF APL IV QVIKT+SVE+MPF LSFFLTLSA+MWF YGL  
Sbjct  129  SVRAQVLGWICVAVSVCVFAAPLSIVAQVIKTRSVEFMPFNLSFFLTLSAIMWFAYGLST  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
            KD  +A+PN+LGFI G+LQMVLYV+Y+  KK     E+KLPE+
Sbjct  189  KDTCVALPNVLGFILGLLQMVLYVIYRKAKK--VILEEKLPEH  229



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 178/234 (76%), Gaps = 9/234 (4%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L  AFG+LGN+VSF+V+LAPVPTF +IYKKKSTEG+QSVPYV  LFSAM+WIYYAFL  D
Sbjct  10   LVIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITIN+ GC I+T YIS ++ YA K+A++  ++ LLL+N GG+ LI+L++ F+A+  
Sbjct  70   EFLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLAQG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
             +R  ++GW+C+ F++ VF APL I+R VI+TKS   MPF LSFFLTLSAVMW FYGLL 
Sbjct  129  PTRVEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGLLL  185

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
            KD  +A PNILGF FG+ QM+LY +Y+N KK     +QKLP +     GD V+Q
Sbjct  186  KDLYVACPNILGFTFGVAQMILYAIYRN-KKTVLVEDQKLPVH----KGDVVKQ  234



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 171/227 (75%), Gaps = 5/227 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L   FG+LGN++SFMVYLAP+PTF +IYKKKSTEG+QS+PY+V LFS+MLW+YYA L P
Sbjct  9    HLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYASLKP  68

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             D TLLITINS+GC I+  YI  F  YATK A+  T+K  +++NVG + LI L+T F A 
Sbjct  69   ADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIFLVTYF-AM  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              S R  +VGW+C+  A+ VF APL IV QVI+TK+VE+MPF LS FLT+SAVMWFFYGL
Sbjct  128  HGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAVMWFFYGL  187

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGK---KKESTAEQKLPE  767
            L KD  IAIPNILGF  G+LQM+LY +Y+NGK   K+  T E+   E
Sbjct  188  LLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVVTKEEHALE  234



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 179/251 (71%), Gaps = 5/251 (2%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L   L F FG+LGNI+SFMV+L+P+PTF +IY+KKSTEG+QSVPYVV L S ML IYYA 
Sbjct  6    LEQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLLIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            +  +  LLITINS GCFI+T+YI+ +L YATKKA+I  ++  +LLNV  +  I+L+T+ +
Sbjct  66   VKTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVLLTR-L  124

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A     R  +VGWIC+ F+LCVF APL I+R VI+TKSVE+MPF LSFFLTL+A+ WF Y
Sbjct  125  AFTGPDRVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIAWFGY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN----GSCGGGDQV  797
            G   KD  + +PN+LGF+FG++QMV+Y++YKN   K+  A   +PE+             
Sbjct  185  GFFTKDLYVELPNVLGFVFGVVQMVVYMLYKNNNNKKDAAVAAVPEHRVKIAELSSAPAS  244

Query  798  EQKVPEELKEQ  830
            E +V  E K+Q
Sbjct  245  ELQVSLEEKDQ  255



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 188/258 (73%), Gaps = 6/258 (2%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGNI+SFM YLAP+PTF +IYK KST+G+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITINS GC I+T YI+ +L YA KKAK+ T K LLL+NVG +GLI+L+T  +
Sbjct  66   LKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +     R  ++GW+C+ F++ VFVAPL I+R V++TKSVE+MPF LSF LT+SAV+WF Y
Sbjct  126  SAG-DRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PN+LGF FG++QM LY +Y+N   K +   +++    + G  D     V
Sbjct  185  GLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPK-AVLTKEVEAATATGDDDHSAAGV  243

Query  810  PEELKEQVIDVVKLSAAL  863
                KE V+++ KLSAA+
Sbjct  244  ----KEHVVNIAKLSAAV  257



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 188/258 (73%), Gaps = 6/258 (2%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGNI+SFM YLAP+PTF +IYK KST+G+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITINS GC I+T YI+ +L YA KKAK+ T K LLL+NVG +GLI+L+T  +
Sbjct  66   LKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +     R  ++GW+C+ F++ VFVAPL I+R V++TKSVE+MPF LSF LT+SAV+WF Y
Sbjct  126  SAG-DRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PN+LGF FG++QM LY +Y+N   K +   +++    + G  D     V
Sbjct  185  GLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPK-AVLTKEVEAATATGDDDHSAAGV  243

Query  810  PEELKEQVIDVVKLSAAL  863
                KE V+++ KLSAA+
Sbjct  244  ----KEHVVNIAKLSAAV  257



>ref|XP_009337540.1| PREDICTED: bidirectional sugar transporter NEC1 [Pyrus x bretschneideri]
Length=295

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 191/259 (74%), Gaps = 23/259 (9%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L   LT AFGLLGNI+S +V+LAPVPTF  +YKKK+TEG+Q++PYV+GL S+M++IYYA 
Sbjct  3    LHHTLTLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYIYYAL  62

Query  270  LTP----DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILI  437
            L      D TL+ITINSVGC I+T YIS FLFYA KKA+I T   L LLN+  YG+++++
Sbjct  63   LKEELKEDATLVITINSVGCVIETIYISLFLFYAPKKARISTAMLLFLLNLFSYGMMVVL  122

Query  438  TQFVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVM  617
            T+F+A    +R  IV WICLVF+L VFVAPL ++RQVI+TKSVE+MPF LSFFLTL AV 
Sbjct  123  TRFLATG-ETRFKIVAWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAVA  181

Query  618  WFFYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            WFFYG L KDY IA PN+LGF+FG++QMV+YVVYKN K        KL E          
Sbjct  182  WFFYGFLIKDYYIAFPNMLGFLFGVVQMVVYVVYKNAK--------KLLE----------  223

Query  798  EQKVPEELKEQVIDVVKLS  854
            +Q   +EL E +IDV+K++
Sbjct  224  DQPKVQELSEHIIDVMKIN  242



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNIVSF+V+LAP+PTF ++ KKKSTEG+QS+PYVV LFSAMLWIYYA +  D  
Sbjct  12   FAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ GC I+T Y++ ++ +A K+A++ T++ LLLLN GG+G I+L++ F+AK +++
Sbjct  72   LLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAA  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  ++GWIC+VF++ VF APL I+R V++TKSVE+MPF LS FLTL+AVMWFFYGL  KD
Sbjct  132  RLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
              +A+PN+LGFIFG++QM+LY +Y+N ++       K+PE+
Sbjct  192  VYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEH  232



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 184/253 (73%), Gaps = 2/253 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNI+SFMV+LAP+PTFI++YKKKSTEG+QSVPYVV +FSAMLWIYYA L  ++ 
Sbjct  10   FAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYAMLKGNSV  69

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN  G  I+T Y++ F+ YA ++A+I T+K L+LLN GG+  IIL+  ++AK   +
Sbjct  70   LLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLCHYLAKG-QA  128

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  + GWIC+ F++ VFVAPL ++R VI+TKSVEYMPF LS  LTL+A +WFFYG ++KD
Sbjct  129  RLQLYGWICVAFSISVFVAPLSVIRTVIRTKSVEYMPFNLSCCLTLTATVWFFYGFVQKD  188

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
              + +PN++GFIFGI QM LY+VY     KE+  +QKLPE  S    + +E        E
Sbjct  189  LYVTLPNVVGFIFGIAQMTLYLVYSRKYGKEA-EKQKLPEVASPVKQETIEIHTINNKTE  247

Query  828  QVIDVVKLSAALA  866
             +I   ++   +A
Sbjct  248  DIIPPQEIEVVIA  260



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 188/260 (72%), Gaps = 10/260 (4%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNI SF+V+LAP+PTF ++YKKKSTEG+QSVPYV  LF+A +WIYYAFL  +
Sbjct  10   LAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFLKSN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I+T YI+ +L YATK+A++ T++ L L+N GG+  I+L+  F+++  
Sbjct  70   EILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGFCFILLLAHFLSQG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
             +R  ++GW+C+ F++ VF APL +++ VI TKSVE+MPF LSFFLTLSAVMW  YGLL 
Sbjct  129  PTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVMWLSYGLLL  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
            KD  +A PNI+GF FG++QM LY  Y+N K   +  E+KLPE  +    D V+Q      
Sbjct  189  KDLYVATPNIVGFSFGLVQMALYAKYRNNK---TNVEKKLPEQKA----DVVKQMTILTT  241

Query  822  KEQVIDVVKLSAALALTGIS  881
              +V   V++ AALAL  +S
Sbjct  242  TPEV--EVQVQAALALGRVS  259



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
             + L F FG+LGNI+SFMV+LAP+PTF +I+KKKST+G+QS+PY+V LFS+MLW+YYA +
Sbjct  4    HIHLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYYAIV  63

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
              +  LLITINS GC I+T YI  +  YATK A+I T+K  +++NVG + LI   TQF  
Sbjct  64   KTNARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQF-G  122

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
               S R  ++GWIC+ FA+CVF APLCIV +VI+TKSVE+MPF LSFFLTLSA+MWF YG
Sbjct  123  MHGSLRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWFAYG  182

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKK  734
            LL KD  IA+PN+LGF  G+LQM+LY +Y  G K
Sbjct  183  LLLKDICIALPNVLGFTLGLLQMLLYAIYNKGSK  216



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 175/227 (77%), Gaps = 3/227 (1%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+  L FAFG+LGN++SFMV+LAP+PTF ++Y+KKSTEG+ SVPYVV LFS MLWIYYAF
Sbjct  6    LQHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLWIYYAF  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            +  ++ LLITINS G FI+T YI+ +L YA KKA+I  ++  +LL+V  +  I+L+TQ V
Sbjct  66   VKTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVLLTQLV  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             K  S+R  ++GWIC+ F++ VF APL ++R VI+TKSVE+MPF LSFFLTLSA+ WF Y
Sbjct  126  FKG-SNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIAWFGY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
            GL  KD  + +PN+LGF+FGI QM+LY++YK  KKK    E  +PE+
Sbjct  185  GLFTKDIYVQLPNVLGFVFGIAQMLLYIIYK--KKKNVVVEPTVPEH  229



>gb|AFK47472.1| unknown [Lotus japonicus]
Length=260

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 179/254 (70%), Gaps = 9/254 (4%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            ++   FGLLGNIVSFMV+LAP+PTF  IYKKK +EG+QS+PYVV L SAML +YY FL  
Sbjct  8    EMVLIFGLLGNIVSFMVFLAPLPTFYTIYKKKPSEGFQSIPYVVALLSAMLLLYYGFLKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+ITIN +GC I+ SY+  ++ YA KK KI T+  +L+ ++GG GL ++IT FV K 
Sbjct  68   NALLIITINCIGCAIEVSYLMMYIIYAPKKQKISTLLLILMADIGGLGLTMIITMFVVK-  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            ++ R H VG IC +F + VF APL  +R+VIKT+SVEYMPF LS FLTL A MWFFYGL 
Sbjct  127  SAERVHAVGLICAIFNIAVFAAPLSTMRKVIKTRSVEYMPFSLSLFLTLCATMWFFYGLF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKK---ESTAEQKL-----PENGSCGGGDQ  794
             KD  I +PN+LGF+FGI QM+LY++YKN KKK   E+T +Q+      P   S  G ++
Sbjct  187  DKDNYIMMPNVLGFLFGISQMILYIIYKNAKKKVEVEATEQQEWGNTEKPAQHSNDGNNK  246

Query  795  VEQKVPEELKEQVI  836
            +      E+KE ++
Sbjct  247  LVLPSVVEMKEYIV  260



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNIVSF+V+LAP+PTF ++ KKKSTEG+QS+PYVV LFSAMLWIYYA +  D  
Sbjct  12   FAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLITIN+ GC I+T Y++ ++ +A K+A++ T++ LLLLN GG+G I+L++ F+AK +++
Sbjct  72   LLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAA  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  ++GWIC+VF++ VF APL I+R V++TKSVE+MPF LS FLTL+AVMWFFYGL  KD
Sbjct  132  RLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
              +A+PN+LGFIFG++QM+LY +Y+N ++       K+PE+
Sbjct  192  VYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEH  232



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 183/259 (71%), Gaps = 12/259 (5%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
               L FAFG+LGNI SF+V+LAP+PTF ++YKKKSTEG+QSVPYV  LF+A +WIYYAFL
Sbjct  7    HHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFL  66

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
              +  LLITINS GC I+T YI+ +L YATK+A++ T+  L L+N GG+ LI+L+  F++
Sbjct  67   KSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILLLAHFLS  126

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
            +   +R  ++GW+C+ F++ VF APL  ++ VI+TKSVE+MPF LSFFLTLSAVMW  YG
Sbjct  127  QG-PTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVMWLSYG  185

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ---  803
            LL KD  +A PNI+GF FG++QM LY  Y+N K   +  E+KLPE  +    D V+Q   
Sbjct  186  LLLKDLYVATPNIVGFSFGLVQMALYAKYRNNK---TNVEEKLPEQKA----DVVKQMTI  238

Query  804  -KVPEELKEQVIDVVKLSA  857
                 EL+ QV   V   A
Sbjct  239  LTTTPELEVQVQAAVSSHA  257



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 175/228 (77%), Gaps = 8/228 (4%)
 Frame = +3

Query  120  LLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTLLIT  299
            + GNIVSF+V+LAP+PTF ++YKKKSTEG+QSVPYV  LFSAM+WIYYAFL     LLIT
Sbjct  1    MAGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLIT  60

Query  300  INSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRAHI  479
            INS GC I+T YI+ +L YATK A++ T++ LLL+N GG+ LI+L++ F+++   +R  +
Sbjct  61   INSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQG-PTRVEV  119

Query  480  VGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYNIA  659
            +GW+C+ F++ VF APL ++R VI+TKSVE+MPF LSFFLTLSAVMW  YGLL KD  +A
Sbjct  120  LGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVA  179

Query  660  IPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
             PNILGF FG++QM LY  Y+N K   +  E+KLPE+ +    D V+Q
Sbjct  180  TPNILGFSFGVVQMALYAKYRNTK---TIVEEKLPEHKA----DVVKQ  220



>ref|XP_010045482.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Eucalyptus 
grandis]
 gb|KCW83109.1| hypothetical protein EUGRSUZ_B00063 [Eucalyptus grandis]
Length=279

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 185/255 (73%), Gaps = 23/255 (9%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            + FAFGLLGNIVSFM +LAP+PTF  IYK K T+G+QS+PYVV L SAML +YY  +  D
Sbjct  9    VAFAFGLLGNIVSFMTFLAPLPTFYGIYKTKKTQGFQSIPYVVSLLSAMLLLYYGLVKKD  68

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
            T LLITIN +GC I+T+Y++ +L YA+K  ++ T+K  L++NV GYG+++  T F++K  
Sbjct  69   T-LLITINGIGCVIETAYVAAYLIYASKNDRVLTLKLFLIMNVLGYGVVLSTTFFLSKG-  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + RA I+GWIC+ F+L VFVAPLCI+++VIKT+SVE+MP  LS FLTL A++WFFYG L 
Sbjct  127  AKRAWIIGWICMTFSLGVFVAPLCILKKVIKTRSVEFMPITLSIFLTLGAIVWFFYGFLL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGK--KKESTAEQKLPENGSCGGGDQVEQKVPE  815
            KD+ IA+PN+LGF+ G++QMVLY  YKN    + E  ++Q+ P                 
Sbjct  187  KDFFIAVPNVLGFVLGVIQMVLYATYKNANTVEVERNSQQQEP-----------------  229

Query  816  ELKEQVIDVVKLSAA  860
              +E++IDV+KLSAA
Sbjct  230  --REEIIDVMKLSAA  242



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 184/241 (76%), Gaps = 10/241 (4%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L F FG+LGNI+S MVYLAPVPTFI+I+KKKSTE +QS+PY++ LFS+MLW+YYA L 
Sbjct  7    LHLAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLWLYYAMLK  66

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             DT LL+TINS GC I+T+YI+ ++ YAT+++++ T+K L+ +N+G + LI+L+  F+  
Sbjct  67   KDTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILLLAHFLVS  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              S R  ++GW+C+  ++CVF APL I++QVI+TKSVE+MPF LSFFLTLSAVMWF YGL
Sbjct  127  G-SVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVMWFAYGL  185

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG-------SCGGGDQ  794
            L KD  IA+PNILGFI G+LQM+LY +Y+N +K E   ++KLP          S  GG +
Sbjct  186  LLKDLCIALPNILGFILGLLQMLLYGIYRNAQKVEE--KKKLPAENLKSIVILSAVGGPE  243

Query  795  V  797
            V
Sbjct  244  V  244



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 180/251 (72%), Gaps = 16/251 (6%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL +ATK A++ T+K LLL+NVGG+  I+L+ QF+AK  ++
Sbjct  72   LLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILLLCQFLAKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
              +A PN++GF  G LQM+LYVVYK  K      E++L EN               +L E
Sbjct  191  IYVAFPNVIGFALGALQMILYVVYKYCKTSSDLVEKEL-ENA--------------KLPE  235

Query  828  QVIDVVKLSAA  860
              ID++KL  A
Sbjct  236  VSIDMLKLGGA  246



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFG+LGNI+SF V+++PVPTF  I KKKS EG+QSVPYVV LFS+MLWIYYA    + T
Sbjct  2    FAFGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNET  61

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            L+ITINS GC  +T YI+ +  YATKK ++ T++ +LLLN GG+GLI+ +TQ + K  + 
Sbjct  62   LIITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKG-AK  120

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA ++GWIC+ F++ VFVAPL I+ +VI+TKSVE+MPF LS  LTLSAVMWF YGLL +D
Sbjct  121  RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLRD  180

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLP  764
              + +PNI G + G+LQMVLY +Y+N K  ++  E+KLP
Sbjct  181  IYVTVPNIAGMVLGVLQMVLYGIYRNAKPNQA-EEKKLP  218



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 179/248 (72%), Gaps = 16/248 (6%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS F+ +A+KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
              +A PN++GF+ G LQM+LYVVYK  K      E++L                  +L E
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEA---------------AKLPE  235

Query  828  QVIDVVKL  851
              ID+VKL
Sbjct  236  VSIDMVKL  243



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGNIVS  VYLAPVPTF +IYKKKSTEG+QS+PYVV LFSAMLWIYYA L  +
Sbjct  9    LVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWIYYALLKTN  68

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             T+LITIN +GC I+T YI+ +L YA K  KI T+K LLLLN+G YGLI+L++    K  
Sbjct  69   VTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLLSFLFFKG-  127

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  +VGW+C  F++ VF APL I+R+VI+TKSVE+MP  LSFFLTL AV WFFYG+L 
Sbjct  128  FGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFWFFYGILM  187

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
            KD  IAIPN+LGF  G+ QM+LY++Y++  KK    E KLPE
Sbjct  188  KDLYIAIPNVLGFALGVAQMILYIIYRDS-KKHLIVELKLPE  228



>ref|NP_196821.1| senescence-associated protein 29 [Arabidopsis thaliana]
 sp|Q9FY94.1|SWT15_ARATH RecName: Full=Bidirectional sugar transporter SWEET15; Short=AtSWEET15; 
AltName: Full=Senescence-associated protein 29 [Arabidopsis 
thaliana]
 emb|CAC05445.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
 gb|AAK76623.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AAM44982.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AED91859.1| senescence-associated protein 29 [Arabidopsis thaliana]
Length=292

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN++SF+V+LAPVPTF +IYK+KSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALIKKD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YAT++ +I  MK  + +NV  + LI+++T FV K  
Sbjct  70   AFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVVKTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              +  ++GWIC+  ++ VF APL IV +VIKTKSVEYMPF LSFFLT+SAVMWF YGL  
Sbjct  130  PLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKE---STAEQKL  761
             D  IAIPN++GF+ G+LQMVLY+VY+N  +K    +++EQ+L
Sbjct  190  NDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQL  232



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 183/238 (77%), Gaps = 6/238 (3%)
 Frame = +3

Query  87   LLRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYA  266
            + R    F FGL+GN++SFMV+LAP+PTF +IYKKK+ EG+Q++PYVV LFSAMLWIYYA
Sbjct  3    MTRESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIYYA  62

Query  267  FLTPDTTLL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQ  443
            F+  ++ LL ITIN+ G  +++ YI+FFLFYA KK+++ T+K LLLLNV G+G ++L T 
Sbjct  63   FVKRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLATL  122

Query  444  FVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWF  623
            +++K  + R  I+GWICLVF + VF APL I+ +VI+T+SVEYMPF LSF LT++AVMWF
Sbjct  123  YLSKG-AKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMWF  181

Query  624  FYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQV  797
            FYG+L +DY +A+PN LGF+FGI+QMV+Y++Y+N        E+K+   G    GD +
Sbjct  182  FYGMLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA--TPVVIEEKV--KGQEMSGDHI  235



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 187/260 (72%), Gaps = 3/260 (1%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGNI+SFM YLAP+PTF +IYK KST+G+QS+PYVV LFSAMLWIYYA 
Sbjct  6    LQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITINS GC I+T YI+ +L YA KKA++ T + LLL+NVG +GLI+L+T  +
Sbjct  66   LKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +     R  ++GW+C+ F++ VFVAPL I+R V++TKSVE+MPF LS  LT+SAV+WF Y
Sbjct  126  SAG-PRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PN+LGF FG++QM LY +Y+N   K ST   K  E  +    D      
Sbjct  185  GLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRSTMVAKEVEATATDDDDAASPTA  244

Query  810  PEELKEQVIDVVKLSAALAL  869
               +KE V+++ KLSAA A+
Sbjct  245  --GVKEHVVNIAKLSAAAAI  262



>ref|XP_010243612.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=270

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 182/243 (75%), Gaps = 7/243 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFGLLGNIVSFMVYLAPVPTF +IYKKKSTEG+QS+PYVV L SAMLWIYYA L  +
Sbjct  10   LAFAFGLLGNIVSFMVYLAPVPTFYRIYKKKSTEGFQSIPYVVALLSAMLWIYYAMLKNE  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              +L TIN +GC I+  YI+ +L YA K+A++ T+K LLLLNVG YGLI+L+T  +  + 
Sbjct  70   GAMLETINGIGCSIEAIYITIYLVYAPKEARVFTLKLLLLLNVGAYGLILLLTF-LLTNG  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S +  +VGWIC  F++ VF +PL I+RQVI+TKSVE+MPFLLSFFLTL AV+WF YGLL+
Sbjct  129  SRQVMVVGWICAGFSISVFASPLSIMRQVIRTKSVEFMPFLLSFFLTLCAVLWFCYGLLK  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEEL  821
             D  IAIPN+LGF FGI QM+LY+VYK+  KK+   E KLP+         +     EEL
Sbjct  189  NDLYIAIPNVLGFAFGITQMILYMVYKD-TKKDFKCEVKLPQ-----LNPNINSITTEEL  242

Query  822  KEQ  830
            K Q
Sbjct  243  KAQ  245



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 173/225 (77%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGN++SF V+L+PVPTF +I+KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YI+ F+ +A KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LTLSAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSVSLTLSAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF+ G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLMEKELEAAKLPE  235



>sp|Q9FPN0.1|NEC1_PETHY RecName: Full=Bidirectional sugar transporter NEC1; AltName: 
Full=NEC1 [Petunia x hybrida]
 gb|AAG34696.1| NEC1 [Petunia x hybrida]
Length=265

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 178/250 (71%), Gaps = 2/250 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            DL+F FGLLGNIVSFMV+LAPVPTF KIYK+KS+EGYQ++PY+V LFSA L +YYA+L  
Sbjct  8    DLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLLYYAYLRK  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+++IN  GC I+ +YIS FLFYA +K+KI T   L+LL +G  G+++ IT  +A +
Sbjct  68   NAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFT-GWLMLLELGALGMVMPITYLLA-E  125

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S R  IVGWIC    + VF APL I+RQVIKTKSVE+MPF LS FLTL A MWFFYG  
Sbjct  126  GSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFYGFF  185

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            +KD+ IA PNILGF+FGI+QM+LY VYK+ K+ +      + E      G ++   + ++
Sbjct  186  KKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIIINIEDD  245

Query  819  LKEQVIDVVK  848
              +  +  ++
Sbjct  246  NSDNALQSME  255



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 171/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+  YIS F+ +A+KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF+ G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPE  235



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN++SF+V+LAPVPTF +IYK+KSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALIKKD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YAT++ +I  MK  + +NV  + LI+++T FV K  
Sbjct  70   AFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVVKTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              +  ++GWIC+  ++ VF APL IV +VIKTKSVEYMPF LSFFLT+SAVMWF YGL  
Sbjct  130  PLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKE---STAEQKL  761
             D  IAIPN++GF+ G+LQMVLY+VY+N  +K    +++E++L
Sbjct  190  NDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEEQL  232



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 167/225 (74%), Gaps = 4/225 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNI+S MV+L+P+PTF ++Y+KKSTEG+QS PYVV LFS MLWI+YA L    
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWIFYALLKTGA  71

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LL+TIN VGC I+T YI+ +L YA + A++ T K LL LNVG +GL+ L+T  V  + +
Sbjct  72   VLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVSLVT-MVLSNGN  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R H++GWIC+  AL VF APL I+RQVI+TKSVE+MPF LSFFL LSAV+WF YG L+K
Sbjct  131  LRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAVIWFAYGALKK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTA---EQKLPEN  770
            D  +A PN+LGF+FG+ QM LY+ Y+N K   +     E KLPE+
Sbjct  191  DVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEH  235



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 171/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL YA KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R+VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRKVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPE  235



>gb|AGL98401.1| sucrose transporter SWEET9 [Nicotiana attenuata]
Length=272

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 168/213 (79%), Gaps = 2/213 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            +L F FGLLGNIVSFMV+LAPVPTF KIYKK S+EG+Q++PYVV LFSA L +YYA+LT 
Sbjct  8    ELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLLYYAYLTK  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L++TIN+ GC I+ +YI  FLFYA+KK+K+ T+  L+LL+VG  G+++L +   AK 
Sbjct  68   NAFLIVTINAFGCVIELTYIFLFLFYASKKSKMTTV-WLMLLDVGALGIVMLFSYLFAKG  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            T  R  IVGWIC +  + VF APL I+RQVIKTKSVE+MPF LS FLTL A MWFFYG  
Sbjct  127  TK-RVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFYGYF  185

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKK  737
            +KDY IA+PN+LGF+ GI+QM+LY+VYK  ++K
Sbjct  186  KKDYYIALPNVLGFLLGIVQMILYIVYKYARRK  218



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 186/256 (73%), Gaps = 21/256 (8%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FG++GNI+SF V+LAP+PTF +IYKKKSTEG+QS+PYVV LFSAMLWIYYAF+
Sbjct  5    RESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFV  64

Query  273  TPDTTLL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
              +T LL ITIN+ G  +++ Y+S FL YA +K ++ T+K LLLLNV G+G ++L T ++
Sbjct  65   KRETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYL  124

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +K  + R  I+GWICLVF + VF APL I+R+VIKT+SVEYMPF LS FLT++AVMWFFY
Sbjct  125  SKG-AKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFY  183

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL +DY +A+PN LGF+FGI+QMV+Y++Y+N                       +E+ V
Sbjct  184  GLLLRDYYVALPNTLGFVFGIIQMVMYLMYRNATP------------------VALEEPV  225

Query  810  -PEELKEQVIDVVKLS  854
              +EL   +IDVVK+ 
Sbjct  226  KAQELNGHIIDVVKIG  241



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 179/260 (69%), Gaps = 9/260 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNI+S MV+L+P+PTF ++Y+KKSTEG+QS PYVV LFS +LW+YYAFL    
Sbjct  12   AFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLLWMYYAFLKSGA  71

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LL+TIN VGC I+T YI+ +L YA K A++ T K  L L+VG +GLI L+T  V+  T 
Sbjct  72   ELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIALVTMLVSAGT-  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  IVGWIC+  AL VF APL I+R VI+TKSVE+MP  LSFFL LSAV+WF YGLL+K
Sbjct  131  LRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAVIWFAYGLLKK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ--KLPEN------GSCGGGDQVE  800
            D  +A+PN+LGF+FG+ QM LY+ Y+N     +   Q  KLPE+       +  GG   E
Sbjct  191  DVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHVKEVTTNTKLGGAPTE  250

Query  801  QKVPEELKEQVIDVVKLSAA  860
             ++    +   IDV+  SAA
Sbjct  251  GRISCGAEVHPIDVMPTSAA  270



>ref|XP_010112742.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
 gb|EXC34700.1| Bidirectional sugar transporter NEC1 [Morus notabilis]
Length=254

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 173/235 (74%), Gaps = 7/235 (3%)
 Frame = +3

Query  120  LLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT--PDTTLL  293
            +LGNIVSF+VYLAP+PTF +I++KKSTEG+Q++PY V LFSAML +YY  L   P+  ++
Sbjct  2    VLGNIVSFLVYLAPLPTFYRIFRKKSTEGFQAIPYSVALFSAMLTLYYGILKGLPNGVMI  61

Query  294  ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSRA  473
            ITINS+GC I++ Y+  FL YA  K +I T+K L+L N+G YGLI+L T FV K  S R 
Sbjct  62   ITINSIGCAIESIYLIVFLIYAPGKVRIYTIKLLVLFNMGAYGLILLSTSFVGK-ISQRV  120

Query  474  HIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDYN  653
             +VGWIC VF++CVF APL I+R VIKT+SVEYMPF LSF LTL AVMWFFYGLL  D+ 
Sbjct  121  TVVGWICAVFSVCVFAAPLSIIRLVIKTRSVEYMPFALSFCLTLCAVMWFFYGLLVNDFF  180

Query  654  IAIPNILGFIFGILQMVLYVVYKNGKKKESTAE---QKLPENGSCGGGDQVEQKV  809
            IA PNILGF+FGI QM+LY+V+KN  KKE   E   Q++P N +       E  V
Sbjct  181  IASPNILGFLFGIAQMILYLVFKN-SKKEVLPEFKLQEMPPNVAAQANAVQEATV  234



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 170/234 (73%), Gaps = 4/234 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
            TF FG+LGNI+S +VYLAPV TF ++Y+KKSTE + S+PY+V LFS+MLW+YYA L  D 
Sbjct  11   TFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLWLYYALLKTDA  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINS GC I+  YI+ F+ YA   AK  T+K   L+NVG + LI L+TQF A   S
Sbjct  71   MLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFLVTQF-AVGHS  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GWIC+  ++ VF APL IV QVI+T+SVE+MPF LSFFLTLSA+ WF YGLL K
Sbjct  130  YRVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAITWFAYGLLLK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN--GSCGGGDQVE  800
            D  IA+PN+LGF+ G+LQM+LY +Y+N K +E   E+KL E+   +    DQV 
Sbjct  190  DICIAVPNVLGFVLGLLQMLLYAIYRNYKTEED-QEKKLSEHMRNTLATSDQVH  242



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI+SF V+L+PVPTF +I+KKK+TE +QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YI+ F+ +ATKKA++ T+K LLL+N GG+ LI+L+ QF+AK  S+
Sbjct  72   LLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKG-ST  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  +D
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLALRD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>ref|XP_007205793.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
 gb|EMJ06992.1| hypothetical protein PRUPE_ppa010594mg [Prunus persica]
Length=244

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 170/244 (70%), Gaps = 8/244 (3%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNIVSFMV+LAP+PTF  IYKKKS++G+QS+PYVV L SAML +YY  L  
Sbjct  8    QLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSAMLLLYYGVLKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+I+IN +GC I+  Y+ F++ +A+KK KI TM  +LL+NV  +GL++ +T F+  +
Sbjct  68   NAFLIISINGIGCVIEIIYLIFYIVHASKKDKITTMSLILLVNVAAFGLVMAVTLFLLGE  127

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             + R   VGW+C VF + VF APL IVRQVI+TKSVEYMPF LSFFLTL A MWFFYGL 
Sbjct  128  -AKRVSAVGWMCAVFNIAVFAAPLSIVRQVIRTKSVEYMPFSLSFFLTLCATMWFFYGLF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
             KDY IA+PN+LGF+ G+ QM+LY+ YKN  K ++       EN       +  +  P E
Sbjct  187  TKDYYIALPNVLGFLLGVAQMILYLKYKNSGKNDA-------ENKGSQEMKKFHEPQPPE  239

Query  819  LKEQ  830
               Q
Sbjct  240  ADAQ  243



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI+SF V+L+PVPTF +I+KKK+TE +QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YI+ F+ +ATKKA++ T+K LLL+N GG+ LI+L+ QF+AK  S+
Sbjct  72   LLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKG-ST  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  +D
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLALRD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 170/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL YA KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPE  235



>gb|KDP22572.1| hypothetical protein JCGZ_26403 [Jatropha curcas]
Length=289

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 182/244 (75%), Gaps = 5/244 (2%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFGLLGNI SF+V+LAP+PTFI++ KKKSTEG+QS PY+V LFSA + +YYA L  D 
Sbjct  11   AFAFGLLGNITSFVVFLAPIPTFIRVCKKKSTEGFQSFPYLVSLFSASILLYYATLKTDG  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
              L+TINS GCFI+T YI+ F+ YA K+A++ T++ LLL + GG+ LI+L++ F+AK  S
Sbjct  71   FFLMTINSFGCFIETIYIALFIVYAPKQARMSTLRILLLFDFGGFCLILLLSHFLAKGPS  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R  ++GW+ +VF+  VF APL I+R VIKTKSVE++PF LSFFLTLSA+MW FYG+L K
Sbjct  131  ARIQMLGWVNVVFSFAVFAAPLSIMRVVIKTKSVEFLPFPLSFFLTLSAIMWLFYGILVK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVE-QKVPEEL  821
            D  IA PN+LGF+ G++QM+L+V+Y+N K      + +L +N      D ++ + +  E+
Sbjct  191  DLYIAGPNVLGFLCGVVQMILFVIYRNHKPATVAKDPELQQNSV----DDIKLESITCEM  246

Query  822  KEQV  833
            +E V
Sbjct  247  QEAV  250



>ref|XP_009783143.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=263

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 182/257 (71%), Gaps = 2/257 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            +L F FGLLGNIVSFMV+LAPVPTF KIYKK S+EG+Q++PYVV LFSA L +YYA+LT 
Sbjct  8    ELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLLYYAYLTK  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L++TIN+ GC I+  YI  FLFYA+KK+K+ T+  L+LL+VG  G+++L +   AK 
Sbjct  68   NAILIVTINAFGCVIELIYILLFLFYASKKSKMTTV-WLMLLDVGALGIVMLFSYLFAKG  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             S R  IVGWIC    + VF APL I+RQVIKTKSVE+MPF LS FLTL A MWFFYG  
Sbjct  127  -SKRVEIVGWICATVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFYGYF  185

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            +KDY IA+PN+LGF+ GI+QM+LY+VYK  ++K +   +    + +       E K    
Sbjct  186  KKDYYIALPNVLGFLLGIVQMILYIVYKYARRKYNREWELEGIDINIKTDGDFEHKFVSS  245

Query  819  LKEQVIDVVKLSAALAL  869
            +++  ++   +++ L L
Sbjct  246  MEKPSLENGDMTSVLTL  262



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 181/253 (72%), Gaps = 15/253 (6%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN  GCFI+T YIS F+ +ATKKA++ T+K LLL+NVGG+  I+L+ QF+ K  ++
Sbjct  72   LLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
              +A PN++GF+ G LQM+LYVVYK  K      E++L              K+P+E+  
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELE-----------TAKLPDEVS-  238

Query  828  QVIDVVKLSAALA  866
              ID++KL   +A
Sbjct  239  --IDMLKLGTLIA  249



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 187/257 (73%), Gaps = 20/257 (8%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FGLLGNI+SF V+L+P+PTF  I+KKKSTEG+QS+PYVV LFSAMLWIYYAF+
Sbjct  5    RESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIYYAFV  64

Query  273  TPDTTLL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
              +  LL ITIN+ G  +++ Y+  FL YATKK+++ T+K LLLLNV G+G ++L T ++
Sbjct  65   KREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLSTLYL  124

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            AK  + R  I+GWICLVF + VF APL I+ +VI+T+SVEYMPF LSFFLT++AVMWFFY
Sbjct  125  AKG-AKRLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMWFFY  183

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KDY +A+PN LGF+FGI+QMV+Y++Y+N           +P +G   G        
Sbjct  184  GLLLKDYYVALPNTLGFVFGIIQMVMYLIYRNA--------TPVPLDGPVKG--------  227

Query  810  PEELK-EQVIDVVKLSA  857
             +EL    ++DVVK+ +
Sbjct  228  -QELSGGHIVDVVKIGS  243



>ref|XP_002450786.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
 gb|EES09774.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
Length=291

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 189/263 (72%), Gaps = 10/263 (4%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPV--PTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYY  263
            L+  + FAFGLLGNI+SFM YLAP+  PTF +IYK KST+G+QSVPYVV LFSAMLWIYY
Sbjct  6    LQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALFSAMLWIYY  65

Query  264  AFLTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQ  443
            A L  +  LLITINS GC I+T YI  +L YA KKAK+ T K LLLLNVG +GLI+L+T 
Sbjct  66   ALLKSNEFLLITINSAGCVIETLYIVMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTL  125

Query  444  FVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWF  623
             ++     R  ++GW+C+ F++ VFVAPL I+RQV++T+SVE+MPF LS  LT+SAV+WF
Sbjct  126  LLSAG-QHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWF  184

Query  624  FYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ  803
             YGLL KD  +A+PN+LGF FG++QM LY +Y+N   +   A++   ++ +  G      
Sbjct  185  LYGLLIKDKYVALPNVLGFSFGVVQMGLYALYRNATPRVPPAKEVTDDDAAADG----TF  240

Query  804  KVPEELKEQVIDVVKLSAALALT  872
            K+P    E V+ + KL+A  A++
Sbjct  241  KLP---GEHVVTIAKLTAVPAVS  260



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 170/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL YA KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPE  235



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNI+SFMVYLAP+PTF ++YK+KSTEG+QSVPYVV LFSAMLWI YAFL  D 
Sbjct  12   AFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWISYAFLKTDA  71

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITINSVGC I+T YI     YA K  KI T K +LL+ V  +GLI+L+T  ++ + +
Sbjct  72   CLLITINSVGCAIETVYI----VYAPKATKIFTAKLVLLVIVAMFGLILLLTLLLS-EGA  126

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  I+GWIC+ F++ VFVAPL ++R VI+TKSVE+MPF LSFFLTLSAV+WF YGLL +
Sbjct  127  KRVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFAYGLLIR  186

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
            D  +++PN+LGFIFGILQM LYV YK+ +KK +  EQ+ PE+
Sbjct  187  DLYVSLPNVLGFIFGILQMALYVAYKD-RKKAAVVEQEPPEH  227



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 181/253 (72%), Gaps = 15/253 (6%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN  GCFI+T YIS F+ +ATKKA++ T+K LLL+NVGG+  I+L+ QF+ K  ++
Sbjct  72   LLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELKE  827
              +A PN++GF+ G LQM+LYVVYK  K      E++L              K+P+E+  
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELE-----------TAKLPDEVS-  238

Query  828  QVIDVVKLSAALA  866
              ID++KL   +A
Sbjct  239  --IDMLKLGTLIA  249



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGL+GNI+SF V+L+PVPTF +I+KKK+TE +QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YI+ F+ +ATKKA++ T+K LLL+N GG+ LI+L+ QF+AK  S+
Sbjct  72   LLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILLLCQFLAKG-ST  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  +D
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLALRD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 170/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL YA KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPE  235



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 170/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL YA KKA++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPE  235



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 183/258 (71%), Gaps = 17/258 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+  L FAFGLLGNI+SFM YLAP+PTF +IYK KST+G+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  +  LLITIN+ GC I+T YI+ +L YA KKAK+ T K LLLLNVG +GLI+L+T  +
Sbjct  66   LKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +    +R  I+GW+C+ F++ VFVAPL I+RQV++T+SVE+MPF LS  LT+SAV+WF Y
Sbjct  126  SAG-QNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQ--  803
            GLL KD  +A+PN+LGF FG++QM LY +Y+N   +    E            D  E   
Sbjct  185  GLLIKDKYVALPNVLGFSFGVIQMGLYALYRNATPRVPAKEV----------ADDKEDII  234

Query  804  KVPEELKEQVIDVVKLSA  857
            KVP    E V+ + KL A
Sbjct  235  KVP----EHVVTIAKLGA  248



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 171/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL +A KKA++ T+K LLL+N GG+ LI+L++QF+AK T +
Sbjct  72   LLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLSQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF  G LQM+LYVVY+  K      E+     KLPE
Sbjct  191  IYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKEVEAAKLPE  235



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +3

Query  111  AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTL  290
            AFG+LGNI+SF+VYLAPVPTF +IY+KKSTE +QS+PY+V LFS+MLW YYA +  +  L
Sbjct  13   AFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLWFYYALVKQNAFL  72

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            L+TIN  GC I+T YI  F+ YA K ++  T+K  + +NVG + LI+L+T F+A D S+R
Sbjct  73   LVTINCFGCVIETIYIILFITYAPKGSRNSTVKLFVSMNVGVFSLILLLTHFLATD-STR  131

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              I+GWIC+  ++ VF APL IV QVI+TKSVE+MPF+LSFFLTLSA+MWF YGL +KD 
Sbjct  132  ILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAIMWFAYGLFQKDI  191

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE  767
             +A+PNI+GF+ G+ QM+LYV+YKN  K     E+KLPE
Sbjct  192  CVALPNIVGFLLGLTQMLLYVIYKNANKV-IIEEKKLPE  229



>gb|KDP22573.1| hypothetical protein JCGZ_26404 [Jatropha curcas]
Length=285

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 181/259 (70%), Gaps = 19/259 (7%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FG+L NI+S MV LAP+PTF +I KKK++EG+QS+PYV+ LFSAMLW++YA 
Sbjct  3    LHLSGVFIFGVLANIISAMVCLAPLPTFYQICKKKTSEGFQSIPYVIALFSAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
               + TLLITIN+   F++  YI  +L YATK  ++ T+K +L  NV G+G I ++T F+
Sbjct  63   FDNNATLLITINTFTFFMEICYIIVYLIYATKNDRMFTIKLVLFFNVFGFGTICILTLFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
                  R  ++GWIC+VFALCVFVAPL I+R+VIKTKSVE+MPF LSFFLTL+AVMWFFY
Sbjct  123  THG-RKRVDVLGWICMVFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLTAVMWFFY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            G L+KD  +A+PN LGF+FGI+QMV+Y++Y+          QKL           VE+  
Sbjct  182  GFLKKDIYVAVPNTLGFLFGIIQMVIYLIYRK--------PQKL----------TVEEPK  223

Query  810  PEELKEQVIDVVKLSAALA  866
              EL + ++DV KLSA L 
Sbjct  224  LRELSDHIVDVAKLSATLC  242



>ref|XP_007038077.1| Medicago truncatula MTN3, putative [Theobroma cacao]
 gb|EOY22578.1| Medicago truncatula MTN3, putative [Theobroma cacao]
Length=289

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 176/222 (79%), Gaps = 3/222 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F  GLLGNI SF+V+LAP+PTFI++ KKKSTEG+QSVPYVV LFSAMLW+YYAF+     
Sbjct  12   FISGLLGNISSFVVFLAPLPTFIRVCKKKSTEGFQSVPYVVALFSAMLWMYYAFVKSGAF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GC ++T+YI+ ++ YA K+A++ T++ LLL+N GG+  I+L+++F+AK  S+
Sbjct  72   LLVTINSFGCVVETAYIAIYIAYAPKQARMFTLRILLLMNFGGFCSILLVSRFLAKG-SN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R  ++GWIC+ FA  VF APL I+RQVI+TKSVE+MPF LSFFLTLSA+MW  YG+  KD
Sbjct  131  RVEVLGWICVAFATGVFAAPLSIIRQVIRTKSVEFMPFYLSFFLTLSAIMWLLYGIFLKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG  773
              IAIPN+LGFIFG+LQMVLY +Y+N K    T E + PE+ 
Sbjct  191  LYIAIPNVLGFIFGLLQMVLYAIYRNSKT--VTKEVEAPEHS  230



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGN++SF+V+LAP+ TF +I+KKKSTEG+QS+PY+V LFS+MLW+YYA L  D
Sbjct  8    LAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALLKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LL+TINS GC I+  YI  ++ YAT+ A+  T+K    +NVG + LI+L+T F A   
Sbjct  68   AMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHF-AVHG  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S R  ++GWIC+  ++ VF APL IV QV++TKSVE+MPF LSF LTLSA+MWF YGL  
Sbjct  127  SLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKK-ESTAEQKLP  764
            KD  IA+PN+LGF  G+LQM+LY +Y+NG KK +   E+K P
Sbjct  187  KDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAP  228



>ref|XP_010453373.1| PREDICTED: bidirectional sugar transporter SWEET15 [Camelina 
sativa]
Length=296

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN +SF+V+LAPVPTF +IYKKKSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YAT++ +I  MK  + +NV  + LI+++T FV K  
Sbjct  70   AFLLITINSFGCVVETIYIAMFFAYATREKRISAMKLFIAINVAFFSLILMVTHFVVKTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + +  ++GWIC+  ++ VF APL IV +VIKTKSVE+MPF LSFFLT+SAVMWF YGL  
Sbjct  130  TLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNG------KKKESTAEQKL  761
             D  IAIPN++GF+ G+LQMVLY +Y+N       +KK +++EQ+L
Sbjct  190  HDICIAIPNVVGFVLGMLQMVLYGIYRNSSEKPEMEKKINSSEQQL  235



>emb|CDX87161.1| BnaC09g04760D [Brassica napus]
Length=277

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GC I+T YI+ F+ +ATK+A++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF+ G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>ref|NP_001149028.1| LOC100282648 [Zea mays]
 gb|ACG33879.1| MTN3 [Zea mays]
Length=307

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 164/237 (69%), Gaps = 9/237 (4%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNIVS MV+L+P+PTF ++Y+ KSTEG+QS PYVV LFS MLWI YA L P  
Sbjct  12   AFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLKPGA  71

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LL+TIN VGC ++T Y++ +L YA K A++   K LL LNV  +GL+ L+T  ++ D  
Sbjct  72   ELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTMLLS-DAG  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R H++GWIC+  +L VF APL I+RQVI+TKSVE+MP  LSFFL LSAV+WF YG L+K
Sbjct  131  LRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAYGALKK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKK--------KESTAEQKLPENGSCGGGD  791
            D  +A PN+LGF+FG+ QM LY+ Y   +K         E + E+      SCGG +
Sbjct  191  DVFVAFPNVLGFVFGLAQMALYMAYSRNRKPAAALVILPEQSKEEAAEGKASCGGAE  247



>ref|XP_009141677.1| PREDICTED: bidirectional sugar transporter SWEET12 [Brassica 
rapa]
Length=277

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GC I+T YI+ F+ +ATK+A++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF+ G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 181/266 (68%), Gaps = 14/266 (5%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L  AFGLLGNI+SFMVYLAP+PTF +IYKKKSTEG+QS+PY+V LFS+MLW+YYA L P
Sbjct  9    HLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAVLKP  68

Query  279  -DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             D TLLITINSVG  I+T YI  F  YAT  A+  T+K  +++NVG + LI L+T F   
Sbjct  69   ADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIFLVT-FFTM  127

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              + R  +VGW+C+  ++ VF APL IV QVI+TK+VE+MPF LS FLTLSA+ WF YG 
Sbjct  128  HGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAITWFSYGF  187

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN------GSCGG----  785
              KD  IAIPN+LGF  G++QM+LY +Y+NGK K  T E+ +         G+C G    
Sbjct  188  FLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLGTCEGYPVQ  247

Query  786  --GDQVEQKVPEELKEQVIDVVKLSA  857
               ++ E+ +    KE+ ++  +  A
Sbjct  248  IMDEEKEKGIYGREKEKGVEAKECPA  273



>ref|XP_008441813.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
NEC1-like [Cucumis melo]
Length=264

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 180/250 (72%), Gaps = 4/250 (2%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L F FGLLGNI+S MV+LAPVPTF +IYKKK++EG+Q +PYVV L SAML +YYA L 
Sbjct  7    LQLQFIFGLLGNIISLMVFLAPVPTFWRIYKKKTSEGFQCIPYVVALMSAMLLLYYAVLK  66

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             +  LLI+INS GC I+  YI+ + +YA KK KI T+K L++LN+G YG+++  T  +  
Sbjct  67   TNAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGGTMLILH  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
              + R H VGWIC  F L VF +PL I+++VI+TKSVEYMPF LSFFLTLSA MWFFYG 
Sbjct  127  G-NKRTHAVGWICAAFNLAVFASPLTIMKRVIRTKSVEYMPFFLSFFLTLSATMWFFYGF  185

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG-SCGGGDQVEQKVP  812
              KD  IA+PNI+GF+ G++QM++Y++YK+  +K ++ E+KL E G +    DQ   KV 
Sbjct  186  FIKDLFIALPNIVGFLLGMVQMIMYMIYKD--RKGNSLEEKLEEGGKNYEVDDQSLSKVK  243

Query  813  EELKEQVIDV  842
            +  + +  ++
Sbjct  244  KSNQSETKEI  253



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 175/239 (73%), Gaps = 10/239 (4%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            + FAFGLLGNI+SFM YLAP+PTF +IYK KSTEG+QSVPYVV LFSAMLWIYYA L  +
Sbjct  10   MAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLWIYYALLKSN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I+T YI+ +L YA KKAK+ T K LLLLNVG +GLI+L+T  ++   
Sbjct  70   ELLLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILLLTLLLSAG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++GW+C+ F++ VFVAPL I+RQV++T+SVE+MPF LS  LT+SAV+WF YGLL 
Sbjct  129  QRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVVWFLYGLLI  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
            KD  +A+PN++GF FG++QM LY +Y+N       A  ++P        D  + K P E
Sbjct  189  KDKYVALPNVIGFSFGVVQMGLYALYRN-------ATPRVPAKDVA--DDASKDKAPGE  238



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN++SF+V+LAPVPTF +IYKKKSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKKD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YATK  +I  +K  + +NV  + LI+++T FV +  
Sbjct  70   AFLLITINSFGCVVETLYIAMFFAYATKDKRISALKLFIAMNVAFFSLILMVTHFVVETP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + +  ++GWIC+  ++ VF APL IV +VIKTKSVE+MPF LSFFLT+SAVMWF YGL  
Sbjct  130  TLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNG------KKKESTAEQKL  761
             D  IAIPN++GF+ G+LQMVLY VY+N       +KK +++EQ+L
Sbjct  190  NDICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEMEKKINSSEQQL  235



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 170/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I+KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN+ GCFI+T YI+ FL YATK A++ T+KTLLL+N GG+ +I+L+ QF+ K  ++
Sbjct  72   LLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILLLCQFLVKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPE  235



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGNI+S MVYLAP+PTF +I+KKKSTEG+QS+PY+V LFS+MLW+YY F+   
Sbjct  9    LAFIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWLYYGFVKKH  68

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I+T YI  +L YATK A+I T+K  + +NV    LI+L TQ +A   
Sbjct  69   AFLLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLTTQ-LAMHG  127

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R H++GWIC  FA+CVF APL I+ +VI+TKSVE+MP  LSFFLTLSA++WFFYGLL 
Sbjct  128  KLRVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVWFFYGLLL  187

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAE  752
             D  IAIPN+LGFI G+LQM+LY +Y    K+E   E
Sbjct  188  HDICIAIPNVLGFILGLLQMLLYAIYNKSVKEEYALE  224



>ref|XP_004247459.1| PREDICTED: bidirectional sugar transporter NEC1 [Solanum lycopersicum]
Length=286

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = +3

Query  96   MDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLT  275
            + L FAFG+LGN VSF+VYL+P+PTF +I+K+KSTEG+QS+PY V LFSAML++YYA+L 
Sbjct  7    LQLAFAFGILGNGVSFLVYLSPLPTFYRIFKRKSTEGFQSIPYSVSLFSAMLYLYYAYLK  66

Query  276  PDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAK  455
             +  LLITINS G  IQ  Y++ F+ YATK AKI   K L+  N+  +G I+ +T   A 
Sbjct  67   KNEILLITINSFGTGIQLIYLTIFMIYATKSAKIFATKLLIGFNLVAFGAIVGLTYVFAN  126

Query  456  DTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGL  635
            +   R  IVGWIC VF++ VF APL I+R+VI+TKSVE+MPF LSFFLT+ AVMWFFYGL
Sbjct  127  ENDLRISIVGWICAVFSVSVFAAPLSIMRRVIQTKSVEFMPFPLSFFLTICAVMWFFYGL  186

Query  636  LRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKK  737
            L+KD  IA+PNILGF FGI QM+LY +Y+N K++
Sbjct  187  LKKDMYIAMPNILGFSFGIAQMILYAIYRNRKQQ  220



>ref|XP_002511125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51727.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGNI+S +++L+P+ TFI++YKKKSTEG+QS+PYVV LFS MLWIYYA L   
Sbjct  9    LIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWIYYAMLKSG  68

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LL++INS GC +QT YI  F+FYA KKAKI T++ L L+N  G+  I+ +T+F AK  
Sbjct  69   DYLLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVALTRFFAKG-  127

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            SSR HIVGW C+  +  +F APL ++R V++TKSVE+MPF LS FLTLSA+MW  YG+L 
Sbjct  128  SSRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIMWLLYGVLL  187

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKK  734
            KD  IA+PNI G +FG +QMVLYV+Y++GKK
Sbjct  188  KDLYIALPNIFGLVFGAIQMVLYVIYRDGKK  218



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 172/248 (69%), Gaps = 11/248 (4%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFGLLGNI+SF   LAP+PTF +I+K KSTEG+QSVPYVV LFSAMLWI+YA +    
Sbjct  11   AFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITIN+ GC I+T YI  +L YA +KAKI T K +LLLNV G+GLI L+T F A    
Sbjct  71   GLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFLLTLF-AFHGE  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   +GWIC+ F++CVFVAPL I+ +VIKTKSVEYMPF LS  LTLSAV+WF YGLL K
Sbjct  130  TRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVWFLYGLLIK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D  +A+PNILGF FG++QMVLY+ Y N            P   S     +   KVP E  
Sbjct  190  DKYVALPNILGFTFGMIQMVLYMFYMNAT----------PVVASDAKEGKEAWKVPAEDH  239

Query  825  EQVIDVVK  848
              VI+V K
Sbjct  240  VVVINVGK  247



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 167/218 (77%), Gaps = 1/218 (0%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN  GCFI+T YIS F+ +ATKKA++ T+K LLL+NVGG+  I+L+ QF+ K  ++
Sbjct  72   LLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILLLCQFLTKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKL  761
              +A PN++GF+ G LQM+LYVVYK  K      E++L
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKEL  228



>ref|XP_003620983.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=268

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 177/237 (75%), Gaps = 4/237 (2%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGN++SFMV+LAP+ TF +IYKKKSTEG+QS+PY+V LFS+MLW+YYAFL  D
Sbjct  8    LAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFLKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++  YI  ++ YATK A+  T+K LL +N+G +GLI+L+T++ A   
Sbjct  68   EFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKY-AVHG  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++GWIC+  ++ VF APL IV QV++TKSVE+MPF LSF LTLSA+MWF YGL  
Sbjct  127  PIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQ  803
            KD  IA+PN+LGF  G++QM+LY +Y+NG KK++ ++  L       S GG  +V Q
Sbjct  187  KDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEVFQ  243



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGN++SF V+L+PVPTF +I KKK+TEG+QS+PYVV LFSAMLW+YYA    D  
Sbjct  12   FAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GC I+T YI+ F+ +ATK+A++ T+K LLL+N GG+ LI+L+ QF+AK T +
Sbjct  72   LLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILLLCQFLAKGT-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKTKSV+YMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVKYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN++GF+ G LQM+LYVV+K  K      E+     KLPE
Sbjct  191  IYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPE  235



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 176/245 (72%), Gaps = 8/245 (3%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FG+LGN++S MV+L+P+PTF ++Y+KKSTEG+QS PYVV LFS MLW+YYAF+
Sbjct  8    RSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFV  67

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
                 LL+TIN VGC I+T Y++ +L YA K A++ T K LL LN+G +G+I L+T  ++
Sbjct  68   KSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLS  127

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
            +    R H++GWIC+  +L VF APL I+R VI+TKSVE+MPF LSFFL LSAV+WF YG
Sbjct  128  RG-ELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYG  186

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
            LL+KD  +A+PN+LGF+FG+ QM LY+ Y++ K   +++       G       +E K+P
Sbjct  187  LLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAAVAAG-------LETKLP  239

Query  813  EELKE  827
            E +KE
Sbjct  240  EHVKE  244



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 181/256 (71%), Gaps = 11/256 (4%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGN++SFM YLAP+ TF +IYK KST+G+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LQHPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITIN+ GC I+T YI  +L YA K+AK+ T K LLLLNVG +G+I+L+T  +
Sbjct  66   LKSDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            + +   R  ++GW+C+ F++ VFVAPL ++R V++T+SVE+MPF LS  LTLSAV+WF Y
Sbjct  126  S-EGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PNILGF FG++QM LY +Y+N   +  T E     +      D    KV
Sbjct  185  GLLIKDKYVALPNILGFAFGVIQMGLYALYRNSTPRPVTKEVDAESH------DGAAPKV  238

Query  810  PEELKEQVIDVVKLSA  857
            P    E V+++ KL A
Sbjct  239  P----EHVVNIGKLGA  250



>ref|XP_006493252.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Citrus sinensis]
Length=290

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 178/223 (80%), Gaps = 0/223 (0%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            + F   ++GNIVSF+V+LAP+PTF ++ KKKSTEG+QS+PYVV LFSAMLWIYYA +  D
Sbjct  15   ICFHVTIIGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKD  74

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITIN+ GC I+T Y++ ++ +A K+A++ T++ LLLLN GG+G I+L++ F+AK +
Sbjct  75   AFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGS  134

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            ++R  ++GWIC+VF++ VF APL I+R V++TKSVE+MPF LS FLTL+AVMWFFYGL  
Sbjct  135  AARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFL  194

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
            KD  +A+PN+LGFIFG++QM+LY +Y+N ++       K+PE+
Sbjct  195  KDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEH  237



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGNI+SF+VY AP PTF +IYK+KS EG+ S+PY+V LFSAMLW+YYA L  D
Sbjct  11   LGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWLYYALLKKD  70

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC I++ YI  + FYA  +AK  T+K ++ LNVG + +++++ QF+ K  
Sbjct  71   AFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVLIQFLLKG-  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S+R ++ GWIC  F++ VF APL IV +VI+TKSVE+MPF LSFFLTLSA+MWF YGLL+
Sbjct  130  SNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMWFAYGLLK  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
             D  +AIPNILG I G++QMVLY  Y+N  K++   E+KLPE+
Sbjct  190  NDPCVAIPNILGVILGLVQMVLYGFYRNAGKEK--MEKKLPEH  230



>ref|XP_010492063.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 165/226 (73%), Gaps = 6/226 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN +SF+V+LAPVPTF +IYKKKSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YAT+  +I  MK  + +NV  + LI+++T FV K  
Sbjct  70   AFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFITINVAVFSLILMVTHFVVKTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + +  ++GWIC+  ++ VF APL IV +VIKT+SVE+MPF LSFFLT+SAVMWF YGL  
Sbjct  130  TLQVSVLGWICVAISVSVFAAPLMIVARVIKTRSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNG------KKKESTAEQKL  761
             D  IAIPN++GF+ G+LQMVLY VY+N       +KK   +EQ+L
Sbjct  190  HDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKIHLSEQQL  235



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FG+LGNI+S  VYLAP+PTF +I+K+KST G+ S+PY V LFSAMLW+YYAFL  +  
Sbjct  12   FTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLWLYYAFLKTNAV  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LLI+IN+ GC ++T YIS FLFYA+KKA+  T K L ++NVG   LI ++T F+ K   +
Sbjct  72   LLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFVVTFFIFKG-QN  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            R H+VGWIC+  ++CVF APL IV QV++T+SVE+MPF LSFFLTLSAVMWF YGL  KD
Sbjct  131  RVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVMWFGYGLFEKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKK---ESTAEQKL  761
              +A+PN+LGFI G+LQMVLY +++N K +   +   E+K+
Sbjct  191  LCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKM  231



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 168/224 (75%), Gaps = 3/224 (1%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFGLLGNI+S +VYLAPVPTF++IY+KKSTEG+ S+PY+V LFS+MLW++YA L  D
Sbjct  10   LAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLWLHYAMLKKD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LL+TIN  GC I+T YI  ++FYA+K+ ++ T + L+ +N+  +  I+L T F+ K  
Sbjct  70   VFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVLFTHFLMKG-  128

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S R  ++GWIC+  ++ VF +PL IV QV++T+SVE+MPF LSFFLTLSAVMWF YG   
Sbjct  129  SIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVMWFAYGFTT  188

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG  773
            K+  +A+PNILGFI G+LQM+LY +Y+  K K    E+KLPE  
Sbjct  189  KNMCVALPNILGFILGLLQMLLYAIYR--KAKVVVIEEKLPEKN  230



>gb|KEH21559.1| bidirectional sugar transporter [Medicago truncatula]
Length=253

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 180/250 (72%), Gaps = 8/250 (3%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            ++   FGLLGNIVSFMV+LAP+PTF  IYKKKS+EGYQS+PYVV L SA+L +YY FL  
Sbjct  8    EMVLIFGLLGNIVSFMVFLAPLPTFYSIYKKKSSEGYQSIPYVVALLSALLLLYYGFLKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+ITIN +GC I+ +Y+  ++ YA KK KI T+  +L+ ++GG+GL ++IT FV K 
Sbjct  68   NAILIITINCIGCVIEVAYLIMYIIYAPKKLKISTLVFILVADLGGFGLTMIITFFVVK-  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            +S R H VG IC +F + VF APL I+R+VI+T+SVEYMPF LS FLTL A MWFFYGL 
Sbjct  127  SSFRVHAVGLICAIFNIAVFAAPLSIMRKVIRTRSVEYMPFSLSLFLTLCATMWFFYGLF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPE-  815
             KD  I +PN+LGF+FG+ QM+LY++YKN K K  T   +  E+G C  G++  Q  P  
Sbjct  187  DKDNYIMLPNVLGFLFGVSQMILYLIYKNAKNKVETNSTEEQEHG-CDDGNK--QDFPSV  243

Query  816  ---ELKEQVI  836
               E+KE ++
Sbjct  244  VVVEMKENIV  253



>gb|KEH21447.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=279

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 177/237 (75%), Gaps = 4/237 (2%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L FAFG+LGN++SFMV+LAP+ TF +IYKKKSTEG+QS+PY+V LFS+MLW+YYAFL  D
Sbjct  8    LAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFLKKD  67

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++  YI  ++ YATK A+  T+K LL +N+G +GLI+L+T++ A   
Sbjct  68   EFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKY-AVHG  126

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
              R  ++GWIC+  ++ VF APL IV QV++TKSVE+MPF LSF LTLSA+MWF YGL  
Sbjct  127  PIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFL  186

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQVEQ  803
            KD  IA+PN+LGF  G++QM+LY +Y+NG KK++ ++  L       S GG  +V Q
Sbjct  187  KDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEVFQ  243



>emb|CDX68492.1| BnaC01g25700D [Brassica napus]
Length=286

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 169/225 (75%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TINS GCFI+T YIS FL +A KKA++ T+K LLL+N GG+ LI+L+ QF+AK   +
Sbjct  72   LLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGI-T  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVVWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF  G LQM+LYVVY+  K      E+     KLPE
Sbjct  191  MYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKEVEAAKLPE  235



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 178/254 (70%), Gaps = 11/254 (4%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FGLLGN++SFM YLAP+PTF +IYK KST+G+QSVPYVV LFSAMLWIYYA L  D 
Sbjct  11   AFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLWIYYALLKSDE  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLITIN+ GC I+T YI  +L YA K+A++ T K LLLLNVG +GLI+L+T  +     
Sbjct  71   YLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILLLTLLLTAG-E  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R  ++GW+C+ F++CVFVAPL ++R V++T+SVE+MPF LS  LT SAV+WF YGLL K
Sbjct  130  RRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVVWFLYGLLIK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D  +A+PNILGF FG++QM LY +Y+N     +  E   PE+      +    K P    
Sbjct  190  DKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEMDAPES------EDGAVKAP----  239

Query  825  EQVIDVVKLSAALA  866
            E V+++ KL  A A
Sbjct  240  EHVVNIAKLGTAAA  253



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 177/245 (72%), Gaps = 8/245 (3%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FG+LGN++S MV+L+P+PTF ++Y+KKSTEG+QS PYVV LFS MLW+YYAF+
Sbjct  8    RSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFV  67

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
                 LL+TIN VGC I+T Y++ +L YA K A++ T K LL LN+G +G+I L+T  ++
Sbjct  68   KSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLS  127

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
            +    R H++GWIC+  +L VF APL I+R VI+TKSVE+MPF LSFFL LSAV+WF YG
Sbjct  128  RG-ELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYG  186

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
            LL+KD  +A+PN+LGF+FG+ QM LY+ Y++ K   +++   +   G       +E K+P
Sbjct  187  LLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAVVAAG-------LEIKLP  239

Query  813  EELKE  827
            E +KE
Sbjct  240  EHVKE  244



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 166/226 (73%), Gaps = 6/226 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L F FG+LGN +SF+V+LAPVPTF +IYKKKSTE +QS+PY V LFS MLW+YYA +  D
Sbjct  10   LAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKQD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YAT+  +I  MK  + +NV  + +I+++T FV +  
Sbjct  70   AFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFIAINVAFFSMILMVTHFVVRTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + +  ++GWIC+  ++ VF APL IV +VIKTKSVE+MPF LSFFLT+SAVMWF YGL  
Sbjct  130  TIQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNG------KKKESTAEQKL  761
             D  IAIPN++GF+ G+LQMVLY VY+N       +KK + +EQ+L
Sbjct  190  HDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKINLSEQQL  235



>ref|XP_008677256.1| PREDICTED: LOC100282648 isoform X1 [Zea mays]
 gb|AFW62434.1| MTN3 isoform 1 [Zea mays]
 gb|AFW62435.1| MTN3 isoform 2 [Zea mays]
Length=304

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 165/238 (69%), Gaps = 14/238 (6%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             F FG+LGNIVS MV+L+P+PTF ++Y+ KSTEG+QS PYVV LFS MLWI YA L P  
Sbjct  12   AFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCMLWILYALLKPGA  71

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LL+TIN VGC ++T Y++ +L YA K A++   K LL LNV  +GL+ L+T  ++ D  
Sbjct  72   ELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVALVTMLLS-DAG  130

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
             R H++GWIC+  +L VF APL I+RQVI+TKSVE+MP  LSFFL LSAV+WF YG L+K
Sbjct  131  LRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAVVWFAYGALKK  190

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNG---------KKKESTAEQKLPENGSCGGGD  791
            D  +A PN+LGF+FG+ QM LY+ Y+           + KE  AE K     SCGG +
Sbjct  191  DVFVAFPNVLGFVFGLAQMALYMAYRKPAAALVIIPEQSKEEVAEGK----ASCGGAE  244



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 177/256 (69%), Gaps = 10/256 (4%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FG+LGNI+S MV+L+P+PTF ++Y+KKSTEG+QS PYVV LFS MLW+YYAF+
Sbjct  8    RNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFV  67

Query  273  TPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVA  452
                 LL+TIN VGC I+T Y++ +L YA K  ++ T + LL LNVG +GLI L+T  + 
Sbjct  68   KSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALVTLLLP  127

Query  453  KDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYG  632
            +  + R H++GW+C+  +L VF APL I+R VI+TKSVE+MPF LSFFL LSAV+WF YG
Sbjct  128  QG-ALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFGYG  186

Query  633  LLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVP  812
            LL+KD  +A+PN+LGF+FG+ QM LY+ Y+          +K P + S       E K+P
Sbjct  187  LLKKDVFVALPNVLGFVFGVAQMALYMAYRT---------KKPPASSSSSAAAGQEIKLP  237

Query  813  EELKEQVIDVVKLSAA  860
            E +KE    V K  AA
Sbjct  238  EHVKEVTTIVAKAGAA  253



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI SF+V+LAPVPTFI++ +KKSTEG+QS+PYVV LFSA+L IYY+ L  D  
Sbjct  13   FAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTLNADEF  72

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
             L+TINSVGCFI+T YI+ ++ YA KKA+I T++ +LLL+V G+  I+++TQF+ K  + 
Sbjct  73   FLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLVK-RAY  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA ++G+IC   ++ VF APL I+++VI+T+SVEYMPF LSFFLTLSAVMW  YGL  KD
Sbjct  132  RARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSAVMWLCYGLFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGS  776
              +A+PN LGF FG+ QM+LY +Y+N K   S  E+KLP++ +
Sbjct  192  LYVALPNTLGFTFGMAQMILYAIYRNAKPLPS--EEKLPQHKA  232



>ref|XP_011042931.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET10 [Populus euphratica]
Length=273

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L +   F FGLLGNI S  V L+P+PTF +I KKK++EG+QS+PYV+ LF+AMLW++YA 
Sbjct  3    LHLTWVFGFGLLGNITSCSVCLSPLPTFYQICKKKTSEGFQSIPYVIALFNAMLWLFYAI  62

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
               DT LL+ INS   F+   YI   LF+ATKK KI T K LLL NV G+GL+ L+T F+
Sbjct  63   FKKDTILLLAINSFAFFMAIGYIVVXLFFATKKDKILTFKLLLLFNVFGFGLVCLLTLFL  122

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             +    R  ++GWIC++F+LCVFVAPL IVR+VIKTKSVE+MPF LSFFLTLSA+MWF Y
Sbjct  123  TQG-HKRVQVLGWICMIFSLCVFVAPLFIVRKVIKTKSVEFMPFXLSFFLTLSALMWFSY  181

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKK  734
            G L+KD  +AIPNILGFIFG+LQM LY++Y+N +K
Sbjct  182  GYLKKDQFVAIPNILGFIFGLLQMPLYMIYRNPEK  216



>ref|XP_004980522.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=299

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L   L F FGLLGNI+SFM YLAP+PTF +IYK KSTEG+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LDHPLAFTFGLLGNIISFMTYLAPLPTFYRIYKTKSTEGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLIT+N+ GC I+T YI+ +L YA KKAK+ T   LLLLNVG +GLI+L+T  +
Sbjct  66   LKSDEFLLITVNAAGCVIETLYITMYLAYAPKKAKLFTAMILLLLNVGVFGLILLLTMLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A     R  ++GW+C+ FA+ VFVAPL I+RQV++T+SVE+MPF LS  LT+SAV+WF Y
Sbjct  126  AAG-EKRVVLLGWVCVGFAVSVFVAPLSIIRQVVRTRSVEFMPFFLSLSLTVSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAE  752
            GLL KD  +A+PN++GF FG++QM LY +Y+N   +    E
Sbjct  185  GLLIKDKYVALPNVIGFTFGVIQMGLYALYRNATPRVPAKE  225



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 187/255 (73%), Gaps = 16/255 (6%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            FAFGLLGNI SF+V+LAPVPTFI++ +KKSTEG+QS+PYVV LFSA+L IYY+ L  D  
Sbjct  13   FAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTLNADEF  72

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
             L+TINSVGCFI+T YI+ ++ YA KKA+I T++ +LLL+V G+  I+++TQF+ K  + 
Sbjct  73   FLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLVK-RAY  131

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA ++G+IC   ++ VF APL I+++VI+T+SVEYMPF LSFFLTLSAVMW  YGL  KD
Sbjct  132  RARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSAVMWLCYGLFLKD  191

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENG----------SCGGGDQV  797
              +A+PN LGF FG+ QM+LY +Y+N K   +  E+KLP++           +    DQ 
Sbjct  192  LYVALPNTLGFTFGMAQMILYAIYRNAKPLPN--EEKLPQHKADIETQIVITTTTNPDQG  249

Query  798  EQKVPEELKEQVIDV  842
            ++    + ++QVI+V
Sbjct  250  DE---HQNQDQVINV  261



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 184/259 (71%), Gaps = 14/259 (5%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGN++SF+ +LAP+PTF +IYK KSTEG+QSVPYVV LFSAMLWI+YA 
Sbjct  6    LQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            +  + T LITIN+ GC I+T YI  +  YA KKAK+ T K +LLLNVG +G+I+L+T  +
Sbjct  66   IKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILLVTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
             K    R  ++GWIC+ F++ VFVAPL I+R+VI+TKSVEYMPF LS  LTLSAV+WF Y
Sbjct  126  FKG-DKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PNILGF FG++QMVLYV+Y N K   + AE           G     K+
Sbjct  185  GLLIKDKYVALPNILGFTFGVVQMVLYVLYMN-KTPVAVAE-----------GKDAGVKL  232

Query  810  PEELKEQV-IDVVKLSAAL  863
            P    E V +++ KLS AL
Sbjct  233  PSAADEHVLVNITKLSPAL  251



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 162/213 (76%), Gaps = 1/213 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L     FAFGLLGNI+SF   LAP+PTF +I+K KSTEG+QSVPYVV LFSAMLWI+YA 
Sbjct  6    LEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            +     LLI+IN+ GC I+T YI  +L YA +KAKI T K ++LLNV G+GLI+L+T F 
Sbjct  66   VKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILLLTLF-  124

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A    +R   +GWIC+ F++CVFVAPL I+ +VIKTKSVEYMPF LS  LTLSAV+WF Y
Sbjct  125  AFHGETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNG  728
            GLL KD  +A+PNILGF FG++QMVLY+ Y N 
Sbjct  185  GLLIKDKYVALPNILGFTFGMIQMVLYMFYMNA  217



>emb|CDX91144.1| BnaC02g04530D [Brassica napus]
Length=297

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 162/225 (72%), Gaps = 7/225 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGN +SF+V+LAPVPTF +IYK KSTE +QS+PY V LFS MLW+YYA    D
Sbjct  10   LAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALTKQD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YATK+ K+  +K  L +NV  + LII++T F  K  
Sbjct  70   AFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTHFAVKSP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S +  ++GWIC+  ++ VF APL IV +VIKTKSVE+MPF LSFFLT+SAVMWF YG   
Sbjct  130  SLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGAFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-------GKKKESTAEQ  755
             D  IAIPN++GFI G++QMVLY VY+N       GKKK S++EQ
Sbjct  190  HDICIAIPNVVGFILGLVQMVLYGVYRNSGDKLDIGKKKNSSSEQ  234



>ref|XP_004138979.1| PREDICTED: bidirectional sugar transporter NEC1-like [Cucumis 
sativus]
Length=274

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 179/251 (71%), Gaps = 6/251 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNI+SFMV+LAPVPTF  +YKKK++EG+Q +PYVV L SAML +YYA L  
Sbjct  8    QLQFIFGLLGNIISFMVFLAPVPTFWTVYKKKTSEGFQCIPYVVALMSAMLLLYYAVLKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  LLI+INS GC I+  YI+ + +YA KK KI T+K L++LN+G YG+++  T  +   
Sbjct  68   NAYLLISINSFGCVIELIYIALYFYYAPKKLKIFTLKLLMILNLGSYGVMVGGTMLILHG  127

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             + R H VGWIC  F L VF +PL I+++VI TKSVEYMPF LSFFLTLSA MWFFYG  
Sbjct  128  -NKRTHAVGWICAAFNLAVFASPLAIMKRVITTKSVEYMPFSLSFFLTLSATMWFFYGFF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
             KD  IA+PNI+GF+ G++QM++Y++YK+  +K ++ E+KL E G      +V+ +   +
Sbjct  187  IKDLFIALPNIVGFLLGMVQMIMYMIYKD--RKGNSLEEKLEEGGK---KYEVDDQSLSK  241

Query  819  LKEQVIDVVKL  851
             K Q+  ++ L
Sbjct  242  YKGQIRRILDL  252



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 172/248 (69%), Gaps = 12/248 (5%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFGLLGN++SF   LAP+PTF +I+K KSTEG+QSVPYVV LFSAMLWI+YA +    
Sbjct  11   AFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLI+IN+ GC I+T YI  +L YA +KAKI T K ++LLN+ G+GLI L+T F A    
Sbjct  71   GLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFLLTLF-AFHGE  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   +GWIC+ F++CVFVAPL I+ +VIKTKSVEYMPF LS  LTLSA++WF YGLL K
Sbjct  130  TRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGLLIK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D  +A+PNILGF FG++QMVLYV Y N          K P       G +   K P E  
Sbjct  190  DKYVALPNILGFTFGVIQMVLYVFYMN----------KTPMASQVKEGKE-AWKAPAEDH  238

Query  825  EQVIDVVK  848
              VI+V K
Sbjct  239  VVVINVGK  246



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 169/225 (75%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGL+GN++SF V+L+PVPTF +++KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN+ GCFI+T YIS +L YA K AK+ T+K LLL+N GG+ LI+LI QF+ K   +
Sbjct  72   LLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILLICQFLFKG-PT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
            + +A PN++GF+ G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  FYVAFPNVIGFVLGALQMILYVVYKYCKTPPHLGEKEVEAAKLPE  235



>ref|XP_011079737.1| PREDICTED: bidirectional sugar transporter NEC1-like isoform 
X1 [Sesamum indicum]
Length=283

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 179/252 (71%), Gaps = 12/252 (5%)
 Frame = +3

Query  84   ILLRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYY  263
            IL  + +  AFG+LGNIVSF+VYLAP+PTF +I+KKKSTEG+Q++PY V LFSAML++YY
Sbjct  3    ILSTLHIANAFGILGNIVSFLVYLAPLPTFYRIWKKKSTEGFQAIPYSVALFSAMLYLYY  62

Query  264  AFLTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQ  443
            AFL  ++ +LITIN++GC  + +Y++ ++ YATK +++ T + L L NV   G++I  T 
Sbjct  63   AFLKQNSIILITINTIGCVTEIAYLTVYMIYATKVSRVSTTRLLFLFNVSLLGVVIGATY  122

Query  444  FVAKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWF  623
             +A+    R   VGWIC  F++ VF APL I+R+VI+TKSVE+MPF LSFFLT+ AV+WF
Sbjct  123  LLARG-HQRVTAVGWICAAFSVSVFAAPLAIIRRVIRTKSVEFMPFYLSFFLTICAVVWF  181

Query  624  FYGLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPE---NGSCGGGDQ  794
             YG L KDY IA PNILGFIFGI+QM LYVVYK+ K      +Q LP       C  GD 
Sbjct  182  LYGFLIKDYFIAGPNILGFIFGIMQMTLYVVYKDRK------QQILPAAVVETKC--GDH  233

Query  795  VEQKVPEELKEQ  830
            + + V  + + Q
Sbjct  234  IIKDVDHQSQLQ  245



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 167/225 (74%), Gaps = 6/225 (3%)
 Frame = +3

Query  108  FAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT  287
            F FGLLGN++SF V+L+PVPTF +I+KKK+TEG+QS+PYVV LFSA LW+YYA    D  
Sbjct  12   FVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLWLYYATQKKDVF  71

Query  288  LLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSS  467
            LL+TIN+ GCFI+T YIS FL YA K A++ T+K LLL+N GG+  I+L+ QF+ K  ++
Sbjct  72   LLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILLLCQFLVKG-AT  130

Query  468  RAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKD  647
            RA I+G IC+ F++CVF APL I+R VIKT+SVEYMPF LS  LT+SAV+W  YGL  KD
Sbjct  131  RAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVIWLLYGLALKD  190

Query  648  YNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQ-----KLPE  767
              +A PN+LGF  G LQM+LYVVYK  K      E+     KLPE
Sbjct  191  IYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPE  235



>ref|XP_008370771.1| PREDICTED: bidirectional sugar transporter NEC1-like [Malus domestica]
Length=267

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 174/253 (69%), Gaps = 6/253 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F FGLLGNIVSFMV+LAP+PTF  IYKKKS++G+QS+PYVV L SA L +YY  L  
Sbjct  8    QLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSATLLLYYGVLKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+++IN +G  I+ +Y+  ++ YA+KK KI T+  +LL+NV  +GL++ +T F+   
Sbjct  68   NAYLIVSINVIGIXIEVTYLILYIVYASKKDKITTLSLILLVNVAAFGLVLAVTVFLLGG  127

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            T +R   VGWIC VF + VF APL I+RQVI+TKSVE+MPF LS FLTL A MWFFYGL 
Sbjct  128  T-ARVCAVGWICAVFNIAVFAAPLSIMRQVIRTKSVEFMPFSLSLFLTLCATMWFFYGLF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKK----KESTAE-QKLPENGSCGGGDQVEQ  803
             KDY IA+PN+LGF+FGI QM+LY+ YKN  K    K+ST E +KL           V +
Sbjct  187  TKDYYIALPNVLGFLFGIAQMILYMTYKNSGKDVEVKKSTMEMKKLSSTNRPNLTGSVNK  246

Query  804  KVPEELKEQVIDV  842
                +  +Q  DV
Sbjct  247  NSRSDELKQTTDV  259



>ref|XP_007139174.1| hypothetical protein PHAVU_008G007600g [Phaseolus vulgaris]
 gb|ESW11168.1| hypothetical protein PHAVU_008G007600g [Phaseolus vulgaris]
Length=259

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 184/254 (72%), Gaps = 7/254 (3%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            ++   FGLLGNIVSF+V+LAP+PTF KIYK KS+EG+QS+PYVV L SA+L +YY F+  
Sbjct  8    EMVLIFGLLGNIVSFLVFLAPLPTFYKIYKNKSSEGFQSIPYVVALLSALLLLYYGFIKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L++TIN +GC I+ +Y++ ++ YA KK KI T+  +L+ +VGG+GL +LI+ F  K 
Sbjct  68   NALLIVTINCIGCVIEVTYLAMYIIYAHKKQKISTLVMILIADVGGFGLTMLISTFAVKG  127

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
              +R H VGWIC +F + VF APL I+R+VIKTKSVEYMPF LS FLTL A MWFFYGL 
Sbjct  128  I-ARVHAVGWICAIFNIAVFAAPLSIMRKVIKTKSVEYMPFSLSLFLTLCATMWFFYGLF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKN-GKK-KESTAEQKLPE---NGSCGGGDQVEQ  803
             KD  I +PN+LGF+FGI QM+LY++YKN GK  K + AEQ+  E     SC G ++++ 
Sbjct  187  DKDEFIMLPNVLGFLFGISQMILYIIYKNVGKNTKTNCAEQQESEGTKQHSC-GDNKLDF  245

Query  804  KVPEELKEQVIDVV  845
                E+KE  ++ V
Sbjct  246  PSVVEMKENQLNQV  259



>ref|XP_006289174.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
 gb|EOA22072.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
Length=286

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 166/226 (73%), Gaps = 6/226 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            LT  FG+LGN VSF+V +AP+PTF +IYKKKSTE +QS+PY V LFS MLW+YYA +  +
Sbjct  10   LTIIFGILGNAVSFLVLVAPLPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALIKKN  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC +QT YI+ FL YAT+  +I  MK  + +NV  + LI+L+T FV K  
Sbjct  70   AFLLITINSFGCVVQTIYIAMFLAYATRDKRISAMKLFIAINVVFFSLILLVTHFVVKTP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + +  ++GWIC+  ++ VF APL IV +V+KTKSVEYMPF LSFFLT+SAVMWF YGL  
Sbjct  130  TLQVSVLGWICVAISVAVFAAPLMIVARVVKTKSVEYMPFTLSFFLTISAVMWFGYGLFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNG------KKKESTAEQKL  761
             D  IAIPN++GF+ G+LQMVLY VY+N       +KK + +EQ+L
Sbjct  190  NDICIAIPNVVGFVLGMLQMVLYCVYRNASEKPEIEKKINLSEQQL  235



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 169/220 (77%), Gaps = 3/220 (1%)
 Frame = +3

Query  111  AFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTTL  290
            AFG+ GNI+S +VYLAPVPTF +IY+KKSTE +QS+PY V LFS+MLW+YYA +  D  L
Sbjct  13   AFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLWLYYALIKKDAFL  72

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            LITINS GC ++T YIS ++ YA+K +++  MK  + +NVG + LI+++T+F+ K +S R
Sbjct  73   LITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILILTRFLVK-SSIR  131

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              ++GWIC+  ++ VF APL IV +VI+T SVE+MPF LSFFLTLSA+MWF YGL  KD 
Sbjct  132  IQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAIMWFAYGLFIKDI  191

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN  770
             +A+PN+LGF+ G+LQM+LY VY+N KK  +  E+K PE 
Sbjct  192  CVALPNVLGFVLGMLQMLLYAVYRNTKK--AIEEKKPPEQ  229



>ref|XP_003552719.1| PREDICTED: bidirectional sugar transporter NEC1-like [Glycine 
max]
Length=262

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 181/257 (70%), Gaps = 10/257 (4%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            +L   FGLLGNIVSFMV+LAP+PTF  IYK KS+EG+QS+PYVV L SA+L +YY F+  
Sbjct  8    ELVLIFGLLGNIVSFMVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLLYYGFIKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            + TL+ITIN +GC I+ SY++ ++ YA +K KI T+  +L+ ++GG+GL +LIT F  K 
Sbjct  68   NATLIITINCIGCVIEVSYLAMYIIYAPRKQKISTLVMILIADIGGFGLTMLITTFAVKG  127

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
              +R H VGWIC +F + VF APL I+R+VIKTKSVE+MPF LS FLTL A MWFFYG  
Sbjct  128  I-NRVHAVGWICAIFNIAVFAAPLSIMRRVIKTKSVEFMPFSLSLFLTLCATMWFFYGFF  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKK-ESTAEQKLPENG-------SCGGGDQ  794
             KD  I +PN+LGF+FGI QM+LY++YKN KK  E    ++   +G       SC  G++
Sbjct  187  DKDNFIMLPNVLGFLFGISQMILYMIYKNAKKNGEINCTEQQERDGTVNSKQHSC-NGNK  245

Query  795  VEQKVPEELKEQVIDVV  845
            ++     E+KE  ++ V
Sbjct  246  LDFSSLVEMKENQLNQV  262



>gb|EMT20481.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=293

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 180/257 (70%), Gaps = 10/257 (4%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L     FAFGLLGNI+SFM YLAP+PTF +IY+ KST+G+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LEHPWAFAFGLLGNIISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  D  LLITINS GC I+T YI  +L YA K+AK+ T K LLLLNVG +GLI+L+T  +
Sbjct  66   LKSDELLLITINSAGCVIETIYIIMYLTYAPKQAKLFTAKILLLLNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            A     R  ++GW+C+ F++ VFVAPL ++R V++T+SVE+MPF LS  LT+SAV+WF Y
Sbjct  126  AGG-EKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PNILGF FG++QM LY +Y N   +++  E   P +         +   
Sbjct  185  GLLIKDKYVALPNILGFAFGVIQMGLYALYCNAMPRQAPKEVDDPMS---------DHGA  235

Query  810  PEELKEQVIDVVKLSAA  860
              +  E V+++ KLS A
Sbjct  236  AVKAPEHVVNISKLSPA  252



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 180/256 (70%), Gaps = 16/256 (6%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+    FAFGLLGN++SF  YLAP+PTF +IYK KSTEG+QSVPYVV LFSAMLWI+YA 
Sbjct  6    LQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLWIFYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            +  +  LLITIN+ GC I+T YI  +L YA+KKAK+ T K LL LNVG +G+I+L+T  +
Sbjct  66   IKSNEALLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +K   +R   +GW+C+ F++ VFVAPL I+R+V++T+SVEYMPF LS  LTLSA++WF Y
Sbjct  126  SKG-ENRVVSLGWVCVAFSVSVFVAPLSIIRRVVQTRSVEYMPFSLSLTLTLSAIVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKV  809
            GLL KD  +A+PN+LGF FG++QM LYV Y N                    G+  E K+
Sbjct  185  GLLIKDKYVALPNVLGFTFGVVQMGLYVFYMNATPV---------------AGEGKEGKL  229

Query  810  PEELKEQVIDVVKLSA  857
              E  + V++V KL+A
Sbjct  230  AAEEPQVVVNVGKLTA  245



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 172/248 (69%), Gaps = 12/248 (5%)
 Frame = +3

Query  105  TFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDT  284
             FAFGLLGN++SF   LAP+PTF +I+K KSTEG+QSVPYVV LFSAMLWI+YA +    
Sbjct  11   AFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLWIFYALVKTGE  70

Query  285  TLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTS  464
             LLI+IN+ GC I+T YI  +L YA +KAKI T K ++LLN+ G+GLI L+T F A    
Sbjct  71   GLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIVVLLNIAGFGLIFLLTLF-AFHGE  129

Query  465  SRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRK  644
            +R   +GWIC+ F++CVFVAPL I+ +VIKTKSVEYMPF LS  LTLSA++WF YGLL K
Sbjct  130  TRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIVWFLYGLLIK  189

Query  645  DYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEELK  824
            D  +A+PNILGF FG++QMVLYV Y N          K P       G +   K P E  
Sbjct  190  DKYVALPNILGFTFGVIQMVLYVFYMN----------KTPVASQVKEGKE-AWKAPAEDH  238

Query  825  EQVIDVVK  848
              VI+V K
Sbjct  239  VVVINVGK  246



>emb|CDP03543.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 159/209 (76%), Gaps = 1/209 (0%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L  AFG+LGN+VSF+VYLAP+PTF +IYKKKST+G+Q+VPY V LFSAML++YYA+L  
Sbjct  8    QLAAAFGILGNVVSFLVYLAPLPTFYRIYKKKSTQGFQAVPYSVALFSAMLYLYYAYLKK  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  +L TINS GC I+T Y+  F+ YATK AK+ T K L++ NVG Y LI+  T F+   
Sbjct  68   NGIILATINSGGCAIETIYLVLFMIYATKDAKMRTAKLLVIFNVGAYALIVAST-FLLSQ  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
               R  +VGWIC VF++CVF APL I+ +VI+T+SVE+MPF LS FLTL AVMWFFYG L
Sbjct  127  GHRRVALVGWICSVFSVCVFAAPLSIMMKVIRTRSVEFMPFSLSCFLTLCAVMWFFYGFL  186

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKN  725
             KDY IA PNILGF FGI QM+LY +Y+ 
Sbjct  187  IKDYYIATPNILGFAFGIAQMILYAIYRE  215



>ref|NP_001132836.1| hypothetical protein [Zea mays]
 gb|ACF81848.1| unknown [Zea mays]
 tpg|DAA42015.1| TPA: hypothetical protein ZEAMMB73_422539 [Zea mays]
Length=344

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 168/216 (78%), Gaps = 1/216 (0%)
 Frame = +3

Query  90   LRMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAF  269
            L+  + FAFGLLGNI+SFM YLAP+PTF +IY+ KSTEG+QSVPYVV LFSAMLWIYYA 
Sbjct  6    LQHPMAFAFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLWIYYAL  65

Query  270  LTPDTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
            L  +  LLITINS GC I+T YI+ +L YA  KAK+ T K LLLLNVG +GLI+L+T  +
Sbjct  66   LKSNEFLLITINSAGCVIETLYIATYLLYAPNKAKLFTAKILLLLNVGVFGLILLLTLLL  125

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +     R  ++GW+C+ F++ VFVAPL I+RQV++T+SVE+MPF LSF LT SAV+WF Y
Sbjct  126  SAG-PHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVVWFLY  184

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKKK  737
            GLL KD  +A+PN+LGF FG++QM +Y +Y+N   +
Sbjct  185  GLLIKDKYVALPNVLGFTFGVVQMGMYALYRNATPR  220



>ref|XP_007137872.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
 gb|ESW09866.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
Length=291

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 177/247 (72%), Gaps = 5/247 (2%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L+F FG+LGN+ SF+ +LAP+PTF ++ KKKSTEG+QSVPYV  LFSAMLWI+YA++   
Sbjct  6    LSFLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYVKTG  65

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
             TLLITINS GC I+T Y++ FL Y  KKA++ T++ ++L N GG+  I+L+T  +AK  
Sbjct  66   ETLLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLAKG-  124

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            + R  ++GWIC+VFA  VF APL I+R VI+TKSVE++PF LS  L LSA+MW  YG+  
Sbjct  125  AGRVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSMLLLLSAIMWLLYGISL  184

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPEN-GSCGGGDQVEQKVPEE  818
            KD  + +PN++G  FG++Q+VLY++Y+N K   +   +KLPE+ G     + V   V  E
Sbjct  185  KDIYVTLPNVVGLTFGVIQIVLYMMYRNNK---TLKNEKLPEHKGDIDNNENVAPTVSAE  241

Query  819  LKEQVID  839
             +EQ ++
Sbjct  242  NQEQEVN  248



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 177/232 (76%), Gaps = 7/232 (3%)
 Frame = +3

Query  93   RMDLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFL  272
            R    F FG++GNI+SF V+LAP+PTF +IYKKKSTEG+QS+PYVV LFSAMLWIYYAF+
Sbjct  5    RESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFV  64

Query  273  TPDTTLL-ITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFV  449
              +  LL ITIN+ G  +++ Y++ FL YA +K ++ T+K LLLLNV G+G ++L T ++
Sbjct  65   KREAALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYL  124

Query  450  AKDTSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFY  629
            +K  + R  I+GWICLVF + VF APL I+R+VIKT+SVEYMPF LS FLT++AVMWFFY
Sbjct  125  SKG-AKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMWFFY  183

Query  630  GLLRKDYNIAIPNILGFIFGILQMVLYVVYKNGKK---KESTAEQKLPENGS  776
            GLL +DY +A+PN LGF+FGI+QM +Y++Y+N      +E    Q+L  NG 
Sbjct  184  GLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKAQEL--NGH  233



>ref|XP_009586714.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=264

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            +L F FGLLGNIVSFMV+LAP+PTF KIYKK S++G+Q++PYVV  FSA L +YY +L  
Sbjct  8    ELAFLFGLLGNIVSFMVFLAPIPTFYKIYKKGSSDGFQAIPYVVAFFSAGLLLYYGYLIK  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L++TIN+ GC I+ +Y+  FLFYA+KK K+ T+  L+LL+VG  G+++L++   AK 
Sbjct  68   NAILIVTINAFGCVIEVAYLFLFLFYASKKTKVTTV-WLMLLDVGALGIVMLLSYLFAKG  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
             + R  IVGWIC +  + VF APL I+RQVIKTKSVE+MPF LS FLTL A MWFFYG  
Sbjct  127  -AKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSIFLTLCATMWFFYGYF  185

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKL  761
            +KDY IA PN+LGF+ GI+QM+LY+VYK  K +    E +L
Sbjct  186  KKDYYIAFPNVLGFVLGIVQMILYIVYKYAKSRPYKGEWEL  226



>ref|XP_006444236.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
 gb|ESR57476.1| hypothetical protein CICLE_v10023774mg [Citrus clementina]
Length=275

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 157/210 (75%), Gaps = 1/210 (0%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT-L  290
            FGLLGNIVSF+VYLAP+PTF +I+KKKST+G+QS+PY V LFSAML +YYA L      +
Sbjct  12   FGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLYYASLKGSNAFM  71

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            LITIN +GC I++ Y+ FF+ YATK AKI T K L+L N+G  GLI+L+T  ++K +  R
Sbjct  72   LITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLLTYLLSKSSDQR  131

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              IVGWIC VF++CVF APL I+RQVI+TKSVEYMPF LS  LT+ A MW  YGL  KDY
Sbjct  132  LTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAGMWLLYGLSIKDY  191

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKE  740
             IA PNILG  FG  QM+LY+ Y+  +  E
Sbjct  192  YIATPNILGMAFGATQMILYLAYRTRRNSE  221



>gb|KDO87388.1| hypothetical protein CISIN_1g036251mg [Citrus sinensis]
Length=275

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 157/210 (75%), Gaps = 1/210 (0%)
 Frame = +3

Query  114  FGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPDTT-L  290
            FGLLGNIVSF+VYLAP+PTF +I+KKKST+G+QS+PY V LFSAML +YYA L      +
Sbjct  12   FGLLGNIVSFLVYLAPLPTFYRIFKKKSTQGFQSIPYSVALFSAMLLLYYASLKGSNAFM  71

Query  291  LITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDTSSR  470
            LITIN +GC I++ Y+ FF+ YATK AKI T K L+L N+G  GLI+L+T  ++K +  R
Sbjct  72   LITINGIGCIIESLYLLFFMIYATKTAKIYTTKLLILFNIGALGLIVLLTYLLSKSSDQR  131

Query  471  AHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  650
              IVGWIC VF++CVF APL I+RQVI+TKSVEYMPF LS  LT+ A MW  YGL  KDY
Sbjct  132  LTIVGWICAVFSVCVFAAPLSIIRQVIRTKSVEYMPFSLSCCLTICAGMWLLYGLSIKDY  191

Query  651  NIAIPNILGFIFGILQMVLYVVYKNGKKKE  740
             IA PNILG  FG  QM+LY+ Y+  +  E
Sbjct  192  YIATPNILGMAFGATQMILYLAYRTRRNSE  221



>ref|XP_004489106.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Cicer 
arietinum]
Length=254

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 171/248 (69%), Gaps = 6/248 (2%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
            ++   FGLLGNIVSF+V+LAP+PTF  I KKK++EG+QS+PYVV L SAML +YY  L  
Sbjct  11   EMVLIFGLLGNIVSFLVFLAPLPTFYSICKKKTSEGFQSIPYVVALLSAMLLLYYGLLKT  70

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+ITIN +GC I+  Y+  ++ YA +K KI T+  +L+ ++GG GL ++IT F+ K 
Sbjct  71   NAILIITINCIGCVIEVLYLIIYIIYAPRKLKISTLALILVADLGGLGLTLIITNFIVK-  129

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            +  R H VG IC +F + VF APL I+R+VIKT+SVEYMPF LS FLTL A MWFFYGL 
Sbjct  130  SYYRVHAVGLICAIFNIAVFAAPLSIMRKVIKTRSVEYMPFFLSLFLTLCATMWFFYGLF  189

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPE-  815
             KD  I +PN+LGF+FGI QM+LY++YKN K K    E    E    G  D  ++  P  
Sbjct  190  DKDNYIMLPNVLGFLFGISQMILYLIYKNAKNK---VEANSNEQQEYGDDDGNKEDFPSI  246

Query  816  -ELKEQVI  836
             E+KE ++
Sbjct  247  VEMKENIV  254



>ref|XP_004302124.1| PREDICTED: bidirectional sugar transporter NEC1-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 172/251 (69%), Gaps = 7/251 (3%)
 Frame = +3

Query  99   DLTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTP  278
             L F+FGLLGNIVSFMV+LAP+PTF +IYKKKS+EG+QS+PYVV L SAML +YY  +  
Sbjct  8    QLAFSFGLLGNIVSFMVFLAPMPTFYRIYKKKSSEGFQSIPYVVALLSAMLLLYYGVIKT  67

Query  279  DTTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKD  458
            +  L+I+IN+ G  I+ +Y+ F+L YA KK +I T+  +LL+NV  +GL +  T F+   
Sbjct  68   NAILIISINAFGIVIEVAYLIFYLTYAPKKQRIFTLNLILLVNVA-FGLTLAATIFLLSG  126

Query  459  TSSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  638
            T  R   VGWIC VF + VF APL I+R+VI+TKSVE+MPF LS FLTL A  WFFYGL 
Sbjct  127  TK-RVAAVGWICAVFNIAVFAAPLSIMREVIRTKSVEFMPFGLSLFLTLCATTWFFYGLF  185

Query  639  RKDYNIAIPNILGFIFGILQMVLYVVYKNGKKKESTAEQKLPENGSCGGGDQVEQKVPEE  818
             KDY IA+PN+LGF+FGI QM+LY+VY+N  K     E K   N     GD +E +    
Sbjct  186  TKDYYIALPNVLGFLFGIAQMILYMVYRNSGKDHDEVEAKTRTN-----GDDLEMRYKVI  240

Query  819  LKEQVIDVVKL  851
             K +  +  KL
Sbjct  241  SKSKTTNHNKL  251



>ref|XP_009125890.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Brassica 
rapa]
Length=297

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 161/225 (72%), Gaps = 7/225 (3%)
 Frame = +3

Query  102  LTFAFGLLGNIVSFMVYLAPVPTFIKIYKKKSTEGYQSVPYVVGLFSAMLWIYYAFLTPD  281
            L   FG+LGN +SF+V+LAPVPTF +IYK KSTE +QS+PY V LFS MLW+YYA    D
Sbjct  10   LAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALTKQD  69

Query  282  TTLLITINSVGCFIQTSYISFFLFYATKKAKIDTMKTLLLLNVGGYGLIILITQFVAKDT  461
              LLITINS GC ++T YI+ F  YATK+ K+  +K  L +NV  + LII++T F  K  
Sbjct  70   AFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTHFAVKRP  129

Query  462  SSRAHIVGWICLVFALCVFVAPLCIVRQVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLLR  641
            S +  ++GWIC+  ++ VF APL IV +VIKTKSVE+MPF LSFFLT+SAVMWF YG   
Sbjct  130  SLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYGAFL  189

Query  642  KDYNIAIPNILGFIFGILQMVLYVVYKN-------GKKKESTAEQ  755
             D  IAIPN++GFI G++QMVLY VY+N       GKK  S++EQ
Sbjct  190  HDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKKNNSSSEQ  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2776865281746