BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21478_g1_i3 len=312 path=[4075:0-126 3296:127-127 3297:128-311]

Length=312
                                                                      Score     E

ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  75.9    2e-13   
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...  72.8    9e-13   
emb|CDP10671.1|  unnamed protein product                              68.9    5e-11   
emb|CDP16255.1|  unnamed protein product                              67.0    2e-10   
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...  65.9    4e-10   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              65.9    5e-10   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  65.5    6e-10   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  65.9    7e-10   
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...  62.8    1e-09   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  63.9    3e-09   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  63.5    3e-09   
ref|NP_001234202.1|  NRC1                                             63.5    4e-09   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  62.8    6e-09   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  62.4    7e-09   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  62.4    8e-09   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  62.4    8e-09   
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...  62.0    8e-09   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  62.4    1e-08   
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  62.0    1e-08   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...  62.0    1e-08   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  62.0    1e-08   
emb|CDP00736.1|  unnamed protein product                              62.0    1e-08   
emb|CDP08032.1|  unnamed protein product                              60.8    2e-08   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  61.6    2e-08   
emb|CDP10323.1|  unnamed protein product                              61.2    2e-08   
emb|CDP21314.1|  unnamed protein product                              58.9    2e-08   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  61.2    2e-08   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  60.8    3e-08   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  60.8    3e-08   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  60.8    3e-08   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              60.8    3e-08   
emb|CDP05521.1|  unnamed protein product                              60.5    5e-08   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  60.1    5e-08   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  60.1    6e-08   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  59.3    6e-08   
emb|CDP05499.1|  unnamed protein product                              59.7    6e-08   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  59.7    7e-08   
gb|EYU24406.1|  hypothetical protein MIMGU_mgv1a002161mg              59.7    7e-08   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  59.7    7e-08   
emb|CDP16256.1|  unnamed protein product                              59.3    8e-08   
emb|CDP00592.1|  unnamed protein product                              59.3    9e-08   
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8              59.3    1e-07   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              59.3    1e-07   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  58.9    1e-07   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...  58.9    1e-07   
gb|EYU24408.1|  hypothetical protein MIMGU_mgv1a022062mg              58.9    1e-07   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...  58.5    2e-07   
emb|CDP00687.1|  unnamed protein product                              57.8    2e-07   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  58.5    2e-07   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  58.5    2e-07   
emb|CDP05558.1|  unnamed protein product                              58.5    2e-07   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg              58.2    2e-07   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...  58.2    2e-07   
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...  57.8    2e-07   
gb|EYU24152.1|  hypothetical protein MIMGU_mgv1a018081mg              58.2    3e-07   
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...  57.0    3e-07   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  55.8    3e-07   
emb|CDP00690.1|  unnamed protein product                              57.8    3e-07   
dbj|BAD15107.1|  hypothetical protein                                 57.0    3e-07   Nicotiana tabacum [American tobacco]
gb|EYU17740.1|  hypothetical protein MIMGU_mgv1a018663mg              57.4    4e-07   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              57.4    4e-07   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg              57.4    4e-07   
emb|CDP04880.1|  unnamed protein product                              57.4    4e-07   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...  57.4    5e-07   
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg              56.2    5e-07   
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg              57.0    5e-07   
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg              57.0    5e-07   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  57.0    5e-07   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              57.0    5e-07   
ref|XP_004243045.1|  PREDICTED: putative late blight resistance p...  56.6    6e-07   
emb|CDP11831.1|  unnamed protein product                              57.0    6e-07   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...  56.6    7e-07   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              56.6    7e-07   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              56.6    7e-07   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...  56.6    8e-07   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...  56.6    8e-07   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  56.6    8e-07   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  56.6    8e-07   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  56.2    9e-07   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  56.2    9e-07   
ref|XP_009800168.1|  PREDICTED: putative late blight resistance p...  56.2    9e-07   
ref|XP_009799406.1|  PREDICTED: putative late blight resistance p...  56.2    1e-06   
ref|XP_009799404.1|  PREDICTED: putative late blight resistance p...  56.2    1e-06   
ref|XP_009800164.1|  PREDICTED: putative late blight resistance p...  56.2    1e-06   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  56.2    1e-06   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  55.8    1e-06   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  55.8    1e-06   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...  55.8    1e-06   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              55.8    1e-06   
emb|CDP00691.1|  unnamed protein product                              55.8    1e-06   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg              55.8    1e-06   
emb|CDP00737.1|  unnamed protein product                              55.8    1e-06   
gb|EYU40383.1|  hypothetical protein MIMGU_mgv1a001106mg              55.8    2e-06   
ref|XP_011087136.1|  PREDICTED: putative late blight resistance p...  55.8    2e-06   
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  55.5    2e-06   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  55.8    2e-06   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  55.5    2e-06   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  55.5    2e-06   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  55.5    2e-06   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  55.5    2e-06   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...  55.1    2e-06   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2              55.1    2e-06   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  55.1    3e-06   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...  55.1    3e-06   
ref|XP_011087139.1|  PREDICTED: putative late blight resistance p...  55.1    3e-06   
gb|EYU24185.1|  hypothetical protein MIMGU_mgv1a024774mg              54.7    3e-06   
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  54.7    3e-06   
ref|XP_009603167.1|  PREDICTED: putative late blight resistance p...  54.7    4e-06   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  54.7    4e-06   
emb|CDP20211.1|  unnamed protein product                              54.3    4e-06   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...  54.3    4e-06   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  52.8    4e-06   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...  54.3    4e-06   
gb|EYU24159.1|  hypothetical protein MIMGU_mgv1a020220mg              54.3    4e-06   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  54.3    4e-06   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  54.3    5e-06   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  54.3    5e-06   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              54.3    5e-06   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  53.5    5e-06   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  54.3    5e-06   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  53.5    5e-06   
emb|CDP00692.1|  unnamed protein product                              54.3    5e-06   
emb|CDP08033.1|  unnamed protein product                              53.9    5e-06   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  53.5    7e-06   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  53.5    7e-06   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  53.5    7e-06   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  53.5    7e-06   
ref|XP_009599401.1|  PREDICTED: putative late blight resistance p...  52.4    7e-06   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              53.5    8e-06   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
emb|CDP05514.1|  unnamed protein product                              53.5    8e-06   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_011071970.1|  PREDICTED: putative late blight resistance p...  53.5    8e-06   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  53.5    9e-06   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  53.5    9e-06   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  53.1    9e-06   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211  51.6    1e-05   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
ref|XP_011088084.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
ref|XP_009593857.1|  PREDICTED: putative late blight resistance p...  52.4    1e-05   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  52.4    2e-05   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  52.4    2e-05   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  52.4    2e-05   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              52.4    2e-05   
emb|CDP05441.1|  unnamed protein product                              52.4    2e-05   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  50.4    2e-05   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  52.0    2e-05   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg              52.0    2e-05   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...  52.0    3e-05   
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              51.6    3e-05   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  52.0    3e-05   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  52.0    3e-05   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  52.0    3e-05   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  51.6    3e-05   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  51.6    3e-05   
emb|CDP11186.1|  unnamed protein product                              52.0    3e-05   
ref|XP_011087137.1|  PREDICTED: putative late blight resistance p...  51.6    4e-05   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  51.6    4e-05   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  51.2    4e-05   
gb|AAV31175.1|  Putative disease resistance protein, identical        51.2    4e-05   Solanum tuberosum [potatoes]
gb|EYU38159.1|  hypothetical protein MIMGU_mgv1a025995mg              51.2    4e-05   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  51.2    4e-05   
ref|XP_011072138.1|  PREDICTED: putative late blight resistance p...  50.8    4e-05   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  51.2    4e-05   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  49.3    4e-05   
emb|CDP20685.1|  unnamed protein product                              51.2    5e-05   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...  51.2    5e-05   
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...  51.2    5e-05   
gb|EYU17781.1|  hypothetical protein MIMGU_mgv1a023021mg              51.2    5e-05   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  51.2    5e-05   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  51.2    6e-05   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  50.8    6e-05   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...  50.8    6e-05   
gb|EYU24400.1|  hypothetical protein MIMGU_mgv1a026464mg              50.8    6e-05   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg              50.8    6e-05   
emb|CDP15849.1|  unnamed protein product                              50.8    7e-05   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              50.4    8e-05   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg              50.4    8e-05   
gb|EYU17705.1|  hypothetical protein MIMGU_mgv1a018542mg              50.4    8e-05   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...  50.4    9e-05   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              50.4    9e-05   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  50.4    9e-05   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  50.4    9e-05   
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg              50.1    1e-04   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...  50.1    1e-04   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  50.1    1e-04   
emb|CDP16841.1|  unnamed protein product                              50.1    1e-04   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...  50.1    1e-04   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  50.1    1e-04   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  48.9    1e-04   
emb|CDP20153.1|  unnamed protein product                              50.1    1e-04   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  50.1    1e-04   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg              50.1    1e-04   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg              50.1    1e-04   
gb|EYU40390.1|  hypothetical protein MIMGU_mgv1a018316mg              49.7    1e-04   
emb|CDP10267.1|  unnamed protein product                              49.7    2e-04   
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...  49.7    2e-04   
ref|XP_009622940.1|  PREDICTED: putative late blight resistance p...  49.7    2e-04   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              49.3    2e-04   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
gb|EYU17692.1|  hypothetical protein MIMGU_mgv1a019705mg              49.3    2e-04   
emb|CDP16498.1|  unnamed protein product                              49.3    2e-04   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              49.3    2e-04   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              49.3    2e-04   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
emb|CDP12800.1|  unnamed protein product                              49.3    2e-04   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  48.9    3e-04   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  48.9    3e-04   
emb|CDP11642.1|  unnamed protein product                              48.9    3e-04   
gb|KDP30596.1|  hypothetical protein JCGZ_16249                       48.5    3e-04   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
emb|CDP01146.1|  unnamed protein product                              48.1    3e-04   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  48.5    4e-04   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              48.1    5e-04   
gb|AAV88068.1|  NBS-LRR protein                                       48.1    5e-04   Ipomoea batatas [batate]
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  48.1    5e-04   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  48.1    5e-04   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  48.1    5e-04   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  48.1    5e-04   
emb|CDP10797.1|  unnamed protein product                              47.8    6e-04   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...  47.8    6e-04   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  47.8    6e-04   
ref|XP_009602411.1|  PREDICTED: putative late blight resistance p...  47.8    6e-04   
gb|AET22504.1|  hypothetical protein                                  47.8    6e-04   
emb|CDP21316.1|  unnamed protein product                              45.8    6e-04   
emb|CDP12799.1|  unnamed protein product                              47.8    6e-04   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  47.8    7e-04   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...  47.8    7e-04   
ref|XP_009604639.1|  PREDICTED: putative late blight resistance p...  47.4    7e-04   
ref|XP_009763637.1|  PREDICTED: probable disease resistance RPP8-...  47.0    7e-04   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  47.4    7e-04   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  47.4    7e-04   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg              47.4    8e-04   
ref|XP_009604647.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
emb|CDP12798.1|  unnamed protein product                              47.4    8e-04   
emb|CDP04754.1|  unnamed protein product                              47.4    8e-04   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              47.4    9e-04   
emb|CDP18740.1|  unnamed protein product                              47.0    9e-04   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...  47.4    9e-04   
emb|CDP11163.1|  unnamed protein product                              47.4    0.001   
ref|XP_009601897.1|  PREDICTED: putative late blight resistance p...  47.0    0.001   



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 61/103 (59%), Gaps = 15/103 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIYI--EGELVSGC--LENLVDLDLLEKLKFRIGRVERFCLPT-------  118
            F  +PNLK+LGI I  + + +  C  L+NLV L  LEKLK  +        PT       
Sbjct  545  FLRIPNLKKLGILIVDDSDTIQKCYCLDNLVHLTQLEKLKVEVRESWLIFRPTIKGWVDI  604

Query  117  ----SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                +FP  LKKLTLC+T+L W++M ++ KL NLEVLKLKD A
Sbjct  605  PHCDNFPPNLKKLTLCTTHLEWEDMNILSKLPNLEVLKLKDHA  647



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 64/113 (57%), Gaps = 18/113 (16%)
 Frame = -1

Query  291  VTSSDRNPNFGMVPNLKELGIYIE--GELVSGCLENLVDLDLLEKLKFRIGRVERFCL--  124
            + SS  +  F  +PNLK+LGI I+     +  CL+NLV L  LEKLK  +   E F L  
Sbjct  187  IPSSCNDEVFLRIPNLKKLGILIDVASYPIRNCLDNLVHLTQLEKLKVVVR--EPFLLIF  244

Query  123  ------------PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                          +FP  LKKLTLC T L W++M ++ KL NLEVLKLKD+A
Sbjct  245  TPIIEGWMDIPHCDNFPPNLKKLTLCRTNLQWEDMNILRKLPNLEVLKLKDYA  297



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGC---LENLVDLDLLEKLKFRIGRV---ERFCLP--TSFP  109
               +PNLK+LG+Y   E  S C   + N+  L  LE LK     +   ER  +P    FP
Sbjct  580  IASLPNLKKLGLYETAEAHSNCWSYISNVAQLHQLEILKLNFINLFAEERRWVPCVDEFP  639

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              LKKLTL S+YLPW +M V+  L NLEVLKLK+ A
Sbjct  640  PNLKKLTLSSSYLPWKDMNVLSMLPNLEVLKLKNNA  675



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 51/97 (53%), Gaps = 4/97 (4%)
 Frame = -1

Query  279  DRNPNFGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE----RFCLPTSF  112
            +R P    +     L I IE    S   E+L  L  LE LK     V     R     +F
Sbjct  682  ERAPKLKKLAICGRLAILIEANGQSRLFESLCTLQFLENLKLLNEDVSSPLNRLPQENNF  741

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P KL KLTL  T+LPW++M V+GKL NLEVLKLKD A
Sbjct  742  PRKLTKLTLSKTFLPWNQMSVLGKLENLEVLKLKDNA  778



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 67/125 (54%), Gaps = 22/125 (18%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYI--EGELVSGC--LENLVDLDLLEKLKFRIG  145
            QTL  L  +S +    F  +PNLK+LGI I  + + +  C  L+NLV L  LEKLK +  
Sbjct  355  QTLTGLMPSSCNEEV-FLRIPNLKKLGILIVDDSDTIQKCYCLDNLVHLSQLEKLKVQFR  413

Query  144  R---------------VERFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLK  16
                            +    +P   +FP  LKKLTLC T++ W++M ++ KL NLEVLK
Sbjct  414  ESYMLIFRWMSEDWMDLSSLHIPHCDNFPPNLKKLTLCRTHIQWEDMNILRKLPNLEVLK  473

Query  15   LKDFA  1
            LK  A
Sbjct  474  LKHHA  478



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  258  MVPNLKELGIYI------EGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTS-----F  112
            M+PNLK+LG+          ++   CLENLV L  LEKLKF +     F  P       F
Sbjct  719  MIPNLKKLGLAFCTSDKPYEDIEHYCLENLVYLHQLEKLKFVVE--SDFPSPVKLHFPVF  776

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P KL+KLTL    LPW +M ++G L NL+VLKL++ A
Sbjct  777  PMKLRKLTLSGWRLPWKDMTIVGSLPNLQVLKLRESA  813



>ref|XP_011084823.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=557

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -1

Query  258  MVPNLKELGIY----IEGELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPTSF--PSK  103
            M+PNLK+L +Y            CL NLV L LLE L   FR   +E    P +F  PS 
Sbjct  361  MMPNLKKLKVYYCDVFTAVWAKYCLSNLVHLCLLETLSLMFRPVGLEVNPFPANFALPST  420

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            L+KLTL    LPW +M VI  L NLEVLKL+D A
Sbjct  421  LQKLTLTDCALPWQDMAVIHSLPNLEVLKLRDDA  454



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGEL---VSGCLENLVDLDLLEKLK---FRIGRVE-RFCLP--TSF  112
            F  +  +K+LGI+  G     V  CL+NL+ L  LE LK   F +  ++  F LP   SF
Sbjct  672  FEGIKKVKKLGIFGTGNEFIDVPECLDNLIHLHELETLKIAGFNMDLLDFDFRLPRLVSF  731

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL  TYLPW++M +I KL  LEVL+LK+ A
Sbjct  732  PPNLKKLTLSKTYLPWEDMTIISKLPKLEVLQLKNSA  768



>ref|XP_009618247.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
 ref|XP_009618250.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
Length=255

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 57/103 (55%), Gaps = 16/103 (16%)
 Frame = -1

Query  264  FGMVPNLKELGIY---------IEGELVSGCLENLVDLDLLEKLKF----RIGRVERFCL  124
            F   PNLK+LG+           + E  SG   N+  LD LEKLK     R  R ++  L
Sbjct  49   FTRTPNLKKLGVRGKIDALLETSKDESSSGLFSNIGKLDCLEKLKLVNDTRQSR-KQLHL  107

Query  123  PTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P +  FP KLKKLTL  T+  W +M ++G L  LEVLKLK++A
Sbjct  108  PPAYIFPQKLKKLTLIDTWFEWKDMSILGLLEYLEVLKLKEYA  150



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/96 (42%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIYI-----EGELVSGCLENLVDLDLLEKLKFR-IGRVERFCLPTS--FP  109
            F  +P LK+L I+      + E  S    NL  L+LLE LK   + R  +  LP+   FP
Sbjct  681  FACLPALKKLEIFATESNSKAEQTSEYFSNLASLNLLETLKCSFLYRPRKHRLPSGDHFP  740

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  ++LPW++M  +  L  LEVLKL+ FA
Sbjct  741  ANLKKLTLSGSFLPWEDMAKLAVLPKLEVLKLRSFA  776



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -1

Query  258  MVPNLKELGI-YIEGELVSGC-LENLVDLDLLEKLKFRI--GRVERFCLPTSFPSKLKKL  91
            M+PNLK+L I Y  G+      L NL+    LEKLK +I    + R  L  +FP  LKKL
Sbjct  562  MIPNLKKLSISYFRGKNDQEYQLNNLLHFHQLEKLKVKIFPTFLFRRKLNLAFPPSLKKL  621

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL     PW++MG++  L NLEVLKL+D+A
Sbjct  622  TLSGWQRPWEDMGIVSLLPNLEVLKLRDYA  651



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 14/97 (14%)
 Frame = -1

Query  255  VPNLKELGIYIEGELV-------SGCLENLVDLDLLEKLKF-RIGRVERFCL---PTS-F  112
             PNLK+LGI   G++        S  L N+  L  LE LK   +G++++  L   P S F
Sbjct  683  APNLKKLGI--RGKIAKLMEPSQSVLLNNVKRLQFLENLKLINVGQIDQTQLRLPPASIF  740

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P+KL+KLTL  T+L WD+M V+ +L NL+VLKLKD A
Sbjct  741  PTKLRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNA  777



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 50/94 (53%), Gaps = 9/94 (10%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGEL-------VSGCLENLVDLDLLEKLKFRIGR--VERFCLPTSF  112
            F  +PNLK L ++ E EL       +S  L N   L  LE LKFR  R    R     S 
Sbjct  363  FSAIPNLKRLTVHHEEELTEFERVEISQHLSNFSRLKELEILKFRGNRQYFRRMPGKYSL  422

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            P+ L  LTL  TYLPW+++  I  L NLEVLK+K
Sbjct  423  PTSLNSLTLTDTYLPWEDIANIVMLPNLEVLKIK  456



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 56/94 (60%), Gaps = 12/94 (13%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-GELVSGCLENLVDLDLLEKLKFRI--GRVER-----FCLPTSFP  109
            F  +PNLK L IY + G + S  L +L  L+ LE LK     G  ER     F LPTS  
Sbjct  706  FSGIPNLKRLKIYGDKGNMTSEKLNSLSCLNKLETLKITCYRGYYERPPQSKFALPTS--  763

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              LK+LTL STYLPW++M  I  L NL+VLK+KD
Sbjct  764  --LKRLTLESTYLPWEDMANIVMLPNLQVLKIKD  795



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 14/98 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-------SGCLENLVDLDLLEKLKF---RIGRVERFCLPTS  115
            F   PNLK+LGI   G++        S  L+N+  L+ LE LK     I   +   LP +
Sbjct  497  FARAPNLKKLGI--RGKIAVLLEPNTSTSLKNVKKLEYLESLKLINDSIQTGKELHLPPA  554

Query  114  --FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              FP+KL+KLTL  T+L W++M V+G+L +LEVLKLK+
Sbjct  555  YIFPTKLRKLTLLDTWLGWNDMSVLGQLEHLEVLKLKE  592



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = -1

Query  252  PNLKELGIYIEGELV----SGCLENLVDLDLLEKLKFRIG-RVERFCLPT-SFPSKLKKL  91
            PNLK+LG+Y  G  +    S  L+NLV L  LE LK      +    LP  SFP  LK+L
Sbjct  691  PNLKKLGVYYYGAGIEDWSSYDLKNLVRLSKLENLKLVFNWPLNEVLLPNLSFPQSLKEL  750

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL ++ L W++M +IG L +LEVLKLK+ A
Sbjct  751  TLNASKLSWEDMSIIGSLPHLEVLKLKEHA  780



>ref|XP_011084836.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=481

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 59/115 (51%), Gaps = 15/115 (13%)
 Frame = -1

Query  312  QTLYW--LKVTSSDRNPNFGMVPNLKELGIYIE----GELVSGCLENLVDLDLLEKLKFR  151
            QTLY    + TS+       M+PNLK+L +Y +     +    CL NLV L  LE L   
Sbjct  195  QTLYVDNFRFTSN----TIEMIPNLKKLKLYYDDASTAKWAKYCLNNLVHLCQLETLNLM  250

Query  150  -----IGRVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                 +  V+ F    +FP KLKKLTL    LPW  M VI  L NLEVLKL+  A
Sbjct  251  FTFMLMCEVDPFPASFAFPPKLKKLTLSKCRLPWQGMAVIRSLLNLEVLKLRYIA  305



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (57%), Gaps = 16/99 (16%)
 Frame = -1

Query  255  VPNLKELGI--------YIEGELVSGCLENLVDLDLLEKLKFRIG----RVERFCLPT--  118
            +PNLK+LGI        Y++       LE+LV+L  LE LK  I     R  +F  P   
Sbjct  885  IPNLKKLGISYDVSSQAYVDWSQFE--LESLVNLHQLETLKIVIKNDPYRTSKFVNPPQL  942

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            +FP KLK+LTL    LPW+ M ++G L NLEVLKLK  A
Sbjct  943  AFPQKLKRLTLSGCGLPWETMTIVGSLPNLEVLKLKKDA  981



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -1

Query  264  FGMVPNLKELGI---YIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT--SFPSKL  100
            F  +PNLK+L I   Y+  E+    L +L  L  LE LK+R   ++   +P+  + P+ L
Sbjct  679  FSAIPNLKKLQIVGNYL-MEMKREHLNSLSCLKELEILKYRDDGIQPSRIPSMYALPTSL  737

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            K+LTLC T LPW++M  I KL NLEVLK+KD
Sbjct  738  KRLTLCFTSLPWEDMANIVKLPNLEVLKIKD  768



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 52/99 (53%), Gaps = 12/99 (12%)
 Frame = -1

Query  264  FGMVPNLKELGI------YIEGELVSGCLENLVDLDLLEKLKFRIG---RVERFCLPT--  118
            F  +PN+K+L I      Y E E+   C  +L  L  LE L F I         CLP   
Sbjct  656  FKRIPNVKKLMILGHMVQYGESEM-PDCFNDLASLGKLESLGFHIQTNINHLNLCLPPPG  714

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            +FP  LKKLT   TY+PW  M ++G L NLEVLKL+  A
Sbjct  715  NFPQNLKKLTFIFTYMPWKNMDIVGMLPNLEVLKLRSSA  753



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 11/93 (12%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGR-------VERFCLPTSFPS  106
            F  +PNLK L IY     ++  L +L  L+ LE LK    R         +F LPTS   
Sbjct  700  FSDIPNLKTLKIYGAKGDITSELNSLSCLNKLETLKIACNRRYYERPPQSKFALPTS---  756

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL STYLPW++M  I  L NL+VLK+KD
Sbjct  757  -LKRLTLESTYLPWEDMANIVMLPNLQVLKIKD  788



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 9/112 (8%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLK---  157
            QTL  +++TS  R   F  +P L+ L I    E       S  L NLV L LLE LK   
Sbjct  615  QTLSTIRLTSCTREV-FRSMPYLRRLAICETKEDHNTNETSKYLSNLVHLPLLEALKCSF  673

Query  156  FRIGRVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            +R  +  R     +FPS L+KLTL  +YLPW++M  I +L  LEVLKL++ A
Sbjct  674  YRDAKPWRTLPWDAFPSNLRKLTLSWSYLPWEDMTNISRLPKLEVLKLRNCA  725



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = -1

Query  249  NLKELGIY------IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCL----PTSFPSKL  100
            NLK+LGI       ++ +  S   ++L +L+ LE+LK     V    L    P  FP +L
Sbjct  215  NLKKLGISGNLGTLMKAKGESNLFDHLCELNFLERLKLCSNDVNSKLLALPQPHKFPKRL  274

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             KL+L +T L WD+M ++GKL  LEVLKLKD+A
Sbjct  275  TKLSLQNTSLGWDQMSILGKLQYLEVLKLKDYA  307



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGE---LVSGCLENLVDLDLLEKL------KFRIGRVERFCLPTSF  112
            F  +  +K+LGIY   +   +   CLENL+DL  LE L      KF+     R   P SF
Sbjct  726  FEGIKKVKKLGIYGTKDDFNIEPRCLENLMDLFELEALTIVSYRKFKADTFLRLPCPGSF  785

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTLC T+L W +M ++  L  L+VL+L++ A
Sbjct  786  PPNLKKLTLCCTFLLWKDMTIVSMLPKLKVLQLRNNA  822



>emb|CDP10323.1| unnamed protein product [Coffea canephora]
Length=686

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -1

Query  276  RNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLK---FRIGRVERFCLP  121
            R   F  +P L ELG+    E         CL++L  L  LE L    +R  R  R    
Sbjct  492  RRDAFANMPYLAELGLCETKEDYYRDRSCECLKDLAYLHKLEALNCSFYREIREARTISW  551

Query  120  TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             +FPS L+KLTL ++ LPW++M  + KL NLEVLKLK++A
Sbjct  552  DAFPSNLRKLTLSASNLPWEDMTNVAKLPNLEVLKLKNYA  591



>emb|CDP21314.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 10/113 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRI  148
            QTLY ++ +   +   F ++P+LK+LGI    E      +S  L NLV L  LE L+   
Sbjct  35   QTLYTIQFSCCTKE-FFSVMPHLKKLGICETKEDYSTDSLSQVLNNLVCLQELETLECSF  93

Query  147  GRVERFCLP----TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                R         + P  LK L+L  +YLPW++M  I  L NLEVLKLK++A
Sbjct  94   HTQNREVRKNLGLAALPVTLKHLSLSRSYLPWEDMTFIAMLPNLEVLKLKNYA  146



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 52/101 (51%), Gaps = 15/101 (15%)
 Frame = -1

Query  267  NFGMVPNLKELGIYIEGELVSG------CLENLVDLDLLEKLKFRIGRVE------RFCL  124
             F  +  +KELGI   G   S       CL+NL+ L  LE L       E      R   
Sbjct  719  TFEGIKKVKELGI---GGNTSDFYKKPKCLDNLIYLHELEALSIASYNSEPDGLFLRLPC  775

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  FP  LKKLTLC T+LPW++M +I KL  LEVL+LK  A
Sbjct  776  PGYFPPNLKKLTLCRTFLPWEDMAIISKLPKLEVLQLKARA  816



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG---CLENLVDLDLLEKL------KFRIGRVERFCLPTSF  112
            F  +  +K+LGIY   +  +    CLENL+DL  LE L      KF          P SF
Sbjct  728  FEGIKKVKKLGIYGTKDDFNSEPRCLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSF  787

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTLC T+L W +M ++  L  LEVL+L++ A
Sbjct  788  PPNLKKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNA  824



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG---CLENLVDLDLLEKL------KFRIGRVERFCLPTSF  112
            F  +  +K+LGIY   +  +    CLENL+DL  LE L      KF          P SF
Sbjct  636  FEGIKKVKKLGIYGTKDDFNSEPRCLENLMDLHELEALTIVSYRKFNSNTFLSLPCPGSF  695

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTLC T+L W +M ++  L  LEVL+L++ A
Sbjct  696  PPNLKKLTLCCTFLLWKDMTIVSMLPKLEVLQLRNNA  732



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGE--LVSGCLENLVDLDLLEKLKFRIG--------RVERFCLPTS  115
            F  VPNL++LGIY   E     G  E LV L  LE LK+           + +R     S
Sbjct  705  FLSVPNLRKLGIYQTEEDYRFRGWFEQLVHLQELETLKYAFSNPFVSSALKPDRLPSWRS  764

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            FP KL KLTL  T LPW++M  +  L  LEVLKL+++A
Sbjct  765  FPPKLVKLTLSGTSLPWEDMVELSMLPKLEVLKLRNYA  802



>gb|EYU24172.1| hypothetical protein MIMGU_mgv1a025900mg, partial [Erythranthe 
guttata]
Length=885

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PN+K+L I + G + S CL NL  L  LE+L  ++      C    FPS LK+L L   
Sbjct  675  IPNVKKLEI-VCGTIGSNCLRNLGLLHKLEQLYLKLNTGTSCCGEIVFPSSLKELMLSEC  733

Query  75   YLPWDEMGVIGKLSNLEVLKLKDFA  1
             +PW++M V+G L NL+VL+L+  A
Sbjct  734  KIPWEDMSVVGSLPNLQVLELRKNA  758



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = -1

Query  300  WLKVTSSDRNPNFGMVPNLKELGIYIEGELVSGCLE--NLVDLDLLEKLKFRIGRVERFC  127
            W       R+     +PN++ LG +I            +L  L++LEKLKF         
Sbjct  807  WPNSAGPSRDILLARIPNVRNLGFHITLSSREDPFNFFDLSGLNVLEKLKFEYQTYGMVP  866

Query  126  LPTS----FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            +  S    FPS LKKLTL  +++ W+EM +IG L NLEVLK+KD
Sbjct  867  VTISSSDKFPSSLKKLTLVGSHVNWEEMSIIGMLPNLEVLKVKD  910



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNF-GMVPNLKELGIYIE---GELVSGCLENLVDLDLLEKLKFRIG  145
            QTL  L V+S++ +     ++PNLK+LGI +     E  +  L  L  L  LE L     
Sbjct  700  QTL--LTVSSTNFSKKIVSIIPNLKKLGILVSKKNDEHPTNFLNYLSSLHCLETLNLSFS  757

Query  144  ----RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                +        +FP  L+ LTL  ++LPW+EM  +GK+ NLEVLKLKD A
Sbjct  758  LQNEKSSTISQWNAFPPNLRALTLSGSHLPWEEMVTVGKIPNLEVLKLKDRA  809



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 50/90 (56%), Gaps = 6/90 (7%)
 Frame = -1

Query  252  PNLKELGIYIEGELVSGC----LENLVDLDLLEKLK--FRIGRVERFCLPTSFPSKLKKL  91
            PNLK+LG+Y  G  +       L+NLV L  LE LK  F     E      SFP  LKKL
Sbjct  691  PNLKKLGVYYYGAGIEDWSAYDLKNLVRLSKLENLKCVFNWPPNETLLPNLSFPQSLKKL  750

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL  + L W  M +IG L +LEVLKLK +A
Sbjct  751  TLDGSNLSWKGMSIIGSLPHLEVLKLKQYA  780



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 54/99 (55%), Gaps = 13/99 (13%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-------SGCLENLVDLDLLEKLKF----RIGRVERFCLPT  118
            F   PNLK+LGI   G++        S    N+  L  LE LK     + G+  R     
Sbjct  286  FSRAPNLKKLGI--RGKIFMLLEPNKSELFNNVKKLQCLENLKLINVGQSGKQLRLPPTY  343

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             FP+ L+KLTL  T+L WD+M V+G+L  LEVLKLKD A
Sbjct  344  IFPTNLRKLTLLDTWLEWDDMSVLGQLEYLEVLKLKDNA  382



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYI--EGELVSGCLENLVDLDLLEKLKF--RIG  145
            QT+  ++ +SS +      +PNL  LG ++     +      +L  L +LE L F  +  
Sbjct  653  QTISQVRPSSSIQEV-LARMPNLVNLGCHLTLSDAMKHAQFPDLSRLRMLETLTFDYQTL  711

Query  144  RVERFCLP--TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             + +F LP  + FP  LKKLTL  +Y+ W EM +IG L NLEVLK+KD
Sbjct  712  NMAKFFLPQPSKFPPNLKKLTLVGSYVDWKEMSIIGMLPNLEVLKIKD  759



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 13/92 (14%)
 Frame = -1

Query  258  MVPNLKELGIYIEGELVSGC------LENLVDLDLLEKLKFRIGRVERFCLPT----SFP  109
            M+PNLK+LGI      V G       L NLVDL  LE LK  +  + R   P     +FP
Sbjct  682  MIPNLKKLGILYG---VYGIKWREYHLHNLVDLHQLENLKVWVEDISREPFPLWEKLAFP  738

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
              LKKLTL      W++M  +G L NLEV+KL
Sbjct  739  VMLKKLTLSGCLFCWEDMTTVGSLQNLEVMKL  770



>gb|EYU24406.1| hypothetical protein MIMGU_mgv1a002161mg [Erythranthe guttata]
Length=707

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 55/105 (52%), Gaps = 18/105 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE---GELVS----GCLENLVDLDLLEKLK-------FRIGRVERFC  127
            F  +PNLK+LGI IE    E        C +++  L+ LE LK       F    +   C
Sbjct  506  FRSIPNLKKLGIRIELSPDEATDREPLSCFQHISHLEKLESLKCVVVNPIFNTTGIA-VC  564

Query  126  LP---TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             P   + FPS LKKL+LC    PW+EM  I  L NLEVLKL+ +A
Sbjct  565  PPPPLSVFPSGLKKLSLCGLGYPWEEMSKIALLPNLEVLKLRSYA  609



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 14/98 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGEL-------VSGCLENLVDLDLLEKLKF---RIGRVERFCLPTS  115
            F   PNLK+LGI   G++        S  L+N+  ++ LE LK     I   +   LP +
Sbjct  676  FARAPNLKKLGI--RGKISVLLEPNTSTSLKNVKKVEYLESLKLINDGIQTGKELHLPPA  733

Query  114  --FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              FP+KL+KLTL  T L W++M V+G+L +LEVLKLK+
Sbjct  734  HIFPTKLRKLTLVDTRLGWNDMSVLGQLEHLEVLKLKE  771



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = -1

Query  279  DRNPNFGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLK----FRIGRVERFCLPTSF  112
            +R P    +    +L +       S   E+L  LD LE LK    +    ++R     +F
Sbjct  495  ERTPKLKKLAICGKLAVLFRANGRSNVFESLCALDFLENLKLLNEYVSSPLKRLPQEHNF  554

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            P KL  LTL  T LPW++M  +GKL+NLEVLKLK
Sbjct  555  PRKLTMLTLSKTLLPWNQMSTLGKLANLEVLKLK  588



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 11/114 (10%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGI------YIEGELVSGCLENLVDLDLLEKLKFR  151
            QTL  +   S  R+  F  VP LK+LGI      +++G   S   ++   L+ LE LK  
Sbjct  709  QTLSSISPESCKRDV-FERVPKLKKLGICGRLASFMQGNNESSLFDSFSKLEFLENLKLI  767

Query  150  IG----RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                  ++      + FP  L +LTL +T L W  M ++GKL NLEVLKLKD A
Sbjct  768  NADFNSKLHFLPHESKFPRSLTRLTLLNTMLDWKHMSILGKLENLEVLKLKDNA  821



>gb|AGW23829.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
 gb|AGX27502.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
Length=768

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 50/94 (53%), Gaps = 9/94 (10%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVS----GCLENLVDLDLLEKLKFRIGR---VERFCLPTSF--PSK  103
            +PNLK+L +Y     V+     CL NLV L  LE L          +   LP SF  P  
Sbjct  672  MPNLKKLKVYYYHLFVAVWTEYCLSNLVHLYQLETLNLLFINSLIYKENPLPASFALPPN  731

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LKKLTL    +PW  M VIG L NLEVLKL+D A
Sbjct  732  LKKLTLSGCTIPWRHMTVIGSLPNLEVLKLRDNA  765



>gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Erythranthe 
guttata]
Length=834

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 7/88 (8%)
 Frame = -1

Query  255  VPNLKELGI-YIEGELVSGCLENLVDLDLLEKL--KFRIGRVERFCLPTSFPSKLKKLTL  85
            +PNLK+LG+ Y   E+   C  NL  L  LE L  +F  G  +      +FP  LKKL L
Sbjct  663  IPNLKKLGVHYRTDEIGPFCWTNLAGLRKLESLVLEFSAGISDNI----AFPDSLKKLAL  718

Query  84   CSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                +PW++M ++G L NLEVLKLK  A
Sbjct  719  SECKVPWEDMSIVGSLPNLEVLKLKSGA  746



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 53/93 (57%), Gaps = 7/93 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PS  106
            F  +PNLK L I+      + E +S  L++L  L  LE LKFR     R  LP  F  P+
Sbjct  658  FSAIPNLKRLKIHGNWRECKREKISQHLDSLSCLKELEILKFRYQGAYRRQLPRKFSLPT  717

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL +T  P ++M  I  L NLEVLK+KD
Sbjct  718  SLKRLTLTNTLFPPEDMTNITMLPNLEVLKMKD  750



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 54/101 (53%), Gaps = 17/101 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F    NLK+LGI       I+G+  SG  ++L  L+ +EKLK            G++   
Sbjct  679  FERARNLKKLGIRGRLALLIDGK--SGSFDSLGKLENVEKLKLLNDVFPSPPSEGQLRGL  736

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              P  FP KLK LTL  T+L W  M ++G L NLEVLKLKD
Sbjct  737  PPPYKFPKKLKSLTLADTFLDWSNMSILGLLENLEVLKLKD  777



>gb|EYU24408.1| hypothetical protein MIMGU_mgv1a022062mg [Erythranthe guttata]
Length=740

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 18/102 (18%)
 Frame = -1

Query  255  VPNLKELGIYIE-------GELVSGCLENLVDLDLLEKLK-------FRIGRVERFCLP-  121
            +PNLK+LGI IE        +  S C +++  L+ LE LK       F   R+   C P 
Sbjct  542  IPNLKKLGIQIELSPEAATNQEPSSCFDHISHLEKLESLKCVVVNPSFNTTRIA-VCPPP  600

Query  120  --TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              + FPS LKKL+L     PW+EM  I  L NLEVLKL+  A
Sbjct  601  PLSVFPSGLKKLSLSGLGYPWEEMSKIALLPNLEVLKLRSCA  642



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-----SGCLENLVDLDLLEKLKF---RIGRVERFCLPTS--  115
            F   PNLK+LGI  +  ++     +  L+N+  L+ LE LK       +  +  LP +  
Sbjct  681  FARTPNLKKLGIRGKISVLLDNKSAASLKNVKRLEYLENLKLINDSSIQTSKLRLPPAYI  740

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            FP+KL+KLTL  T+L W +M ++G+L +LEVLK+K+
Sbjct  741  FPTKLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKE  776



>emb|CDP00687.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 61/113 (54%), Gaps = 10/113 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRI  148
            QTLY ++ +   +   F ++P+LK+LGI    E      +S  L NLV L  LE L+   
Sbjct  172  QTLYTIQFSCCTKE-FFSVMPHLKKLGICETKEDYSTDSLSQVLNNLVCLQELETLECSF  230

Query  147  G----RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                  V +     + P  LK L+L  +YLPW++M  I  L NLEVLKLK++A
Sbjct  231  HTQNREVRKNLGLAALPVTLKHLSLSWSYLPWEDMTFIAMLPNLEVLKLKNYA  283



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 8/107 (7%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELV--SGCLENLVDLDLLEKLKFRIGRV  139
            QT+Y L   S  +    G + N+K+LGIY + +    S   +NLV L  LEKL+F +   
Sbjct  713  QTIYGLSARSCTKEVISG-IRNVKKLGIYGDKDDCEDSRLFDNLVHLHQLEKLRFGLLTP  771

Query  138  ERF---CLPT--SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             +F    +P+  SFP+ LKKL L  T L W++M +I +L NLEVLK+
Sbjct  772  WKFGDATIPSAKSFPAMLKKLELNGTCLRWEDMNIISELPNLEVLKV  818



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKL---KFRIGRVERFCLPTSF--PSKL  100
            F  +PNLK+L I I   L+    E L  L  LEKL   K+R   ++   +P+ +  P+ L
Sbjct  675  FSAIPNLKKLKI-IGNYLMEMKRERLNSLSCLEKLEILKYRDDGIQPSQIPSKYVLPASL  733

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            K+LTL  T LPW++M  I  L NLEVLK+KD
Sbjct  734  KRLTLSCTSLPWEDMANIITLPNLEVLKIKD  764



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 54/102 (53%), Gaps = 19/102 (19%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVS--------GCLENLVDLDLLEKLK-----FRIG--RVERFCLP  121
             PNLK+LGI   G+LV            +NL  LD LE LK     F +   +     LP
Sbjct  683  TPNLKKLGI--RGKLVMLVQERGGMSLFDNLAKLDHLETLKLLNDTFPLDPFKCHIPGLP  740

Query  120  TS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             S  FP  LKKLTL  T L W EM  +G L NLEVLKLKD+A
Sbjct  741  QSYKFPPNLKKLTLSDTLLDWSEMSTLGMLPNLEVLKLKDYA  782



>gb|EYU24175.1| hypothetical protein MIMGU_mgv1a026011mg [Erythranthe guttata]
Length=860

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PN+K+L I + G + S CL NL  L  LE+L   +      C    FPS LK+L L   
Sbjct  634  IPNVKKLEI-VCGTIGSNCLRNLGLLHKLEQLNLELITGTSCCGEIVFPSSLKELILSEC  692

Query  75   YLPWDEMGVIGKLSNLEVLKLKDFA  1
             +PW++M V+G L NL+VL+L   A
Sbjct  693  KIPWEDMSVVGSLPNLQVLELHKNA  717



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV------SGCLENLVDLDLLEKLKF-----RIGRVERFCLPT  118
            F   PNLK+LGI   G++          L+N+  L+ LE LK      + G+  R     
Sbjct  683  FARTPNLKKLGI--RGKIAVLLEPNKSLLKNVKKLESLENLKLINDSSQTGKGLRLPPSY  740

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             FP+KL+KL+L  T+L W++M ++G++ +LEVLKLK+
Sbjct  741  IFPTKLRKLSLVDTWLEWNDMSILGQMEHLEVLKLKE  777



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 14/97 (14%)
 Frame = -1

Query  255  VPNLKELGIYIEGELV-------SGCLENLVDLDLLEKLKF-RIGRVERFCL---PTS-F  112
             PNLK+LGI   G++        S    N+  L  LE LK   +G+ ++  L   P S F
Sbjct  286  APNLKKLGI--RGKIAKLMEPSRSILFNNVKRLQFLENLKLINVGQTDQTQLRLPPASLF  343

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P+KL++LTL  T+L WD+M V+ +L  L+VLKLKD A
Sbjct  344  PTKLRRLTLSDTWLEWDDMSVLKQLEYLQVLKLKDNA  380



>gb|EYU24152.1| hypothetical protein MIMGU_mgv1a018081mg, partial [Erythranthe 
guttata]
Length=832

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            + N+K+L I + G + S CL NL  L  LE+L  ++      C    FPS LK L L   
Sbjct  673  IANVKKLKI-VCGTIGSNCLRNLGLLHKLERLNLKLNTGTSCCGEIVFPSSLKVLVLSEC  731

Query  75   YLPWDEMGVIGKLSNLEVLKLKDFA  1
             +PW++M V+G L NL+VL+L+  A
Sbjct  732  KIPWEDMSVVGSLPNLQVLELRKNA  756



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 55/104 (53%), Gaps = 18/104 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGEL-----------VSGCLENLVDLDLLEKLKF---RIGRVERFC  127
            F   PNLK+LG+   G+L            SG   N+  LD LEKLK         ++  
Sbjct  131  FTRTPNLKKLGV--RGKLNALLETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSSKQLH  188

Query  126  LPTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LP +  FP KLKKLTL  T+  W +M ++G L  LEVLKLK+ A
Sbjct  189  LPPAYIFPQKLKKLTLIDTWFEWKDMSILGLLDYLEVLKLKENA  232



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 10/114 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEG--ELVSGCLENLVDLDLLEKLKFR--IG  145
            +TL  + V +S+   NF  +P +K+L + +     ++S  +++L+ L  LEKL+    I 
Sbjct  19   ETLDSISVAASNWKENFTAIPKVKKLAVCLPPWRSVMSNLIDSLIRLVDLEKLRIHLDIS  78

Query  144  RVERFCL--PT----SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              E F L  PT     +P+ LK  TL  T L W++M  +G+L N+EVL+LK FA
Sbjct  79   PYENFSLRLPTLLSDVYPTFLKSSTLVGTCLLWEDMTTLGQLPNVEVLRLKCFA  132



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 10/113 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRI  148
            QTLY ++ +   +   F ++P+LK+LGI    E      +S  L NLV L  LE L+   
Sbjct  340  QTLYTIQFSCCTKE-FFSVMPHLKKLGICETKEDYSTDSLSQVLNNLVCLQELETLECSF  398

Query  147  GRVERFCLP----TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                R         + P  LK L+L  +YLPW++M  I  L NLEVLKLK++A
Sbjct  399  HTQNREVRKNLGLAALPVTLKHLSLSWSYLPWEDMTFIAMLPNLEVLKLKNYA  451



>dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum]
Length=364

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 13/95 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV------SGCLENLVDLDLLEKLKF-----RIGRVERFCLPT  118
            F   PNLK+LGI   G++          L+N+  L+ LE LK      + G+  R     
Sbjct  220  FARTPNLKKLGI--RGKIAVLLEPNKSLLKNVKKLEYLENLKLINDSSQTGKGLRLPPSY  277

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             FP+KL+KL+L  T+L W++M ++G+L +LEVLKL
Sbjct  278  IFPTKLRKLSLVDTWLEWNDMSILGQLEHLEVLKL  312



>gb|EYU17740.1| hypothetical protein MIMGU_mgv1a018663mg [Erythranthe guttata]
Length=854

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVS----GCLENLVDLDLLEKLK-------FRIGRVERFCLPT  118
            F  +PNLK+LGI IE E  +     C + +  L+ LE LK       F  G V    LP 
Sbjct  657  FKRLPNLKKLGIRIESESNADELLSCFDYISHLNGLETLKCTIENPVFTSGVVVGARLPI  716

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
             FP  LKKL L     PW+EM  IG L NL VLKL 
Sbjct  717  FFPKCLKKLCLSGLGYPWEEMTKIGSLPNLRVLKLH  752



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 14/88 (16%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTL  85
              +VPNLK+LGI +  +     L +L  L L            R+    +FP KL+ LTL
Sbjct  531  MAIVPNLKKLGIIVSDKNHDFFLNDLSSLHL-----------SRW---DAFPPKLRALTL  576

Query  84   CSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            C  +LPW++M  IGK+  LEVLK+KD A
Sbjct  577  CGGHLPWEDMVNIGKIPELEVLKVKDRA  604



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 52/103 (50%), Gaps = 15/103 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-GELV-----SGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F   PNLK LGI  + G+L+     S   ++L  L  LE LK            G + R 
Sbjct  681  FARAPNLKVLGIRGQLGKLLEIKNGSMLFDSLGRLSHLENLKLINDVFPRPPSEGSLSRL  740

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              P  FP  L+KLTL  T L W +M  +G L NLEVLKLKD A
Sbjct  741  PHPYKFPPNLRKLTLSDTLLEWKDMSTLGMLENLEVLKLKDNA  783



>emb|CDP04880.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 48/87 (55%), Gaps = 5/87 (6%)
 Frame = -1

Query  258  MVPNLKELGIYIEGELVSGC-LENLVDL----DLLEKLKFRIGRVERFCLPTSFPSKLKK  94
            M+P++++LG  I       C   NL  L      L  LK        +    +FPS LKK
Sbjct  816  MLPSVQKLGCIISNSWQECCEASNLFKLLECLRELRSLKMSFHVRAPYPFKFTFPSNLKK  875

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKL  13
            LT+ +  LPWDE+ VIG+LSNLEVLKL
Sbjct  876  LTISNARLPWDEISVIGQLSNLEVLKL  902



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 13/95 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV------SGCLENLVDLDLLEKLKF-----RIGRVERFCLPT  118
            F   PNLK+LGI   G++          L+N+  L+ LE LK      + G+  R     
Sbjct  684  FARTPNLKKLGI--RGKIAVLLEPNKSLLKNVKKLEYLENLKLINDSSQTGKGLRLPPSY  741

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             FP+KL+KL+L  T+L W++M ++G+L +LEVLKL
Sbjct  742  IFPTKLRKLSLVDTWLEWNDMSILGQLEHLEVLKL  776



>gb|EYU21833.1| hypothetical protein MIMGU_mgv1a009417mg [Erythranthe guttata]
Length=342

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 17/95 (18%)
 Frame = -1

Query  255  VPNLKELGIYIEGE---LVSGCLENLVDLDLLEKLKFRIGR---------VERFCLPTSF  112
            +PN+ +L I    E   L+S CL+NL  L  LE L+F IG          V+ F LP S 
Sbjct  162  IPNINKLQISYSNEPQGLLSYCLDNLGHLHKLESLRFTIGTLFKQPPNDWVQNFILPNS-  220

Query  111  PSKLKKLTLCSTYLPWDEMGV-IGKLSNLEVLKLK  10
               LKKLTL  T L W++M   IG L NLEVLKL+
Sbjct  221  ---LKKLTLMGTKLKWEDMKTKIGWLPNLEVLKLR  252



>gb|EYU24168.1| hypothetical protein MIMGU_mgv1a022184mg, partial [Erythranthe 
guttata]
Length=802

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PN+K+L I + G + S CL NL  L  LE L  ++      C    FPS LK L L   
Sbjct  673  IPNVKKLEI-VCGTIGSNCLRNLGLLHKLEYLNLKLNTGTSCCGEIVFPSSLKVLVLSEC  731

Query  75   YLPWDEMGVIGKLSNLEVLKL  13
             +PW++M V+G L NLE L L
Sbjct  732  KIPWEDMSVVGSLPNLEALTL  752



>gb|EYU22232.1| hypothetical protein MIMGU_mgv1a002671mg [Erythranthe guttata]
Length=648

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 53/103 (51%), Gaps = 17/103 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F    NLK LGI       IEG++  G  ++L  L  LEKLK            G++   
Sbjct  439  FDRARNLKRLGIRGRLASLIEGKV--GSFDSLGKLGNLEKLKLLNDVFPNPPSEGQLRGL  496

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              P  FP KL+ LTL  T+L W  M +IG L NLEVLKLK+ A
Sbjct  497  PQPYKFPPKLRSLTLADTFLDWCHMSIIGLLENLEVLKLKEKA  539



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = -1

Query  255  VPNLKELGI-YIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCS  79
            VPNLK+LGI Y+E    SG LENL  L  LE L   I +        +FP+ LKKLTL S
Sbjct  673  VPNLKKLGIVYLEKG--SGGLENLARLQKLESL-LVIEKDVSLLANITFPTSLKKLTLTS  729

Query  78   TYLPWDEMGVIGK-LSNLEVLKL  13
              +PW+EM V G  L NLE LKL
Sbjct  730  CCIPWEEMTVFGSVLPNLEKLKL  752



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 17/95 (18%)
 Frame = -1

Query  255  VPNLKELGIYIEGE---LVSGCLENLVDLDLLEKLKFRIGR---------VERFCLPTSF  112
            +PN+ +L I+   E    +S CL+NL  L  LE L+F +           VE F LP S 
Sbjct  561  IPNINKLQIFYYEEPQGFLSYCLDNLGHLHKLESLRFSLNPINKPSLNDLVENFILPNS-  619

Query  111  PSKLKKLTLCSTYLPWDEMGV-IGKLSNLEVLKLK  10
               LKKLTL  TYL W+EM   IG L NL+VLKLK
Sbjct  620  ---LKKLTLEGTYLKWEEMNTKIGLLPNLQVLKLK  651



>ref|XP_004243045.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Solanum lycopersicum]
Length=473

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG------CLENLVDLDLLEKLKFRIGRVERFCLPTSF--P  109
            F  +PNLK L +    +   G       L +L  L  LE+LK R   +  F +P  +  P
Sbjct  323  FSAIPNLKTLILRGSQKECQGDQKMFKHLNSLACLKRLEQLKIRCKDLYLFPIPCKYTLP  382

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + L+ LTL  TYLPW++M  I KL  LEVLK+K++ 
Sbjct  383  TSLRSLTLSYTYLPWEDMANIVKLPKLEVLKIKNYG  418



>emb|CDP11831.1| unnamed protein product [Coffea canephora]
Length=898

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 10/98 (10%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKFRIGRVER--FCLPTS--  115
            F    NLK+LGI       +EG   S   ++L ++D LE LK     V      LP +  
Sbjct  650  FKRAKNLKKLGIRGKLHNLVEGNGESSFFDSLCEVDSLENLKLYGDDVNSKLLALPQAHK  709

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            FP +L +L+L +T L W+ M ++G L  LEVLKLKD+A
Sbjct  710  FPPRLTRLSLHNTSLDWNYMSILGDLRYLEVLKLKDYA  747



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 60/101 (59%), Gaps = 20/101 (20%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-------SGCLENLVDLDLLEKLKF------RIGRVERFCL  124
            F   PNLK+LGI   G++        +  L+N+  L+ LE LK       + G++    L
Sbjct  682  FARTPNLKKLGI--RGKIAVLLDNKSAVSLKNVKRLEYLENLKLINDSSIQTGKLR---L  736

Query  123  PTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            P +  FP+KL+KLTL  T+L W +M ++G+L +LEVLK+K+
Sbjct  737  PPAYIFPTKLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKE  777



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -1

Query  255  VPNLKELGI--YIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLC  82
            +PN+K+L I  +IEG  +  CL NL  L  LE L              +FPS +KKL+L 
Sbjct  581  IPNVKKLNIMFHIEGPTIHYCLHNLSLLCKLESLTCSYSISNNLLQKLTFPSSIKKLSLI  640

Query  81   STYLPWDEMGVIGKLSNLEVLKLK  10
               + W+++ +IG L NLEVLKLK
Sbjct  641  FCRVNWEDLTLIGSLQNLEVLKLK  664



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = -1

Query  258  MVPNLKELGIYI--EGELVSGCLENLVDLDLLEKLKFRI------GRVERFCLPTSFPSK  103
            M+PN+KEL I+   E +     L++LV L  LE+LK  +       R E+  +  +FP  
Sbjct  624  MIPNVKELAIFYTKEHQEEEYHLDDLVHLKQLERLKLTVPYFWSSSRWEK--ITPAFPKT  681

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LK LT+     PW EM V+G L NL+VLK+++  
Sbjct  682  LKWLTIRGGRRPWSEMTVVGSLPNLQVLKIRNHG  715



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 51/103 (50%), Gaps = 15/103 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F   PNLK LGI       +E +  S   ++L  L  LE LK            G++   
Sbjct  681  FARAPNLKVLGIRGQLAKLLENKSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNL  740

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                 FP KLKKLTL  T L W++M  +G L NLE+LKLKD A
Sbjct  741  PQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNA  783



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 56/103 (54%), Gaps = 16/103 (16%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV---------SGCLENLVDLDLLEKLKF----RIGRVERFCL  124
            F   PNLK+LG+  + + +         SG   N+  LD LEKLK     R  R ++  L
Sbjct  678  FTRTPNLKKLGVRGKIDALLETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSR-KQLHL  736

Query  123  PTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P +  FP KLK LTL  T+  W +M ++G L  LEVLKLK+ A
Sbjct  737  PPAYIFPQKLKTLTLIDTWFEWKDMSILGLLEYLEVLKLKENA  779



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 48/97 (49%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG----CLENLVDLDLLEKLKFRI---GRVERFCLPT--SF  112
            F  +PNLKELGI  E           LE LV+L  LE LK              P   +F
Sbjct  757  FKRIPNLKELGISYEVSPSENWSKYQLEALVNLHQLETLKLLFKYSSHASEIVNPPKLAF  816

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P KLK+L L    +PW  M ++G L NLEVLKL+  A
Sbjct  817  PEKLKRLILAGCGIPWSSMTIVGALPNLEVLKLRKNA  853



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 52/107 (49%), Gaps = 25/107 (23%)
 Frame = -1

Query  261  GMVPNLKELGIYIEGELV--------SGCLENLVDLDLLEKLKFRIGRVERFCLPTS---  115
               P L++LGI   G+L         S   +NL  LD LE LK      + F LP S   
Sbjct  681  ARTPGLRKLGI--RGKLATLVATNGDSSLFDNLAKLDNLETLKLL---NDTFPLPPSQCQ  735

Query  114  ---------FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                     FP  LKKLTL  T+L W  +  +G L NLEVLKLKD+A
Sbjct  736  IPGLPQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYA  782



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 48/97 (49%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG----CLENLVDLDLLEKLKFRI---GRVERFCLPT--SF  112
            F  +PNLKELGI  E           LE LV+L  LE LK              P   +F
Sbjct  528  FKRIPNLKELGISYEVSPSENWSKYQLEALVNLHQLETLKLLFKYSSHASEIVNPPKLAF  587

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P KLK+L L    +PW  M ++G L NLEVLKL+  A
Sbjct  588  PEKLKRLILAGCGIPWSSMTIVGALPNLEVLKLRKNA  624



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 51/103 (50%), Gaps = 15/103 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF-------RIGRVERFCL  124
                PNL++LGI       +E +  S   + L  LD LE LK           R     L
Sbjct  681  LARTPNLRKLGIRGKLITLVEEKGGSTMFDILAKLDRLESLKLLNDAFPLDPSRCIIPGL  740

Query  123  PTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P S  FP  LKK+TL  T L WD M  +G L NLEVLKLKD+A
Sbjct  741  PPSYKFPPNLKKITLSDTLLDWDHMSTLGMLPNLEVLKLKDYA  783



>ref|XP_009800168.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=643

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  255  VPNLKELGIYIE---GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPTSFPSKLKKL  91
            VPNL +L   +E   G+     L  L  L+ LE LK  F    V RF    +FP  LKKL
Sbjct  408  VPNLVKLRCLVEEPQGDRTCIWLPGLESLNKLESLKVYFLKRSVRRF--EVNFPMNLKKL  465

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL S  LPW E+ +IG L NLEVLKL+  A
Sbjct  466  TLSSCQLPWSEISIIGNLENLEVLKLESNA  495



>ref|XP_009799406.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=636

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  255  VPNLKELGIYIE---GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPTSFPSKLKKL  91
            VPNL +L   +E   G+     L  L  L+ LE LK  F    V RF    +FP  LKKL
Sbjct  404  VPNLVKLRCLVEEPQGDRTCIWLPGLESLNKLESLKVYFLKRSVRRF--EVNFPMNLKKL  461

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL S  LPW E+ +IG L NLEVLKL+  A
Sbjct  462  TLSSCQLPWSEISIIGNLENLEVLKLESNA  491



>ref|XP_009799404.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=761

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  255  VPNLKELGIYIE---GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPTSFPSKLKKL  91
            VPNL +L   +E   G+     L  L  L+ LE LK  F    V RF    +FP  LKKL
Sbjct  529  VPNLVKLRCLVEEPQGDRTCIWLPGLESLNKLESLKVYFLKRSVRRF--EVNFPMNLKKL  586

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL S  LPW E+ +IG L NLEVLKL+  A
Sbjct  587  TLSSCQLPWSEISIIGNLENLEVLKLESNA  616



>ref|XP_009800164.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800165.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800166.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800167.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=768

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -1

Query  255  VPNLKELGIYIE---GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPTSFPSKLKKL  91
            VPNL +L   +E   G+     L  L  L+ LE LK  F    V RF    +FP  LKKL
Sbjct  533  VPNLVKLRCLVEEPQGDRTCIWLPGLESLNKLESLKVYFLKRSVRRF--EVNFPMNLKKL  590

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL S  LPW E+ +IG L NLEVLKL+  A
Sbjct  591  TLSSCQLPWSEISIIGNLENLEVLKLESNA  620



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE-------RFCLPTSFPS  106
            F  +  +K+LGI       S  L NL  L  LE L               R   P SFP 
Sbjct  692  FKGIKKVKKLGISCNSYTESEWLANLNYLHELETLSIASSSYYGYVYSDFRLPCPGSFPP  751

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK--DFA  1
             LKKLTLC T L W++M +I KL  LEVL+LK  DFA
Sbjct  752  NLKKLTLCGTRLSWEDMTIISKLPKLEVLQLKEDDFA  788



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE-------RFCLPTSFPS  106
            F  +  +K+LGI       S  L NL  L  LE L               R   P SFP 
Sbjct  682  FKGIKKVKKLGISCNSYTESEWLANLNYLHELETLSIASSSYYGYVYSDFRLPCPGSFPP  741

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK--DFA  1
             LKKLTLC T L W++M +I KL  LEVL+LK  DFA
Sbjct  742  NLKKLTLCGTRLSWEDMTIISKLPKLEVLQLKEDDFA  778



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY---IEGELVSGCLENLVDLDLLEKLKFRIGRVERF----CLP--TSF  112
            F  + N+++LGI     E +    CL+NL+ L  LE+LK     + R+     LP  +SF
Sbjct  697  FEGIKNVRKLGISGTEDEFDYEPICLDNLIYLHELEELKISSYILTRYDVLLSLPFASSF  756

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL  T+L W++M +I KL  LEVL+LK  A
Sbjct  757  PPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADA  793



>ref|XP_009614965.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
 ref|XP_009614966.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=886

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 12/100 (12%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-GELV----SGCLENLVDLDLLEKLKF--RIGRVER--FCLPTS-  115
            F   PN+K+LGI  + G L+    S    N+  L+ LE LK    +G+V R    LP + 
Sbjct  676  FVRAPNMKKLGIRGKIGMLLESNESALFNNVKKLECLESLKLINDVGQVGRTPLRLPPAY  735

Query  114  -FPSKLKKLTLCSTYLPWD-EMGVIGKLSNLEVLKLKDFA  1
             FP KL+KLTL  T+L WD +M ++G+L  LEVLKLK+ A
Sbjct  736  IFPRKLRKLTLIDTWLDWDHDMSILGQLQYLEVLKLKENA  775



>gb|EYU24183.1| hypothetical protein MIMGU_mgv1a021378mg, partial [Erythranthe 
guttata]
Length=828

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRI-GRVERFCLPTSFPSKLKKLTLCS  79
            +PN+K+LGI +   + S CL NL  L  LE L     G + R  +   FPS +KKL L  
Sbjct  666  IPNVKKLGI-VCSTVGSHCLSNLGFLHKLESLSLAFDGTIGRGNM--VFPSSVKKLCLSE  722

Query  78   TYLPWDEMGVIGKLSNLEVLKLKDFA  1
              +PW++M ++G L NL+VLKL+  A
Sbjct  723  CKIPWEDMSIVGSLPNLQVLKLRSNA  748



>emb|CDP00691.1| unnamed protein product [Coffea canephora]
Length=693

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 10/113 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRI  148
            QTLY ++ +S  +   F ++P+LK+LGI    E       S  L NLV L  LE L+   
Sbjct  482  QTLYTIQFSSCTKEV-FSVMPHLKKLGICETKEDYSIDSFSQVLNNLVYLQELETLECSF  540

Query  147  G----RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                  V R       P  LK L+L  +YLPW  M  I  L NLEVL+LK++A
Sbjct  541  HTQNREVRRILGLALLPVTLKHLSLSWSYLPWKYMTSIAMLPNLEVLELKNYA  593



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 44/79 (56%), Gaps = 4/79 (5%)
 Frame = -1

Query  225  IEGELVSGCLENLVDLDLLEKLKFRI--GRVERFCLPTS--FPSKLKKLTLCSTYLPWDE  58
            I+ E    CL NLV L  LE+LKF        R  L  +  FP  +KKLTL    LPW+ 
Sbjct  656  IQEEWSKYCLNNLVHLHKLEELKFHAMPHDYHRSDLSRNLVFPLTMKKLTLSGCNLPWES  715

Query  57   MGVIGKLSNLEVLKLKDFA  1
            M ++G L NLEVLKLK  A
Sbjct  716  MTIVGSLPNLEVLKLKKGA  734



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRI  148
            QTL  ++  S   +  F ++P L++LGI    E     +    L+NL +L  LE LK   
Sbjct  798  QTLSTIRFASCTSDV-FLVMPYLRKLGICETKEDFITDMSCRWLKNLANLQYLEALKCSF  856

Query  147  ----GRVERFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                    R   P+   FP  L+KLTL  +YLPW ++  I  L NLEVLKLK++A
Sbjct  857  YKQNAEAPRILRPSVLHFPLTLRKLTLSWSYLPWKDIACIAMLPNLEVLKLKNYA  911



>gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Erythranthe guttata]
Length=888

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 50/101 (50%), Gaps = 18/101 (18%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV----SGCLENLVDLDLLEKLKF---------RIGRVERFCL  124
            F   PNL  LGI   G+L     S CL   + L+ L+KLK              + R   
Sbjct  683  FNKTPNLINLGI--RGDLATLSDSRCL---IKLNRLQKLKLLYDVFPDVTSENPLSRLAQ  737

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  FP  LK L L +T+L W  M  +GKL  L+VLKLKDFA
Sbjct  738  PDRFPPNLKILELSATHLSWKHMSTLGKLGALKVLKLKDFA  778



>ref|XP_011087136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSG----CLENLVDLDLLEKLKFRIGRVE---RFCLPT----SFP  109
            +PNL  LGI I   L       CL++L  L  LE LK  I       R  +PT    +FP
Sbjct  678  IPNLTRLGIQIGLTLDVAKPLCCLDHLRYLRRLESLKCVILNPNPRLRVVVPTPPVTAFP  737

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            S LKKLTL     PW+ M  I KL NLEVLKL+  A
Sbjct  738  SSLKKLTLSGLGFPWEYMSTIAKLRNLEVLKLRCHA  773



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 54/95 (57%), Gaps = 9/95 (9%)
 Frame = -1

Query  258  MVPNLKELGI-YIEG---ELVSGCLENLVDLDLLEKLKFRIGRVE---RFCLPT--SFPS  106
            ++PNLK+LGI Y+     E  +    N V L  LE LK      +   R  LP   +FP 
Sbjct  559  IMPNLKKLGILYVHDSSTEWSTYEFNNFVHLHKLETLKCLFSAKDDLVRKPLPLNLAFPL  618

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             LKKLTL    L W++M VIG L NL+VLKL+D+A
Sbjct  619  DLKKLTLSGCRLSWEKMTVIGSLPNLQVLKLRDYA  653



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -1

Query  264  FGMVPNLKEL---GIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PSKL  100
            F  +PNLK+L   G Y+  E+    L +L  L  LE LK+R   ++   +P+ +  P+ L
Sbjct  673  FSAIPNLKKLKIIGNYL-MEMKRERLNSLSCLKKLEILKYRDDGIQPSQIPSKYVLPASL  731

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            K+LTL  T LPW +M  +  L NLEVLK+KD
Sbjct  732  KRLTLSCTSLPWKDMANVITLPNLEVLKIKD  762



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = -1

Query  255  VPNLKELGIYIEGEL---VSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTL  85
            +PNLK++ IY   ++    S CL NLV L  LE L  R   +    +   FP+ LKKL L
Sbjct  674  IPNLKKMKIYYLNKVEDWSSYCLYNLVHLHKLESLYVRAKDLSLKNM--GFPTSLKKLEL  731

Query  84   CSTYLPWDEMGVIGKLSNLEVLKLK  10
                +PW++M +IG L NLEVL LK
Sbjct  732  YECKVPWEDMIIIGSLPNLEVLMLK  756



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELV--SGCLENLVDLDLLEKLKFRIGRV  139
            QT+Y L   S  +    G + N+K+LGIY + +    S   +NLV L  LE L+F     
Sbjct  713  QTIYLLSAFSCTKEVISG-IENVKKLGIYGDRDDFEDSRLFDNLVYLHQLENLRFYFHST  771

Query  138  ERFCLPT-----SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             +F   T     +FP+ LKKL L  T L W+++ +I +L NLEVLK+
Sbjct  772  WKFGEATIPSAEAFPATLKKLELNGTCLRWEDINIISELPNLEVLKV  818



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 25/107 (23%)
 Frame = -1

Query  261  GMVPNLKELGIYIEGELV--------SGCLENLVDLDLLEKLKFRIGRVERFCLPTS---  115
               P L++LGI   G++         S   +NL  LD LE LK      + F LP S   
Sbjct  681  ARTPGLRKLGI--RGKVATLVATNGDSSLFDNLAKLDNLETLKLL---NDTFPLPPSQCQ  735

Query  114  ---------FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                     FP  LKKLTL  T+L W  +  +G L NLEVLKLKD+A
Sbjct  736  ISGLPQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYA  782



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = -1

Query  219  GELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT------SFPSKLKKLTLCSTYLPWDE  58
             +L S CL NL  L  L+ LK  +G      +P       + P  LKKLTL  TYLPW+ 
Sbjct  738  SDLWSDCLRNLALLPQLKALKI-VGLTPPVQVPKLALHLDALPENLKKLTLSFTYLPWES  796

Query  57   MGVIGKLSNLEVLKLKDFA  1
            M  + +L NLEVLKLK++A
Sbjct  797  MASLCRLPNLEVLKLKNYA  815



>ref|XP_009798793.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=704

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 12/100 (12%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-GELV----SGCLENLVDLDLLEKLKF--RIGRVER--FCLPTS-  115
            F   PN+K+LGI    G L+    S    N+  L+ LE LK    +G++ R    LP + 
Sbjct  494  FVRAPNMKKLGIRGNIGMLLESNESALFNNVKKLECLESLKLINDVGQIGRTPLRLPPAY  553

Query  114  -FPSKLKKLTLCSTYLPWD-EMGVIGKLSNLEVLKLKDFA  1
             FP KL+KLTL +T+L WD +M ++G+L  LEVLKLK+ A
Sbjct  554  IFPRKLRKLTLINTWLDWDHDMSILGQLQYLEVLKLKENA  593



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 51/103 (50%), Gaps = 15/103 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F   PNLK LGI       +E +  S   ++L  L  LE LK            G++   
Sbjct  681  FARAPNLKVLGIRGQLAKLLENKSGSMLFDSLGKLSHLENLKLLNDVFPRPPSEGKLTNP  740

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                 FP KLKKLTL  T L W++M  +G L NLE+LKLKD A
Sbjct  741  PQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNA  783



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 52/97 (54%), Gaps = 12/97 (12%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGC------LENLVDLDLLEKLKFRIG----RVERFCLPT--SF  112
            +PNLK+LGI  +    +        LE+L +L  LE LK  I     R  +F  P   SF
Sbjct  786  IPNLKKLGISYDVSSQAYVDRWQFNLESLANLHQLETLKIIIKNDPYRTSKFVNPPKLSF  845

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P KL +LTL    LPW+ M ++G L  LEVLKLK  A
Sbjct  846  PRKLNRLTLSGCGLPWERMTIVGLLPCLEVLKLKKDA  882



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 54/102 (53%), Gaps = 14/102 (14%)
 Frame = -1

Query  264  FGMVPNLKELGI---------YIEGELVSGCLENLVDLDLLEKLKFRIGRVE---RFCLP  121
            F   PNLK+LG+           +G   SG   N+  L+ LE LK      +   +  LP
Sbjct  676  FTRTPNLKKLGVRGKIAALLEASKGGSGSGLFSNIGKLECLENLKLVNDTRQSDKQLHLP  735

Query  120  TS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             +  FP KLKKLTL  T+L W +M ++G L  LEVLKLK+ A
Sbjct  736  PAYIFPQKLKKLTLIDTWLKWKDMSILGLLEYLEVLKLKENA  777



>ref|XP_011087139.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=988

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (55%), Gaps = 11/95 (12%)
 Frame = -1

Query  255  VPNLKELGIYIE-----GELVSGCLENLVDLDLLEKLKFRIGRVE-RFCLPTS----FPS  106
            +PNL +LG+ +E      EL+  C E+L  L  LE LK+ +     +   P +    FP 
Sbjct  764  IPNLIKLGVQMELAPDFDELLC-CFEHLASLHKLESLKWSVVNPNLKLLFPAASVLIFPP  822

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             LKKLTL    LPW+    I KL NLEVLKL+ +A
Sbjct  823  GLKKLTLSGLGLPWEYNSTIAKLKNLEVLKLQRYA  857



>gb|EYU24185.1| hypothetical protein MIMGU_mgv1a024774mg [Erythranthe guttata]
Length=880

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PNLK+L I I G + S  L NL  L  LE+L   +    R      FPS LK+LTL   
Sbjct  614  IPNLKKLEI-ICGTIGSNRLSNLGLLHKLEQLNLELITGTRCGGGIVFPSSLKELTLTEC  672

Query  75   YLPWDEMGVIGKLSNLEVLKLKDFA  1
             +PW+ M  +G L NLEVL L+  A
Sbjct  673  KIPWEHMSTVGSLPNLEVLSLRRNA  697



>ref|XP_011072146.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 7/89 (8%)
 Frame = -1

Query  255  VPNLKELGIYIEG---ELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT---SFPSKLKK  94
            +PNLK+LGIY E    E    CL NLV L  LE L   +  +    LP    +FP+ LKK
Sbjct  680  IPNLKKLGIYYEENNMEWTYYCLYNLVRLQKLESLSIEVDDLRPDNLPLENLTFPTSLKK  739

Query  93   LTLCSTYLPWDEMGVIGK-LSNLEVLKLK  10
            L L S  +PW++M  +G  L NLE L LK
Sbjct  740  LWLDSCNIPWEKMMTLGSLLPNLEKLVLK  768



>ref|XP_009603167.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFR----IGRVE---RFCLPTSFPS  106
            F  +  +K++GI  +    S  L NL  L  LE L        G V    R   P SFP 
Sbjct  704  FKGIKKVKKMGISCDSYSESEWLANLKYLLELEALSIASSSYYGNVYSDFRLPCPGSFPP  763

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK--DFA  1
             LKKLTLC T L W++M +I KL  LEVL+LK  DFA
Sbjct  764  NLKKLTLCCTRLSWEDMTIISKLPKLEVLQLKEDDFA  800



>ref|XP_009603166.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFR----IGRVE---RFCLPTSFPS  106
            F  +  +K++GI  +    S  L NL  L  LE L        G V    R   P SFP 
Sbjct  704  FKGIKKVKKMGISCDSYSESEWLANLKYLLELEALSIASSSYYGNVYSDFRLPCPGSFPP  763

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK--DFA  1
             LKKLTLC T L W++M +I KL  LEVL+LK  DFA
Sbjct  764  NLKKLTLCCTRLSWEDMTIISKLPKLEVLQLKEDDFA  800



>emb|CDP20211.1| unnamed protein product [Coffea canephora]
Length=694

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 52/98 (53%), Gaps = 10/98 (10%)
 Frame = -1

Query  264  FGMVPNLKELGI------YIEGELVSGCLENLVDLDLLEKLKFRIGRVER--FCLPTS--  115
            F    NLK+LGI       +E    S   + L +L+ LE LK     V      LP +  
Sbjct  487  FKRTRNLKKLGICGKLNNIVEANGESSLFDCLCELNSLENLKLYGDDVSSKLLALPQAHK  546

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            FP +L +L+L +T L WD M ++G L  LEVLKLKD+A
Sbjct  547  FPPRLARLSLHNTSLNWDYMSILGNLQYLEVLKLKDYA  584



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY---IEGELVSGCLENLVDLDLLEKLKF------RIGRVERFCLPTSF  112
            F  + N+++LGI     E +    CL+NL+ L  LE+LK       R   + R     SF
Sbjct  674  FEGIKNVRKLGISGTEDEFDYEPICLDNLIYLPELEELKIASYILTRYDVLLRLPFAGSF  733

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL  T+L W++M +I KL  LEVL+LK  A
Sbjct  734  PPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADA  770



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 10/114 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIE--GELVSGCLENLVDLDLLEKLKFR--IG  145
            +TL  + V  S+    F  +P +K+L + ++    +    +++L+ L  LEKL+    I 
Sbjct  19   ETLDSISVADSNWKEIFTGIPKVKKLVVCLQPWRSVTFNLIDSLIRLVDLEKLRIHLDIS  78

Query  144  RVERFCL--PT----SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              E F L  PT     FP+ LK LTL  T L W++M  +G+L NLEVL+LK FA
Sbjct  79   PYENFSLRLPTLLLDVFPTFLKSLTLVGTRLLWEDMTTLGQLPNLEVLRLKCFA  132



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY---IEGELVSGCLENLVDLDLLEKLKF------RIGRVERFCLPTSF  112
            F  + N+++LGI     E +    CL+NL+ L  LE+LK       R   + R     SF
Sbjct  674  FEGIKNVRKLGISGTEDEFDYEPICLDNLIYLPELEELKIASYILTRYDVLLRLPFAGSF  733

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL  T+L W++M +I KL  LEVL+LK  A
Sbjct  734  PPNLKKLTLRKTFLLWEDMTIISKLPKLEVLQLKADA  770



>gb|EYU24159.1| hypothetical protein MIMGU_mgv1a020220mg, partial [Erythranthe 
guttata]
Length=797

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PN+K+L I + G   S CL NL  L  LE+L   +    R C    FPS LK L L   
Sbjct  676  IPNVKKLEI-VCGTTGSNCLRNLGLLHKLEQLYLELITGTRCCGEIVFPSSLKGLILSEC  734

Query  75   YLPWDEMGVIGKLSNLEVL  19
             +PW++M V+G L NL+ L
Sbjct  735  KIPWEDMSVVGSLPNLQFL  753



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGR-VERFCLPTSF--P  109
            F   PNLK L I+        +++   L NL  L+ LE LK    R +    LP+ +  P
Sbjct  684  FTGFPNLKRLKIHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALP  743

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            + LK+LTL  TYLPW++M  I  L NL+VLK+KD
Sbjct  744  TSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKD  777



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGR-VERFCLPTSF--P  109
            F   PNLK L I+        +++   L NL  L+ LE LK    R +    LP+ +  P
Sbjct  684  FTGFPNLKRLKIHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALP  743

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            + LK+LTL  TYLPW++M  I  L NL+VLK+KD
Sbjct  744  TSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKD  777



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGR-VERFCLPTSF--P  109
            F   PNLK L I+        +++   L NL  L+ LE LK    R +    LP+ +  P
Sbjct  668  FTGFPNLKRLKIHGAWAECRRDMIFQTLNNLSCLNKLEILKIICSRKLYPHPLPSKYALP  727

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            + LK+LTL  TYLPW++M  I  L NL+VLK+KD
Sbjct  728  TSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKD  761



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -1

Query  258  MVPNLKELGIYIEGELVSG--CLENLVDLDLLEKLKFRIGRVERFCLPT-SFPSKLKKLT  88
            M+PN+K+LGI+   +       LENLV L  L  LK  +     F   + +FP  LKKL+
Sbjct  673  MIPNVKKLGIFYSEDKYKQEYHLENLVHLQNLVNLKLTVRANLSFPNKSLNFPQTLKKLS  732

Query  87   LCSTYLPWDE-MGVIGKLSNLEVLKLKDF  4
            L    LPW   M  IG L NL+VLKL+++
Sbjct  733  LSGESLPWQSTMMSIGSLPNLQVLKLRNY  761



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 7/93 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT--SFPS  106
            F  +PNLK L IY      + E +S  L++L  L  LE LKFR     R  LP   S P+
Sbjct  214  FSAIPNLKRLKIYGNWRECKREKISQHLDSLSCLKELEILKFRYQGRYRRRLPRKLSLPT  273

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL +T+   +++  I  L NLEVLK+KD
Sbjct  274  SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD  306



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = -1

Query  219  GELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT------SFPSKLKKLTLCSTYLPWDE  58
             +L S CL NL  L  LE LK  +G      +P       + P  LKKLTL  TYLPW+ 
Sbjct  746  SDLWSDCLRNLALLPQLEALKI-VGLRAPVQVPKLAFHLDALPENLKKLTLSFTYLPWES  804

Query  57   MGVIGKLSNLEVLKLKDFA  1
            M  + +L NLEVLKLK +A
Sbjct  805  MTSLCRLPNLEVLKLKPYA  823



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 7/93 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPT--SFPS  106
            F  +PNLK L IY      + E +S  L++L  L  LE LKFR     R  LP   S P+
Sbjct  214  FSAIPNLKRLKIYGNWRECKREKISQHLDSLSCLKELEILKFRYQGRYRRRLPRKLSLPT  273

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL +T+   +++  I  L NLEVLK+KD
Sbjct  274  SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD  306



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 10/113 (9%)
 Frame = -1

Query  312   QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELVSGC-----LENLVDLDLLEKLK--F  154
             QTL  +K++   +   F ++P+LK+L I    E    C     L NL  L  LE L+  F
Sbjct  913   QTLSTIKISCCTKEV-FSVMPHLKKLEICETEEDCGICEPSVLLGNLQYLKELETLECCF  971

Query  153   RIGRVE--RFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                RVE  +    ++ P  L++L+L  +YLPW++  +IG L  LEVLKLK FA
Sbjct  972   YKQRVEARQISFFSALPCSLRQLSLSWSYLPWEDTSLIGMLPRLEVLKLKHFA  1024



>emb|CDP08033.1| unnamed protein product [Coffea canephora]
Length=869

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  FP++L KL+L +T L WD+M ++GKL  LEVLKLKD+A
Sbjct  717  PHRFPARLTKLSLQNTSLGWDQMSILGKLQYLEVLKLKDYA  757



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 15/102 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLP------------  121
            F ++PNLK L I + G +     + +  L L+E L+  +G+++                 
Sbjct  685  FALMPNLKNLEIVLGG-VTRDLWKRISCLPLIEVLRIIVGKIDYSAFSLYRSKAHDDFLK  743

Query  120  --TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              ++FP  L++LTL  T LPW+ M ++G L NLE+L+L+D A
Sbjct  744  YRSTFPPTLRRLTLGGTCLPWEAMDIVGMLPNLEILELEDDA  785



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009599401.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Nicotiana tomentosiformis]
Length=253

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 15/102 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE--RFCL-----------  124
            F ++PNLK L I + G      + N   L L+E L+  +G+++   F L           
Sbjct  30   FALMPNLKNLEIVLNGVAHELWIGNSC-LPLIEVLRIIVGKMDYRAFSLYRSKAHDAFLK  88

Query  123  -PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              ++FP  L++LTL  T LPW+ M ++G L NLE+L+L+D A
Sbjct  89   YKSTFPPTLRRLTLGGTCLPWEAMDIVGMLPNLEILELEDDA  130



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 56/98 (57%), Gaps = 17/98 (17%)
 Frame = -1

Query  255  VPNLKELGI-YIE--GELVSGCLENLVDLDLLEKLKFRI---------GRVERFCLPTSF  112
            +PN+ +L I Y E   E +S CL+NL  L  LE L+F +           V+ F LP S 
Sbjct  592  IPNINKLQISYFEEPQEFLSYCLDNLGHLHKLESLRFILYPRNKASLNDLVQNFILPNS-  650

Query  111  PSKLKKLTLCSTYLPWDEMGV-IGKLSNLEVLKLKDFA  1
               LKKLTL  T L W++M   IG L NL+VLKLK+++
Sbjct  651  ---LKKLTLMGTKLKWEDMNTKIGLLPNLQVLKLKEYS  685



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 8/97 (8%)
 Frame = -1

Query  273  NPNFGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGR-VERFCLPTSF  112
            N  F   PNLK L ++        + +S  L +L  L  LE LK +  R +    LP+ +
Sbjct  684  NEMFTRTPNLKRLKLHGAWEECRRDTISQTLNSLYCLTELEILKIKCSRKLYPHPLPSKY  743

Query  111  --PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              P+ L +LTL  TYLPW++M  I  L NL+VLK+KD
Sbjct  744  VLPNSLMRLTLRCTYLPWEDMANIVTLPNLQVLKIKD  780



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 49/91 (54%), Gaps = 9/91 (10%)
 Frame = -1

Query  255  VPNLKELG--IYIEGELVSGCLENLVDLDLLEKLKFRIGR--VERFCL----PTSFPSKL  100
            +PNL  LG  +            +L  L LLE LKF I      +FC     PTSFP  L
Sbjct  679  MPNLVNLGCNLSFSNTAKDFLFPDLSILKLLETLKFDIQTWGTLQFCYSSPQPTSFPPSL  738

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            KKLTL  + L W EM  IG+L NLEVLK+K+
Sbjct  739  KKLTLIGS-LDWKEMSTIGRLPNLEVLKVKN  768



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 13/79 (16%)
 Frame = -1

Query  198  LENLVDLDLLEKLKFRIGRVE------RFC-----LPTS--FPSKLKKLTLCSTYLPWDE  58
            L +LVDL  LE L  ++ R +      RF      +P++  FP+KLKKL L  T L W+E
Sbjct  724  LRHLVDLHHLETLSIKVDRYQVSHWSSRFHKLPVYVPSAIHFPTKLKKLKLVGTRLSWEE  783

Query  57   MGVIGKLSNLEVLKLKDFA  1
            + ++G+  NLEVLKLK  A
Sbjct  784  LNIVGQWPNLEVLKLKPNA  802



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_011071970.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=906

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 10/113 (9%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGI--YIEGELVSGC-LENLV---DLDLLEKLKFR  151
            QTL  L   S  ++  F    NLK LGI   +   L + C LENL    +L L+  L + 
Sbjct  686  QTLSRLSPESC-KDEVFTKARNLKRLGISGRLHNLLEAHCSLENLAFLENLKLVNDLSYE  744

Query  150  I--GRVERFCL-PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            +  G+  R  L P   P KLK+LTL +TYL W +M  +G++  L+VLKLK+ A
Sbjct  745  LETGKSLRSLLQPKFLPRKLKRLTLSATYLDWSDMSTLGEIDTLQVLKLKNKA  797



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 22/106 (21%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-----------SGCLENLVDLDLLEKLKF-----RIGRVER  133
            F   PNLK+LG+   G++            SG   N+  LD LE LK      + G+  +
Sbjct  676  FTRTPNLKKLGV--RGKIAALLETSKDGSGSGLFGNIGKLDCLENLKLVNDTRQSGK--Q  731

Query  132  FCLPTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              LP +  FP KLKKLTL  T+  W +M ++G L  LEVLKLK  A
Sbjct  732  LHLPPAYIFPQKLKKLTLIDTWFEWKDMSILGLLEYLEVLKLKQNA  777



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE-----NLVDLDLLEKLKFRIGRV--ERFCLPTS----FP  109
            + N+K+L I+ E +    C E     NLV L  LE L F I     E F +  S    FP
Sbjct  754  IRNVKKLRIFGEKDEYQICQESRLFDNLVHLHQLETLSFEINVPWNEVFSMTISSAKVFP  813

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            + LKKLTL  T L W+++ +IG+L NLE LKL + A
Sbjct  814  ATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDA  849



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 51/91 (56%), Gaps = 12/91 (13%)
 Frame = -1

Query  246  LKELGIY------IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTS---FPSKLKK  94
            LK+LGI       +  E +SG L+ LV L+ LE  K   G   +  LP     FP  LKK
Sbjct  676  LKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFK---GFFIKPWLPKQCDVFPPTLKK  732

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LTL    LPWD+M ++ KL  LEVLKLK +A
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYA  763



>ref|XP_009781183.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=711

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 56/98 (57%), Gaps = 10/98 (10%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV--SGCLENLVDLDLLEKLKFRIG---RVERFC-LPT----S  115
            F  V N+K LG+ I  +L   S   ++L+ L  L KL+  +     V+ F  LP     S
Sbjct  502  FMAVTNVKALGVLINPDLNEWSNFNDSLICLSDLRKLRIHLALPPYVQFFPRLPAPQWNS  561

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            FP KL  LTL +T+L W ++  +GKL NLEVLKLK FA
Sbjct  562  FPEKLMHLTLEATHLLWKDISFLGKLPNLEVLKLKYFA  599



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 51/91 (56%), Gaps = 12/91 (13%)
 Frame = -1

Query  246  LKELGIY------IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTS---FPSKLKK  94
            LK+LGI       +  E +SG L+ LV L+ LE  K   G   +  LP     FP  LKK
Sbjct  676  LKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFK---GFFIKPWLPKQCDVFPPTLKK  732

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LTL    LPWD+M ++ KL  LEVLKLK +A
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYA  763



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 18/99 (18%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSG--------CLENLVDLDLLEKLKFRIGR------VERFCLPT  118
            +PNLK+LGI IE    +G        C +NL     L+ LK  +        V      +
Sbjct  704  IPNLKKLGIRIE----TGPDDVEPLYCFDNLDFFRELQSLKCSVMNPIFQRVVPAISYNS  759

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             FP+ LKKLTL     PW  M  I +L NLEVLKL+ +A
Sbjct  760  IFPTSLKKLTLSGLRFPWGHMSDIAELRNLEVLKLRCYA  798



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 51/91 (56%), Gaps = 12/91 (13%)
 Frame = -1

Query  246  LKELGIY------IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTS---FPSKLKK  94
            LK+LGI       +  E +SG L+ LV L+ LE  K   G   +  LP     FP  LKK
Sbjct  676  LKKLGIRESEEECLTAEQMSGNLKKLVLLEHLETFK---GFFIKPWLPKQCDVFPPTLKK  732

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LTL    LPWD+M ++ KL  LEVLKLK +A
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYA  763



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  FRIGRVERFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            FR   V R   P+  SFP  LKKLTL  T LPW+ M +  KL NLEVL+LKD A
Sbjct  719  FRSNAVPRSINPSPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHA  772



>ref|XP_009796673.1| PREDICTED: uncharacterized protein LOC104243211 [Nicotiana sylvestris]
Length=270

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = -1

Query  207  SGCLENLVDLDLLEKLKF----RIGRVERFCLPTS--FPSKLKKLTLCSTYLPWDEMGVI  46
            SG   N+  LD LEKLK     R  R ++  LP +  FP KLKKLTL  T   W +M ++
Sbjct  92   SGLFSNIGKLDCLEKLKLVNDTRQSR-KQLHLPPAYIFPQKLKKLTLIDTGFEWKDMSIL  150

Query  45   GKLSNLEVLKLKDFA  1
            G L  LEVLKLK+ A
Sbjct  151  GLLEYLEVLKLKENA  165



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 7/73 (10%)
 Frame = -1

Query  198  LENLVDLDLLEKLKF-------RIGRVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGK  40
            ++NL  LD LE L         R     R     S P  LKKL L +T+LPW+ M +IGK
Sbjct  698  IDNLKYLDELEALSIADNNYPSRTCPFFRLTSQDSLPPSLKKLKLTTTHLPWEYMAIIGK  757

Query  39   LSNLEVLKLKDFA  1
            L NLEVL+LK +A
Sbjct  758  LPNLEVLQLKKWA  770



>ref|XP_011088084.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Sesamum indicum]
Length=602

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -1

Query  255  VPNLKELGI-YIEGELV---SGCLENLVDLDLLEKLK---FRIGRVERFCLPT--SFPSK  103
            +PNLK+LGI Y+   L    S    N + L  LE LK          R  LP   +FP  
Sbjct  504  MPNLKKLGISYVHDTLTEWSSYEFNNFIYLHKLETLKCVFVTRDASARQPLPLNLAFPPN  563

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LKKLTL    + W++M V+G L NLEVLKL+D A
Sbjct  564  LKKLTLSGCRISWEKMIVVGSLPNLEVLKLRDNA  597



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = -1

Query  264  FGMVPNLKELGI------YIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSK  103
            F   PNLK+L I      YI    + G L NL +LD LE+LKF          P +FP  
Sbjct  674  FKQFPNLKKLQISGDHEEYITSYEMKG-LHNLCNLDQLEELKFDGMPHSTLPHPEAFPKN  732

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            LKKL+   T++  +++ ++ KL  LE LKLK
Sbjct  733  LKKLSFSKTHVNLEDLRILSKLPKLEALKLK  763



>ref|XP_009593857.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=563

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 15/102 (15%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE--RFCL-----------  124
            F ++PNLK L I + G +       +  L L+E L+  +G+++   F L           
Sbjct  445  FALMPNLKNLEIVLTG-VAHELWIGISCLPLIEVLRIIVGKIDYRAFSLYRSKAHDAFLK  503

Query  123  -PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              ++FP  L++LTL  T LPW+ M ++G L NLE+L+L+D A
Sbjct  504  YKSTFPPTLRRLTLGGTCLPWEAMDIVGMLPNLEILELEDDA  545



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 7/93 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PS  106
            F  +PNLK L I+      + + +   L++L  L  LE LKF+     R  LP  F  P+
Sbjct  657  FSAIPNLKRLKIHGNWSECKRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPT  716

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL +T  P ++M  I  L NLEVLK+KD
Sbjct  717  SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKD  749



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 7/93 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PS  106
            F  +PNLK L I+      + + +   L++L  L  LE LKF+     R  LP  F  P+
Sbjct  657  FSAIPNLKRLKIHGNWSECKRDKIYQHLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPT  716

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             LK+LTL +T  P ++M  I  L NLEVLK+KD
Sbjct  717  SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKD  749



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  LKKLTL  T LPW+ M +  KL NLEVL+LKD A
Sbjct  732  PGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHA  772



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  LKKLTL  T LPW+ M +  KL NLEVL+LKD A
Sbjct  743  PGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHA  783



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 9/91 (10%)
 Frame = -1

Query  255  VPNLKELGIYIEG-ELVSGCLENLVDLDLLEKLKF----RIGRVERFCLPT-SFPSKLKK  94
            VPNL +LG ++E    V  CL  L   + LE  KF     I   E   LP   FP  L K
Sbjct  683  VPNLTKLGTWVEEPSDVHLCLNQL---EKLESFKFIVLNPIPNPENNFLPKLVFPKTLTK  739

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LTL    L W++M +I +L NLEVLKL++FA
Sbjct  740  LTLSGCGLHWEDMAIIEELPNLEVLKLREFA  770



>gb|EYU24181.1| hypothetical protein MIMGU_mgv1a025424mg, partial [Erythranthe 
guttata]
Length=702

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 7/89 (8%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRI----GRVERFCLPTSFPSKLKKLT  88
            +PNLK+LGI +   + S  L NL     LE L        GR  R  +   FPS LKKL 
Sbjct  537  IPNLKKLGI-VCPTIGSYSLSNLGFFHKLESLSLAFVGTRGRGPRGNM--VFPSSLKKLV  593

Query  87   LCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            L    +PW++M ++G L NLEVLKL+  A
Sbjct  594  LSECKIPWEDMSIVGSLPNLEVLKLQSNA  622



>emb|CDP05441.1| unnamed protein product [Coffea canephora]
Length=803

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLE--NLVDLDLLEKLKFR---IGRVE-RFCLPTSFPSKLKK  94
             PNL++LG+++     +  L   +L  L+ LE LKF+   +G V   F  P  FP  LKK
Sbjct  608  TPNLRKLGLHMTFSKGNDNLSFPDLSHLNHLEALKFKYQTLGMVPWSFPHPHMFPPSLKK  667

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            LTL  + + W+EM ++  L +LEVLK+KD
Sbjct  668  LTLIGSLVNWNEMSILELLPSLEVLKIKD  696



>ref|XP_006365952.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=226

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 17/99 (17%)
 Frame = -1

Query  264  FGMVPNLKELGI------YIEGELVSGCLENLVDLDLLEKLKFRI----GRV---ERFCL  124
            F ++PN+K+L I      YI  + V+    +L  LD L +LKF+I    GR      F L
Sbjct  46   FRLLPNVKKLQICGIQEDYIRRDKVN--FHDLCCLDQLTELKFKIRKMIGRAIYDTSFVL  103

Query  123  P--TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
            P   +FP  L KL   +T L W+++ ++GKL  LE LKL
Sbjct  104  PPLVAFPKNLNKLAFTATRLHWEDLEILGKLPKLEALKL  142



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 13/94 (14%)
 Frame = -1

Query  255  VPNLKELGIYIEGE-----LVSGCLENLVDLDLLEKLKFRIG------RVERFCLPTS--  115
            + N+K+LGI  +G        S   +NLV L  LE LKF+        ++    +P++  
Sbjct  679  IQNVKKLGIVGDGGDYRTFQKSAFFDNLVHLHQLETLKFQFRYVWMSEQISPATIPSAKA  738

Query  114  FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
            FP+ LK L L  T L W+++ +IG+L NLEVLKL
Sbjct  739  FPATLKNLKLVGTGLRWEDLNIIGELPNLEVLKL  772



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 50/103 (49%), Gaps = 17/103 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F    NLK+LGI       I+G++  G   +L  LD LE LK            G++   
Sbjct  557  FDTACNLKKLGIRGPLASLIDGKI--GSFGSLRKLDHLENLKLLNDVFSRPASEGQLRYL  614

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              P  FP KLK LTL  T L W  M ++G L  L VLKLKD A
Sbjct  615  PQPYEFPPKLKSLTLSDTSLDWSHMSILGLLEKLIVLKLKDNA  657



>ref|XP_011102162.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=997

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE----GELVSGCLENLVDLDLLEKLKFRIGRVE-RFCLPTS----F  112
            F  +PNL +LG+ +E     +    C E L  L  LE LK+ +     +  +P +    F
Sbjct  795  FERIPNLIKLGVQMELAPDVDEPLCCFELLASLHKLESLKWSVVNPNLQLLVPAASVPIF  854

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL     PW+ M  I +L NLEVLKL+ +A
Sbjct  855  PPGLKKLTLSGLGFPWEYMSTIARLENLEVLKLQCYA  891



>gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Erythranthe guttata]
Length=745

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 17/98 (17%)
 Frame = -1

Query  255  VPNLKELGI-YIE--GELVSGCLENLVDLDLLEKLKFRIGR---------VERFCLPTSF  112
            +PN+ +L I Y E   E +S  L+NL  L  LE L+F +           V+ F LP S 
Sbjct  530  IPNINKLQISYFEEPQEFLSYTLDNLGHLHKLESLRFSLHSENKPSLNDMVQNFILPNS-  588

Query  111  PSKLKKLTLCSTYLPWDEMGV-IGKLSNLEVLKLKDFA  1
               LKKLTL  T L W++M   IG L NL+VLKLK+++
Sbjct  589  ---LKKLTLIGTKLKWEDMNTKIGLLPNLQVLKLKEYS  623



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 8/97 (8%)
 Frame = -1

Query  273  NPNFGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGR-VERFCLPTSF  112
            N  F   PNLK L ++        + +S  L +L  L  LE LK    R +    LP+++
Sbjct  684  NEMFTRTPNLKRLKLHGAWEECRRDTISQMLNSLYCLPQLEILKIICSRKLYPHPLPSTY  743

Query  111  --PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
              P+ L +LTL  TYLPW++M  I  L NL+VLK+KD
Sbjct  744  VLPTSLVRLTLRCTYLPWEDMANIVMLPNLQVLKIKD  780



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = -1

Query  219  GELVSGCLENLVDLDLLEKLKF-----RIGRVERFCLPTSFPSKLKKLTLCSTYLPWDEM  55
             +L S C  NL  L  LE LK       +  ++      + P  LKKLTL  TYLPW+ M
Sbjct  743  SDLWSDCFRNLALLPQLEALKIFGLKPPVQELKLARHLDALPENLKKLTLSFTYLPWESM  802

Query  54   GVIGKLSNLEVLKLKDFA  1
              + +L NLEVLKLK++A
Sbjct  803  TSLCRLPNLEVLKLKNYA  820



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 9/80 (11%)
 Frame = -1

Query  219  GELVSGCLENLVDLDLLEKLKF-------RIGRVERFCLPTSFPSKLKKLTLCSTYLPWD  61
             +L S C  NL  L  LE LK        +  ++ R     + P  LKKLTL  TYLPW+
Sbjct  779  SDLWSDCFRNLALLPQLEALKIFGLKPPVQEPKLARHL--DALPENLKKLTLSFTYLPWE  836

Query  60   EMGVIGKLSNLEVLKLKDFA  1
             M  + +L NLEVLKLK++A
Sbjct  837  SMTSLCRLPNLEVLKLKNYA  856



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  LKKLTL  T LPW+ M +  KL NLEVL+LK++A
Sbjct  729  PGSFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNYA  769



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 9/80 (11%)
 Frame = -1

Query  219  GELVSGCLENLVDLDLLEKLKF-------RIGRVERFCLPTSFPSKLKKLTLCSTYLPWD  61
             +L S C  NL  L  LE LK        +  ++ R     + P  LKKLTL  TYLPW+
Sbjct  794  SDLWSDCFRNLALLPQLEALKIFGLKPPVQEPKLARHL--DALPENLKKLTLSFTYLPWE  851

Query  60   EMGVIGKLSNLEVLKLKDFA  1
             M  + +L NLEVLKLK++A
Sbjct  852  SMTSLCRLPNLEVLKLKNYA  871



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 55/112 (49%), Gaps = 18/112 (16%)
 Frame = -1

Query  291   VTSSDRNPNFGM--------VPNLKELG-IYIEGELVSGCLENLVDLDLLEKLK----FR  151
             VT S  + +FGM        +PNL+    I+++    S        LD L +L+    F 
Sbjct  1260  VTFSSLSLSFGMDTEKILRKLPNLRSFSCIFLDARDSSQSCNQFPRLDFLPQLESLKIFY  1319

Query  150   IGRVERFCLPTSF--PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              GR  +   P  F  P  LKKLTL S  LPWD +  IG+L NL+VLKL   A
Sbjct  1320  AGRTRK---PGEFSLPLNLKKLTLSSFGLPWDHISTIGRLPNLQVLKLASEA  1368



>ref|XP_011087137.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=870

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRI----GRVERFCLP-----TSF  112
             G +PNLK+LG  +E  L +    ++ +   L+ LK  I       ++  +P     + F
Sbjct  664  LGRIPNLKKLGFQVELPLDAVEPLHVANSRGLKSLKCAIVNPNPSFDQVVVPALQGVSIF  723

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            PS LKKLTL    LPW++M +I  + NLEVLKL+ +A
Sbjct  724  PSTLKKLTLSGLSLPWEDMSIIACIWNLEVLKLRCYA  760



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PS  106
            F  +PNLK L ++      EG  +S  L +L  L  LE LKF    ++   +P+ F  P 
Sbjct  685  FSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELEMLKFNGDGLQLPRIPSKFALPV  744

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
             LK+LTL  T LPW++M  I  L NL+ LK+K
Sbjct  745  CLKRLTLSYTSLPWEDMANIVMLPNLQELKIK  776



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  264  FGMVPNLKELGIY-----IEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSF--PS  106
            F  +PNLK L ++      EG  +S  L +L  L  LE LKF    ++   +P+ F  P 
Sbjct  685  FSAIPNLKRLKVHGDWEECEGRKMSQYLNSLSCLKELEMLKFNGDGLQLPRIPSKFALPV  744

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
             LK+LTL  T LPW++M  I  L NL+ LK+K
Sbjct  745  CLKRLTLSYTSLPWEDMANIVMLPNLQELKIK  776



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -1

Query  198  LENLVDLDLLEKLKFRIGRVERFCL--PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLE  25
            L++L  L +  +  + I     F L  P SFP KLKKL L  T LPW+ M +I KL  LE
Sbjct  620  LQDLESLSIAIQYWYIINSTRFFSLTSPDSFPQKLKKLKLSRTCLPWEYMSIISKLPVLE  679

Query  24   VLKLKDFA  1
            VL+LK +A
Sbjct  680  VLQLKRYA  687



>gb|EYU38159.1| hypothetical protein MIMGU_mgv1a025995mg [Erythranthe guttata]
Length=769

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -1

Query  255  VPNLKELGIYIEGEL-------VSGCLENLVDLDLLEKLKFRI--GRVERFCLPTSFPSK  103
            +PNLK+LGI IE           S C +++  L+ LE LK  I    ++   L + FP  
Sbjct  582  IPNLKKLGIRIEISSDAASDCEPSSCFDHISLLNKLESLKCVIVNPTLKNPPLLSVFPLG  641

Query  102  LKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LKKL L     PW+EM  I  L NLEVLKL+ +A
Sbjct  642  LKKLCLSGLGYPWEEMSKIASLPNLEVLKLRCYA  675



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 8/93 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-----GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPT-SFP  109
            +  +PN+K+L I  +      E    CL+NLV L  LE LK  F     ++  LP  +FP
Sbjct  612  YKSIPNVKKLEIVYDKNSNTTEWSLYCLDNLVHLHQLESLKCHFLDAHRQKPDLPDLTFP  671

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            SKLK+L+L    +P   M  IG L NLE+LKL+
Sbjct  672  SKLKELSLLGWEIPSKYMTTIGSLHNLEILKLR  704



>ref|XP_011072138.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=427

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            VPNLK+LGI I  E  S  LENL  L  LE L      V       +FP+ LKKL+L + 
Sbjct  262  VPNLKKLGI-IRYEKSSSGLENLARLQKLESLYLFEKNVSLLA-NITFPTSLKKLSLSNC  319

Query  75   YLPWDEMGVIGK-LSNLEVLKL  13
             +PW+EM V G  L NLE L L
Sbjct  320  CIPWEEMTVFGSVLPNLEKLTL  341



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 8/93 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE-----GELVSGCLENLVDLDLLEKLK--FRIGRVERFCLPT-SFP  109
            +  +PN+K+L I  +      E    CL+NLV L  LE LK  F     ++  LP  +FP
Sbjct  684  YKSIPNVKKLEIVYDKNSNTTEWSLYCLDNLVHLHQLESLKCHFLDAHRQKPDLPDLTFP  743

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            SKLK+L+L    +P   M  IG L NLE+LKL+
Sbjct  744  SKLKELSLLGWEIPSKYMTTIGSLHNLEILKLR  776



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = -1

Query  207  SGCLENLVDLDLLEKLKFR--IGRVERFCL--PT----SFPSKLKKLTLCSTYLPWDEMG  52
            S   E+L+ L  LEKL+    I   E F L  PT     FP+ LK LTL  T L W++M 
Sbjct  12   SQSRESLIRLVDLEKLRIHLDISPYENFSLRLPTLLLDVFPTFLKSLTLVGTRLLWEDMT  71

Query  51   VIGKLSNLEVLKLKDFA  1
             +G+L NLEVL+LK FA
Sbjct  72   TLGQLPNLEVLRLKCFA  88



>emb|CDP20685.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -1

Query  309   TLYWLKVTSSDRNPN-FGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVER  133
             TL  L VT  DR  N    +PN+++L I +     S    NL  L ++E L+     +  
Sbjct  951   TLSTLTVTLDDRAENIMRKIPNVRQLKIQLSAAECSAGYCNLSHLTVIETLEVSAESLPS  1010

Query  132   FCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
               +  SFP  LK+L L   +LPW ++  I +L +LEVL L
Sbjct  1011  NPVEFSFPLHLKELVLGGLHLPWSKISAIEELPDLEVLTL  1050



>ref|XP_011072129.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=884

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            P  FP KLK LTL  T+L W  M ++G L NLEVLKLKD
Sbjct  738  PYKFPKKLKSLTLADTFLDWSNMSILGLLENLEVLKLKD  776



>ref|XP_011073066.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=777

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 48/99 (48%), Gaps = 12/99 (12%)
 Frame = -1

Query  297  LKVTSSDRNPNFG-----MVPNLKELGIYIEGELVSG----CLENLVDLDLLEKLKFRIG  145
            L+  S   N NF      M+  LK+L +Y     ++      L NLV L  LEKL+F   
Sbjct  676  LQTLSYITNFNFSKKAVRMMQKLKKLNVYYGAVTLARRSDYGLNNLVHLRQLEKLRFSYR  735

Query  144  RVERFCLPT---SFPSKLKKLTLCSTYLPWDEMGVIGKL  37
            R     +PT   +FP  LKKLTL     PWD M V+G L
Sbjct  736  RSVSCNVPTPIFAFPRTLKKLTLSDCRFPWDHMTVVGSL  774



>gb|EYU17781.1| hypothetical protein MIMGU_mgv1a023021mg [Erythranthe guttata]
Length=827

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = -1

Query  255  VPNLKELGIYIEGEL--VSGCLENLVDLDLLEKLKFRIGR-----VERFCLPTSFPSKLK  97
            +PNLK+L ++ +        CL +L  L  L+  KF + +     + +  +   FP+ L 
Sbjct  685  MPNLKKLAVWTKTPPGPTDSCL-HLGQLQNLQAFKFTVVQPRPKLMSKTKIIDHFPNTLV  743

Query  96   KLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            KL L    LPW++M VIG+L  LEVLKL+D A
Sbjct  744  KLRLSGCALPWEDMTVIGQLPCLEVLKLRDMA  775



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 5/93 (5%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSG---CLENLVDLDLLEKLKFRIGRVERFCLPT--SFPSKL  100
            F  V  +K+LGI+ + +   G   CL+NL+ L  LE+L  +        LP   SFP  L
Sbjct  642  FEGVKKVKKLGIFDKNDEYDGKSRCLDNLIYLHELEELSIKSYMSSFVRLPRLDSFPPNL  701

Query  99   KKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            KKLTL  T L W +M  I  L  L VL+LK+ A
Sbjct  702  KKLTLNGTGLMWKDMTTISMLPKLNVLQLKNGA  734



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 8/74 (11%)
 Frame = -1

Query  198   LENLVDLDLLEKLKFRIGRVE------RFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIG  43
             L +LVDL  LE L  ++ R +      RF       FP KLKKL L  T L W+E+ +IG
Sbjct  1696  LRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIG  1755

Query  42    KLSNLEVLKLKDFA  1
             +  NLEVLKLK  A
Sbjct  1756  QWPNLEVLKLKPNA  1769


 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 8/74 (11%)
 Frame = -1

Query  198   LENLVDLDLLEKLKFRIGRVE------RFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIG  43
             L +LVDL  LE L  ++ R +      RF       FP KLKKL L  T L W+E+ +IG
Sbjct  2503  LRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIG  2562

Query  42    KLSNLEVLKLKDFA  1
             +  NLEVLKLK  A
Sbjct  2563  QWPNLEVLKLKPNA  2576



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 51/97 (53%), Gaps = 9/97 (9%)
 Frame = -1

Query  264   FGMVPNLKELGIY-IEGELVSG--CLENLVDLDLLEKLKFRI------GRVERFCLPTSF  112
             F  +  +K LGI   E E  S   CL+NL+ L  LE L          G   R     SF
Sbjct  912   FEAIKKVKNLGISGSENEFHSEPRCLDNLIYLHELEALSIVSYSRQPDGLFLRLPHLDSF  971

Query  111   PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             P  LKKLTL  T+L W++M +I +L  LEVL+LK+ A
Sbjct  972   PPNLKKLTLRRTWLSWEDMTIISELPELEVLQLKEDA  1008



>ref|XP_011087333.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=841

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 52/99 (53%), Gaps = 14/99 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELVSGCLEN--LVDLDLLEKLKFRIGRVERFC---------LPT  118
            F   P LK LGI   G+L++  L+N  L +L  LEKLK       R            P 
Sbjct  637  FDRAPYLKTLGI--RGQLLT-LLDNRSLANLGRLEKLKLVNDAFPRVASENPLQGLPQPD  693

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             FP  L+ LTL ST+L W  M V+G L+ LEVLKLK+ A
Sbjct  694  RFPPNLRILTLSSTFLDWKNMFVLGMLNALEVLKLKENA  732



>gb|EYU24400.1| hypothetical protein MIMGU_mgv1a026464mg, partial [Erythranthe 
guttata]
Length=731

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 11/92 (12%)
 Frame = -1

Query  255  VPNLKELGIYIE--------GELVSGCLENLVDLDLLEKLKFRI-GRVERFCLPTS-FPS  106
            +PNLK+LGI IE         E +S C +++  L+ LE LK  I   + +   P S FPS
Sbjct  540  IPNLKKLGIRIEISPDVTTYQEPLS-CFDHISHLEKLESLKCVIVNPILKNPPPLSIFPS  598

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
             LKKL+L     PW+EM  I  L NLEVLKL+
Sbjct  599  GLKKLSLSGLGYPWEEMSKIDLLPNLEVLKLR  630



>gb|EYU24151.1| hypothetical protein MIMGU_mgv1a019744mg, partial [Erythranthe 
guttata]
Length=868

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            + N+K+L I + G + S CL NL  L  LE+L   +      C    FPS LK L L   
Sbjct  675  IANVKKLEI-VCGTIGSNCLRNLGLLHKLEQLNLELITGTSCCGEIVFPSSLKVLVLSEC  733

Query  75   YLPWDEMGVIGKLSNLEVLKLKDFA  1
             +PW++M V+G L  LE L+L+  A
Sbjct  734  KIPWEDMSVVGSLPKLEDLELQKNA  758



>emb|CDP15849.1| unnamed protein product [Coffea canephora]
Length=1155

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 52/101 (51%), Gaps = 3/101 (3%)
 Frame = -1

Query  309   TLYWLKVTSSDRNPN-FGMVPNLKELGIYIEG-ELVSGCLENLVDLDLLEKLKFRIGRVE  136
             TL  L VT  DR  N    VPN+++L I +   E   GC  NL  L  LE L+     + 
Sbjct  953   TLSTLTVTLDDRAANIMRKVPNVRQLKIQLSAAECSVGCC-NLSHLSSLEALEVSAESLP  1011

Query  135   RFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
                +  SFP  LK+L L   +LPW ++ VI +L  LEVL L
Sbjct  1012  SNPVEFSFPLNLKELVLGGLHLPWSKISVIQELPELEVLIL  1052



>gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Erythranthe guttata]
Length=859

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -1

Query  258  MVPNLKELGIYIEGE--LVSGCLENLVDLDLLEKLKFR-IGRVE-RFCLPTSFPSKLKKL  91
            M+PNL++LGI   G+       L NLV L  LE LK   IGR   R  L   FP  LK+L
Sbjct  663  MLPNLRKLGIVYSGDDCYQEFHLGNLVLLCKLESLKLEVIGRPHFRTRLNPVFPRLLKEL  722

Query  90   TLCS-TYLPWDEMGVIGKLSNLEVLKLKDFA  1
            TL     + W +M ++G L NL+VLKL+D A
Sbjct  723  TLSGFGIINWKDMTIVGSLLNLQVLKLRDSA  753



>gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Erythranthe guttata]
Length=643

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 49/103 (48%), Gaps = 17/103 (17%)
 Frame = -1

Query  264  FGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKF---------RIGRVERF  130
            F    NLK+LGI       I+G++  G    L  +D LE LK            G++   
Sbjct  441  FDTACNLKKLGIRGPLASLIDGKI--GSFGILRKMDHLENLKLLNDVFPRPASEGQLRYL  498

Query  129  CLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              P  FP KLK LTL  T L W  M ++G L  L VLKLKD A
Sbjct  499  PQPYEFPPKLKSLTLSDTSLDWSHMPILGSLEKLIVLKLKDNA  541



>gb|EYU17705.1| hypothetical protein MIMGU_mgv1a018542mg, partial [Erythranthe 
guttata]
Length=756

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSG----CLENLVDLDLLEKLK-------FRIGRVERFCLPTSFP  109
            +PNLKEL I IE   V+     C +++ +L  L++L+       F+   V RF   +  P
Sbjct  601  IPNLKELTIQIELVPVASKPFSCFDHIYNLHQLQELECEITNPIFKTEVVTRFGPLSDLP  660

Query  108  SKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            S L KLTL     PW+EM  I  L NL  L L+ +A
Sbjct  661  SSLTKLTLSGLGYPWEEMRKISSLPNLTDLVLQCYA  696



>ref|XP_009777218.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777219.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777220.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777221.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=791

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 18/106 (17%)
 Frame = -1

Query  285  SSDRNPNFGMVPNLKELGI-YIEGELVSGCLEN---LVDLDLLEKLK---------FRIG  145
            SS  N  F  +PNLK L I     E +   L N    +D+ +L KL+         +R  
Sbjct  583  SSCTNEIFSAIPNLKRLSIRQTYSESLKCALRNTDHFLDMSILRKLQASKCFFYVHYRCS  642

Query  144  RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             + R+     FP+ LK+LTL  +YLPW+E+  +  L NLEVLKLK+
Sbjct  643  -LRRYI----FPTCLKRLTLKGSYLPWEELSSLVVLPNLEVLKLKN  683



>gb|EYU31460.1| hypothetical protein MIMGU_mgv1a020657mg [Erythranthe guttata]
Length=720

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 6/90 (7%)
 Frame = -1

Query  258  MVPNLKELGI--YIEGELVSGCLENLVDLDLLEKLKFRIGRV----ERFCLPTSFPSKLK  97
            M+PN+KELGI   I+       L+NLV L  LE+ K  +       +   +  +FP  LK
Sbjct  523  MIPNVKELGICYTIDNREKEYELDNLVRLKQLERFKLTLSYPLDVWKGKNITLAFPKTLK  582

Query  96   KLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
             L+      PW EM ++G L NL+VLK+K+
Sbjct  583  WLSFGGWSRPWSEMTIVGSLPNLQVLKIKE  612



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 10/75 (13%)
 Frame = -1

Query  207  SGCLENLVDLDLLEKLKF---RIG-----RVERFCLPTS--FPSKLKKLTLCSTYLPWDE  58
            S   +NLV L  LE L F   R G     R+    +P++  FP  L+KL L STY+ W++
Sbjct  720  SRLFDNLVHLHQLETLSFEFRRWGSSENWRISPATIPSAKAFPVTLRKLKLKSTYVRWED  779

Query  57   MGVIGKLSNLEVLKL  13
            + ++G+L NLEVLKL
Sbjct  780  LNIVGELPNLEVLKL  794



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -1

Query  291  VTSSDRNPNFGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIG---RVERFCLP  121
             TSSD    F  +P++K L + +  +     ++NL+ L  L+ L+  +      + F  P
Sbjct  610  ATSSDLKEIFMAIPHVKVLDVELNQDGWDNVIDNLIYLADLQNLRILLRLPFDAQLFQRP  669

Query  120  TS-----FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            ++     FP+ LK L L  T+L W EM ++  L NLE LKL+ FA
Sbjct  670  SARPFDVFPANLKSLILAETHLLWTEMTMLSNLPNLEGLKLELFA  714



>gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Erythranthe 
guttata]
Length=692

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 13/91 (14%)
 Frame = -1

Query  255  VPNLKELGI-YIEGE--LVSGCLENLVDLDLLEKLKFRIGR-----VERFCLPTSFPSKL  100
            +PN+ +L I Y E     +S CL+NL  L  LE L+F +       V+ F LP S    L
Sbjct  488  IPNINKLQISYFEEPQGFLSYCLDNLDHLHKLESLRFSLYSKNKHLVQNFILPNS----L  543

Query  99   KKLTLCSTYLPWDEMGV-IGKLSNLEVLKLK  10
            KKLTL  T L WD+M   IG L +L+VLKLK
Sbjct  544  KKLTLWGTMLKWDDMKTKIGLLPSLQVLKLK  574



>ref|XP_011101277.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101278.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101279.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101280.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101281.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 18/101 (18%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKF--------RIGRV-------ERFCLP  121
            +PNLK+L I IE     G  E+L  LD+ + +K+         +G V        +   P
Sbjct  672  IPNLKKLRIQIEE--APGAAESLCSLDVDQGIKWFGFQRGIKSLGFVIINPVPKPQIAAP  729

Query  120  T-SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              S PS L+KL+L     PW +  VIGKL +LEVLKLK++A
Sbjct  730  IKSLPSGLRKLSLSGLGCPWKDARVIGKLWHLEVLKLKNYA  770



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -1

Query  291  VTSSDRNPNFGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIG---RVERFCLP  121
             TSSD    F  +P++K L + +  +     ++NL+ L  L+ L+  +      + F  P
Sbjct  668  ATSSDLKEIFMAIPHVKVLDVELNQDGWDNVIDNLIYLADLQNLRILLRLPFDAQLFQRP  727

Query  120  TS-----FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            ++     FP+ LK L L  T+L W EM ++  L NLE LKL+ FA
Sbjct  728  SARPFDVFPANLKSLILAETHLLWTEMTMLSNLPNLEGLKLELFA  772



>emb|CDP16841.1| unnamed protein product [Coffea canephora]
Length=900

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 52/105 (50%), Gaps = 13/105 (12%)
 Frame = -1

Query  276  RNPNFGMVPNLKELGIY------IEGELVSGCLENLVDLDLLEKLKFRI----GRVERFC  127
            +N  FG    L++LGI       +E    S   ++   LD LE LK       G   +  
Sbjct  687  KNEVFGRTKKLRKLGIRGNLGTLVEANGESSLFQSHCKLDSLETLKLHHDTDDGNQRQLV  746

Query  126  LPT--SFPSKLKKLTLCSTYLPWD-EMGVIGKLSNLEVLKLKDFA  1
            LP    FP  L +L+L +T L W+  M ++GKL  LEVLKLKD A
Sbjct  747  LPQPHKFPRTLTRLSLHNTRLHWEVHMPILGKLRYLEVLKLKDNA  791



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 10/95 (11%)
 Frame = -1

Query  255  VPNLKELGIYIE-GELVSGCL----ENLVDLDLLEKLKF-RIGRVERFCL---PTS-FPS  106
             P LK+LGI  +  +L+   L     N+  L  LE LK   +G+ ++  L   P S FP+
Sbjct  498  APKLKKLGIRGKIAKLLEPSLPVLFNNVKMLQCLENLKLINVGQTDQTQLRLPPASLFPT  557

Query  105  KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            KL++LTL  T+L WD+M V+ +L  L VLKLKD A
Sbjct  558  KLRRLTLSDTWLEWDDMSVLKQLEYLLVLKLKDNA  592



>ref|XP_011071868.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=859

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            VPNLK+LGI +  +  SG LENL  L  LE L      V       SFP+ LKKL+L + 
Sbjct  669  VPNLKKLGI-VHLKKGSGGLENLARLQKLESLYLLEENVSLLA-NISFPTSLKKLSLSNC  726

Query  75   YLPWDEMGVIGK-LSNLEVLKL  13
             +PW++M V G  L NLE L L
Sbjct  727  CIPWEKMTVFGSILPNLEKLTL  748



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 14/102 (14%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-------SGCL--ENLVDLDLLEKLKF----RIGRVERFCL  124
            F   PNLK+LG+  + + +       SG +   N+  L  LE LK     R+        
Sbjct  28   FTRTPNLKKLGVRGKIDALLETSKDGSGSVLFSNIGKLACLEYLKLVNDTRLSSKPLHLP  87

Query  123  PTS-FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P   FP KLKKL+L  T+  W +M ++G L +LEVLKLK++A
Sbjct  88   PAYIFPQKLKKLSLVDTWFEWKDMSILGLLPDLEVLKLKEYA  129



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -1

Query  255   VPNLKELG-IYIEGELVSGCLENLVDLDLLEKLK-FRIGRVERFCLPT--SFPSKLKKLT  88
             +P L++LG I+ E ++ +G       L  L +L+  ++    RFC P    FP  LKKLT
Sbjct  1261  LPQLQKLGCIFSESKVDTGQGYGFPLLGFLTQLEALKVTYSGRFCHPRKFDFPLNLKKLT  1320

Query  87    LCSTYLPWDEMGVIGKLSNLEVLKL  13
             L    LPWD +  IG+L NLEVLKL
Sbjct  1321  LSKFCLPWDCVSEIGRLPNLEVLKL  1345



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 30/110 (27%)
 Frame = -1

Query  261  GMVPNLKELGIYIEGELVSG-------------CLENLVDLDLLEKLKFRIG--------  145
              +PNLK L       LV+G             CL NL  +  LE LK            
Sbjct  669  ATLPNLKTLA----SNLVTGGNHDAFDVDWLGSCLNNLEQMYSLETLKLLFNLPMNNPRP  724

Query  144  --RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
               ++R+    +FP  LK LTL  ++L W++  V+G L NLEVLKLKDF+
Sbjct  725  RNSIQRW---NAFPPNLKNLTLSCSFLLWEDARVLGNLPNLEVLKLKDFS  771



>gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Erythranthe guttata]
Length=891

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 24/100 (24%)
 Frame = -1

Query  249  NLKELGIYIEGELV------SGCLENLVDLDLLEKLKF---------RIGRVERFCLPTS  115
            NLK+LG+   G L       SG  ++L  L  LE LK          ++G      LP S
Sbjct  694  NLKKLGV--RGNLALLMDPKSGSFDSLRKLGSLENLKLINDAFPHPSKLGD-----LPPS  746

Query  114  --FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
              FP KL+ LTL ST L W +M ++G L NL VLKLKD A
Sbjct  747  YRFPKKLRSLTLSSTLLDWTDMSILGSLENLLVLKLKDKA  786



>gb|EYU17689.1| hypothetical protein MIMGU_mgv1a024130mg [Erythranthe guttata]
Length=872

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 16/101 (16%)
 Frame = -1

Query  264  FGMVPNLKELGIYIE----GELVSGCLENLVDLDLLEKLK---------FRIGRVERFCL  124
            F  +PNL++LGI IE        S C +++  L+ L+ LK          ++    +F +
Sbjct  671  FEGMPNLQKLGIRIEFAPDASESSNCFDHVSHLNELKSLKCVVVNPVFDTKVVAPPKFSI  730

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
               FP +LKKL+L     PW++M  I  L NLEVLKL+  A
Sbjct  731  ---FPERLKKLSLSGFGYPWEDMNKIALLPNLEVLKLQCHA  768



>gb|EYU40390.1| hypothetical protein MIMGU_mgv1a018316mg [Erythranthe guttata]
Length=865

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 46/85 (54%), Gaps = 12/85 (14%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTS----FPSKLKKLT  88
            +PNLK+L I I G + S  L NL  L  LE+L          C P      FP+ LK+L 
Sbjct  659  IPNLKKLEI-ICGTIGSNRLSNLGLLHKLEQLSM-------LCCPCGGEIVFPNSLKELR  710

Query  87   LCSTYLPWDEMGVIGKLSNLEVLKL  13
            L    +PW+EM VIG L NL+VL L
Sbjct  711  LHGCKIPWEEMSVIGSLPNLQVLVL  735



>emb|CDP10267.1| unnamed protein product [Coffea canephora]
Length=985

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 3/85 (4%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE--RFCLPTSFPSKLKKLTLC  82
            +PN++ L I+  G     C  N+  L  LE L     R    R  +  SFP  LKKL+LC
Sbjct  796  IPNVRRLQIFNHGGQNRVCC-NMSRLVCLESLTLDGDRFSGSREHVELSFPMNLKKLSLC  854

Query  81   STYLPWDEMGVIGKLSNLEVLKLKD  7
            +  +P  +M +I +L NLEVLKL+D
Sbjct  855  NLGIPCRKMSLIEQLPNLEVLKLRD  879



>ref|XP_009793189.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=873

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 52/97 (54%), Gaps = 9/97 (9%)
 Frame = -1

Query  264  FGMVPNLKELGIY--IEGELVS---GCLENLVDLDLLEKLKF--RIGRVERFCLPTS--F  112
            F   P LK+LGI   IE  L S   G   N  +L  LEKLK    +    +  LP+   F
Sbjct  677  FARCPYLKKLGIRGKIEVLLQSNRVGPFLNDQNLKCLEKLKLVNDLSAGGKLHLPSENIF  736

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P  LKKLTL  T L W EMG + KL  LEVLKLK+ A
Sbjct  737  PKSLKKLTLLGTGLDWKEMGRLCKLEVLEVLKLKENA  773



>ref|XP_009622940.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=890

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVE-  136
            QTL  +   S  RN     V NLK+LGI  + E + G  E+  +L  LE+LK     +  
Sbjct  677  QTLSKIAPESCTRNV-LAKVCNLKKLGIEGKLEALLG-FESFEELKCLERLKMLNDIMSP  734

Query  135  RFCLPTSFPS---KLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            +  LP  F +    LKKLTL ST + W E   +GKL +LEVLKLKD A
Sbjct  735  KIQLPQLFFTYLRTLKKLTLSSTKIDWSEAKELGKLESLEVLKLKDNA  782



>gb|EYU26873.1| hypothetical protein MIMGU_mgv1a025130mg [Erythranthe guttata]
Length=811

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKLTLCST  76
            +PNLK+L + + G + S C+ NL  L  LE L        R  +   FP  LK+L L   
Sbjct  597  IPNLKKLEV-VCGTIGSNCVRNLGLLQKLEVLTLSCSPCGREIV---FPYSLKELRLHGC  652

Query  75   YLPWDEMGVIGKLSNLEVLKL  13
             +PW++M VIG L NLEVL L
Sbjct  653  KIPWEDMSVIGSLPNLEVLML  673



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFPS LKKLTL  T LPW+ M +  KL NLEVL+LK  A
Sbjct  729  PGSFPSNLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHA  769



>gb|EYU17692.1| hypothetical protein MIMGU_mgv1a019705mg [Erythranthe guttata]
Length=730

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 14/99 (14%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSG------CLENLVDLDLLEKLK-------FRIGRVERFCLPTS  115
            +PNL++LGI IE  L +       C +++  L  L  LK         +  +     P S
Sbjct  565  IPNLQKLGIRIELALENVDQKPFFCFDHISHLHELNTLKCVVVNPQITLSEIVAPIFPLS  624

Query  114  -FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
             FPS L KLTL     PW+EM  I  L NL VLKLK +A
Sbjct  625  IFPSSLVKLTLSGLGYPWEEMSRISSLPNLRVLKLKCYA  663



>emb|CDP16498.1| unnamed protein product [Coffea canephora]
Length=909

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 47/84 (56%), Gaps = 5/84 (6%)
 Frame = -1

Query  237  LGIYIEGELVSGCLENLVDLDLLEKLKFRIGRV--ERFCLPTS--FPSKLKKLTLCSTYL  70
            LG  +E +  S   + L  L  +E LK     +  E   LP S  FP+ LK+L+L  T L
Sbjct  712  LGTLVEPDGDSHLFDYLCKLSTIENLKLHGADINSELQALPKSNKFPTNLKRLSLEKTSL  771

Query  69   PWD-EMGVIGKLSNLEVLKLKDFA  1
             W+  M +IGKL +LEVLKLKD A
Sbjct  772  KWNIHMPIIGKLQSLEVLKLKDNA  795



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 16/103 (16%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV---------SGCLENLVDLDLLEKLKF----RIGRVERFCL  124
            F   PNLK+LG+  + + +         SG   N+  L  LE LK     R+   +   L
Sbjct  680  FTRTPNLKKLGVRGKIDALLESSKDGSGSGLFSNIGKLGCLEYLKLVNDTRLSS-KPLHL  738

Query  123  PTS--FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P +  FP KLKKL+L  T+  W +M ++G L  LEVLKLK+ A
Sbjct  739  PPAYIFPQKLKKLSLVDTWFEWKDMSILGLLPELEVLKLKENA  781



>gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Erythranthe 
guttata]
Length=842

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 6/87 (7%)
 Frame = -1

Query  255  VPNLKELGIY---IEGELVSGCLENLVDLDLLEKLKFRIG---RVERFCLPTSFPSKLKK  94
            + N+K+L I    +  EL   CL N+  L  LE L +            L  +FPS L K
Sbjct  639  IANIKKLEIVYYDVSEELYDNCLYNIDKLHKLESLYYHFDDEPNRSDLLLNLTFPSSLHK  698

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKL  13
            LTL   +L W+++ +IG L NL VLKL
Sbjct  699  LTLEGCFLHWEDLTIIGSLPNLRVLKL  725



>gb|EYU24187.1| hypothetical protein MIMGU_mgv1a001243mg [Erythranthe guttata]
Length=855

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 46/91 (51%), Gaps = 16/91 (18%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSGC------LENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKK  94
            +PNLK+LGI+     +         L NLV L  LEKL              SF + LKK
Sbjct  669  MPNLKKLGIFYSFSEIDETGWSKYGLSNLVHLHKLEKLNL---------YGKSFVA-LKK  718

Query  93   LTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            LT     L W+EM ++G L NLEVLKLK  A
Sbjct  719  LTFSGCGLKWNEMTIVGSLPNLEVLKLKRHA  749



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFPS LKKLTL  T LPW+ M +  KL NLEVL+LK  A
Sbjct  728  PGSFPSNLKKLTLSRTCLPWNCMIIFSKLPNLEVLELKVHA  768



>emb|CDP12800.1| unnamed protein product [Coffea canephora]
Length=1162

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  114   FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
             FP  LKKLTL S + PW E+ VIGKL NLEVLKL+
Sbjct  1026  FPLNLKKLTLSSNHQPWSEISVIGKLPNLEVLKLE  1060



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 12/115 (10%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELV---SGCLENLVDLDLLEKLKFRIGR  142
            QT+Y L+ +   +   F  +  +K+L I  E +     +G   NL   + LE LK  +  
Sbjct  653  QTVYGLRPSCCTKEI-FEGIKKVKKLEIAGEAQEFNSETGWHNNLKYFEELEALKVTVSL  711

Query  141  VERFCLPT--------SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
               F  P         SFP  LKKLTL  T LPW+ M +  KL NLEVL+LK+ A
Sbjct  712  YCGFDYPPCLINPSSGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRA  766



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 12/115 (10%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIYIEGELV---SGCLENLVDLDLLEKLKFRIGR  142
            QT+Y L+ +   +   F  +  +K+L I  E +     +G   NL   + LE LK  +  
Sbjct  653  QTVYGLRPSCCTKEI-FEGIKKVKKLEIAGEAQEFNSETGWHNNLKYFEELEALKVTVSL  711

Query  141  VERFCLPT--------SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
               F  P         SFP  LKKLTL  T LPW+ M +  KL NLEVL+LK+ A
Sbjct  712  YCGFDYPPCLINPSSGSFPPNLKKLTLTRTCLPWNCMKIFSKLPNLEVLELKNRA  766



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 14/95 (15%)
 Frame = -1

Query  255  VPNLKELGIYI-EGELV----SGCLENLVDLDLLEKLKFRIG-----RVER--FCLPTS-  115
            + N+K+LGIY  E E      S   +NL +L  LE L  +I      ++ +    +P++ 
Sbjct  645  IRNVKKLGIYADEYEFKTFHGSKLFDNLANLHQLETLSLKISVPLQTKINKVPLTIPSAK  704

Query  114  -FPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             FP+ LKKL L +T L W++M +IG+L +LEVLKL
Sbjct  705  AFPATLKKLKLDNTCLRWEDMDIIGELPDLEVLKL  739



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = -1

Query  222  EGELVSGC--LENLVDLDLLE----KLKFR--IGRVERFCLPT--SFPSKLKKLTLCSTY  73
            E E    C   +N V L  LE    +L+FR  +  +    +P+  SFP  LKKL L  T 
Sbjct  723  EYESFQACRLFDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTD  782

Query  72   LPWDEMGVIGKLSNLEVLKLKDFA  1
            L W+++ +IG+L NLE+LKLK +A
Sbjct  783  LRWEDLNIIGELPNLEILKLKRYA  806



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = -1

Query  222  EGELVSGC--LENLVDLDLLE----KLKFR--IGRVERFCLPT--SFPSKLKKLTLCSTY  73
            E E    C   +N V L  LE    +L+FR  +  +    +P+  SFP  LKKL L  T 
Sbjct  723  EYESFQACRLFDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTD  782

Query  72   LPWDEMGVIGKLSNLEVLKLKDFA  1
            L W+++ +IG+L NLE+LKLK +A
Sbjct  783  LRWEDLNIIGELPNLEILKLKRYA  806



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 50/95 (53%), Gaps = 9/95 (9%)
 Frame = -1

Query  279   DRNPNFGMVPNLKELGIYIEGELVSG------CLENLVDLDLLEKLKFRIGRVERFCLPT  118
             D +    M+PNL+EL         S        LE L  L+ L K+ +R GR  +   P 
Sbjct  1255  DADEMIRMLPNLRELSCIFSKSRGSRDYYQFPRLEKLTQLESL-KIVYR-GRTIKTS-PF  1311

Query  117   SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             +FP  LKKLTL + +L WD +  IG L NLE+LKL
Sbjct  1312  NFPLGLKKLTLINFFLRWDHISTIGSLENLEILKL  1346



>gb|KDP30596.1| hypothetical protein JCGZ_16249 [Jatropha curcas]
Length=878

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = -1

Query  264  FGMVPNLKELGIYIEGELV-SGCLENLVDLDLLEKLKFRIGRVER--FCLPTS--FPSKL  100
              +VPNL +LGIY + E   S    NL  L  L+KLK    R  +    +P+S  FPS L
Sbjct  680  LSLVPNLVKLGIYGDIEKSKSLAFNNLSKLQHLQKLKLMRDRRYQPAIDIPSSIDFPSSL  739

Query  99   KKLTLCSTYLPWDEMGVIGK-LSNLEVLKLKDFA  1
             +LTL  T L  D M ++GK L  L+VLKLKD A
Sbjct  740  IRLTLSQTQLIVDPMELLGKRLPKLQVLKLKDGA  773



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  +KKLT   T +PW+ M +  KL NLEVL+LKD A
Sbjct  729  PGSFPPNIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDA  769



>ref|XP_010319214.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=882

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            P SFP KLK+L L  TYLPW+ + +I KL  LEVLKLK
Sbjct  712  PDSFPQKLKELKLRCTYLPWECISIISKLPELEVLKLK  749



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  +KKLT   T +PW+ M +  KL NLEVL+LKD A
Sbjct  739  PGSFPPNIKKLTFSGTCIPWNCMNIFSKLPNLEVLELKDDA  779



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = -1

Query  222  EGELVSGC--LENLVDLDLLE----KLKFR--IGRVERFCLPT--SFPSKLKKLTLCSTY  73
            E E    C   +N V L  LE    +L+FR  +  +    +P+  SFP  LKKL L  T 
Sbjct  723  EYESFQACRLFDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTD  782

Query  72   LPWDEMGVIGKLSNLEVLKLKDFA  1
            L W+++ +IG+L NLE+LKLK +A
Sbjct  783  LRWEDLNIIGELPNLEILKLKRYA  806



>emb|CDP01146.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  111  PSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            P KLKKLT+ +  LPW E+ VIG+L NLEVLKL D
Sbjct  457  PLKLKKLTMSNARLPWHEISVIGQLPNLEVLKLHD  491



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  PTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            P SFP  LKKLTL  T LPW+ M +  KL NLEVL+LK  A
Sbjct  730  PGSFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKARA  770



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 52/98 (53%), Gaps = 20/98 (20%)
 Frame = -1

Query  255  VPNLKELGIYIEGELVSG------CLENLVDLDLLEKLK------FRIGR---VERFCLP  121
            +PN+ +L I  EGE   G      CL+NL  L  LE         + + R   ++ F +P
Sbjct  694  IPNITKLKICYEGEKFGGYLSSYYCLKNLGRLGKLESFDCYFDNGYELNRNDMLQNFIIP  753

Query  120  TSFPSKLKKLTLCSTYLPWDEMGV-IGKLSNLEVLKLK  10
             S    +KKLTL  TYL W++M   IG L NLEVLKLK
Sbjct  754  NS----IKKLTLSWTYLKWEDMKTKIGWLPNLEVLKLK  787



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 4/104 (4%)
 Frame = -1

Query  312  QTLYWLKVTSSDRNPNFGMVPNLKELGIY--IEGELVSGCLENLVDLDLLEKLKFRIGRV  139
            QTL W+  T   R   +   PN+K+L I+   +  ++   L  LV L+ L  +    G +
Sbjct  643  QTLSWVCPTHC-RTEVYRKFPNIKKLKIFGFCDSPIILDDLNYLVRLERL-TISVSFGCI  700

Query  138  ERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
                 P+ FPS+LKKL+L  T L   ++ +IG L  LEVLKLK+
Sbjct  701  VTLPKPSMFPSRLKKLSLNDTSLSKKDLMIIGMLPRLEVLKLKN  744



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
            SFP  LKKLTL  T LPW+ M +  KL NLEVL+LK+ A
Sbjct  731  SFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNLA  769



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 36/71 (51%), Gaps = 8/71 (11%)
 Frame = -1

Query  198  LENLVDLDLLEKLKFRIG--------RVERFCLPTSFPSKLKKLTLCSTYLPWDEMGVIG  43
            ++NL  L  LE L   I         R        SFP KLKKL L  T LPW+ M +I 
Sbjct  696  IDNLKHLQDLESLSIEIQYWSTINGTRFFSLTSSDSFPQKLKKLKLSRTCLPWEYMSIIS  755

Query  42   KLSNLEVLKLK  10
            KL  LEVLKLK
Sbjct  756  KLPELEVLKLK  766



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  117   SFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKL  13
             +FPSKLK+LTL    LPW E+ +IG+L NLE+LKL
Sbjct  1585  NFPSKLKELTLSKFRLPWSEISIIGELPNLEILKL  1619



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = -1

Query  258  MVPNLKELGIYIEGE---LVSGCLENLVDLDLLEKLKFRIGRV-ERFCL--PTSFPSKLK  97
            + P+LK+LG+    +   L    L NL+ L  LEKLK  IG   +R  L    +FP+ L+
Sbjct  706  IFPSLKKLGLIYNRDRIFLQVYQLHNLIHLRQLEKLKICIGSYWDRHPLWEKLAFPTTLQ  765

Query  96   KLTLCSTYLPWDEMGVIGKLSNLEVLKLK  10
            KLTL    L   +M  +G L NL VLKL+
Sbjct  766  KLTLSGCVLSQQDMATVGSLPNLHVLKLR  794



>emb|CDP10797.1| unnamed protein product [Coffea canephora]
Length=899

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = -1

Query  252  PNLKEL--GIYI----EGELVSGCLENLVDLDLLEKLKFRIGRVERFCLPTSFPSKLKKL  91
            PN+++L   +Y+    E  +   CL  L  LDL       +   +R+ L   FP  +KKL
Sbjct  709  PNIRKLRSSLYLNHGYEYHVAIECLSQLESLDL----SCVVYGGDRYQLDIQFPLIIKKL  764

Query  90   TLCSTYLPWDEMGVIGKLSNLEVLKLKD  7
            TL    LPW +M  IG L NLEVLKL D
Sbjct  765  TLSYFRLPWSKMSAIGNLPNLEVLKLLD  792



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = -1

Query  207  SGCLENLVDLDLLEKLKFRIGRV--ERFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIGK  40
            SG   NL  L  LE L   + R       +P+  +FP+ LKKL L ST + W+++ ++G+
Sbjct  765  SGLFNNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  824

Query  39   LSNLEVLKL  13
            L NLEVLKL
Sbjct  825  LPNLEVLKL  833



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 48/104 (46%), Gaps = 21/104 (20%)
 Frame = -1

Query  261  GMVPNLKELGIYIEGELVSG----------CLENLVDLDLLEKLKFRIGRVERFCLP---  121
              +PNLK L       LV+G          CL NL  +  LE LK       +  LP   
Sbjct  684  ATLPNLKTLA----SNLVTGGNHDVDWLGSCLNNLHQMYSLETLKLLFNLPMKNPLPRNS  739

Query  120  ----TSFPSKLKKLTLCSTYLPWDEMGVIGKLSNLEVLKLKDFA  1
                 +FP  LK LTL  + L W +  V+G L NLEVLKLK F+
Sbjct  740  IQRWNAFPPNLKNLTLSCSLLLWQDARVLGNLPNLEVLKLKYFS  783



>ref|XP_009602411.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=912

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = -1

Query  207  SGCLENLVDLDLLEKLKFRIGRV--ERFCLPT--SFPSKLKKLTLCSTYLPWDEMGVIGK  40
            SG   NL  L  LE L   + R       +P+  +FP+ LKKL L ST + W+++ ++G+
Sbjct  765  SGLFNNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  824

Query  39   LSNLEVLKL  13
            L NLEVLKL
Sbjct  825  LPNLEVLKL  833



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512023305854