BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21426_g6_i1 len=926 path=[1374:0-109 1484:110-136 3583:137-925]

Length=926
                                                                      Score     E

ref|XP_010049949.1|  PREDICTED: transcription factor LUX isoform X1   66.2    8e-09   
ref|XP_010049950.1|  PREDICTED: transcription factor LUX isoform X2   66.2    9e-09   
gb|KDP32338.1|  hypothetical protein JCGZ_13263                       63.2    8e-08   
ref|XP_002529346.1|  conserved hypothetical protein                   62.8    1e-07   Ricinus communis
gb|KHN27391.1|  Two-component response regulator ARR18                55.1    4e-05   
ref|XP_007154940.1|  hypothetical protein PHAVU_003G159800g           55.1    4e-05   
ref|XP_003525655.1|  PREDICTED: uncharacterized protein LOC100807925  54.7    4e-05   
ref|XP_010656386.1|  PREDICTED: uncharacterized protein LOC100250892  54.3    6e-05   
ref|XP_003528276.1|  PREDICTED: uncharacterized protein LOC100809196  53.9    1e-04   
ref|XP_010254263.1|  PREDICTED: probable transcription factor GLK2    53.9    1e-04   
gb|KHN39723.1|  Two-component response regulator ARR18                53.5    1e-04   
ref|XP_003524007.1|  PREDICTED: transcription factor LUX-like         53.5    1e-04   
emb|CAN83719.1|  hypothetical protein VITISV_017077                   53.1    1e-04   Vitis vinifera
ref|XP_009403477.1|  PREDICTED: uncharacterized protein LOC103987021  51.6    5e-04   
ref|XP_007013309.1|  Homeodomain-like superfamily protein             51.2    6e-04   
ref|XP_009374059.1|  PREDICTED: uncharacterized protein LOC103962996  50.8    8e-04   



>ref|XP_010049949.1| PREDICTED: transcription factor LUX isoform X1 [Eucalyptus grandis]
Length=480

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 11/68 (16%)
 Frame = +1

Query  670  QQKIPSKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRSGSCPSPT------LALASPD  822
            QQ +  KET+IGF+VSP   + N   NGGAFLPFSK+ R+GSCPSP+      LAL SPD
Sbjct  131  QQSLAPKETDIGFNVSPKFSLENKSRNGGAFLPFSKE-RNGSCPSPSLRALPELALGSPD  189

Query  823  GKELEEKK  846
             KE+E+KK
Sbjct  190  -KEMEDKK  196



>ref|XP_010049950.1| PREDICTED: transcription factor LUX isoform X2 [Eucalyptus grandis]
 gb|KCW82779.1| hypothetical protein EUGRSUZ_C04155 [Eucalyptus grandis]
Length=479

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 11/68 (16%)
 Frame = +1

Query  670  QQKIPSKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRSGSCPSPT------LALASPD  822
            QQ +  KET+IGF+VSP   + N   NGGAFLPFSK+ R+GSCPSP+      LAL SPD
Sbjct  131  QQSLAPKETDIGFNVSPKFSLENKSRNGGAFLPFSKE-RNGSCPSPSLRALPELALGSPD  189

Query  823  GKELEEKK  846
             KE+E+KK
Sbjct  190  -KEMEDKK  196



>gb|KDP32338.1| hypothetical protein JCGZ_13263 [Jatropha curcas]
Length=480

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMN---NNGGAFLPFSKDHRSGSCPSPTLALASPDGKELEEKKSLE  855
            KET IGF+VSP   ++    NGGAFLPFSK+     CPSPTLALAS D KE+E+KK LE
Sbjct  139  KETSIGFNVSPKLGLDTKQRNGGAFLPFSKER--NLCPSPTLALASTD-KEMEDKKCLE  194



>ref|XP_002529346.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33013.1| conserved hypothetical protein [Ricinus communis]
Length=474

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 51/87 (59%), Gaps = 14/87 (16%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMN---NNGGAFLPFSKDHRSGSCPSPTLALASPDGKELEEKKSLEI  858
            KET IGF+VSP   ++    NGGAFLPFSK+     CPSPTLALAS D + +E+KK LE 
Sbjct  135  KETNIGFNVSPKLGLDTKQRNGGAFLPFSKER--NLCPSPTLALASTDKELMEDKKCLET  192

Query  859  NVNLGKCS--------NNGPATTELGK  915
               L  CS        +NG    E GK
Sbjct  193  ENGLS-CSKRDNSSKVSNGGIMIEHGK  218



>gb|KHN27391.1| Two-component response regulator ARR18 [Glycine soja]
Length=428

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 15/92 (16%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMNN----NGGAFLPFSKDHRS--GSC--PSPTLALASPDGKELEEK  843
            KE++IGFS+SP   ++N     GGAFLPFSK+  S  GS   P P L LAS + KE+E+K
Sbjct  136  KESDIGFSISPKLALDNKQRNGGGAFLPFSKERNSCQGSTLRPLPELVLASAE-KEMEDK  194

Query  844  KSLEINVNLGKC------SNNGPATTELGKSG  921
            K  E+ +    C      S +  A  + GK G
Sbjct  195  KRAEVEIKGVSCQSRKENSGSDGAVVDQGKGG  226



>ref|XP_007154940.1| hypothetical protein PHAVU_003G159800g [Phaseolus vulgaris]
 gb|ESW26934.1| hypothetical protein PHAVU_003G159800g [Phaseolus vulgaris]
Length=450

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 14/91 (15%)
 Frame = +1

Query  688  KETEIGFSVSP----NPQMNNNGGAFLPFSKDHRS--GSC--PSPTLALASPDGKELEEK  843
            KE +IGFS+SP    + +  N GGAFLPFSK+  S  GS   P P LALAS + KE+E+K
Sbjct  135  KEADIGFSISPKLALDSKQRNGGGAFLPFSKERNSCQGSTLRPLPELALASSE-KEMEDK  193

Query  844  KSLEINVNLG---KCSNNGP--ATTELGKSG  921
            K  E+   +    K  N+G   A  + GKSG
Sbjct  194  KRAEVEKGVSCQNKKENSGSDGAVVDQGKSG  224



>ref|XP_003525655.1| PREDICTED: uncharacterized protein LOC100807925 [Glycine max]
Length=454

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 15/92 (16%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMNN----NGGAFLPFSKDHRS--GSC--PSPTLALASPDGKELEEK  843
            KE++IGFS+SP   ++N     GGAFLPFSK+  S  GS   P P L LAS + KE+E+K
Sbjct  136  KESDIGFSISPKLALDNKQRNGGGAFLPFSKERNSCQGSTLRPLPELVLASAE-KEMEDK  194

Query  844  KSLEINVNLGKC------SNNGPATTELGKSG  921
            K  E+ +    C      S +  A  + GK G
Sbjct  195  KRAEVEIKGVSCQSRKENSGSDGAVVDQGKGG  226



>ref|XP_010656386.1| PREDICTED: uncharacterized protein LOC100250892 [Vitis vinifera]
Length=461

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 53/97 (55%), Gaps = 21/97 (22%)
 Frame = +1

Query  685  SKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRSGSCPSPT------LALA-SPDGKEL  834
            SKE +IGF+VSP    +N   NGGAFLPFSK+    SCPSP       LALA S D K++
Sbjct  135  SKEPDIGFTVSPKLGFDNKQRNGGAFLPFSKER--NSCPSPNLRVLPDLALANSADHKDV  192

Query  835  EEKKSLEI--------NVNLGKCSNNGPATTELGKSG  921
            E+KK  E           N GK  N G AT E  K+ 
Sbjct  193  EDKKCSETENGIAFSRRENCGKVVNGG-ATMEQVKAA  228



>ref|XP_003528276.1| PREDICTED: uncharacterized protein LOC100809196 [Glycine max]
 gb|KHN23993.1| Two-component response regulator-like APRR2 [Glycine soja]
Length=467

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 9/75 (12%)
 Frame = +1

Query  679  IPSKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRS--GSCPSPTLALASPDGKELEEK  843
            +P +  +IGFSVSP   ++N   NGGAFLPFSK+  S  G    P LALASP+ KE+EE 
Sbjct  139  LPKEGADIGFSVSPKLALDNKHRNGGAFLPFSKERNSCQGLRGLPELALASPE-KEIEEN  197

Query  844  KSLEINVNLGKCSNN  888
            K     +   KCS  
Sbjct  198  K---CELEAEKCSKR  209



>ref|XP_010254263.1| PREDICTED: probable transcription factor GLK2 [Nelumbo nucifera]
Length=455

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 21/95 (22%)
 Frame = +1

Query  697  EIG---FSVSPNPQMNN---NGGAFLPFSKDHRSGSCPS----PTLALASPDGKELEEKK  846
            E+G   FSVSP   +++   NGGAFLPFSK+  + + P+    P LALAS D KE+E+KK
Sbjct  138  EVGDQCFSVSPKLALDSKQRNGGAFLPFSKERNTCASPTLRGLPELALASTD-KEMEDKK  196

Query  847  SLE----INVNLGKCSNN------GPATTELGKSG  921
              E    ++V+  +  N+      G ATTE GK G
Sbjct  197  CSESDNAVSVSCSRRENSSKSNAGGTATTEQGKGG  231



>gb|KHN39723.1| Two-component response regulator ARR18 [Glycine soja]
Length=462

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 11/90 (12%)
 Frame = +1

Query  682  PSKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRS--GSCPSPTLALASPDGKELEEKK  846
            P    ++GFSVSPNP ++N   NGGAFLPFSK+  S  G    P +ALAS + KE+E+K 
Sbjct  137  PKNGADMGFSVSPNPALDNKHRNGGAFLPFSKERNSCQGLRDLPEVALASSE-KEMEKKC  195

Query  847  SLEI-----NVNLGKCSNNGPATTELGKSG  921
             LE        N GK S +     + GKS 
Sbjct  196  ELESEKCSKRENSGKGSGSCEGVVDQGKSA  225



>ref|XP_003524007.1| PREDICTED: transcription factor LUX-like [Glycine max]
Length=462

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 11/90 (12%)
 Frame = +1

Query  682  PSKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRS--GSCPSPTLALASPDGKELEEKK  846
            P    ++GFSVSPNP ++N   NGGAFLPFSK+  S  G    P +ALAS + KE+E+K 
Sbjct  137  PKNGADMGFSVSPNPALDNKHRNGGAFLPFSKERNSCQGLRDLPEVALASSE-KEMEKKC  195

Query  847  SLEI-----NVNLGKCSNNGPATTELGKSG  921
             LE        N GK S +     + GKS 
Sbjct  196  ELESEKCSKRENSGKGSGSCEGVVDQGKSA  225



>emb|CAN83719.1| hypothetical protein VITISV_017077 [Vitis vinifera]
Length=444

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 49/93 (53%), Gaps = 20/93 (22%)
 Frame = +1

Query  685  SKETEIGFSVSPNPQMNN---NGGAFLPFSKDHRSGSCPSPT------LALA-SPDGKEL  834
            SKE +IGF+VSP    +N   NGGAFLPFSK+    SCPSP       LALA S D K +
Sbjct  76   SKEPDIGFTVSPKLGFDNKQRNGGAFLPFSKER--NSCPSPNLRVLPDLALANSADHKXV  133

Query  835  EEKKSLEI--------NVNLGKCSNNGPATTEL  909
            E+KK  E           N GK  N G    ++
Sbjct  134  EDKKCSETENGIAFSRRENCGKVVNGGATMXQV  166



>ref|XP_009403477.1| PREDICTED: uncharacterized protein LOC103987021 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 7/67 (10%)
 Frame = +1

Query  682  PSKETEIGFSVSPNPQMN---NNGGAFLPFSKDH----RSGSCPSPTLALASPDGKELEE  840
            P KETE  F VSP   ++    NGGAFLPFSK+     RS S     LALASP+   +E+
Sbjct  133  PPKETEQAFDVSPKLSLDTKQRNGGAFLPFSKEKSKAARSASRALSELALASPEKVVVED  192

Query  841  KKSLEIN  861
            KK +E+ 
Sbjct  193  KKCVELE  199



>ref|XP_007013309.1| Homeodomain-like superfamily protein [Theobroma cacao]
 gb|EOY30928.1| Homeodomain-like superfamily protein [Theobroma cacao]
Length=467

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 21/93 (23%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMN---NNGGAFLPFSKDHRSGSCPS------PTLALASPDGKELEE  840
            KETEIGF+VSP   ++    NGGAFLPF+K+    SCP       P LALAS + K++E+
Sbjct  136  KETEIGFNVSPKLALDTKPRNGGAFLPFTKER--NSCPGSALQALPDLALASAN-KDMED  192

Query  841  KK--------SLEINVNLGKCSNNGPATTELGK  915
            K+        S +   N GK S NG    E G+
Sbjct  193  KRCSDTENGMSCQRRENSGKVS-NGVVVIEQGR  224



>ref|XP_009374059.1| PREDICTED: uncharacterized protein LOC103962996 [Pyrus x bretschneideri]
Length=487

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 44/84 (52%), Gaps = 16/84 (19%)
 Frame = +1

Query  688  KETEIGFSVSPNPQMNN------NGGAFLPFSKDHRSGSCPSPTLALASPDGKE----LE  837
            KET+IGFSVSP     N       GGAFLPFSKD      P P LALASP+  +    LE
Sbjct  153  KETDIGFSVSPKLGFENKQHRSYGGGAFLPFSKDRSPTLRPLPELALASPENNKSEIVLE  212

Query  838  EKKSLEINVNL------GKCSNNG  891
            +K +   N N+      G C+  G
Sbjct  213  DKTNHLENGNINSSSAAGNCNEQG  236



Lambda      K        H        a         alpha
   0.316    0.131    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1994468264640