BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21426_g5_i1 len=1072 path=[5989:0-116 1484:117-143 1511:144-1071]

Length=1072
                                                                      Score     E

ref|XP_011078200.1|  PREDICTED: putative GATA transcription facto...    101   2e-21   
ref|XP_009604300.1|  PREDICTED: putative GATA transcription facto...    101   5e-21   
emb|CDP03165.1|  unnamed protein product                              94.7    8e-19   
ref|XP_009768461.1|  PREDICTED: putative GATA transcription facto...  94.4    1e-18   
ref|XP_010049743.1|  PREDICTED: GATA transcription factor 21          90.9    2e-17   
ref|XP_002279283.1|  PREDICTED: putative GATA transcription facto...  86.7    5e-16   Vitis vinifera
ref|XP_011093726.1|  PREDICTED: putative GATA transcription facto...  84.7    3e-15   
ref|XP_002514107.1|  hypothetical protein RCOM_1046780                84.3    4e-15   Ricinus communis
ref|XP_008780491.1|  PREDICTED: putative GATA transcription facto...  82.0    6e-15   
ref|XP_006451458.1|  hypothetical protein CICLE_v10009004mg           83.6    6e-15   
gb|KDO57760.1|  hypothetical protein CISIN_1g021859mg                 83.6    6e-15   
ref|XP_006353530.1|  PREDICTED: putative GATA transcription facto...  83.6    8e-15   
ref|XP_004251667.1|  PREDICTED: putative GATA transcription facto...  83.2    1e-14   
ref|XP_004287558.1|  PREDICTED: uncharacterized protein LOC101297577  83.2    2e-14   
ref|XP_010915216.1|  PREDICTED: putative GATA transcription facto...  82.0    2e-14   
emb|CAN63090.1|  hypothetical protein VITISV_032017                   80.5    2e-14   Vitis vinifera
gb|KEH32529.1|  GATA type zinc finger transcription factor family...  82.4    2e-14   
gb|EYU28412.1|  hypothetical protein MIMGU_mgv1a024876mg              79.3    3e-14   
ref|XP_010925416.1|  PREDICTED: putative GATA transcription facto...  80.9    4e-14   
gb|EYU27295.1|  hypothetical protein MIMGU_mgv1a020800mg              81.3    5e-14   
ref|XP_006600457.1|  PREDICTED: GATA transcription factor 21-like...  79.7    2e-13   
ref|XP_003550634.1|  PREDICTED: GATA transcription factor 21-like...  80.1    2e-13   
ref|XP_003543725.1|  PREDICTED: GATA transcription factor 21-like     79.7    2e-13   
gb|KHN06609.1|  GATA transcription factor 21                          79.3    2e-13   
ref|XP_007138732.1|  hypothetical protein PHAVU_009G232700g           79.0    3e-13   
gb|KDP33828.1|  hypothetical protein JCGZ_07399                       79.0    3e-13   
ref|XP_006346565.1|  PREDICTED: GATA transcription factor 21-like     77.0    4e-13   
gb|EEC80836.1|  hypothetical protein OsI_23438                        73.6    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004507931.1|  PREDICTED: GATA transcription factor 21-like     77.4    6e-13   
ref|XP_004243958.1|  PREDICTED: GATA transcription factor 21          77.0    8e-13   
ref|XP_009381174.1|  PREDICTED: GATA transcription factor 21-like...  76.6    9e-13   
emb|CDX94365.1|  BnaC01g18190D                                        78.2    1e-12   
gb|KHG09089.1|  Putative GATA transcription factor 22 -like protein   77.4    1e-12   
ref|XP_010090039.1|  Putative GATA transcription factor 22            77.8    1e-12   
ref|XP_009142013.1|  PREDICTED: putative GATA transcription facto...  78.2    1e-12   
emb|CDX89358.1|  BnaA01g15350D                                        77.8    1e-12   
ref|XP_002869626.1|  zinc finger family protein                       77.4    2e-12   
ref|NP_194345.1|  putative GATA transcription factor 22               77.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32891.1|  BnaC09g33380D                                        77.8    2e-12   
ref|XP_008793253.1|  PREDICTED: putative GATA transcription facto...  76.3    2e-12   
ref|XP_009381173.1|  PREDICTED: putative GATA transcription facto...  77.0    2e-12   
ref|XP_010448318.1|  PREDICTED: putative GATA transcription facto...  77.4    2e-12   
ref|XP_008645645.1|  PREDICTED: putative GATA transcription facto...  77.4    2e-12   
ref|XP_002866169.1|  hypothetical protein ARALYDRAFT_495776           77.4    2e-12   
ref|XP_010539131.1|  PREDICTED: GATA transcription factor 21          76.6    2e-12   
gb|EPS60442.1|  hypothetical protein M569_14364                       73.9    2e-12   
ref|NP_200497.1|  GATA transcription factor 21                        77.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433543.1|  PREDICTED: putative GATA transcription facto...  77.0    2e-12   
ref|XP_009120195.1|  PREDICTED: GATA transcription factor 21-like     77.4    2e-12   
ref|XP_010438794.1|  PREDICTED: putative GATA transcription facto...  77.0    2e-12   
ref|XP_006401276.1|  hypothetical protein EUTSA_v10013793mg           77.4    2e-12   
gb|AAL38250.1|  unknown protein                                       77.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393645.1|  PREDICTED: putative GATA transcription facto...  77.0    3e-12   
ref|XP_002516445.1|  conserved hypothetical protein                   74.3    3e-12   Ricinus communis
ref|XP_007136825.1|  hypothetical protein PHAVU_009G077500g           75.1    3e-12   
ref|XP_007203151.1|  hypothetical protein PRUPE_ppa024374mg           75.9    3e-12   
ref|XP_003546455.1|  PREDICTED: putative GATA transcription facto...  76.3    3e-12   
ref|XP_006283991.1|  hypothetical protein CARUB_v10005113mg           76.6    3e-12   
ref|XP_009361893.1|  PREDICTED: putative GATA transcription facto...  76.6    3e-12   
ref|NP_001280882.1|  transcription factor GATA-5                      76.6    3e-12   
ref|XP_009352650.1|  PREDICTED: GATA transcription factor 21-like...  76.6    4e-12   
ref|XP_010443344.1|  PREDICTED: GATA transcription factor 21-like     76.6    4e-12   
ref|XP_010451548.1|  PREDICTED: GATA transcription factor 21          76.6    4e-12   
ref|XP_008242340.1|  PREDICTED: GATA transcription factor 21          75.9    5e-12   
emb|CDX88593.1|  BnaA03g10560D                                        76.3    5e-12   
ref|XP_009132168.1|  PREDICTED: GATA transcription factor 21-like     76.3    5e-12   
ref|XP_010925019.1|  PREDICTED: putative GATA transcription facto...  75.1    6e-12   
gb|KDO80097.1|  hypothetical protein CISIN_1g020987mg                 73.9    7e-12   
ref|XP_010049197.1|  PREDICTED: putative GATA transcription facto...  75.1    8e-12   
gb|KHN29722.1|  Putative GATA transcription factor 22                 73.2    8e-12   
ref|XP_007012845.1|  GATA type zinc finger transcription factor f...  74.7    8e-12   
ref|XP_006475929.1|  PREDICTED: GATA transcription factor 21-like...  74.3    1e-11   
ref|XP_006475930.1|  PREDICTED: GATA transcription factor 21-like...  74.3    1e-11   
ref|XP_010097066.1|  Putative GATA transcription factor 22            75.1    1e-11   
ref|XP_007012281.1|  GATA type zinc finger transcription factor f...  74.3    1e-11   
ref|XP_004135818.1|  PREDICTED: putative GATA transcription facto...  74.7    1e-11   
ref|XP_006450836.1|  hypothetical protein CICLE_v10008943mg           74.7    1e-11   
emb|CDY65439.1|  BnaCnng47160D                                        75.1    1e-11   
ref|XP_008797761.1|  PREDICTED: putative GATA transcription facto...  72.4    1e-11   
ref|XP_006450837.1|  hypothetical protein CICLE_v10008943mg           74.7    1e-11   
ref|XP_004141424.1|  PREDICTED: GATA transcription factor 21-like     73.9    1e-11   
gb|KDP34100.1|  hypothetical protein JCGZ_07671                       74.3    1e-11   
gb|KHN35841.1|  Putative GATA transcription factor 22                 74.3    1e-11   
dbj|BAJ91968.1|  predicted protein                                    74.7    1e-11   
ref|NP_001281002.1|  endothelial transcription factor GATA-2          74.3    2e-11   
ref|XP_004951451.1|  PREDICTED: putative GATA transcription facto...  74.3    2e-11   
ref|XP_008450852.1|  PREDICTED: GATA transcription factor 21          74.3    2e-11   
ref|XP_011019465.1|  PREDICTED: putative GATA transcription facto...  73.9    2e-11   
ref|XP_002308561.2|  hypothetical protein POPTR_0006s24560g           73.9    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010667257.1|  PREDICTED: putative GATA transcription facto...  73.9    2e-11   
gb|AGU42761.1|  GATA nirate-inducible carbon-metabolism involved ...  73.9    2e-11   
ref|XP_008452719.1|  PREDICTED: GATA transcription factor 21-like     74.7    2e-11   
ref|NP_001057917.1|  Os06g0571800                                     74.3    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ACG27673.1|  GATA transcription factor 20                          74.3    2e-11   Zea mays [maize]
ref|XP_006656178.1|  PREDICTED: putative GATA transcription facto...  74.3    2e-11   
ref|NP_001130465.1|  uncharacterized protein LOC100191563             74.3    2e-11   Zea mays [maize]
ref|XP_010047576.1|  PREDICTED: GATA transcription factor 21-like     73.6    2e-11   
ref|XP_002453545.1|  hypothetical protein SORBIDRAFT_04g007750        74.3    2e-11   Sorghum bicolor [broomcorn]
ref|XP_010942001.1|  PREDICTED: putative GATA transcription facto...  73.2    3e-11   
gb|EEE65910.1|  hypothetical protein OsJ_21757                        74.3    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KGN55332.1|  hypothetical protein Csa_4G646060                     74.3    3e-11   
ref|XP_006578078.1|  PREDICTED: putative GATA transcription facto...  73.2    3e-11   
ref|XP_010483172.1|  PREDICTED: GATA transcription factor 21-like     73.9    3e-11   
gb|EEC80838.1|  hypothetical protein OsI_23440                        73.9    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006648462.1|  PREDICTED: putative GATA transcription facto...  73.6    3e-11   
ref|XP_002437185.1|  hypothetical protein SORBIDRAFT_10g022580        73.9    3e-11   Sorghum bicolor [broomcorn]
gb|AIB05542.1|  C2C2-GATA transcription factor                        73.9    4e-11   
gb|AFW87011.1|  GATA transcription factor 20                          73.9    4e-11   
ref|XP_010656197.1|  PREDICTED: GATA transcription factor 21 isof...  72.8    4e-11   
ref|XP_002282173.1|  PREDICTED: GATA transcription factor 21 isof...  72.8    4e-11   Vitis vinifera
ref|XP_006450838.1|  hypothetical protein CICLE_v10008968mg           72.8    5e-11   
ref|XP_006450839.1|  hypothetical protein CICLE_v10008968mg           72.8    5e-11   
ref|XP_009409597.1|  PREDICTED: putative GATA transcription facto...  71.2    5e-11   
ref|XP_009388677.1|  PREDICTED: putative GATA transcription facto...  72.4    6e-11   
ref|XP_007161012.1|  hypothetical protein PHAVU_001G035600g           72.0    6e-11   
ref|XP_009126922.1|  PREDICTED: GATA transcription factor 21-like     73.2    6e-11   
gb|AFK36651.1|  unknown                                               70.9    7e-11   
ref|XP_010262144.1|  PREDICTED: putative GATA transcription facto...  72.4    7e-11   
emb|CDY67979.1|  BnaC02g44480D                                        73.2    7e-11   
dbj|BAJ92108.1|  predicted protein                                    72.8    7e-11   
gb|KHN37033.1|  Putative GATA transcription factor 22                 71.6    8e-11   
ref|XP_004966043.1|  PREDICTED: putative GATA transcription facto...  72.4    8e-11   
ref|XP_003563721.1|  PREDICTED: GATA transcription factor 21-like     72.4    8e-11   
ref|XP_009398824.1|  PREDICTED: putative GATA transcription facto...  71.2    1e-10   
ref|XP_006413221.1|  hypothetical protein EUTSA_v10025461mg           72.4    1e-10   
ref|XP_006601232.1|  PREDICTED: putative GATA transcription facto...  71.6    1e-10   
ref|XP_006280600.1|  hypothetical protein CARUB_v10026556mg           72.4    1e-10   
ref|XP_007154661.1|  hypothetical protein PHAVU_003G137100g           71.6    1e-10   
ref|XP_008377680.1|  PREDICTED: GATA transcription factor 21-like     72.0    1e-10   
ref|XP_010242203.1|  PREDICTED: GATA transcription factor 21-like     71.2    1e-10   
ref|XP_004498890.1|  PREDICTED: putative GATA transcription facto...  70.9    1e-10   
ref|XP_011010724.1|  PREDICTED: putative GATA transcription facto...  71.2    2e-10   
ref|XP_003545375.1|  PREDICTED: putative GATA transcription facto...  71.2    2e-10   
gb|ABK96296.1|  unknown                                               71.2    2e-10   Populus trichocarpa x Populus deltoides
ref|XP_002275498.1|  PREDICTED: GATA transcription factor 16          68.6    2e-10   Vitis vinifera
ref|XP_006842678.1|  hypothetical protein AMTR_s00147p00053080        69.3    2e-10   
ref|XP_008645644.1|  PREDICTED: putative GATA transcription facto...  71.6    2e-10   
emb|CDY42753.1|  BnaA03g47860D                                        71.2    2e-10   
emb|CDY42752.1|  BnaA03g47870D                                        71.2    2e-10   
ref|XP_009137582.1|  PREDICTED: putative GATA transcription facto...  71.2    2e-10   
ref|XP_008800908.1|  PREDICTED: GATA transcription factor 16-like     68.9    2e-10   
emb|CDX87024.1|  BnaC09g03390D                                        67.0    3e-10   
ref|XP_003571121.1|  PREDICTED: putative GATA transcription facto...  70.9    3e-10   
ref|XP_010931703.1|  PREDICTED: GATA transcription factor 15-like...  67.8    3e-10   
ref|XP_009361595.1|  PREDICTED: GATA transcription factor 21          70.9    3e-10   
emb|CDY67546.1|  BnaAnng24640D                                        70.9    3e-10   
ref|XP_009349759.1|  PREDICTED: GATA transcription factor 21-like     70.5    3e-10   
gb|ACJ84046.1|  unknown                                               70.1    4e-10   Medicago truncatula
gb|KDO71821.1|  hypothetical protein CISIN_1g0321122mg                67.4    4e-10   
ref|XP_003588994.1|  GATA transcription factor                        70.1    4e-10   
ref|XP_006419440.1|  hypothetical protein CICLE_v10006161mg           67.4    4e-10   
ref|XP_008797400.1|  PREDICTED: GATA transcription factor 15-like     67.0    5e-10   
gb|AAQ54534.1|  putative GATA-type zinc finger protein                66.2    5e-10   Malus domestica [apple tree]
gb|KHG14878.1|  GATA transcription factor 15 -like protein            67.4    5e-10   
ref|XP_008787687.1|  PREDICTED: GATA transcription factor 16-like     68.2    5e-10   
ref|XP_010914517.1|  PREDICTED: GATA transcription factor 16-like     67.4    5e-10   
ref|XP_010094337.1|  GATA transcription factor 15                     67.0    6e-10   
gb|ABR18198.1|  unknown                                               70.1    6e-10   Picea sitchensis
ref|XP_009406488.1|  PREDICTED: GATA transcription factor 16-like     66.6    6e-10   
gb|KDP27875.1|  hypothetical protein JCGZ_18955                       66.6    6e-10   
ref|XP_010024769.1|  PREDICTED: GATA transcription factor 16          67.0    6e-10   
ref|XP_010924181.1|  PREDICTED: GATA transcription factor 16-like     67.8    6e-10   
ref|XP_006394919.1|  hypothetical protein EUTSA_v10005181mg           65.9    7e-10   
gb|EAY85043.1|  hypothetical protein OsI_06400                        69.7    7e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAJ95329.1|  predicted protein                                    67.4    7e-10   
gb|ABK96478.1|  unknown                                               69.3    7e-10   Populus trichocarpa x Populus deltoides
ref|XP_010924715.1|  PREDICTED: GATA transcription factor 23-like     67.4    7e-10   
ref|XP_008458385.1|  PREDICTED: GATA transcription factor 16-like...  66.2    7e-10   
ref|XP_003554624.1|  PREDICTED: GATA transcription factor 17-like     65.9    7e-10   
ref|XP_006577217.1|  PREDICTED: GATA transcription factor 16-like     65.1    8e-10   
ref|XP_008458384.1|  PREDICTED: GATA transcription factor 16-like...  66.6    8e-10   
ref|NP_001046316.1|  Os02g0220400                                     69.7    8e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004150081.1|  PREDICTED: GATA transcription factor 16-like     66.6    8e-10   
ref|XP_002519177.1|  GATA transcription factor, putative              66.6    8e-10   Ricinus communis
ref|XP_006371885.1|  hypothetical protein POPTR_0018s05160g           68.6    8e-10   
gb|KHN03949.1|  GATA transcription factor 16                          65.1    9e-10   
gb|EAZ22266.1|  hypothetical protein OsJ_05921                        69.3    9e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDY68751.1|  BnaAnng28230D                                        65.5    9e-10   
gb|KEH32333.1|  GATA type zinc finger transcription factor family...  66.2    1e-09   
ref|XP_002459187.1|  hypothetical protein SORBIDRAFT_03g047520        67.4    1e-09   Sorghum bicolor [broomcorn]
ref|NP_001235841.1|  uncharacterized protein LOC100527933             65.9    1e-09   
ref|XP_009795635.1|  PREDICTED: GATA transcription factor 15-like     66.2    1e-09   
ref|XP_003595135.1|  GATA transcription factor                        68.6    1e-09   
gb|AFK37729.1|  unknown                                               66.2    1e-09   
ref|XP_004292792.1|  PREDICTED: putative GATA transcription facto...  68.9    1e-09   
emb|CDY25008.1|  BnaC02g40000D                                        65.1    1e-09   
ref|XP_004971450.1|  PREDICTED: GATA transcription factor 21-like     67.0    1e-09   
emb|CDY05639.1|  BnaC02g38980D                                        65.9    1e-09   
ref|XP_008797161.1|  PREDICTED: GATA transcription factor 15-like     66.6    1e-09   
ref|XP_010670911.1|  PREDICTED: GATA transcription factor 15-like     66.2    1e-09   
gb|AFK42954.1|  unknown                                               68.2    1e-09   
ref|XP_009415717.1|  PREDICTED: GATA transcription factor 21-like     66.2    1e-09   
ref|XP_003550526.1|  PREDICTED: GATA transcription factor 16-like     65.9    2e-09   
ref|XP_002872245.1|  predicted protein                                65.5    2e-09   
ref|XP_008438922.1|  PREDICTED: GATA transcription factor 16-like     65.9    2e-09   
ref|XP_004134234.1|  PREDICTED: GATA transcription factor 16-like...  65.9    2e-09   
ref|XP_004134235.1|  PREDICTED: GATA transcription factor 16-like...  65.9    2e-09   
ref|XP_008340752.1|  PREDICTED: GATA transcription factor 15          65.5    2e-09   
ref|XP_010652224.1|  PREDICTED: GATA transcription factor 15-like     65.5    2e-09   
ref|XP_007035717.1|  GATA transcription factor 15, putative           65.9    2e-09   
ref|XP_010094010.1|  GATA transcription factor 16                     65.9    2e-09   
ref|XP_006345972.1|  PREDICTED: GATA transcription factor 17-like...  66.2    2e-09   
ref|XP_006395075.1|  hypothetical protein EUTSA_v10005103mg           65.5    2e-09   
gb|KHN03321.1|  GATA transcription factor 16                          65.1    2e-09   
ref|XP_002865725.1|  hypothetical protein ARALYDRAFT_917909           64.7    2e-09   
emb|CDY33918.1|  BnaA02g30690D                                        65.5    2e-09   
ref|XP_009369967.1|  PREDICTED: GATA transcription factor 15          65.5    2e-09   
ref|XP_009129774.1|  PREDICTED: GATA transcription factor 16-like     65.5    2e-09   
ref|XP_010043208.1|  PREDICTED: GATA transcription factor 15-like     65.5    2e-09   
ref|XP_006345974.1|  PREDICTED: GATA transcription factor 17-like...  66.2    2e-09   
ref|XP_010442389.1|  PREDICTED: GATA transcription factor 16-like     65.5    2e-09   
ref|XP_007223794.1|  hypothetical protein PRUPE_ppa013171mg           65.5    2e-09   
ref|XP_010098872.1|  GATA transcription factor 16                     65.9    2e-09   
ref|NP_199741.1|  GATA transcription factor 16                        65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378028.1|  hypothetical protein POPTR_0010s00360g           65.5    2e-09   
emb|CDO98802.1|  unnamed protein product                              65.5    2e-09   
ref|XP_007221888.1|  hypothetical protein PRUPE_ppa018120mg           68.2    2e-09   
ref|XP_010321383.1|  PREDICTED: GATA transcription factor 17-like...  66.2    2e-09   
ref|XP_006645414.1|  PREDICTED: GATA transcription factor 16-like     65.5    2e-09   
ref|XP_003565196.1|  PREDICTED: GATA transcription factor 16-like     65.5    2e-09   
ref|XP_008220473.1|  PREDICTED: GATA transcription factor 21-like     68.2    2e-09   
ref|XP_004239796.1|  PREDICTED: GATA transcription factor 17-like...  66.2    2e-09   
ref|NP_001045570.2|  Os01g0976800                                     65.1    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768393.1|  PREDICTED: GATA transcription factor 15-like...  65.9    2e-09   
ref|XP_002278369.2|  PREDICTED: GATA transcription factor 16-like     64.7    3e-09   Vitis vinifera
ref|XP_010259404.1|  PREDICTED: GATA transcription factor 15-like     65.1    3e-09   
ref|XP_009615645.1|  PREDICTED: GATA transcription factor 15-like...  65.5    3e-09   
ref|XP_009767635.1|  PREDICTED: GATA transcription factor 15-like...  65.9    3e-09   
ref|XP_009620101.1|  PREDICTED: GATA transcription factor 16-like     65.1    3e-09   
ref|XP_006858315.1|  hypothetical protein AMTR_s00064p00107710        66.6    3e-09   
ref|XP_006851118.1|  hypothetical protein AMTR_s00025p00250380        65.9    3e-09   
ref|XP_009767636.1|  PREDICTED: GATA transcription factor 15-like...  65.5    3e-09   
gb|EEC72272.1|  hypothetical protein OsI_05433                        65.1    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004508168.1|  PREDICTED: GATA transcription factor 15-like     65.1    3e-09   
emb|CDM86966.1|  unnamed protein product                              65.5    3e-09   
ref|XP_009590423.1|  PREDICTED: GATA transcription factor 15-like...  65.5    3e-09   
gb|AAM63829.1|  unknown                                               64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590421.1|  PREDICTED: GATA transcription factor 15-like...  65.5    3e-09   
ref|XP_010524724.1|  PREDICTED: GATA transcription factor 15-like     65.5    3e-09   
gb|AFK46214.1|  unknown                                               65.1    3e-09   
ref|XP_007154340.1|  hypothetical protein PHAVU_003G110400g           65.1    3e-09   
ref|NP_001051792.1|  Os03g0831200                                     64.7    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_198045.1|  GATA transcription factor 23                        64.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546999.1|  PREDICTED: GATA transcription factor 15-like     65.1    3e-09   
gb|ABK28715.1|  unknown                                               64.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563322.1|  PREDICTED: GATA transcription factor 16-like     64.7    3e-09   
ref|XP_002315462.2|  hypothetical protein POPTR_0010s00360g           64.7    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010268075.1|  PREDICTED: GATA transcription factor 16-like     64.7    3e-09   
ref|XP_006380209.1|  hypothetical protein POPTR_0008s22950g           64.7    3e-09   
gb|EPS59020.1|  hypothetical protein M569_15793                       63.5    3e-09   
ref|XP_001770111.1|  predicted protein                                65.1    3e-09   
ref|XP_010493945.1|  PREDICTED: GATA transcription factor 23-like     64.3    3e-09   
ref|XP_006650841.1|  PREDICTED: GATA transcription factor 15-like     64.7    4e-09   
ref|XP_006378027.1|  hypothetical protein POPTR_0010s00360g           64.7    4e-09   
ref|XP_011046398.1|  PREDICTED: GATA transcription factor 16-like...  64.7    4e-09   
ref|XP_010455058.1|  PREDICTED: GATA transcription factor 23-like...  64.3    4e-09   
ref|XP_009758127.1|  PREDICTED: GATA transcription factor 16-like     63.9    4e-09   
ref|XP_011000509.1|  PREDICTED: GATA transcription factor 15-like     64.3    4e-09   
ref|XP_010051898.1|  PREDICTED: GATA transcription factor 16-like     64.3    4e-09   
ref|XP_006382425.1|  zinc finger family protein                       64.7    4e-09   
ref|XP_011046399.1|  PREDICTED: GATA transcription factor 16-like...  64.7    4e-09   
ref|XP_010274656.1|  PREDICTED: GATA transcription factor 20-like     65.1    5e-09   
gb|EYU37253.1|  hypothetical protein MIMGU_mgv1a015972mg              64.3    5e-09   
gb|KDO57761.1|  hypothetical protein CISIN_1g021859mg                 65.5    5e-09   
ref|XP_009388563.1|  PREDICTED: GATA transcription factor 21-like     65.9    5e-09   
emb|CDP17234.1|  unnamed protein product                              64.7    5e-09   
ref|XP_006344726.1|  PREDICTED: GATA transcription factor 17-like     64.3    5e-09   
ref|XP_003626174.1|  GATA transcription factor                        63.9    6e-09   
ref|XP_004230282.1|  PREDICTED: GATA transcription factor 16-like     64.3    6e-09   
ref|XP_010455054.1|  PREDICTED: GATA transcription factor 23-like...  64.7    6e-09   
ref|XP_004295111.1|  PREDICTED: GATA transcription factor 15-like     64.3    6e-09   
emb|CDY60289.1|  BnaA09g52870D                                        64.7    6e-09   
ref|XP_011036926.1|  PREDICTED: GATA transcription factor 16-like     64.3    7e-09   
ref|XP_007051045.1|  GATA transcription factor 15                     63.5    7e-09   
ref|XP_006281284.1|  hypothetical protein CARUB_v10027332mg           63.9    7e-09   
ref|XP_009408225.1|  PREDICTED: GATA transcription factor 16-like     63.5    7e-09   
gb|KFK38137.1|  hypothetical protein AALP_AA3G074400                  63.5    7e-09   
ref|XP_009112489.1|  PREDICTED: GATA transcription factor 20          64.7    8e-09   
ref|XP_002886168.1|  predicted protein                                64.7    8e-09   
gb|EMS47991.1|  GATA transcription factor 17                          66.6    8e-09   
ref|XP_004252918.1|  PREDICTED: GATA transcription factor 16-like     63.9    8e-09   
emb|CDY13040.1|  BnaC07g03390D                                        64.3    9e-09   
ref|NP_179429.2|  GATA transcription factor 20                        64.7    9e-09   
gb|KGN66031.1|  hypothetical protein Csa_1G569090                     63.9    9e-09   
ref|XP_007163338.1|  hypothetical protein PHAVU_001G226500g           62.8    9e-09   
ref|XP_004173842.1|  PREDICTED: GATA transcription factor 16-like     63.9    9e-09   
ref|XP_007031095.1|  GATA transcription factor 15, putative           64.3    9e-09   
gb|EPS73261.1|  hypothetical protein M569_01500                       63.9    9e-09   
ref|XP_006349829.1|  PREDICTED: GATA transcription factor 15-like     63.9    9e-09   
ref|XP_006409160.1|  hypothetical protein EUTSA_v10022854mg           64.3    9e-09   
ref|XP_006472168.1|  PREDICTED: GATA transcription factor 15-like     63.9    9e-09   
ref|XP_010674149.1|  PREDICTED: GATA transcription factor 17          63.5    9e-09   
gb|AAD15499.1|  putative GATA-type zinc finger transcription factor   64.3    9e-09   
ref|XP_009102248.1|  PREDICTED: GATA transcription factor 20-like     64.3    1e-08   
ref|XP_006433498.1|  hypothetical protein CICLE_v10003698mg           63.9    1e-08   
ref|XP_010455053.1|  PREDICTED: GATA transcription factor 23-like...  64.3    1e-08   
ref|XP_009599707.1|  PREDICTED: GATA transcription factor 16-like     62.8    1e-08   
ref|XP_010467651.1|  PREDICTED: GATA transcription factor 20          64.3    1e-08   
ref|XP_010414258.1|  PREDICTED: GATA transcription factor 20-like     64.3    1e-08   
ref|XP_009414459.1|  PREDICTED: GATA transcription factor 16-like     63.5    1e-08   
ref|XP_006296733.1|  hypothetical protein CARUB_v10014541mg           64.7    1e-08   
emb|CDY72649.1|  BnaA07g36170D                                        64.3    1e-08   
ref|XP_010489544.1|  PREDICTED: GATA transcription factor 20-like     64.3    1e-08   
ref|XP_011100810.1|  PREDICTED: GATA transcription factor 15-like     63.5    1e-08   
ref|XP_010455057.1|  PREDICTED: GATA transcription factor 23-like...  63.9    1e-08   
ref|XP_009391010.1|  PREDICTED: GATA transcription factor 16-like     62.8    1e-08   
ref|XP_006289523.1|  hypothetical protein CARUB_v10003065mg           62.8    1e-08   
gb|EPS67845.1|  hypothetical protein M569_06930                       63.9    1e-08   
ref|XP_006363584.1|  PREDICTED: GATA transcription factor 17-like...  63.5    1e-08   
ref|XP_010482207.1|  PREDICTED: GATA transcription factor 16-like     62.8    1e-08   
emb|CBI39566.3|  unnamed protein product                              62.4    1e-08   
gb|EYU43998.1|  hypothetical protein MIMGU_mgv1a015325mg              63.2    1e-08   
ref|XP_004963593.1|  PREDICTED: GATA transcription factor 20-like     63.9    1e-08   
ref|XP_006411982.1|  hypothetical protein EUTSA_v10027520mg           63.9    1e-08   
gb|KDP23419.1|  hypothetical protein JCGZ_23252                       63.2    2e-08   
emb|CDY69687.1|  BnaAnng31200D                                        63.5    2e-08   
ref|XP_010551005.1|  PREDICTED: GATA transcription factor 23          62.0    2e-08   
ref|XP_008450587.1|  PREDICTED: GATA transcription factor 16-like...  63.2    2e-08   
gb|EPS64619.1|  hypothetical protein M569_10161                       63.2    2e-08   
gb|KCW87800.1|  hypothetical protein EUGRSUZ_A00193                   63.5    2e-08   
ref|XP_011079598.1|  PREDICTED: GATA transcription factor 15-like     62.4    2e-08   
ref|XP_004247383.1|  PREDICTED: GATA transcription factor 23-like     62.0    2e-08   
ref|XP_001773816.1|  predicted protein                                63.5    2e-08   
gb|EYU29484.1|  hypothetical protein MIMGU_mgv1a024745mg              63.9    2e-08   
emb|CDY51221.1|  BnaC09g09760D                                        63.2    2e-08   
ref|XP_004494549.1|  PREDICTED: GATA transcription factor 16-like     62.4    2e-08   
ref|XP_010432159.1|  PREDICTED: GATA transcription factor 19-like     63.5    2e-08   
gb|AAS45431.1|  At4g36620                                             63.2    2e-08   
emb|CDX72587.1|  BnaC07g46090D                                        63.5    2e-08   
ref|XP_010486203.1|  PREDICTED: GATA transcription factor 15-like     62.4    2e-08   
ref|XP_006286076.1|  hypothetical protein CARUB_v10007612mg           63.2    2e-08   
ref|XP_010925915.1|  PREDICTED: GATA transcription factor 19-like     63.9    2e-08   
gb|KHG29742.1|  GATA transcription factor 15 -like protein            62.8    2e-08   
ref|NP_195380.1|  GATA transcription factor 19                        63.2    2e-08   
ref|XP_010437327.1|  PREDICTED: GATA transcription factor 19-like     63.2    2e-08   
ref|XP_010446770.1|  PREDICTED: GATA transcription factor 19-like     63.2    3e-08   
ref|XP_010531031.1|  PREDICTED: GATA transcription factor 19-like     63.5    3e-08   
gb|KFK30283.1|  hypothetical protein AALP_AA7G241100                  63.2    3e-08   
ref|XP_002512484.1|  conserved hypothetical protein                   62.4    3e-08   
ref|XP_006466800.1|  PREDICTED: GATA transcription factor 18-like     63.5    3e-08   
ref|XP_009124673.1|  PREDICTED: GATA transcription factor 15          62.0    3e-08   
emb|CDP20385.1|  unnamed protein product                              62.0    3e-08   
ref|XP_010444297.1|  PREDICTED: GATA transcription factor 15-like     62.0    3e-08   
ref|XP_009151727.1|  PREDICTED: GATA transcription factor 16-like     61.6    3e-08   
emb|CDX90545.1|  BnaA03g42360D                                        62.0    3e-08   
ref|XP_003612004.1|  GATA transcription factor                        63.2    3e-08   
emb|CDY34933.1|  BnaA01g32640D                                        62.0    3e-08   
ref|XP_009394239.1|  PREDICTED: GATA transcription factor 18-like     63.2    3e-08   
ref|XP_006425668.1|  hypothetical protein CICLE_v10026328mg           63.5    3e-08   
gb|AAB61058.1|  contains similarity to GATA-type zinc fingers (PS...  65.1    3e-08   
gb|AAF63824.1|  hypothetical protein                                  61.6    3e-08   
ref|XP_010547468.1|  PREDICTED: GATA transcription factor 18-like     63.5    3e-08   
ref|NP_566290.1|  GATA transcription factor 15                        62.0    3e-08   
emb|CDX85400.1|  BnaC07g27110D                                        61.6    4e-08   
emb|CDP02017.1|  unnamed protein product                              63.5    4e-08   
gb|AAM61093.1|  unknown                                               61.6    4e-08   
ref|XP_004509265.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
gb|EMT31621.1|  GATA transcription factor 21                          62.0    4e-08   
ref|XP_011097106.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_009629630.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_010679730.1|  PREDICTED: GATA transcription factor 19          63.5    4e-08   
ref|XP_006407907.1|  hypothetical protein EUTSA_v10021708mg           61.6    4e-08   
ref|XP_002882490.1|  hypothetical protein ARALYDRAFT_477989           61.6    4e-08   
ref|XP_004512046.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_006346995.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_006407908.1|  hypothetical protein EUTSA_v10021708mg           61.6    4e-08   
ref|XP_008235171.1|  PREDICTED: GATA transcription factor 23-like     61.6    4e-08   
emb|CDY53079.1|  BnaC03g76690D                                        62.8    4e-08   
ref|XP_006298741.1|  hypothetical protein CARUB_v10014841mg           61.6    4e-08   
ref|XP_008805393.1|  PREDICTED: GATA transcription factor 19-like     63.5    4e-08   
ref|XP_008452087.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_011082433.1|  PREDICTED: GATA transcription factor 15-like     61.6    4e-08   
ref|XP_006646176.1|  PREDICTED: GATA transcription factor 19-like     62.0    4e-08   
ref|XP_007156047.1|  hypothetical protein PHAVU_003G253900g           63.2    4e-08   
ref|XP_004233970.1|  PREDICTED: GATA transcription factor 18-like     63.2    4e-08   
ref|XP_008800719.1|  PREDICTED: GATA transcription factor 19          63.2    4e-08   
gb|KHF98095.1|  GATA transcription factor 15 -like protein            61.2    5e-08   
ref|XP_004146553.1|  PREDICTED: GATA transcription factor 18-like     62.8    5e-08   
ref|XP_008440715.1|  PREDICTED: GATA transcription factor 18-like     62.4    5e-08   
ref|XP_009418851.1|  PREDICTED: GATA transcription factor 16-like...  61.6    5e-08   
ref|XP_004233721.1|  PREDICTED: GATA transcription factor 19          63.2    5e-08   
gb|KGN53302.1|  hypothetical protein Csa_4G046650                     63.2    5e-08   
ref|XP_006340931.1|  PREDICTED: GATA transcription factor 18-like     62.8    5e-08   
ref|XP_009410977.1|  PREDICTED: GATA transcription factor 19-like     63.2    5e-08   
ref|XP_004143515.1|  PREDICTED: GATA transcription factor 18-like     62.4    5e-08   
gb|KDP39471.1|  hypothetical protein JCGZ_05152                       62.4    5e-08   
ref|XP_007156947.1|  hypothetical protein PHAVU_002G030800g           62.8    5e-08   
ref|XP_009796257.1|  PREDICTED: GATA transcription factor 19-like     63.2    5e-08   
emb|CDY68627.1|  BnaC01g40720D                                        62.4    5e-08   
gb|KFK34335.1|  hypothetical protein AALP_AA5G131600                  63.5    5e-08   
ref|XP_008241682.1|  PREDICTED: GATA transcription factor 19-like     63.2    5e-08   
ref|XP_003519898.2|  PREDICTED: GATA transcription factor 18-like     62.8    6e-08   
ref|XP_010548965.1|  PREDICTED: GATA transcription factor 17-like     61.6    6e-08   
ref|XP_009143303.1|  PREDICTED: GATA transcription factor 19-like     62.4    6e-08   
ref|NP_001150557.1|  GATA zinc finger family protein                  62.0    6e-08   
ref|XP_011042193.1|  PREDICTED: GATA transcription factor 16-like     61.2    6e-08   
ref|XP_010548330.1|  PREDICTED: GATA transcription factor 19-like     62.4    6e-08   
ref|XP_007202952.1|  hypothetical protein PRUPE_ppa014930mg           63.2    6e-08   
ref|XP_002885174.1|  hypothetical protein ARALYDRAFT_479155           61.6    6e-08   
ref|XP_011041705.1|  PREDICTED: GATA transcription factor 16-like     61.2    6e-08   
ref|XP_006480034.1|  PREDICTED: GATA transcription factor 16-like...  60.8    6e-08   
ref|XP_002320320.2|  hypothetical protein POPTR_0014s11940g           60.8    6e-08   
ref|XP_006480033.1|  PREDICTED: GATA transcription factor 16-like...  61.2    6e-08   
ref|XP_006480035.1|  PREDICTED: GATA transcription factor 16-like...  60.8    6e-08   
gb|KDO87082.1|  hypothetical protein CISIN_1g033001mg                 60.8    6e-08   
ref|XP_003548888.1|  PREDICTED: GATA transcription factor 18-like     62.8    6e-08   
emb|CDY70754.1|  BnaAnng34860D                                        62.4    6e-08   
ref|XP_009603282.1|  PREDICTED: GATA transcription factor 19-like     63.2    6e-08   
ref|XP_009788710.1|  PREDICTED: GATA transcription factor 17-like     61.2    6e-08   
ref|XP_006444444.1|  hypothetical protein CICLE_v10022856mg           60.8    6e-08   
ref|XP_009418844.1|  PREDICTED: GATA transcription factor 16-like...  61.2    7e-08   
emb|CDX77958.1|  BnaA09g31530D                                        62.8    7e-08   
ref|XP_009371601.1|  PREDICTED: GATA transcription factor 18-like     62.8    7e-08   
ref|XP_006878595.1|  hypothetical protein AMTR_s00011p00253850        62.0    7e-08   
ref|XP_011003734.1|  PREDICTED: GATA transcription factor 18          62.8    7e-08   
ref|XP_006383192.1|  hypothetical protein POPTR_0005s12440g           62.8    7e-08   
ref|XP_009347541.1|  PREDICTED: GATA transcription factor 19-like     62.8    7e-08   
ref|XP_007046928.1|  GATA type zinc finger transcription factor f...  62.4    7e-08   
ref|XP_006406796.1|  hypothetical protein EUTSA_v10021612mg           61.6    7e-08   
ref|XP_010504756.1|  PREDICTED: GATA transcription factor 17-like     61.6    7e-08   
ref|XP_010515465.1|  PREDICTED: GATA transcription factor 18-like     63.2    7e-08   
ref|XP_006403988.1|  hypothetical protein EUTSA_v10010986mg           63.2    7e-08   
ref|XP_009340744.1|  PREDICTED: GATA transcription factor 19-like     62.8    7e-08   
ref|XP_006590690.1|  PREDICTED: GATA transcription factor 18-like     62.4    7e-08   
ref|XP_008338089.1|  PREDICTED: GATA transcription factor 18          62.8    7e-08   
ref|XP_003565832.1|  PREDICTED: GATA transcription factor 19-like     62.0    7e-08   
ref|XP_002310237.2|  MONOPOLE family protein                          62.4    7e-08   
ref|XP_002515326.1|  GATA transcription factor, putative              60.5    7e-08   
ref|XP_010254813.1|  PREDICTED: GATA transcription factor 18-like     62.4    7e-08   
ref|XP_006480036.1|  PREDICTED: GATA transcription factor 16-like...  60.5    7e-08   
ref|XP_009115764.1|  PREDICTED: GATA transcription factor 18          63.2    7e-08   
ref|XP_011025798.1|  PREDICTED: GATA transcription factor 18          62.4    7e-08   
ref|XP_006298581.1|  hypothetical protein CARUB_v10014665mg           61.6    7e-08   
ref|XP_010089034.1|  GATA transcription factor 18                     62.8    8e-08   
ref|XP_006359887.1|  PREDICTED: GATA transcription factor 23-like     60.1    8e-08   
ref|XP_008354660.1|  PREDICTED: GATA transcription factor 19-like     62.8    8e-08   
ref|XP_006444443.1|  hypothetical protein CICLE_v10022856mg           60.5    8e-08   
ref|XP_009612537.1|  PREDICTED: GATA transcription factor 17-like     60.8    8e-08   
gb|KDO87083.1|  hypothetical protein CISIN_1g033001mg                 60.5    8e-08   
ref|XP_010487559.1|  PREDICTED: GATA transcription factor 17          61.6    8e-08   
ref|XP_011099620.1|  PREDICTED: GATA transcription factor 18-like     62.4    8e-08   
ref|XP_009136565.1|  PREDICTED: GATA transcription factor 18-like     62.8    8e-08   
ref|XP_010550406.1|  PREDICTED: GATA transcription factor 18-like     62.8    8e-08   
ref|XP_010924277.1|  PREDICTED: GATA transcription factor 19          62.4    9e-08   
ref|XP_002867005.1|  zinc finger family protein                       61.6    9e-08   
dbj|BAK02107.1|  predicted protein                                    60.8    9e-08   
emb|CDY24779.1|  BnaA08g15310D                                        61.6    9e-08   
ref|XP_010263645.1|  PREDICTED: GATA transcription factor 19          62.4    9e-08   
ref|XP_010465713.1|  PREDICTED: GATA transcription factor 17-like     61.2    9e-08   
ref|XP_010551086.1|  PREDICTED: GATA transcription factor 17          61.2    9e-08   
ref|XP_010503761.1|  PREDICTED: GATA transcription factor 18-like     62.8    9e-08   
ref|XP_006291611.1|  hypothetical protein CARUB_v10017765mg           62.8    9e-08   
emb|CDX75893.1|  BnaC03g39760D                                        61.2    9e-08   
ref|XP_003569499.1|  PREDICTED: GATA transcription factor 19-like     62.0    9e-08   
ref|XP_002876050.1|  predicted protein                                62.8    9e-08   
gb|KHG03426.1|  GATA transcription factor 18 -like protein            62.0    9e-08   
ref|XP_010424892.1|  PREDICTED: GATA transcription factor 18          62.8    9e-08   
emb|CDX82388.1|  BnaA03g34330D                                        60.8    9e-08   
emb|CBI17512.3|  unnamed protein product                              62.8    1e-07   
emb|CDY09717.1|  BnaC07g33440D                                        60.8    1e-07   
emb|CDX73777.1|  BnaC08g22260D                                        62.8    1e-07   
ref|XP_007206217.1|  hypothetical protein PRUPE_ppa015310mg           60.8    1e-07   
ref|NP_566939.1|  GATA transcription factor 18                        62.8    1e-07   
gb|AAM63797.1|  transcription factor-like protein                     62.8    1e-07   
ref|XP_010649139.1|  PREDICTED: GATA transcription factor 18-like     62.0    1e-07   
emb|CAB42916.1|  transcription factor-like protein                    62.8    1e-07   
emb|CDX69237.1|  BnaC01g02160D                                        61.6    1e-07   
emb|CDY28986.1|  BnaC07g31920D                                        62.4    1e-07   
ref|XP_008245759.1|  PREDICTED: GATA transcription factor 17-like     60.8    1e-07   
ref|XP_009406295.1|  PREDICTED: GATA transcription factor 19-like     62.0    1e-07   
ref|XP_002502132.1|  predicted protein                                62.8    1e-07   
ref|XP_009109327.1|  PREDICTED: GATA transcription factor 19-like     61.2    1e-07   
ref|XP_009146054.1|  PREDICTED: GATA transcription factor 17-like     60.8    1e-07   
emb|CDM83642.1|  unnamed protein product                              61.6    1e-07   
ref|XP_006284629.1|  hypothetical protein CARUB_v10005860mg           60.8    1e-07   
emb|CDY32214.1|  BnaA01g17700D                                        60.8    1e-07   
ref|XP_006654834.1|  PREDICTED: GATA transcription factor 19-like     62.0    1e-07   
ref|XP_001752308.1|  predicted protein                                63.5    1e-07   
emb|CDX92103.1|  BnaA05g23040D                                        60.5    1e-07   
ref|XP_009146462.1|  PREDICTED: GATA transcription factor 17-like     60.8    1e-07   
ref|XP_002458269.1|  hypothetical protein SORBIDRAFT_03g030310        61.6    1e-07   
ref|XP_004969380.1|  PREDICTED: GATA transcription factor 20-like     61.6    1e-07   
ref|XP_008657512.1|  PREDICTED: GATA transcription factor 19-like     60.8    1e-07   
ref|XP_010449847.1|  PREDICTED: GATA transcription factor 17-like     60.8    1e-07   
ref|XP_008451515.1|  PREDICTED: GATA transcription factor 15-like     60.5    1e-07   
gb|ABK96226.1|  unknown                                               60.1    1e-07   
ref|XP_010434882.1|  PREDICTED: GATA transcription factor 17-like     60.8    1e-07   
ref|NP_188312.1|  GATA transcription factor 17                        60.8    1e-07   
ref|XP_002302743.2|  hypothetical protein POPTR_0002s20080g           60.1    1e-07   
emb|CDX95897.1|  BnaC05g36480D                                        60.5    1e-07   
ref|XP_003629440.1|  GATA transcription factor                        61.2    1e-07   
ref|XP_006855367.1|  hypothetical protein AMTR_s00057p00121410        60.1    1e-07   
gb|EMT09575.1|  hypothetical protein F775_43556                       60.5    1e-07   
ref|XP_002521591.1|  GATA transcription factor, putative              62.4    1e-07   
ref|XP_004289140.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...  62.8    2e-07   
emb|CDY34429.1|  BnaC01g22040D                                        60.1    2e-07   
ref|NP_001172493.1|  Os01g0662800                                     61.2    2e-07   
ref|XP_008350602.1|  PREDICTED: GATA transcription factor 16-like     60.5    2e-07   
ref|XP_002868160.1|  hypothetical protein ARALYDRAFT_329901           60.5    2e-07   
ref|XP_010265900.1|  PREDICTED: white collar 2 protein-like           61.2    2e-07   



>ref|XP_011078200.1| PREDICTED: putative GATA transcription factor 22 [Sesamum indicum]
Length=231

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 109/200 (55%), Gaps = 32/200 (16%)
 Frame = +2

Query  257  HLFLNSRSSWDNQPQLYYDSDP-QFFYPQHPKVDNNHAAN--GGSYDQ-----GPKTKAS  412
            H+F NS +    Q    Y  D  QF++PQH  +D+N+ AN  GGS  +         K +
Sbjct  38   HIFFNSAT----QDHTGYSYDRRQFYHPQH-HLDDNYGANYHGGSTCEIKNKVEGGLKLT  92

Query  413  LWRSTNCEDSNDHHTHDEGII-PVKWMSSKMRVMQKMKSSGSNRACQvatmastattitt  589
            LW+  + E+ N+    D+    PVKWMSSKMR+M KMK+  +        +  +++    
Sbjct  93   LWKKED-EEYNESIVADKSTTNPVKWMSSKMRLMHKMKNPTTTTTTDRVALKISSSATAP  151

Query  590  tvvaattttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTP  769
            T                +EDQK       S  +  SS++  S+N  PIRVCADCNTTKTP
Sbjct  152  TK---------------LEDQK--LQPSSSLETDLSSNSFPSNNNSPIRVCADCNTTKTP  194

Query  770  LWRSGPKGPKSLCNACGIRQ  829
            LWRSGPKGPKSLCNACGIRQ
Sbjct  195  LWRSGPKGPKSLCNACGIRQ  214



>ref|XP_009604300.1| PREDICTED: putative GATA transcription factor 22 [Nicotiana tomentosiformis]
Length=315

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 122/240 (51%), Gaps = 59/240 (25%)
 Frame = +2

Query  131  PFPFELSNEdhdhhhhqnhnLNFTTPNYHNVsssssahsqpsHLFLNSRSSWDNQPQL-Y  307
            PFPF L+NED+D +H      +  +PNY+  SSSSS  S     F NS +   NQ Q  Y
Sbjct  15   PFPFVLNNEDYDLNH------SLVSPNYYQASSSSSYSSSYHEFFFNSTT---NQNQTGY  65

Query  308  YDSDPQFFYPQHPKVDNNHAANGGSYDQ------GPKTKASLWRSTNCEDSNDHHTHDEG  469
            Y  D  +  P  P+VDN     GG YD       G   K +LW+    ED N++      
Sbjct  66   YHRDEYYTPPHQPEVDNE----GGLYDVEKKNKVGSGLKLTLWKR---EDKNENQNEKN-  117

Query  470  IIPVKWMSSKMRVM-QKMKSSGSNRACQvatmastattitttvvaattttattEMMKI-I  643
              PVKWMSSK++   Q +    +N +                             +K+ +
Sbjct  118  --PVKWMSSKIKASDQTILEKTTNNST---------------------------YIKLKL  148

Query  644  EDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            EDQK+  S       S+++SN+     +PIRVCADCNTTKTPLWRSGPKGPK+LCNACGI
Sbjct  149  EDQKQQPSYPLETDYSSNNSNN----NIPIRVCADCNTTKTPLWRSGPKGPKTLCNACGI  204



>emb|CDP03165.1| unnamed protein product [Coffea canephora]
Length=318

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 88/164 (54%), Gaps = 34/164 (21%)
 Frame = +2

Query  359  NHAANGGSYDQGPK----TKASLWRS-TNCEDSNDHHTHDEGIIPV--KWMSSKMRVMQK  517
            NHA   GS D   K    +K SLW++ TN   ++DH    E I PV  KW+SSK+++MQK
Sbjct  75   NHAPYTGSQDPEKKANKGSKISLWKNNTNGNQADDH----EEINPVNNKWVSSKVKLMQK  130

Query  518  MKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKRAssclesehssns  697
            M            T                        MK  ED ++  +    E  + S
Sbjct  131  MNKPDLKEITSSTTT----------------------TMKF-EDHQKQPTSASPEADNFS  167

Query  698  ssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            S++ S+ +  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  168  SNSSSNISNTPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  211



>ref|XP_009768461.1| PREDICTED: putative GATA transcription factor 22 [Nicotiana sylvestris]
Length=317

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 123/240 (51%), Gaps = 55/240 (23%)
 Frame = +2

Query  131  PFPFELSNEdhdhhhhqnhnLNFTTPNYHNVsssssahsqpsHLFLNSRSSWDNQPQL-Y  307
            PFPF L+NED+D +H      +  +P  +   SS+S++S P   F NS +   NQ Q  Y
Sbjct  15   PFPFVLNNEDYDLNH------SLVSPYNNYQPSSASSYSSPYQFFFNSTT---NQNQTGY  65

Query  308  YDSDPQFFYPQHPKVDNNHAANGGSYDQ------GPKTKASLWRSTNCEDSNDHHTHDEG  469
            Y  D  +  P  P+ DN     GGSYD       G   K +LW+       + +H +   
Sbjct  66   YHHDEYYTPPHQPEGDNE----GGSYDVEKKNKVGSGLKLTLWKR-----EDKYHENQNE  116

Query  470  IIPVKWMSSKMRVMQ--KMKSSGSNRACQvatmastattitttvvaattttattEMMKII  643
              PVKWMSSK+      +M+ + +N   ++                             +
Sbjct  117  KDPVKWMSSKINTSDGARMEKTTNNTYIKLK----------------------------L  148

Query  644  EDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            EDQK+  S        +S+S+++S+N +PIRVCADCNTTKTPLWRSGPKGPK+LCNACGI
Sbjct  149  EDQKQQPSYPLESTDYSSNSSNNSNNNIPIRVCADCNTTKTPLWRSGPKGPKTLCNACGI  208



>ref|XP_010049743.1| PREDICTED: GATA transcription factor 21 [Eucalyptus grandis]
 gb|KCW82503.1| hypothetical protein EUGRSUZ_C03895 [Eucalyptus grandis]
Length=340

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 88/164 (54%), Gaps = 13/164 (8%)
 Frame = +2

Query  338  QHPKVDNNHAANGGSYDQGPKTKASLWRSTNCEDSNDHHTHDEGIIPVKWMSSKMRVMQK  517
            QHP+  ++   + G    G     +LW+        D     +    VKWMSSKMR+M+K
Sbjct  77   QHPQEVDHKPVSQGESHGGHGLNITLWKKEEG-GVRDESDQVDKYYSVKWMSSKMRIMKK  135

Query  518  MKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKRAssclesehssns  697
            M SS  +   Q  T   T+ +I+                  +ED KR  S    E  S+S
Sbjct  136  MMSSDHHEQSQDNTPMMTSGSISAGGDHKL----------FVEDHKRLPSSSSLETDSSS  185

Query  698  ssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +S+   +N  PIRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  186  NSSSYDTN--PIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  227



>ref|XP_002279283.1| PREDICTED: putative GATA transcription factor 22 [Vitis vinifera]
 emb|CBI20665.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 92/179 (51%), Gaps = 46/179 (26%)
 Frame = +2

Query  317  DPQFFYPQHPKVDNNHAANGGSYDQGPKTKASLWRSTNCEDSNDHHTH-------DEGII  475
            DPQ    QH   D+ + ++GG  +    + +SL +    ++ + H          DEG  
Sbjct  64   DPQ----QHEDKDDKYISHGGCGESQVFSSSSLLQPMADDNKSSHKLSVFKKEEGDEGNK  119

Query  476  PV-KWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQ  652
               KWMSSKMR+M+KM +S    A                           ++ + +ED 
Sbjct  120  STEKWMSSKMRLMRKMMNSDCTTA---------------------------KIEQKVEDH  152

Query  653  KRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            ++  +  E   S+N+S+       +PIRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  153  QQWDNINEFNSSNNTSN-------IPIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  204



>ref|XP_011093726.1| PREDICTED: putative GATA transcription factor 22 [Sesamum indicum]
Length=308

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 87/179 (49%), Gaps = 57/179 (32%)
 Frame = +2

Query  323  QFFYPQHPKVDNN--HAANGGSYDQGPKTKA------SLWRSTNCEDSNDHHTHDEGI--  472
            Q ++P HP+ D++  +   GGS     K K       +LW++            DEG+  
Sbjct  67   QLYHP-HPQEDDSTTYGYRGGSSCDEMKNKVNSGLKLTLWKN-----------KDEGLAK  114

Query  473  --IPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIE  646
              IPVKWMS+KMRVMQ  K   ++R                                 + 
Sbjct  115  KDIPVKWMSTKMRVMQ--KMKNTDRIS-------------------------------VS  141

Query  647  DQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
              K+      S  +  SS++ S ++  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGI
Sbjct  142  SFKQLLQPSSSMETDLSSNSSSYNSNSPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  200



>ref|XP_002514107.1| hypothetical protein RCOM_1046780 [Ricinus communis]
 gb|EEF48061.1| hypothetical protein RCOM_1046780 [Ricinus communis]
Length=312

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 96/184 (52%), Gaps = 44/184 (24%)
 Frame = +2

Query  305  YYDSDPQFFYPQHPKVDNNHAANGGSYD-----------QGPKTKASLWRSTNCEDSNDH  451
            YY  + Q  +  H +VDN +A++G S+D           Q         +ST+ ED  D+
Sbjct  57   YYHKELQPLH--HQEVDNIYASHGRSWDHRIIKNENENGQELSVCKKEDKSTSIEDQRDN  114

Query  452  HTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEM  631
             +       VKWMSSKMR+M+KM ++                           TT  T  
Sbjct  115  SS-------VKWMSSKMRLMRKMMTTDQT----------------------VNTTQHTSS  145

Query  632  MKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCN  811
            M  +ED++++ S    +  S+ + + +S+N   IRVC+DCNTTKTPLWRSGP+GPKSLCN
Sbjct  146  MHKLEDKEKSRSLPLQDDYSSKNLSDNSNNT--IRVCSDCNTTKTPLWRSGPRGPKSLCN  203

Query  812  ACGI  823
            ACGI
Sbjct  204  ACGI  207



>ref|XP_008780491.1| PREDICTED: putative GATA transcription factor 22, partial [Phoenix 
dactylifera]
Length=202

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 73/133 (55%), Gaps = 26/133 (20%)
 Frame = +2

Query  434  EDSNDHHTHDEGI-IPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaatt  610
            E S+D     E +  P  WMSSKMR M+KM +S                           
Sbjct  30   ESSHDRCVSQEDLHGPSNWMSSKMRFMRKMMNSD-------------------------H  64

Query  611  ttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPK  790
             +     M+ ++DQ RA+    +  SS+SSS++  S    IRVC+DCNTTKTPLWRSGP+
Sbjct  65   VSKPRRNMQALQDQVRANQDRSTSSSSSSSSSNGYSPSGIIRVCSDCNTTKTPLWRSGPR  124

Query  791  GPKSLCNACGIRQ  829
            GPKSLCNACGIRQ
Sbjct  125  GPKSLCNACGIRQ  137



>ref|XP_006451458.1| hypothetical protein CICLE_v10009004mg [Citrus clementina]
 ref|XP_006475428.1| PREDICTED: putative GATA transcription factor 22-like [Citrus 
sinensis]
 gb|ESR64698.1| hypothetical protein CICLE_v10009004mg [Citrus clementina]
Length=306

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 89/184 (48%), Gaps = 45/184 (24%)
 Frame = +2

Query  302  LYYDSDPQFFYPQHPKVDNNHAANGGSYDQ-GP---------KTKASLWRSTNCEDSNDH  451
             YY       +P+  ++  + AA  GS D  GP          T   L  S+  E+ ND 
Sbjct  50   FYYRESVLLRHPKEVRILYSQAA--GSCDHPGPAVMDESGSESTGLKLSMSSEKEERNDQ  107

Query  452  HTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEM  631
            +   E    VKWMSSKMR+M+KM  S  + A                            M
Sbjct  108  N-QSENSSSVKWMSSKMRLMKKMMYSSPDAAA---------------------------M  139

Query  632  MKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCN  811
             K+ + QK+  S      + N+++N ++     IRVCADCNTTKTPLWRSGP+GPKSLCN
Sbjct  140  QKLEDHQKQPPSSSLEPDNGNNNNNTNT-----IRVCADCNTTKTPLWRSGPRGPKSLCN  194

Query  812  ACGI  823
            ACGI
Sbjct  195  ACGI  198



>gb|KDO57760.1| hypothetical protein CISIN_1g021859mg [Citrus sinensis]
Length=306

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 89/184 (48%), Gaps = 45/184 (24%)
 Frame = +2

Query  302  LYYDSDPQFFYPQHPKVDNNHAANGGSYDQ-GP---------KTKASLWRSTNCEDSNDH  451
             YY       +P+  ++  + AA  GS D  GP          T   L  S+  E+ ND 
Sbjct  50   FYYRESVLLRHPKEVRILYSQAA--GSCDHPGPAVMDESGSESTGLKLSMSSEKEERNDQ  107

Query  452  HTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEM  631
            +   E    VKWMSSKMR+M+KM  S  + A                            M
Sbjct  108  N-QSENSSSVKWMSSKMRLMKKMMYSSPDAAA---------------------------M  139

Query  632  MKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCN  811
             K+ + QK+  S      + N+++N ++     IRVCADCNTTKTPLWRSGP+GPKSLCN
Sbjct  140  QKLEDHQKQPPSSSLEPDNGNNNNNTNT-----IRVCADCNTTKTPLWRSGPRGPKSLCN  194

Query  812  ACGI  823
            ACGI
Sbjct  195  ACGI  198



>ref|XP_006353530.1| PREDICTED: putative GATA transcription factor 22-like [Solanum 
tuberosum]
Length=323

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  722  VVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            ++PIRVC+DCNTTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  152  IIPIRVCSDCNTTKTPLWRSGPKGPKSLCNACGIRQ  187



>ref|XP_004251667.1| PREDICTED: putative GATA transcription factor 22 [Solanum lycopersicum]
Length=326

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  722  VVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            ++PIRVC+DCNTTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  146  IIPIRVCSDCNTTKTPLWRSGPKGPKSLCNACGIRQ  181



>ref|XP_004287558.1| PREDICTED: uncharacterized protein LOC101297577 [Fragaria vesca 
subsp. vesca]
Length=357

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 68/119 (57%), Gaps = 16/119 (13%)
 Frame = +2

Query  473  IPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQ  652
            I VKWMSSKMR+M+KM +     +    T A+T    T  V  + +           E+Q
Sbjct  131  ISVKWMSSKMRIMRKMTNPDQTISSHNNTTAATNDGTTARVNFSASHN--------FEEQ  182

Query  653  KRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            K         H  +     SS +  PIRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  183  K--------LHPLSPLGTDSSYSTNPIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  233



>ref|XP_010915216.1| PREDICTED: putative GATA transcription factor 22 [Elaeis guineensis]
Length=285

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 31/146 (21%)
 Frame = +2

Query  395  PKTKASLWRSTNCEDSNDHHTHDEGI-IPVKWMSSKMRVMQKMKSSGSNRACQvatmast  571
            P T  + + +T  E S+D H   E +  P  WMSSKMR M+KM +S              
Sbjct  75   PVTFPTNYNNTIEESSHDRHVSQEDLHGPSNWMSSKMRFMRKMMNS--------------  120

Query  572  attitttvvaattttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADC  751
                                M+I+ED+  ++      +++N +S         IRVC+DC
Sbjct  121  -----------DHVGKPRRNMQILEDRVPSNQDRSISNNTNGNSPGGI-----IRVCSDC  164

Query  752  NTTKTPLWRSGPKGPKSLCNACGIRQ  829
            NTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  165  NTTKTPLWRSGPRGPKSLCNACGIRQ  190



>emb|CAN63090.1| hypothetical protein VITISV_032017 [Vitis vinifera]
Length=211

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 34/116 (29%)
 Frame = +2

Query  482  KWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKRA  661
            KWMSSKMR+M+KM +S    A                           ++ + +ED ++ 
Sbjct  28   KWMSSKMRLMRKMMNSDCTTA---------------------------KIEQKVEDHQQ-  59

Query  662  ssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
                    + N  ++ ++++ +PIRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  60   ------WDNINEXNSSNNTSNIPIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  109



>gb|KEH32529.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=327

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 77/146 (53%), Gaps = 32/146 (22%)
 Frame = +2

Query  398  KTKASL---WRSTNCEDS-NDHHTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatma  565
            KTK  L   W+     D  N++   D+    VKWMSSKMR+M+KM  S    +  + + +
Sbjct  98   KTKHKLTIRWKKEQISDEMNNNQEADQDGTSVKWMSSKMRIMKKMMVSDQTGSSNLTSNS  157

Query  566  stattitttvvaattttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCA  745
                                      EDQK+  S   +++SS+++ +        IRVC+
Sbjct  158  KQIK---------------------FEDQKQPLSPQGTDNSSSNNYST-------IRVCS  189

Query  746  DCNTTKTPLWRSGPKGPKSLCNACGI  823
            DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  190  DCNTTKTPLWRSGPRGPKSLCNACGI  215



>gb|EYU28412.1| hypothetical protein MIMGU_mgv1a024876mg [Erythranthe guttata]
Length=165

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            PIRVCADC+TTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  12   PIRVCADCSTTKTPLWRSGPKGPKSLCNACGIRQ  45



>ref|XP_010925416.1| PREDICTED: putative GATA transcription factor 22 [Elaeis guineensis]
Length=286

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 73/131 (56%), Gaps = 30/131 (23%)
 Frame = +2

Query  434  EDSNDHHTHDEGI-IPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaatt  610
            E S+D +   E +  P KWMSSKMR M+KM +SG                          
Sbjct  86   EPSHDRYVSQEDLHGPTKWMSSKMRFMRKMMNSG-----------------------HVI  122

Query  611  ttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPK  790
             +     M+I++DQ +++    + +SS++S +        IRVC+DCNTTKTPLWRSGP+
Sbjct  123  MSKRRTNMQILQDQGQSNQDGSTSNSSSNSPSGI------IRVCSDCNTTKTPLWRSGPR  176

Query  791  GPKSLCNACGI  823
            GPKSLCNACGI
Sbjct  177  GPKSLCNACGI  187



>gb|EYU27295.1| hypothetical protein MIMGU_mgv1a020800mg [Erythranthe guttata]
Length=315

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  166  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  199



>ref|XP_006600457.1| PREDICTED: GATA transcription factor 21-like isoform X2 [Glycine 
max]
Length=310

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 90/185 (49%), Gaps = 27/185 (15%)
 Frame = +2

Query  287  DNQPQLYYDSDPQFFYPQHPKVDNNHAANGGSYD----QGPKTKASLWRSTNCEDSNDHH  454
            D + + YY    + + P H +       + GS+D    +    KA++W+     + N   
Sbjct  40   DQEARSYYWEPTKQYLPSHEEETEKIIPSSGSWDHSVAESEHNKATVWKKAEERNENLES  99

Query  455  THDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMM  634
               E    +KWM +KMR+M+KM  S        +   +T                     
Sbjct  100  VAAEDG-SLKWMPAKMRIMRKMLVSDQTDTYTNSDNNTTHK-------------------  139

Query  635  KIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNA  814
               +DQK+  S      +S+S++  + SN   +RVC+DC+TTKTPLWRSGP+GPKSLCNA
Sbjct  140  --FDDQKQQLSSPLGTDNSSSNNYSNHSNNT-VRVCSDCHTTKTPLWRSGPRGPKSLCNA  196

Query  815  CGIRQ  829
            CGIRQ
Sbjct  197  CGIRQ  201



>ref|XP_003550634.1| PREDICTED: GATA transcription factor 21-like isoform X1 [Glycine 
max]
 gb|KHN17667.1| Putative GATA transcription factor 22 [Glycine soja]
Length=322

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 90/185 (49%), Gaps = 27/185 (15%)
 Frame = +2

Query  287  DNQPQLYYDSDPQFFYPQHPKVDNNHAANGGSYD----QGPKTKASLWRSTNCEDSNDHH  454
            D + + YY    + + P H +       + GS+D    +    KA++W+     + N   
Sbjct  52   DQEARSYYWEPTKQYLPSHEEETEKIIPSSGSWDHSVAESEHNKATVWKKAEERNENLES  111

Query  455  THDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMM  634
               E    +KWM +KMR+M+KM  S        +   +T                     
Sbjct  112  VAAEDG-SLKWMPAKMRIMRKMLVSDQTDTYTNSDNNTTHK-------------------  151

Query  635  KIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNA  814
               +DQK+  S      +S+S++  + SN   +RVC+DC+TTKTPLWRSGP+GPKSLCNA
Sbjct  152  --FDDQKQQLSSPLGTDNSSSNNYSNHSNNT-VRVCSDCHTTKTPLWRSGPRGPKSLCNA  208

Query  815  CGIRQ  829
            CGIRQ
Sbjct  209  CGIRQ  213



>ref|XP_003543725.1| PREDICTED: GATA transcription factor 21-like [Glycine max]
Length=314

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 84/183 (46%), Gaps = 31/183 (17%)
 Frame = +2

Query  290  NQPQLYYDSDPQFFYPQHPKVDNNHAANGGSYDQGPKT---KASLWRSTNCEDSNDHHTH  460
            +Q    YD +     P H +         GS+    +    K ++WR    E+ N++   
Sbjct  53   DQEARSYDWETTKHLPSHEEEAEKIIPTSGSWGHSVEESEHKVTVWRK---EERNENLAE  109

Query  461  DEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKI  640
            D     VKWM SKMR+M+KM  S    A       +                        
Sbjct  110  DGS---VKWMPSKMRIMRKMLVSNQTDAYTSDNNTTHK----------------------  144

Query  641  IEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACG  820
             +D K+  S       ++S++    SN   +RVC+DC+TTKTPLWRSGP+GPKSLCNACG
Sbjct  145  FDDHKQQLSSPLGIDDNSSNNYSDKSNNSIVRVCSDCHTTKTPLWRSGPRGPKSLCNACG  204

Query  821  IRQ  829
            IRQ
Sbjct  205  IRQ  207



>gb|KHN06609.1| GATA transcription factor 21 [Glycine soja]
Length=314

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 72/142 (51%), Gaps = 28/142 (20%)
 Frame = +2

Query  404  KASLWRSTNCEDSNDHHTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastatti  583
            K ++WR    E+ N++   D     VKWM SKMR+M+KM  S    A       +     
Sbjct  94   KVTVWRK---EERNENLAEDGS---VKWMPSKMRIMRKMLVSNQTDAYTSDNNTTHK---  144

Query  584  tttvvaattttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTK  763
                                +D K+  S       ++S++    SN   +RVC+DC+TTK
Sbjct  145  -------------------FDDHKQQLSSPLGIDDNSSNNYSDKSNNSIVRVCSDCHTTK  185

Query  764  TPLWRSGPKGPKSLCNACGIRQ  829
            TPLWRSGP+GPKSLCNACGIRQ
Sbjct  186  TPLWRSGPRGPKSLCNACGIRQ  207



>ref|XP_007138732.1| hypothetical protein PHAVU_009G232700g [Phaseolus vulgaris]
 gb|ESW10726.1| hypothetical protein PHAVU_009G232700g [Phaseolus vulgaris]
Length=306

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            VP+RVC DC+TTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  161  VPLRVCVDCHTTKTPLWRSGPKGPKSLCNACGIRQ  195



>gb|KDP33828.1| hypothetical protein JCGZ_07399 [Jatropha curcas]
Length=305

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 69/115 (60%), Gaps = 26/115 (23%)
 Frame = +2

Query  479  VKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKR  658
            VKWMSSKMR+M+KM SS    +                             +   E++K 
Sbjct  112  VKWMSSKMRLMRKMMSSDQMES--------------------------NNYVHKFEEKKD  145

Query  659  AssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
             SS L+ ++SS + SN++++N   IRVCADCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  146  RSSPLQDDNSSKNFSNNNNNNNNSIRVCADCNTTKTPLWRSGPRGPKSLCNACGI  200



>ref|XP_006346565.1| PREDICTED: GATA transcription factor 21-like [Solanum tuberosum]
Length=222

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +PIRVC DCNTTKTPLWRSGPKGPKSLCNACGI
Sbjct  84   IPIRVCTDCNTTKTPLWRSGPKGPKSLCNACGI  116



>gb|EEC80836.1| hypothetical protein OsI_23438 [Oryza sativa Indica Group]
Length=66

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  8    IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  40



>ref|XP_004507931.1| PREDICTED: GATA transcription factor 21-like [Cicer arietinum]
Length=266

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTTKTPLWRSGPKGPK+LCNACGIRQ
Sbjct  127  VRVCSDCNTTKTPLWRSGPKGPKTLCNACGIRQ  159



>ref|XP_004243958.1| PREDICTED: GATA transcription factor 21 [Solanum lycopersicum]
Length=266

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +PIRVC DCNTTKTPLWRSGPKGPKSLCNACGI
Sbjct  132  IPIRVCTDCNTTKTPLWRSGPKGPKSLCNACGI  164



>ref|XP_009381174.1| PREDICTED: GATA transcription factor 21-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 67/131 (51%), Gaps = 29/131 (22%)
 Frame = +2

Query  446  DHHTHDEGIIPVK---WMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaatttt  616
            D +  +EG++  +   WMSSKMR M+KM +S                          +  
Sbjct  30   DPYVTEEGVVADRAGQWMSSKMRFMRKMMNS---------------------SHIVVSKQ  68

Query  617  attEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGP  796
                M    +DQ R+     S  + +++S         IRVC+DCNTTKTPLWRSGP+GP
Sbjct  69   PRGSMRITPDDQSRSHRLGYSGSNRSNNSPSGI-----IRVCSDCNTTKTPLWRSGPRGP  123

Query  797  KSLCNACGIRQ  829
            KSLCNACGIRQ
Sbjct  124  KSLCNACGIRQ  134



>emb|CDX94365.1| BnaC01g18190D [Brassica napus]
Length=360

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  195  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  227



>gb|KHG09089.1| Putative GATA transcription factor 22 -like protein [Gossypium 
arboreum]
Length=305

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVCADCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  171  IRVCADCNTTKTPLWRSGPRGPKSLCNACGIRQ  203



>ref|XP_010090039.1| Putative GATA transcription factor 22 [Morus notabilis]
 gb|EXB38836.1| Putative GATA transcription factor 22 [Morus notabilis]
Length=335

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVCADCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  197  IRVCADCNTTKTPLWRSGPRGPKSLCNACGIRQ  229



>ref|XP_009142013.1| PREDICTED: putative GATA transcription factor 22 [Brassica rapa]
Length=360

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  195  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  227



>emb|CDX89358.1| BnaA01g15350D [Brassica napus]
Length=360

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  195  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  227



>ref|XP_002869626.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45885.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=347

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  190  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  222



>ref|NP_194345.1| putative GATA transcription factor 22 [Arabidopsis thaliana]
 sp|Q9SZI6.1|GAT22_ARATH RecName: Full=Putative GATA transcription factor 22 [Arabidopsis 
thaliana]
 emb|CAB39680.1| putative transcription factor [Arabidopsis thaliana]
 emb|CAB79470.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE85164.1| putative GATA transcription factor 22 [Arabidopsis thaliana]
Length=352

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  198  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  230



>emb|CDY32891.1| BnaC09g33380D [Brassica napus]
Length=388

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  222  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  254



>ref|XP_008793253.1| PREDICTED: putative GATA transcription factor 22 [Phoenix dactylifera]
Length=287

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 64/116 (55%), Gaps = 30/116 (26%)
 Frame = +2

Query  476  PVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQK  655
            P KWM SKMR M+KM +SG +   +                           M+I++D+ 
Sbjct  106  PGKWMPSKMRFMRKMMNSGHDIMSKTRRN-----------------------MQILQDRG  142

Query  656  RAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            + SS     +SSNS S         IRVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  143  QDSSTSMRNNSSNSPSGI-------IRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  191



>ref|XP_009381173.1| PREDICTED: putative GATA transcription factor 22 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=336

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 67/131 (51%), Gaps = 29/131 (22%)
 Frame = +2

Query  446  DHHTHDEGIIPVK---WMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaatttt  616
            D +  +EG++  +   WMSSKMR M+KM +S                          +  
Sbjct  120  DPYVTEEGVVADRAGQWMSSKMRFMRKMMNSS---------------------HIVVSKQ  158

Query  617  attEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGP  796
                M    +DQ R+     S  + +++S         IRVC+DCNTTKTPLWRSGP+GP
Sbjct  159  PRGSMRITPDDQSRSHRLGYSGSNRSNNSPSGI-----IRVCSDCNTTKTPLWRSGPRGP  213

Query  797  KSLCNACGIRQ  829
            KSLCNACGIRQ
Sbjct  214  KSLCNACGIRQ  224



>ref|XP_010448318.1| PREDICTED: putative GATA transcription factor 22 [Camelina sativa]
Length=364

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  214  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  246



>ref|XP_008645645.1| PREDICTED: putative GATA transcription factor 22 isoform X2 [Zea 
mays]
 gb|AFW71315.1| hypothetical protein ZEAMMB73_375168 [Zea mays]
 gb|AIB05541.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=370

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            V +RVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  186  VVVRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  220



>ref|XP_002866169.1| hypothetical protein ARALYDRAFT_495776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42428.1| hypothetical protein ARALYDRAFT_495776 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  226  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  258



>ref|XP_010539131.1| PREDICTED: GATA transcription factor 21 [Tarenaya hassleriana]
Length=319

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  186  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  218



>gb|EPS60442.1| hypothetical protein M569_14364 [Genlisea aurea]
Length=144

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVCADC+TTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  55   RVCADCSTTKTPLWRSGPKGPKSLCNACGIRQ  86



>ref|NP_200497.1| GATA transcription factor 21 [Arabidopsis thaliana]
 sp|Q5HZ36.2|GAT21_ARATH RecName: Full=GATA transcription factor 21 [Arabidopsis thaliana]
 dbj|BAA97205.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABG25059.1| At5g56860 [Arabidopsis thaliana]
 gb|AED96815.1| GATA transcription factor 21 [Arabidopsis thaliana]
Length=398

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  229  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  261



>ref|XP_010433543.1| PREDICTED: putative GATA transcription factor 22 [Camelina sativa]
Length=362

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  214  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  246



>ref|XP_009120195.1| PREDICTED: GATA transcription factor 21-like [Brassica rapa]
 emb|CDY32755.1| BnaA10g10940D [Brassica napus]
Length=387

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  221  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  253



>ref|XP_010438794.1| PREDICTED: putative GATA transcription factor 22 [Camelina sativa]
Length=362

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  214  IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  246



>ref|XP_006401276.1| hypothetical protein EUTSA_v10013793mg [Eutrema salsugineum]
 gb|ESQ42729.1| hypothetical protein EUTSA_v10013793mg [Eutrema salsugineum]
Length=384

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  224  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  256



>gb|AAL38250.1| unknown protein [Arabidopsis thaliana]
Length=398

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  229  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  261



>ref|XP_008393645.1| PREDICTED: putative GATA transcription factor 22 [Malus domestica]
Length=358

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 66/117 (56%), Gaps = 20/117 (17%)
 Frame = +2

Query  479  VKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKR  658
            VKWMSSKMR+MQKM +     A             TT          T    ++++ Q+ 
Sbjct  152  VKWMSSKMRLMQKMTNPDLALA------------GTTKNYVLAAAEITEHKFQVVQYQEN  199

Query  659  AssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +     S +S+N++ +        +RVC+DCNT+ TPLWRSGP+GPKSLCNACGIRQ
Sbjct  200  SDETSFSRNSNNTTPD--------VRVCSDCNTSTTPLWRSGPRGPKSLCNACGIRQ  248



>ref|XP_002516445.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45786.1| conserved hypothetical protein [Ricinus communis]
Length=186

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  54   IRVCSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  86



>ref|XP_007136825.1| hypothetical protein PHAVU_009G077500g, partial [Phaseolus vulgaris]
 gb|ESW08819.1| hypothetical protein PHAVU_009G077500g, partial [Phaseolus vulgaris]
Length=225

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVCADCNTT TPLWRSGP GPKSLCNACGIRQ
Sbjct  91   IRVCADCNTTSTPLWRSGPNGPKSLCNACGIRQ  123



>ref|XP_007203151.1| hypothetical protein PRUPE_ppa024374mg [Prunus persica]
 gb|EMJ04350.1| hypothetical protein PRUPE_ppa024374mg [Prunus persica]
Length=297

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  147  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  179



>ref|XP_003546455.1| PREDICTED: putative GATA transcription factor 22-like [Glycine 
max]
 gb|KHN24612.1| Putative GATA transcription factor 22 [Glycine soja]
Length=315

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            + +RVC+DC+TTKTPLWRSGPKGPKSLCNACGIRQ
Sbjct  171  ITVRVCSDCHTTKTPLWRSGPKGPKSLCNACGIRQ  205



>ref|XP_006283991.1| hypothetical protein CARUB_v10005113mg [Capsella rubella]
 gb|EOA16889.1| hypothetical protein CARUB_v10005113mg [Capsella rubella]
Length=361

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  216  VRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  248



>ref|XP_009361893.1| PREDICTED: putative GATA transcription factor 22 [Pyrus x bretschneideri]
Length=353

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 65/117 (56%), Gaps = 20/117 (17%)
 Frame = +2

Query  479  VKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKR  658
            VKWMSSKMR+MQKM +     A             TT               ++++ Q+ 
Sbjct  152  VKWMSSKMRLMQKMTNPDLAPA------------GTTENHILAAAENAEHKFQVVQHQEN  199

Query  659  AssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +     S +S+N++ +        +RVC+DCNT+ TPLWRSGP+GPKSLCNACGIRQ
Sbjct  200  SDETSFSRNSNNTTPD--------VRVCSDCNTSTTPLWRSGPRGPKSLCNACGIRQ  248



>ref|NP_001280882.1| transcription factor GATA-5 [Malus domestica]
 gb|ADL36695.1| GATA domain class transcription factor [Malus domestica]
Length=359

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  208  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  240



>ref|XP_009352650.1| PREDICTED: GATA transcription factor 21-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009352651.1| PREDICTED: GATA transcription factor 21-like isoform X2 [Pyrus 
x bretschneideri]
Length=359

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  208  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  240



>ref|XP_010443344.1| PREDICTED: GATA transcription factor 21-like [Camelina sativa]
Length=396

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  226  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  258



>ref|XP_010451548.1| PREDICTED: GATA transcription factor 21 [Camelina sativa]
Length=396

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  226  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  258



>ref|XP_008242340.1| PREDICTED: GATA transcription factor 21 [Prunus mume]
Length=335

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  185  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  217



>emb|CDX88593.1| BnaA03g10560D [Brassica napus]
Length=355

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC++CNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  193  IRVCSNCNTTKTPLWRSGPRGPKSLCNACGIRQ  225



>ref|XP_009132168.1| PREDICTED: GATA transcription factor 21-like [Brassica rapa]
Length=384

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC++CNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  222  IRVCSNCNTTKTPLWRSGPRGPKSLCNACGIRQ  254



>ref|XP_010925019.1| PREDICTED: putative GATA transcription factor 22 [Elaeis guineensis]
Length=286

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DC+TTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  160  IRVCSDCSTTKTPLWRSGPQGPKSLCNACGIRQ  192



>gb|KDO80097.1| hypothetical protein CISIN_1g020987mg [Citrus sinensis]
Length=232

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  92   VRICSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  124



>ref|XP_010049197.1| PREDICTED: putative GATA transcription factor 22 [Eucalyptus 
grandis]
 gb|KCW81694.1| hypothetical protein EUGRSUZ_C03048 [Eucalyptus grandis]
Length=321

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 61/117 (52%), Gaps = 28/117 (24%)
 Frame = +2

Query  479  VKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQKR  658
            +KWM  KMR++QKMK++                            +   E M+ +++  +
Sbjct  123  IKWMPLKMRILQKMKNTTYGNG-----------------------STEDESMQFVDEFAK  159

Query  659  AssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
                 +      SS+ +++     IRVC DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  160  NHHRQDRTEIRFSSNGNNA-----IRVCTDCNTTTTPLWRSGPRGPKSLCNACGIRQ  211



>gb|KHN29722.1| Putative GATA transcription factor 22, partial [Glycine soja]
Length=201

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVCADCNTT TPLWRSGP GPKSLCNACGIRQ
Sbjct  62   RVCADCNTTSTPLWRSGPNGPKSLCNACGIRQ  93



>ref|XP_007012845.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY30464.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
Length=302

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            + IRVCADCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  166  ITIRVCADCNTTKTPLWRSGPRGPKSLCNACGI  198



>ref|XP_006475929.1| PREDICTED: GATA transcription factor 21-like isoform X3 [Citrus 
sinensis]
 gb|KDO80096.1| hypothetical protein CISIN_1g020987mg [Citrus sinensis]
Length=278

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  138  VRICSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  170



>ref|XP_006475930.1| PREDICTED: GATA transcription factor 21-like isoform X4 [Citrus 
sinensis]
Length=275

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  135  VRICSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  167



>ref|XP_010097066.1| Putative GATA transcription factor 22 [Morus notabilis]
 gb|EXB66867.1| Putative GATA transcription factor 22 [Morus notabilis]
Length=333

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  174  VRVCSDCNTTSTPLWRSGPRGPKSLCNACGIRQ  206



>ref|XP_007012281.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
 gb|EOY29900.1| GATA type zinc finger transcription factor family protein, putative 
[Theobroma cacao]
Length=311

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  174  VRVCSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  206



>ref|XP_004135818.1| PREDICTED: putative GATA transcription factor 22-like [Cucumis 
sativus]
 ref|XP_004158464.1| PREDICTED: putative GATA transcription factor 22-like [Cucumis 
sativus]
 gb|KGN66237.1| hypothetical protein Csa_1G587970 [Cucumis sativus]
Length=325

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  187  IRTCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  219



>ref|XP_006450836.1| hypothetical protein CICLE_v10008943mg [Citrus clementina]
 ref|XP_006475928.1| PREDICTED: GATA transcription factor 21-like isoform X2 [Citrus 
sinensis]
 gb|ESR64076.1| hypothetical protein CICLE_v10008943mg [Citrus clementina]
 gb|KDO80095.1| hypothetical protein CISIN_1g020987mg [Citrus sinensis]
Length=316

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  176  VRICSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  208



>emb|CDY65439.1| BnaCnng47160D [Brassica napus]
Length=384

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC++CNTTKTPLWRSGP+GPK+LCNACGIRQ
Sbjct  222  IRVCSNCNTTKTPLWRSGPRGPKTLCNACGIRQ  254



>ref|XP_008797761.1| PREDICTED: putative GATA transcription factor 22 [Phoenix dactylifera]
Length=176

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC++C+TTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  48   IRVCSNCSTTKTPLWRSGPQGPKSLCNACGIRQ  80



>ref|XP_006450837.1| hypothetical protein CICLE_v10008943mg [Citrus clementina]
 ref|XP_006475927.1| PREDICTED: GATA transcription factor 21-like isoform X1 [Citrus 
sinensis]
 gb|ESR64077.1| hypothetical protein CICLE_v10008943mg [Citrus clementina]
 gb|KDO80094.1| hypothetical protein CISIN_1g020987mg [Citrus sinensis]
Length=319

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R+C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  179  VRICSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  211



>ref|XP_004141424.1| PREDICTED: GATA transcription factor 21-like [Cucumis sativus]
Length=271

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  125  VRVCSDCNTTTTPLWRSGPQGPKSLCNACGIRQ  157



>gb|KDP34100.1| hypothetical protein JCGZ_07671 [Jatropha curcas]
Length=310

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  167  IRVCSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  199



>gb|KHN35841.1| Putative GATA transcription factor 22 [Glycine soja]
Length=325

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            + +RVC+DC+TTKTPLWRSGPKGPK+LCNACGIRQ
Sbjct  177  ITVRVCSDCHTTKTPLWRSGPKGPKTLCNACGIRQ  211



>dbj|BAJ91968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  174  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  206



>ref|NP_001281002.1| endothelial transcription factor GATA-2 [Malus domestica]
 gb|ADL36692.1| GATA domain class transcription factor [Malus domestica]
Length=342

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DC+TTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  202  IRVCSDCSTTKTPLWRSGPRGPKSLCNACGIRQ  234



>ref|XP_004951451.1| PREDICTED: putative GATA transcription factor 22-like [Setaria 
italica]
Length=336

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  171  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  203



>ref|XP_008450852.1| PREDICTED: GATA transcription factor 21 [Cucumis melo]
Length=339

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR C+DCNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  191  IRTCSDCNTTKTPLWRSGPRGPKSLCNACGIRQ  223



>ref|XP_011019465.1| PREDICTED: putative GATA transcription factor 22 [Populus euphratica]
Length=303

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  168  RVCSDCNTTSTPLWRSGPRGPKSLCNACGIRQ  199



>ref|XP_002308561.2| hypothetical protein POPTR_0006s24560g [Populus trichocarpa]
 gb|ABK95624.1| unknown [Populus trichocarpa]
 gb|EEE92084.2| hypothetical protein POPTR_0006s24560g [Populus trichocarpa]
Length=303

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  168  RVCSDCNTTSTPLWRSGPRGPKSLCNACGIRQ  199



>ref|XP_010667257.1| PREDICTED: putative GATA transcription factor 22 [Beta vulgaris 
subsp. vulgaris]
Length=319

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  731   IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQrkarramaaaaakaaaaaatgaaESSL  910
             IRVC+DC+TT TPLWRSGP+GPKSLCNACGIRQRKARRA  AAAA A       A  +S+
Sbjct  163   IRVCSDCHTTTTPLWRSGPQGPKSLCNACGIRQRKARRAAMAAAATAGYNGGNDAIVTSI  222

Query  911   NInkakptkekpttaaaknpatGVNHHHHHDEVTPFKKRYKIVAGERPSDH  1063
             +       +             G++HHH      P KKR KI+   R +++
Sbjct  223   S-----RVEAPKPKVQEMKSERGLDHHHQKSNTLPLKKRSKIIDAARTNNY  268



>gb|AGU42761.1| GATA nirate-inducible carbon-metabolism involved protein [Populus 
nigra x Populus x canadensis]
Length=303

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  168  RVCSDCNTTSTPLWRSGPRGPKSLCNACGIRQ  199



>ref|XP_008452719.1| PREDICTED: GATA transcription factor 21-like [Cucumis melo]
Length=413

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  234  VRVCSDCNTTTTPLWRSGPQGPKSLCNACGIRQ  266



>ref|NP_001057917.1| Os06g0571800 [Oryza sativa Japonica Group]
 dbj|BAD61831.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD61935.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19831.1| Os06g0571800 [Oryza sativa Japonica Group]
Length=347

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  200  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  232



>gb|ACG27673.1| GATA transcription factor 20 [Zea mays]
Length=370

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  178  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  210



>ref|XP_006656178.1| PREDICTED: putative GATA transcription factor 22-like [Oryza 
brachyantha]
Length=355

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  205  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  237



>ref|NP_001130465.1| uncharacterized protein LOC100191563 [Zea mays]
 gb|ACF78684.1| unknown [Zea mays]
 gb|ACN29292.1| unknown [Zea mays]
Length=370

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  178  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  210



>ref|XP_010047576.1| PREDICTED: GATA transcription factor 21-like [Eucalyptus grandis]
 gb|KCW79523.1| hypothetical protein EUGRSUZ_C00899 [Eucalyptus grandis]
Length=316

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC DCNT+KTPLWRSGPKGPK+LCNACGIRQ
Sbjct  169  VRVCVDCNTSKTPLWRSGPKGPKTLCNACGIRQ  201



>ref|XP_002453545.1| hypothetical protein SORBIDRAFT_04g007750 [Sorghum bicolor]
 gb|EES06521.1| hypothetical protein SORBIDRAFT_04g007750 [Sorghum bicolor]
Length=371

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  181  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  213



>ref|XP_010942001.1| PREDICTED: putative GATA transcription factor 22 [Elaeis guineensis]
Length=291

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 72/142 (51%), Gaps = 41/142 (29%)
 Frame = +2

Query  425  TNCEDSND---------HHTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastat  577
            TN +D+ND         +H  ++G   VKWM SKMR M+KM +S                
Sbjct  85   TNTDDNNDKMDQYVCNGYHEDEDGHGSVKWMPSKMRWMRKMVAS----------------  128

Query  578  titttvvaattttattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNT  757
                       +      M+ ++++K+ +  + + +  + +          IRVC+DC+T
Sbjct  129  ------EQTVRSKPARRSMEDLQEEKQHNQDMSNSNFPSGT----------IRVCSDCST  172

Query  758  TKTPLWRSGPKGPKSLCNACGI  823
            TKTPLWRSGP+GPKSLCNACGI
Sbjct  173  TKTPLWRSGPQGPKSLCNACGI  194



>gb|EEE65910.1| hypothetical protein OsJ_21757 [Oryza sativa Japonica Group]
Length=390

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  200  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  232



>gb|KGN55332.1| hypothetical protein Csa_4G646060 [Cucumis sativus]
Length=417

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  236  VRVCSDCNTTTTPLWRSGPQGPKSLCNACGIRQ  268



>ref|XP_006578078.1| PREDICTED: putative GATA transcription factor 22-like [Glycine 
max]
Length=292

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVCADCNTT TPLWRSGP GPKSLCNACGIRQ
Sbjct  153  RVCADCNTTSTPLWRSGPNGPKSLCNACGIRQ  184



>ref|XP_010483172.1| PREDICTED: GATA transcription factor 21-like [Camelina sativa]
Length=396

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+ CNTTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  226  IRVCSGCNTTKTPLWRSGPRGPKSLCNACGIRQ  258



>gb|EEC80838.1| hypothetical protein OsI_23440 [Oryza sativa Indica Group]
Length=387

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  197  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  229



>ref|XP_006648462.1| PREDICTED: putative GATA transcription factor 22-like [Oryza 
brachyantha]
Length=348

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  174  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  206



>ref|XP_002437185.1| hypothetical protein SORBIDRAFT_10g022580 [Sorghum bicolor]
 gb|EER88552.1| hypothetical protein SORBIDRAFT_10g022580 [Sorghum bicolor]
Length=386

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  187  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  219



>gb|AIB05542.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=437

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  245  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  277



>gb|AFW87011.1| GATA transcription factor 20 [Zea mays]
Length=437

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  245  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  277



>ref|XP_010656197.1| PREDICTED: GATA transcription factor 21 isoform X1 [Vitis vinifera]
Length=310

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVCADCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  175  IRVCADCNTTKTPLWRSGPRGPKSLCNACGI  205



>ref|XP_002282173.1| PREDICTED: GATA transcription factor 21 isoform X2 [Vitis vinifera]
 emb|CBI27913.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVCADCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  174  IRVCADCNTTKTPLWRSGPRGPKSLCNACGI  204



>ref|XP_006450838.1| hypothetical protein CICLE_v10008968mg [Citrus clementina]
 ref|XP_006475926.1| PREDICTED: putative GATA transcription factor 22-like isoform 
X2 [Citrus sinensis]
 gb|ESR64078.1| hypothetical protein CICLE_v10008968mg [Citrus clementina]
 gb|KDO80098.1| hypothetical protein CISIN_1g021329mg [Citrus sinensis]
Length=312

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  173  MRACSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  205



>ref|XP_006450839.1| hypothetical protein CICLE_v10008968mg [Citrus clementina]
 ref|XP_006475925.1| PREDICTED: putative GATA transcription factor 22-like isoform 
X1 [Citrus sinensis]
 gb|ESR64079.1| hypothetical protein CICLE_v10008968mg [Citrus clementina]
 gb|KDO80099.1| hypothetical protein CISIN_1g021329mg [Citrus sinensis]
Length=314

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +R C+DCNTT TPLWRSGP+GPKSLCNACGIRQ
Sbjct  175  MRACSDCNTTTTPLWRSGPRGPKSLCNACGIRQ  207



>ref|XP_009409597.1| PREDICTED: putative GATA transcription factor 22 [Musa acuminata 
subsp. malaccensis]
Length=229

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC++C+TTKTPLWRSGP+GPKSLCNACGIRQ
Sbjct  117  VRVCSNCSTTKTPLWRSGPRGPKSLCNACGIRQ  149



>ref|XP_009388677.1| PREDICTED: putative GATA transcription factor 22 [Musa acuminata 
subsp. malaccensis]
Length=302

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 59/116 (51%), Gaps = 31/116 (27%)
 Frame = +2

Query  476  PVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattttattEMMKIIEDQK  655
            P KWMSSKMR M+KM +S                            +     M + EDQ 
Sbjct  120  PGKWMSSKMRFMRKMMNS-----------------------THFVVSKPRGSMLLSEDQS  156

Query  656  RAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            + S    + + SN +          IR+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  157  QRSQGFGTGNQSNGNGI--------IRICSDCNTTKTPLWRSGPRGPKSLCNACGI  204



>ref|XP_007161012.1| hypothetical protein PHAVU_001G035600g [Phaseolus vulgaris]
 gb|ESW33006.1| hypothetical protein PHAVU_001G035600g [Phaseolus vulgaris]
Length=290

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNT+ TPLWRSGPKGPKSLCNACGIRQ
Sbjct  151  RVCSDCNTSTTPLWRSGPKGPKSLCNACGIRQ  182



>ref|XP_009126922.1| PREDICTED: GATA transcription factor 21-like [Brassica rapa]
 emb|CDY20709.1| BnaA02g08490D [Brassica napus]
Length=394

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  228  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  258



>gb|AFK36651.1| unknown [Lotus japonicus]
Length=204

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVCADCNTTKTPLWR GP+GPK+LCNACGI
Sbjct  66   VRVCADCNTTKTPLWRGGPRGPKTLCNACGI  96



>ref|XP_010262144.1| PREDICTED: putative GATA transcription factor 22 [Nelumbo nucifera]
Length=316

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            + +RVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  183  ITVRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  215



>emb|CDY67979.1| BnaC02g44480D [Brassica napus]
Length=392

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  227  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  257



>dbj|BAJ92108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR C+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  175  IRTCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  207



>gb|KHN37033.1| Putative GATA transcription factor 22 [Glycine soja]
Length=288

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNT+ TPLWRSGPKGPKSLCNACGIRQ
Sbjct  153  RVCSDCNTSTTPLWRSGPKGPKSLCNACGIRQ  184



>ref|XP_004966043.1| PREDICTED: putative GATA transcription factor 22-like [Setaria 
italica]
Length=362

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  178  RVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  209



>ref|XP_003563721.1| PREDICTED: GATA transcription factor 21-like [Brachypodium distachyon]
Length=347

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            IR C+DCNTTKTPLWRSGP GPKSLCNACGIRQ
Sbjct  173  IRTCSDCNTTKTPLWRSGPCGPKSLCNACGIRQ  205



>ref|XP_009398824.1| PREDICTED: putative GATA transcription factor 22 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  143  IRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  173



>ref|XP_006413221.1| hypothetical protein EUTSA_v10025461mg [Eutrema salsugineum]
 gb|ESQ54674.1| hypothetical protein EUTSA_v10025461mg [Eutrema salsugineum]
Length=380

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +R+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  217  VRICSDCNTTKTPLWRSGPRGPKSLCNACGI  247



>ref|XP_006601232.1| PREDICTED: putative GATA transcription factor 22-like [Glycine 
max]
Length=306

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNT+ TPLWRSGPKGPKSLCNACGIRQ
Sbjct  171  RVCSDCNTSTTPLWRSGPKGPKSLCNACGIRQ  202



>ref|XP_006280600.1| hypothetical protein CARUB_v10026556mg [Capsella rubella]
 gb|EOA13498.1| hypothetical protein CARUB_v10026556mg [Capsella rubella]
Length=395

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  230  VRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  260



>ref|XP_007154661.1| hypothetical protein PHAVU_003G137100g [Phaseolus vulgaris]
 gb|ESW26655.1| hypothetical protein PHAVU_003G137100g [Phaseolus vulgaris]
Length=309

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVCADC+TTKTPLWRSGP+GPKSLCNACGI
Sbjct  173  VRVCADCHTTKTPLWRSGPRGPKSLCNACGI  203



>ref|XP_008377680.1| PREDICTED: GATA transcription factor 21-like [Malus domestica]
Length=355

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNT  TPLWRSGP+GPKSLCNACGIRQ
Sbjct  219  VRVCSDCNTNTTPLWRSGPRGPKSLCNACGIRQ  251



>ref|XP_010242203.1| PREDICTED: GATA transcription factor 21-like [Nelumbo nucifera]
Length=305

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVC+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  175  VRVCSDCNTTKTPLWRSGPRGPKSLCNACGI  205



>ref|XP_004498890.1| PREDICTED: putative GATA transcription factor 22-like [Cicer 
arietinum]
Length=284

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DCNT  TPLWRSGP GPK+LCNACGIRQ
Sbjct  151  VRVCSDCNTNSTPLWRSGPMGPKTLCNACGIRQ  183



>ref|XP_011010724.1| PREDICTED: putative GATA transcription factor 22 [Populus euphratica]
Length=302

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTT TPLWRSGP+GPKSLCNACGI
Sbjct  169  IRVCSDCNTTSTPLWRSGPRGPKSLCNACGI  199



>ref|XP_003545375.1| PREDICTED: putative GATA transcription factor 22-like [Glycine 
max]
 gb|KHN17230.1| Putative GATA transcription factor 22 [Glycine soja]
Length=306

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            RVC+DCNT+ TPLWR+GPKGPKSLCNACGIRQ
Sbjct  168  RVCSDCNTSTTPLWRTGPKGPKSLCNACGIRQ  199



>gb|ABK96296.1| unknown [Populus trichocarpa x Populus deltoides]
Length=306

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTT TPLWRSGP+GPKSLCNACGI
Sbjct  173  IRVCSDCNTTSTPLWRSGPRGPKSLCNACGI  203



>ref|XP_002275498.1| PREDICTED: GATA transcription factor 16 [Vitis vinifera]
 ref|XP_010649545.1| PREDICTED: GATA transcription factor 16 [Vitis vinifera]
 emb|CBI22924.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            P + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  32   PKKTCADCGTTKTPLWRGGPAGPKSLCNACGIR  64



>ref|XP_006842678.1| hypothetical protein AMTR_s00147p00053080 [Amborella trichopoda]
 gb|ERN04353.1| hypothetical protein AMTR_s00147p00053080 [Amborella trichopoda]
Length=206

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
             IR C DCNTTKTPLWR+GP GP+SLCNACGIR
Sbjct  102  AIRACVDCNTTKTPLWRTGPAGPRSLCNACGIR  134



>ref|XP_008645644.1| PREDICTED: putative GATA transcription factor 22 isoform X1 [Zea 
mays]
Length=374

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 4/39 (10%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPK----SLCNACGIRQ  829
            V +RVC+DCNTTKTPLWRSGP+GPK    SLCNACGIRQ
Sbjct  186  VVVRVCSDCNTTKTPLWRSGPRGPKVNYQSLCNACGIRQ  224



>emb|CDY42753.1| BnaA03g47860D [Brassica napus]
Length=370

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            R+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  218  RICSDCNTTKTPLWRSGPRGPKSLCNACGI  247



>emb|CDY42752.1| BnaA03g47870D [Brassica napus]
Length=370

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            R+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  218  RICSDCNTTKTPLWRSGPRGPKSLCNACGI  247



>ref|XP_009137582.1| PREDICTED: putative GATA transcription factor 22 [Brassica rapa]
Length=388

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            R+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  218  RICSDCNTTKTPLWRSGPRGPKSLCNACGI  247



>ref|XP_008800908.1| PREDICTED: GATA transcription factor 16-like [Phoenix dactylifera]
Length=212

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            RVCADC T+KTPLWRSGP GPKSLCNACGIR
Sbjct  70   RVCADCRTSKTPLWRSGPSGPKSLCNACGIR  100



>emb|CDX87024.1| BnaC09g03390D [Brassica napus]
Length=103

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            +R C+DC TTKTP+WR GP GPKSLCNACGIR
Sbjct  8    VRCCSDCKTTKTPMWRGGPSGPKSLCNACGIR  39



>ref|XP_003571121.1| PREDICTED: putative GATA transcription factor 22 [Brachypodium 
distachyon]
Length=346

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DCNTTKTPLWRSGP GPKSLCNACGI
Sbjct  174  IRVCSDCNTTKTPLWRSGPCGPKSLCNACGI  204



>ref|XP_010931703.1| PREDICTED: GATA transcription factor 15-like isoform X2 [Elaeis 
guineensis]
Length=138

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  24   LKSCADCRTTKTPLWRGGPSGPKSLCNACGIR  55



>ref|XP_009361595.1| PREDICTED: GATA transcription factor 21 [Pyrus x bretschneideri]
Length=341

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DC+TTKTPLWRSGP+GPKSLCNACGI
Sbjct  201  IRVCSDCSTTKTPLWRSGPRGPKSLCNACGI  231



>emb|CDY67546.1| BnaAnng24640D [Brassica napus]
Length=376

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            R+C+DCNTTKTPLWRSGP+GPKSLCNACGI
Sbjct  218  RICSDCNTTKTPLWRSGPRGPKSLCNACGI  247



>ref|XP_009349759.1| PREDICTED: GATA transcription factor 21-like [Pyrus x bretschneideri]
Length=342

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IRVC+DC+TTKTPLWRSGP+GPKSLCNACGI
Sbjct  201  IRVCSDCSTTKTPLWRSGPRGPKSLCNACGI  231



>gb|ACJ84046.1| unknown [Medicago truncatula]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DC+T+ TPLWRSGP GPKSLCNACGIRQ
Sbjct  185  VRVCSDCSTSHTPLWRSGPMGPKSLCNACGIRQ  217



>gb|KDO71821.1| hypothetical protein CISIN_1g0321122mg, partial [Citrus sinensis]
Length=140

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  27   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|XP_003588994.1| GATA transcription factor [Medicago truncatula]
 gb|AES59245.1| GATA zinc finger protein [Medicago truncatula]
Length=305

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DC+T+ TPLWRSGP GPKSLCNACGIRQ
Sbjct  186  VRVCSDCSTSHTPLWRSGPMGPKSLCNACGIRQ  218



>ref|XP_006419440.1| hypothetical protein CICLE_v10006161mg [Citrus clementina]
 ref|XP_006488880.1| PREDICTED: GATA transcription factor 15-like [Citrus sinensis]
 gb|ESR32680.1| hypothetical protein CICLE_v10006161mg [Citrus clementina]
Length=147

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  34   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  64



>ref|XP_008797400.1| PREDICTED: GATA transcription factor 15-like [Phoenix dactylifera]
Length=138

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  24   LKSCADCRTTKTPLWRGGPSGPKSLCNACGIR  55



>gb|AAQ54534.1| putative GATA-type zinc finger protein [Malus domestica]
Length=100

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNAC  817
            IRVC+DCNTTKTPLWRSGP+GPKSLCNAC
Sbjct  72   IRVCSDCNTTKTPLWRSGPRGPKSLCNAC  100



>gb|KHG14878.1| GATA transcription factor 15 -like protein [Gossypium arboreum]
Length=156

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            +VCADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  36   KVCADCGTSKTPLWRGGPAGPKSLCNACGIR  66



>ref|XP_008787687.1| PREDICTED: GATA transcription factor 16-like [Phoenix dactylifera]
Length=210

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            P RVCA+C T++TPLWRSGP GPKSLCNACGIR
Sbjct  70   PSRVCAECRTSQTPLWRSGPNGPKSLCNACGIR  102



>ref|XP_010914517.1| PREDICTED: GATA transcription factor 16-like [Elaeis guineensis]
Length=153

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  24   LKSCADCRTTKTPLWRGGPSGPKSLCNACGIR  55



>ref|XP_010094337.1| GATA transcription factor 15 [Morus notabilis]
 gb|EXB55757.1| GATA transcription factor 15 [Morus notabilis]
Length=146

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  33   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  63



>gb|ABR18198.1| unknown [Picea sitchensis]
Length=380

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            RVC DC TTKTPLWRSGP+GPKSLCNACGIR
Sbjct  249  RVCVDCKTTKTPLWRSGPQGPKSLCNACGIR  279



>ref|XP_009406488.1| PREDICTED: GATA transcription factor 16-like [Musa acuminata 
subsp. malaccensis]
Length=120

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR+GP GPKSLCNACGIR
Sbjct  20   LKCCADCRTTKTPLWRAGPSGPKSLCNACGIR  51



>gb|KDP27875.1| hypothetical protein JCGZ_18955 [Jatropha curcas]
Length=136

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  740  CADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  29   CADCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|XP_010024769.1| PREDICTED: GATA transcription factor 16 [Eucalyptus grandis]
 gb|KCW61260.1| hypothetical protein EUGRSUZ_H04023 [Eucalyptus grandis]
Length=159

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  29   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  59



>ref|XP_010924181.1| PREDICTED: GATA transcription factor 16-like [Elaeis guineensis]
Length=213

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            RVC+DC T+KTPLWRSGP GPKSLCNACGIR
Sbjct  65   RVCSDCRTSKTPLWRSGPNGPKSLCNACGIR  95



>ref|XP_006394919.1| hypothetical protein EUTSA_v10005181mg [Eutrema salsugineum]
 gb|ESQ32205.1| hypothetical protein EUTSA_v10005181mg [Eutrema salsugineum]
Length=101

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            IR C+DC TTKTP+WR GP GPKSLCNACGIR
Sbjct  8    IRCCSDCKTTKTPMWRGGPSGPKSLCNACGIR  39



>gb|EAY85043.1| hypothetical protein OsI_06400 [Oryza sativa Indica Group]
Length=347

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGI
Sbjct  175  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGI  205



>dbj|BAJ95329.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADCNTTKTPLWR GP GPKSLCNACGIR
Sbjct  41   KSCADCNTTKTPLWRGGPNGPKSLCNACGIR  71



>gb|ABK96478.1| unknown [Populus trichocarpa x Populus deltoides]
Length=303

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            RVC+DCNTT TPLWRSGP+GPKSLCNACGI
Sbjct  171  RVCSDCNTTSTPLWRSGPRGPKSLCNACGI  200



>ref|XP_010924715.1| PREDICTED: GATA transcription factor 23-like [Elaeis guineensis]
Length=179

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            P RVCA+C T++TPLWRSGP GP+SLCNACGIR
Sbjct  38   PSRVCAECRTSQTPLWRSGPNGPRSLCNACGIR  70



>ref|XP_008458385.1| PREDICTED: GATA transcription factor 16-like isoform X2 [Cucumis 
melo]
Length=120

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  8    KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  38



>ref|XP_003554624.1| PREDICTED: GATA transcription factor 17-like [Glycine max]
Length=96

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPK+LCNACGIR
Sbjct  19   KCCADCKTTKTPLWRGGPAGPKTLCNACGIR  49



>ref|XP_006577217.1| PREDICTED: GATA transcription factor 16-like [Glycine max]
Length=80

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPK+LCNACGIR
Sbjct  11   KCCADCKTTKTPLWRGGPAGPKTLCNACGIR  41



>ref|XP_008458384.1| PREDICTED: GATA transcription factor 16-like isoform X1 [Cucumis 
melo]
Length=139

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  27   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|NP_001046316.1| Os02g0220400 [Oryza sativa Japonica Group]
 dbj|BAD17612.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF08230.1| Os02g0220400 [Oryza sativa Japonica Group]
 dbj|BAG94221.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGI
Sbjct  175  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGI  205



>ref|XP_004150081.1| PREDICTED: GATA transcription factor 16-like [Cucumis sativus]
 ref|XP_004161386.1| PREDICTED: GATA transcription factor 16-like [Cucumis sativus]
 gb|KGN47402.1| hypothetical protein Csa_6G312540 [Cucumis sativus]
Length=139

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  27   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|XP_002519177.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF43041.1| GATA transcription factor, putative [Ricinus communis]
Length=149

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  740  CADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  29   CADCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|XP_006371885.1| hypothetical protein POPTR_0018s05160g [Populus trichocarpa]
 gb|ERP49682.1| hypothetical protein POPTR_0018s05160g [Populus trichocarpa]
Length=266

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            RVC+DCNTT TPLWRSGP+GPKSLCNACGI
Sbjct  117  RVCSDCNTTSTPLWRSGPRGPKSLCNACGI  146



>gb|KHN03949.1| GATA transcription factor 16 [Glycine soja]
Length=79

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPK+LCNACGIR
Sbjct  10   KCCADCKTTKTPLWRGGPAGPKTLCNACGIR  40



>gb|EAZ22266.1| hypothetical protein OsJ_05921 [Oryza sativa Japonica Group]
Length=354

 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +RVC+DCNTTKTPLWRSGP GPKSLCNACGI
Sbjct  175  VRVCSDCNTTKTPLWRSGPCGPKSLCNACGI  205



>emb|CDY68751.1| BnaAnng28230D [Brassica napus]
Length=101

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            +R C++C TTKTP+WR GP GPKSLCNACGIR
Sbjct  30   VRCCSECKTTKTPMWRGGPSGPKSLCNACGIR  61



>gb|KEH32333.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=144

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            P + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  28   PKKTCADCGTSKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_002459187.1| hypothetical protein SORBIDRAFT_03g047520 [Sorghum bicolor]
 gb|EES04307.1| hypothetical protein SORBIDRAFT_03g047520 [Sorghum bicolor]
Length=217

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC+TTKTPLWR GP+GPKSLCNACGIR
Sbjct  39   KACADCHTTKTPLWRGGPEGPKSLCNACGIR  69



>ref|NP_001235841.1| uncharacterized protein LOC100527933 [Glycine max]
 gb|ACU17164.1| unknown [Glycine max]
 gb|KHN02924.1| GATA transcription factor 16 [Glycine soja]
Length=130

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  37   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  67



>ref|XP_009795635.1| PREDICTED: GATA transcription factor 15-like [Nicotiana sylvestris]
Length=152

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  21   LKTCADCGTTKTPLWRGGPAGPKSLCNACGIR  52



>ref|XP_003595135.1| GATA transcription factor [Medicago truncatula]
 gb|AES65386.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=297

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 66/130 (51%), Gaps = 32/130 (25%)
 Frame = +2

Query  434  EDSNDHHTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattt  613
            ++ ++ +  DEG I +KWM SK R++++M      RA +                     
Sbjct  96   KEEDNENFRDEGRISMKWMPSKKRMIKRMMED--QRASEQ--------------------  133

Query  614  tattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKG  793
                      E +K+      +   +  SSN++ SN   +RVC DC+TTKTPLWRSGP G
Sbjct  134  ----------EFEKQIKQLSPNLVGTEDSSNNNFSNNSTVRVCTDCHTTKTPLWRSGPTG  183

Query  794  PKSLCNACGI  823
            PKSLCNACGI
Sbjct  184  PKSLCNACGI  193



>gb|AFK37729.1| unknown [Medicago truncatula]
Length=143

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  728  PIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            P + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  28   PKKTCADCGTSKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_004292792.1| PREDICTED: putative GATA transcription factor 22-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  722  VVPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            V   RVC+DC+T  TPLWRSGP+GPKSLCNACGIRQ
Sbjct  206  VSAARVCSDCSTNTTPLWRSGPRGPKSLCNACGIRQ  241



>emb|CDY25008.1| BnaC02g40000D [Brassica napus]
Length=100

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            +R C+DC TTKTP+WR GP GPKSLCNACGIR
Sbjct  8    VRCCSDCRTTKTPMWRGGPSGPKSLCNACGIR  39



>ref|XP_004971450.1| PREDICTED: GATA transcription factor 21-like [Setaria italica]
Length=202

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC+TTKTPLWR GP+GPKSLCNACGIR
Sbjct  29   KACADCHTTKTPLWRGGPEGPKSLCNACGIR  59



>emb|CDY05639.1| BnaC02g38980D [Brassica napus]
Length=131

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  26   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  56



>ref|XP_008797161.1| PREDICTED: GATA transcription factor 15-like [Phoenix dactylifera]
Length=178

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  740  CADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  60   CADCRTTKTPLWRGGPSGPKSLCNACGIR  88



>ref|XP_010670911.1| PREDICTED: GATA transcription factor 15-like [Beta vulgaris subsp. 
vulgaris]
Length=155

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            I+ CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  25   IKRCADCGTSKTPLWRGGPAGPKSLCNACGIR  56



>gb|AFK42954.1| unknown [Medicago truncatula]
Length=302

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 32/130 (25%)
 Frame = +2

Query  434  EDSNDHHTHDEGIIPVKWMSSKMRVMQKMKSSGSNRACQvatmastattitttvvaattt  613
            ++ ++ +  DEG I +KWM SK R++++M      RA +                     
Sbjct  101  KEEDNENFRDEGRISMKWMPSKKRMIKRMMED--QRASEQ--------------------  138

Query  614  tattEMMKIIEDQKRAssclesehssnsssnhsssnVVPIRVCADCNTTKTPLWRSGPKG  793
                      E +K+      +   +  SSN++ SN   +RVC DC TTKTPLWRSGP G
Sbjct  139  ----------EFEKQIKQLSPNLVGTEDSSNNNFSNNSTVRVCTDCRTTKTPLWRSGPTG  188

Query  794  PKSLCNACGI  823
            PKSLCNACGI
Sbjct  189  PKSLCNACGI  198



>ref|XP_009415717.1| PREDICTED: GATA transcription factor 21-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            IR C+DC+TTKTPLWRSGP+GPKSLCNACGI
Sbjct  60   IRFCSDCSTTKTPLWRSGPQGPKSLCNACGI  90



>ref|XP_003550526.1| PREDICTED: GATA transcription factor 16-like [Glycine max]
Length=140

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  37   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  67



>ref|XP_002872245.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48504.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=123

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            +R C+DC TTKTP+WR GP GPKSLCNACGIR
Sbjct  25   VRCCSDCKTTKTPMWRGGPTGPKSLCNACGIR  56



>ref|XP_008438922.1| PREDICTED: GATA transcription factor 16-like [Cucumis melo]
Length=147

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  35   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  65



>ref|XP_004134234.1| PREDICTED: GATA transcription factor 16-like isoform 1 [Cucumis 
sativus]
Length=151

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  39   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  69



>ref|XP_004134235.1| PREDICTED: GATA transcription factor 16-like isoform 2 [Cucumis 
sativus]
 gb|KGN57147.1| hypothetical protein Csa_3G165640 [Cucumis sativus]
Length=148

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  36   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  66



>ref|XP_008340752.1| PREDICTED: GATA transcription factor 15 [Malus domestica]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  30   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_010652224.1| PREDICTED: GATA transcription factor 15-like [Vitis vinifera]
Length=140

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            R CADC+TT+TPLWR GP GP+SLCNACGIR
Sbjct  29   RSCADCHTTRTPLWRGGPAGPRSLCNACGIR  59



>ref|XP_007035717.1| GATA transcription factor 15, putative [Theobroma cacao]
 gb|EOY06643.1| GATA transcription factor 15, putative [Theobroma cacao]
Length=147

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  38   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  68



>ref|XP_010094010.1| GATA transcription factor 16 [Morus notabilis]
 gb|EXB55044.1| GATA transcription factor 16 [Morus notabilis]
Length=158

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            R C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  22   RSCVDCRTTKTPLWRGGPAGPKSLCNACGIR  52



>ref|XP_006345972.1| PREDICTED: GATA transcription factor 17-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345973.1| PREDICTED: GATA transcription factor 17-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  29   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  60



>ref|XP_006395075.1| hypothetical protein EUTSA_v10005103mg [Eutrema salsugineum]
 gb|ESQ32361.1| hypothetical protein EUTSA_v10005103mg [Eutrema salsugineum]
Length=139

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  34   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  64



>gb|KHN03321.1| GATA transcription factor 16, partial [Glycine soja]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  20   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  50



>ref|XP_002865725.1| hypothetical protein ARALYDRAFT_917909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41984.1| hypothetical protein ARALYDRAFT_917909 [Arabidopsis lyrata subsp. 
lyrata]
Length=111

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  9    KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  39



>emb|CDY33918.1| BnaA02g30690D [Brassica napus]
Length=141

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  32   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  62



>ref|XP_009369967.1| PREDICTED: GATA transcription factor 15 [Pyrus x bretschneideri]
 ref|XP_009347769.1| PREDICTED: GATA transcription factor 15-like [Pyrus x bretschneideri]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  30   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_009129774.1| PREDICTED: GATA transcription factor 16-like [Brassica rapa]
Length=140

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  32   KACADCGTSKTPLWRGGPAGPKSLCNACGIR  62



>ref|XP_010043208.1| PREDICTED: GATA transcription factor 15-like [Eucalyptus grandis]
Length=149

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  22   KFCADCKTTKTPLWRGGPSGPKSLCNACGIR  52



>ref|XP_006345974.1| PREDICTED: GATA transcription factor 17-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006345975.1| PREDICTED: GATA transcription factor 17-like isoform X4 [Solanum 
tuberosum]
Length=196

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  28   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  59



>ref|XP_010442389.1| PREDICTED: GATA transcription factor 16-like [Camelina sativa]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  30   KTCADCGTSKTPLWRGGPSGPKSLCNACGIR  60



>ref|XP_007223794.1| hypothetical protein PRUPE_ppa013171mg [Prunus persica]
 ref|XP_008223290.1| PREDICTED: GATA transcription factor 15-like [Prunus mume]
 gb|EMJ24993.1| hypothetical protein PRUPE_ppa013171mg [Prunus persica]
Length=136

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  30   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_010098872.1| GATA transcription factor 16 [Morus notabilis]
 gb|EXB75964.1| GATA transcription factor 16 [Morus notabilis]
Length=174

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            R C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  38   RSCVDCRTTKTPLWRGGPAGPKSLCNACGIR  68



>ref|NP_199741.1| GATA transcription factor 16 [Arabidopsis thaliana]
 sp|Q9FJ10.1|GAT16_ARATH RecName: Full=GATA transcription factor 16 [Arabidopsis thaliana]
 dbj|BAB10348.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABK32152.1| At5g49300 [Arabidopsis thaliana]
 dbj|BAH30620.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95794.1| GATA transcription factor 16 [Arabidopsis thaliana]
Length=139

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  36   KTCADCGTSKTPLWRGGPVGPKSLCNACGIR  66



>ref|XP_006378028.1| hypothetical protein POPTR_0010s00360g [Populus trichocarpa]
 gb|ERP55825.1| hypothetical protein POPTR_0010s00360g [Populus trichocarpa]
Length=153

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  32   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  62



>emb|CDO98802.1| unnamed protein product [Coffea canephora]
Length=154

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            I+ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  20   IKTCTDCGTTKTPLWRGGPAGPKSLCNACGIR  51



>ref|XP_007221888.1| hypothetical protein PRUPE_ppa018120mg [Prunus persica]
 gb|EMJ23087.1| hypothetical protein PRUPE_ppa018120mg [Prunus persica]
Length=325

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DC+T  TPLWRSGP GPKSLCNACGIRQ
Sbjct  194  VRVCSDCHTNSTPLWRSGPLGPKSLCNACGIRQ  226



>ref|XP_010321383.1| PREDICTED: GATA transcription factor 17-like isoform X1 [Solanum 
lycopersicum]
Length=197

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  29   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  60



>ref|XP_006645414.1| PREDICTED: GATA transcription factor 16-like [Oryza brachyantha]
Length=139

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC+TTKTPLWR GP GPKSLCNACGIR
Sbjct  22   KACADCHTTKTPLWRGGPGGPKSLCNACGIR  52



>ref|XP_003565196.1| PREDICTED: GATA transcription factor 16-like [Brachypodium distachyon]
Length=156

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + C DCNTTKTPLWR GP GPKSLCNACGIR
Sbjct  21   KACTDCNTTKTPLWRGGPTGPKSLCNACGIR  51



>ref|XP_008220473.1| PREDICTED: GATA transcription factor 21-like [Prunus mume]
Length=345

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIRQ  829
            +RVC+DC+T  TPLWRSGP GPKSLCNACGIRQ
Sbjct  208  VRVCSDCHTNSTPLWRSGPLGPKSLCNACGIRQ  240



>ref|XP_004239796.1| PREDICTED: GATA transcription factor 17-like isoform X2 [Solanum 
lycopersicum]
Length=196

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  28   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  59



>ref|NP_001045570.2| Os01g0976800 [Oryza sativa Japonica Group]
 dbj|BAD87039.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAH01077.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56108.1| hypothetical protein OsJ_04967 [Oryza sativa Japonica Group]
 dbj|BAF07484.2| Os01g0976800 [Oryza sativa Japonica Group]
Length=142

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC+TTKTPLWR GP GPKSLCNACGIR
Sbjct  22   KACADCHTTKTPLWRGGPGGPKSLCNACGIR  52



>ref|XP_009768393.1| PREDICTED: GATA transcription factor 15-like isoform X1 [Nicotiana 
sylvestris]
Length=180

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  26   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  57



>ref|XP_002278369.2| PREDICTED: GATA transcription factor 16-like [Vitis vinifera]
 emb|CAN74414.1| hypothetical protein VITISV_042395 [Vitis vinifera]
Length=125

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  19   KCCTDCKTTKTPLWRGGPAGPKSLCNACGIR  49



>ref|XP_010259404.1| PREDICTED: GATA transcription factor 15-like [Nelumbo nucifera]
 ref|XP_010259405.1| PREDICTED: GATA transcription factor 15-like [Nelumbo nucifera]
Length=140

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  740  CADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            CADC TTKTPLWR GP GPK+LCNACGIR
Sbjct  30   CADCGTTKTPLWRGGPAGPKTLCNACGIR  58



>ref|XP_009615645.1| PREDICTED: GATA transcription factor 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=176

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ CADC TTKTPLWR GP GPKSLCNACGI+
Sbjct  26   VKTCADCGTTKTPLWRGGPAGPKSLCNACGIK  57



>ref|XP_009767635.1| PREDICTED: GATA transcription factor 15-like isoform X1 [Nicotiana 
sylvestris]
Length=180

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  38   LKTCVDCGTTKTPLWRGGPAGPKSLCNACGIR  69



>ref|XP_009620101.1| PREDICTED: GATA transcription factor 16-like [Nicotiana tomentosiformis]
Length=148

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  26   LKTCVDCGTTKTPLWRGGPAGPKSLCNACGIR  57



>ref|XP_006858315.1| hypothetical protein AMTR_s00064p00107710 [Amborella trichopoda]
 gb|ERN19782.1| hypothetical protein AMTR_s00064p00107710 [Amborella trichopoda]
Length=257

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGI  823
            +R C+DC TTKTPLWRSGP+GPKSLCNACGI
Sbjct  112  VRTCSDCYTTKTPLWRSGPQGPKSLCNACGI  142



>ref|XP_006851118.1| hypothetical protein AMTR_s00025p00250380 [Amborella trichopoda]
 gb|ERN12699.1| hypothetical protein AMTR_s00025p00250380 [Amborella trichopoda]
Length=208

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  725  VPIRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
             P+  CADC T KTPLWR+GP GPKSLCNACGIR
Sbjct  108  TPVNACADCKTVKTPLWRNGPLGPKSLCNACGIR  141



>ref|XP_009767636.1| PREDICTED: GATA transcription factor 15-like isoform X2 [Nicotiana 
sylvestris]
Length=175

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  33   LKTCVDCGTTKTPLWRGGPAGPKSLCNACGIR  64



>gb|EEC72272.1| hypothetical protein OsI_05433 [Oryza sativa Indica Group]
Length=141

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC+TTKTPLWR GP GPKSLCNACGIR
Sbjct  22   KACADCHTTKTPLWRGGPGGPKSLCNACGIR  52



>ref|XP_004508168.1| PREDICTED: GATA transcription factor 15-like [Cicer arietinum]
Length=144

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  34   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  64



>emb|CDM86966.1| unnamed protein product [Triticum aestivum]
Length=180

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + C DCNTTKTPLWR GP GPKSLCNACGIR
Sbjct  27   KACDDCNTTKTPLWRGGPNGPKSLCNACGIR  57



>ref|XP_009590423.1| PREDICTED: GATA transcription factor 15-like isoform X2 [Nicotiana 
tomentosiformis]
Length=168

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  27   LKTCVDCGTTKTPLWRGGPAGPKSLCNACGIR  58



>gb|AAM63829.1| unknown [Arabidopsis thaliana]
Length=120

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            IR C++C TTKTP+WR GP GPKSLCNACGIR
Sbjct  25   IRCCSECKTTKTPMWRGGPTGPKSLCNACGIR  56



>ref|XP_009590421.1| PREDICTED: GATA transcription factor 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=174

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  33   LKTCVDCGTTKTPLWRGGPAGPKSLCNACGIR  64



>ref|XP_010524724.1| PREDICTED: GATA transcription factor 15-like [Tarenaya hassleriana]
Length=166

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  49   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  79



>gb|AFK46214.1| unknown [Lotus japonicus]
Length=144

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  31   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  61



>ref|XP_007154340.1| hypothetical protein PHAVU_003G110400g [Phaseolus vulgaris]
 gb|ESW26334.1| hypothetical protein PHAVU_003G110400g [Phaseolus vulgaris]
Length=162

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC TTKTPLWR GP GPKSLCNACGIR
Sbjct  60   KTCADCGTTKTPLWRGGPAGPKSLCNACGIR  90



>ref|NP_001051792.1| Os03g0831200 [Oryza sativa Japonica Group]
 gb|AAO39875.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAP46233.1| putative GATA-type zinc finger protein [Oryza sativa Japonica 
Group]
 gb|ABF99705.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13706.1| Os03g0831200 [Oryza sativa Japonica Group]
 gb|EAY92433.1| hypothetical protein OsI_14166 [Oryza sativa Indica Group]
 gb|EAY92446.1| hypothetical protein OsI_14179 [Oryza sativa Indica Group]
 gb|EAZ29168.1| hypothetical protein OsJ_13227 [Oryza sativa Japonica Group]
 dbj|BAG93601.1| unnamed protein product [Oryza sativa Japonica Group]
Length=136

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + C DC+TTKTPLWR GP GPKSLCNACGIR
Sbjct  25   KACTDCHTTKTPLWRGGPSGPKSLCNACGIR  55



>ref|NP_198045.1| GATA transcription factor 23 [Arabidopsis thaliana]
 sp|Q8LC59.2|GAT23_ARATH RecName: Full=GATA transcription factor 23 [Arabidopsis thaliana]
 gb|ABD59127.1| At5g26930 [Arabidopsis thaliana]
 gb|ABE66183.1| zinc finger family protein [Arabidopsis thaliana]
 dbj|BAH30599.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93628.1| GATA transcription factor 23 [Arabidopsis thaliana]
Length=120

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            IR C++C TTKTP+WR GP GPKSLCNACGIR
Sbjct  25   IRCCSECKTTKTPMWRGGPTGPKSLCNACGIR  56



>ref|XP_010546999.1| PREDICTED: GATA transcription factor 15-like [Tarenaya hassleriana]
Length=160

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  44   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  74



>gb|ABK28715.1| unknown [Arabidopsis thaliana]
Length=121

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            IR C++C TTKTP+WR GP GPKSLCNACGIR
Sbjct  25   IRCCSECKTTKTPMWRGGPTGPKSLCNACGIR  56



>ref|XP_003563322.1| PREDICTED: GATA transcription factor 16-like [Brachypodium distachyon]
Length=146

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + C DCNTTKTPLWR GP GPKSLCNACGIR
Sbjct  24   KACTDCNTTKTPLWRGGPCGPKSLCNACGIR  54



>ref|XP_002315462.2| hypothetical protein POPTR_0010s00360g [Populus trichocarpa]
 gb|EEF01633.2| hypothetical protein POPTR_0010s00360g [Populus trichocarpa]
Length=139

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  28   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  58



>ref|XP_010268075.1| PREDICTED: GATA transcription factor 16-like [Nelumbo nucifera]
Length=142

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  740  CADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            C DC TTKTPLWR GP GPKSLCNACGIR
Sbjct  32   CTDCRTTKTPLWRGGPAGPKSLCNACGIR  60



>ref|XP_006380209.1| hypothetical protein POPTR_0008s22950g [Populus trichocarpa]
 gb|ERP58006.1| hypothetical protein POPTR_0008s22950g [Populus trichocarpa]
Length=138

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  734  RVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            + CADC T+KTPLWR GP GPKSLCNACGIR
Sbjct  27   KTCADCGTSKTPLWRGGPAGPKSLCNACGIR  57



>gb|EPS59020.1| hypothetical protein M569_15793, partial [Genlisea aurea]
Length=87

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  731  IRVCADCNTTKTPLWRSGPKGPKSLCNACGIR  826
            ++ C+DC TT+TPLWR GP GPKSLCNACGI+
Sbjct  1    LKSCSDCRTTRTPLWRGGPAGPKSLCNACGIK  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2496906446688