BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21392_g1_i2 len=827 path=[3475:0-295 2758:296-319 89:320-718
1476:719-826]

Length=827
                                                                      Score     E

ref|XP_011097570.1|  PREDICTED: ras-related protein RABH1e              312   1e-103   
ref|XP_004235062.1|  PREDICTED: ras-related protein RABH1e-like         311   5e-103   
ref|XP_010267966.1|  PREDICTED: ras-related protein RABH1e              310   7e-103   
ref|XP_006366321.1|  PREDICTED: ras-related protein RABH1e-like         310   8e-103   
ref|XP_002307084.1|  Ras-related GTP-binding family protein             310   9e-103   Populus trichocarpa [western balsam poplar]
emb|CDP01457.1|  unnamed protein product                                310   1e-102   
ref|XP_010269260.1|  PREDICTED: ras-related protein RABH1e-like i...    309   3e-102   
ref|XP_009342518.1|  PREDICTED: ras-related protein RABH1e-like         308   4e-102   
ref|XP_008353923.1|  PREDICTED: ras-related protein RABH1e              307   5e-102   
ref|XP_010087594.1|  Ras-related protein                                308   5e-102   
ref|XP_003525055.1|  PREDICTED: ras-related protein RABH1e-like         308   5e-102   
gb|EYU23989.1|  hypothetical protein MIMGU_mgv1a013931mg                308   7e-102   
ref|XP_010547607.1|  PREDICTED: ras-related protein RABH1e              308   7e-102   
ref|XP_008343311.1|  PREDICTED: ras-related protein RABH1e              308   9e-102   
ref|XP_003552057.1|  PREDICTED: ras-related protein RABH1e-like         308   9e-102   
ref|XP_006428196.1|  hypothetical protein CICLE_v10026499mg             307   1e-101   
ref|XP_010926288.1|  PREDICTED: ras-related protein RABH1e              307   1e-101   
ref|XP_004143465.1|  PREDICTED: ras-related protein RABH1e-like         306   2e-101   
ref|XP_004288200.1|  PREDICTED: ras-related protein RABH1e-like         306   2e-101   
ref|XP_007047951.1|  RAB GTPase H1E isoform 1                           306   3e-101   
ref|XP_010916878.1|  PREDICTED: ras-related protein RABH1e-like         306   3e-101   
ref|XP_002531261.1|  protein with unknown function                      306   4e-101   Ricinus communis
ref|XP_009593307.1|  PREDICTED: ras-related protein RABH1e              306   4e-101   
gb|KHN44343.1|  Ras-related protein RABH1e                              306   5e-101   
ref|XP_003531349.1|  PREDICTED: ras-related protein RABH1e-like         305   8e-101   
ref|XP_010025451.1|  PREDICTED: ras-related protein RABH1e              305   9e-101   
ref|XP_004240017.1|  PREDICTED: ras-related protein RABH1e              305   9e-101   
gb|ABK23720.1|  unknown                                                 305   1e-100   Picea sitchensis
ref|XP_009764281.1|  PREDICTED: ras-related protein RABH1e              305   1e-100   
ref|XP_004504075.1|  PREDICTED: ras-related protein RABH1e-like         305   1e-100   
ref|XP_010519539.1|  PREDICTED: ras-related protein RABH1e-like         305   1e-100   
ref|XP_006355553.1|  PREDICTED: ras-related protein RABH1e-like         304   2e-100   
emb|CBI25776.3|  unnamed protein product                                303   2e-100   
gb|KDP46827.1|  hypothetical protein JCGZ_24036                         304   2e-100   
gb|EPS66071.1|  hypothetical protein M569_08708                         304   2e-100   
ref|XP_009340511.1|  PREDICTED: ras-related protein RABH1e              304   2e-100   
ref|XP_002271220.2|  PREDICTED: ras-related protein RABH1e              304   2e-100   Vitis vinifera
ref|XP_011090551.1|  PREDICTED: ras-related protein RABH1e-like         303   5e-100   
ref|XP_006591505.1|  PREDICTED: ras-related protein RABH1e-like i...    303   7e-100   
ref|XP_008782142.1|  PREDICTED: ras-related protein RABH1e              302   9e-100   
ref|XP_009802532.1|  PREDICTED: ras-related protein RABH1e              302   1e-99    
ref|XP_007205911.1|  hypothetical protein PRUPE_ppa011539mg             301   2e-99    
ref|XP_010269259.1|  PREDICTED: ras-related protein RABH1e-like i...    301   3e-99    
ref|XP_009338093.1|  PREDICTED: ras-related protein RABH1e-like         300   6e-99    
gb|KHG04027.1|  Ras-related RABH1e -like protein                        300   7e-99    
ref|XP_004502420.1|  PREDICTED: ras-related protein RABH1e-like         300   8e-99    
ref|XP_008234005.1|  PREDICTED: ras-related protein RABH1e              299   2e-98    
ref|XP_010532473.1|  PREDICTED: ras-related protein RABH1e-like         299   2e-98    
ref|XP_008795552.1|  PREDICTED: ras-related protein RABH1e              299   2e-98    
ref|XP_006288665.1|  hypothetical protein CARUB_v10001971mg             298   4e-98    
ref|XP_002871412.1|  hypothetical protein ARALYDRAFT_487852             298   5e-98    
gb|AAW70387.1|  At5g10260                                               296   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196588.3|  ras-related protein RABH1e                            297   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399521.1|  hypothetical protein EUTSA_v10014689mg             297   1e-97    
gb|KEH20835.1|  RAB GTPase-like protein B1C                             297   1e-97    
ref|XP_010453053.1|  PREDICTED: ras-related protein RABH1e-like         296   2e-97    
ref|XP_010680547.1|  PREDICTED: ras-related protein RABH1e              296   3e-97    
gb|KHG21500.1|  Ras-related RABH1e -like protein                        295   5e-97    
gb|AFK44388.1|  unknown                                                 293   3e-96    
ref|XP_006838450.1|  hypothetical protein AMTR_s00002p00134180          292   1e-95    
ref|XP_002878607.1|  predicted protein                                  291   2e-95    
gb|KCW76817.1|  hypothetical protein EUGRSUZ_D01171                     289   5e-95    
ref|XP_011093480.1|  PREDICTED: ras-related protein RABH1b              290   5e-95    
emb|CDX96987.1|  BnaC09g46380D                                          290   7e-95    
ref|XP_007052416.1|  Ras-related small GTP-binding family protein       290   8e-95    
ref|XP_009404050.1|  PREDICTED: ras-related protein RABH1e              290   9e-95    
ref|XP_009390286.1|  PREDICTED: ras-related protein RABH1e-like         290   9e-95    
ref|XP_010052745.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    290   9e-95    
emb|CDP09376.1|  unnamed protein product                                290   1e-94    
gb|KHG08795.1|  Ras-related RABH1e -like protein                        289   1e-94    
gb|KFK32828.1|  hypothetical protein AALP_AA6G292500                    289   2e-94    
ref|XP_007218411.1|  hypothetical protein PRUPE_ppa011501mg             289   2e-94    
gb|KFK25343.1|  hypothetical protein AALP_AA8G100400                    288   3e-94    
ref|XP_011085344.1|  PREDICTED: ras-related protein RABH1b-like         288   3e-94    
gb|KFK37266.1|  hypothetical protein AALP_AA4G235100                    288   3e-94    
gb|ADM76369.1|  Rab-like protein                                        286   4e-94    
ref|XP_008784700.1|  PREDICTED: ras-related protein RABH1b isofor...    288   4e-94    
ref|XP_006404685.1|  hypothetical protein EUTSA_v10000663mg             288   5e-94    
ref|XP_009131149.1|  PREDICTED: ras-related protein RABH1e              288   5e-94    
ref|XP_004229706.1|  PREDICTED: ras-related protein RABH1b              288   5e-94    
ref|NP_179816.1|  RAB GTPase-like protein H1D                           288   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009766624.1|  PREDICTED: ras-related protein RABH1b              287   8e-94    
ref|XP_006445482.1|  hypothetical protein CICLE_v10022269mg             287   9e-94    
ref|XP_002526504.1|  protein with unknown function                      287   1e-93    Ricinus communis
gb|EYU42316.1|  hypothetical protein MIMGU_mgv1a013870mg                287   1e-93    
ref|XP_009790571.1|  PREDICTED: ras-related protein RABH1b              287   1e-93    
ref|XP_009142275.1|  PREDICTED: ras-related protein RABH1b-like         287   1e-93    
ref|XP_006397642.1|  hypothetical protein EUTSA_v10001633mg             287   1e-93    
ref|XP_009604156.1|  PREDICTED: ras-related protein RABH1b-like         287   1e-93    
ref|XP_010933532.1|  PREDICTED: ras-related protein RABH1b-like         286   2e-93    
ref|XP_011032019.1|  PREDICTED: ras-related protein RABH1b-like         286   2e-93    
ref|XP_008784702.1|  PREDICTED: ras-related protein RABH1b isofor...    286   2e-93    
ref|XP_010472219.1|  PREDICTED: ras-related protein RABH1d              286   2e-93    
ref|XP_006385600.1|  hypothetical protein POPTR_0003s08490g             285   3e-93    
ref|XP_008784703.1|  PREDICTED: ras-related protein RABH1b isofor...    286   3e-93    
ref|XP_002528787.1|  protein with unknown function                      286   3e-93    Ricinus communis
ref|XP_009400213.1|  PREDICTED: ras-related protein RABH1b              286   3e-93    
ref|XP_002302484.1|  Ras-related GTP-binding family protein             286   3e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010559077.1|  PREDICTED: ras-related protein RABH1b              286   3e-93    
gb|KHN06578.1|  Ras-related protein RABH1e                              284   4e-93    
ref|XP_010677218.1|  PREDICTED: ras-related protein RABH1b              285   4e-93    
ref|XP_010269896.1|  PREDICTED: ras-related protein RABH1b              285   4e-93    
ref|XP_009122071.1|  PREDICTED: ras-related protein RABH1e              285   4e-93    
ref|XP_009592200.1|  PREDICTED: ras-related protein RABH1b              285   5e-93    
ref|XP_009112539.1|  PREDICTED: ras-related protein RABH1d              285   5e-93    
gb|KHG03959.1|  Ras-related RABH1b -like protein                        285   6e-93    
ref|XP_009390643.1|  PREDICTED: ras-related protein RABH1b-like         285   9e-93    
gb|AES72198.2|  RAB GTPase-like protein B1C                             285   9e-93    
emb|CDX74672.1|  BnaA05g04180D                                          285   9e-93    
ref|XP_009143050.1|  PREDICTED: ras-related protein RABH1b              285   9e-93    
ref|XP_010524453.1|  PREDICTED: ras-related protein RABH1b-like         285   1e-92    
ref|NP_181989.1|  Ras-related protein RABH1B                            284   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531376.1|  PREDICTED: ras-related protein RABH1d              284   2e-92    
gb|KDP45957.1|  hypothetical protein JCGZ_11860                         284   2e-92    
gb|KDP28909.1|  hypothetical protein JCGZ_14680                         284   2e-92    
emb|CBI16724.3|  unnamed protein product                                283   2e-92    
ref|XP_002968288.1|  rab family GTPase                                  283   3e-92    
ref|XP_010661434.1|  PREDICTED: ras-related protein RABH1b              283   3e-92    
ref|XP_010429146.1|  PREDICTED: ras-related protein RABH1d-like         283   4e-92    
gb|AAA74117.1|  putative                                                283   5e-92    Nicotiana tabacum [American tobacco]
gb|KHG27267.1|  Ras-related RABH1b -like protein                        283   6e-92    
ref|XP_006294994.1|  hypothetical protein CARUB_v10024066mg             283   6e-92    
ref|XP_003517383.1|  PREDICTED: ras-related protein RABH1b-like         282   6e-92    
ref|XP_006853127.1|  hypothetical protein AMTR_s00038p00155900          286   1e-91    
ref|XP_003539133.2|  PREDICTED: ras-related protein RABH1b              282   1e-91    
gb|ACF86139.1|  unknown                                                 281   1e-91    Zea mays [maize]
ref|XP_010238113.1|  PREDICTED: ras-related protein RABH1b              282   1e-91    
ref|XP_010506389.1|  PREDICTED: ras-related protein RABH1b              281   1e-91    
ref|XP_006591506.1|  PREDICTED: ras-related protein RABH1e-like i...    280   2e-91    
ref|XP_009133677.1|  PREDICTED: ras-related protein RABH1b-like         281   2e-91    
ref|XP_011018653.1|  PREDICTED: ras-related protein RABH1b-like i...    281   3e-91    
ref|XP_001785261.1|  Rab6/RabH-family small GTPase                      281   3e-91    
ref|NP_001150271.1|  ras-related protein Rab-6A                         281   3e-91    Zea mays [maize]
ref|XP_007156617.1|  hypothetical protein PHAVU_002G003500g             280   7e-91    
ref|XP_004148503.1|  PREDICTED: ras-related protein RABH1b-like         280   8e-91    
gb|KHN31372.1|  Ras-related protein RABH1e                              281   9e-91    
ref|XP_008668055.1|  PREDICTED: ras-related protein Rab-6A isofor...    279   9e-91    
ref|NP_001142363.1|  hypothetical protein                               279   1e-90    Zea mays [maize]
ref|XP_001759775.1|  Rab6/RabH-family small GTPase                      279   2e-90    
ref|XP_007209608.1|  hypothetical protein PRUPE_ppa011535mg             278   3e-90    
ref|XP_007155742.1|  hypothetical protein PHAVU_003G227800g             278   5e-90    
ref|XP_008232300.1|  PREDICTED: ras-related protein RABH1b              278   6e-90    
tpg|DAA62790.1|  TPA: hypothetical protein ZEAMMB73_332722              279   7e-90    
ref|XP_006354635.1|  PREDICTED: ras-related protein RABH1b-like         276   1e-89    
gb|AES94384.2|  RAB GTPase-like protein B1C                             276   1e-89    
ref|XP_008364780.1|  PREDICTED: ras-related protein RABH1b              276   2e-89    
ref|XP_008369810.1|  PREDICTED: ras-related protein RABH1b              276   2e-89    
ref|XP_006436829.1|  hypothetical protein CICLE_v10032757mg             276   2e-89    
gb|AFK37167.1|  unknown                                                 276   2e-89    
ref|XP_003517384.1|  PREDICTED: ras-related protein RABH1b-like         276   3e-89    
ref|XP_009625739.1|  PREDICTED: ras-related protein RABH1e-like         273   5e-89    
ref|XP_001782940.1|  Rab6/RabH-family small GTPase                      275   6e-89    
gb|AAZ66935.1|  117M18_16                                               275   6e-89    Brassica rapa
ref|XP_007156620.1|  hypothetical protein PHAVU_002G003800g             275   8e-89    
ref|XP_004508989.1|  PREDICTED: ras-related protein RABH1b-like         275   8e-89    
gb|EYU40319.1|  hypothetical protein MIMGU_mgv1a013860mg                275   8e-89    
gb|KEH31569.1|  RAB GTPase-like protein B1C                             274   1e-88    
ref|XP_001783133.1|  predicted protein                                  274   1e-88    
ref|XP_010919837.1|  PREDICTED: ras-related protein RABH1b              274   1e-88    
ref|XP_003549965.2|  PREDICTED: ras-related protein RABH1b-like         274   1e-88    
ref|XP_010544549.1|  PREDICTED: ras-related protein RABH1b              274   2e-88    
ref|XP_005645434.1|  ras-domain-containing protein                      273   3e-88    
ref|XP_004511760.1|  PREDICTED: ras-related protein RABH1b-like         272   5e-88    
ref|NP_001059699.1|  Os07g0496000                                       271   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385937.1|  PREDICTED: ras-related protein RABH1b-like         271   1e-87    
ref|XP_002461043.1|  hypothetical protein SORBIDRAFT_02g039720          271   1e-87    Sorghum bicolor [broomcorn]
emb|CDY23446.1|  BnaC04g49740D                                          284   2e-87    
emb|CBI33936.3|  unnamed protein product                                270   2e-87    
gb|ACU20573.1|  unknown                                                 271   2e-87    Glycine max [soybeans]
ref|XP_002281823.1|  PREDICTED: ras-related protein RABH1b              271   3e-87    Vitis vinifera
gb|KHG28240.1|  Ras-related RABH1b -like protein                        270   5e-87    
ref|XP_001754098.1|  Rab6/RabH-family small GTPase                      270   6e-87    
ref|XP_006657723.1|  PREDICTED: ras-related protein RABH1b-like         269   9e-87    
ref|XP_003611426.1|  Ras-related protein Rab-6                          269   2e-86    
gb|EMT32151.1|  Ras-related protein RABH1B                              272   2e-86    
gb|EMS65503.1|  Ras-related protein RABH1b                              269   3e-86    
ref|XP_010941190.1|  PREDICTED: ras-related protein RABH1b-like i...    268   5e-86    
ref|XP_008811389.1|  PREDICTED: ras-related protein RABH1b-like         266   5e-86    
gb|ABF94403.1|  Ras-related protein Rab-6A, putative, expressed         265   5e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EPS71048.1|  hypothetical protein M569_03713                         265   7e-85    
ref|XP_004985388.1|  PREDICTED: ras-related protein RABH1e-like         265   8e-85    
ref|XP_008670587.1|  PREDICTED: ras-related protein RABH1b-like         264   9e-85    
gb|ABF94402.1|  Ras-related protein Rab-6A, putative, expressed         263   3e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001235476.1|  uncharacterized protein LOC100527651               262   7e-84    
ref|XP_006649538.1|  PREDICTED: ras-related protein RABH1e-like         261   1e-83    
ref|XP_003558615.2|  PREDICTED: ras-related protein RABH1e-like i...    262   1e-83    
ref|XP_005844627.1|  GTP binding protein                                260   3e-83    
gb|AFK47940.1|  unknown                                                 259   4e-83    
ref|XP_001751907.1|  predicted protein                                  260   4e-83    
ref|NP_001147620.1|  LOC100281229                                       258   3e-82    Zea mays [maize]
ref|XP_001780867.1|  Rab6/RabH-family small GTPase                      258   3e-82    
gb|EPS72171.1|  hypothetical protein M569_02585                         257   4e-82    
gb|AFK45067.1|  unknown                                                 256   1e-81    
ref|XP_010941189.1|  PREDICTED: ras-related protein RABH1b-like i...    256   2e-81    
gb|EYU40320.1|  hypothetical protein MIMGU_mgv1a013860mg                253   1e-80    
ref|XP_010229052.1|  PREDICTED: ras-related protein RABH1e-like i...    258   1e-80    
gb|KFM27875.1|  Ras-related protein RABH1e                              251   1e-79    
emb|CDX81264.1|  BnaC09g06750D                                          251   2e-79    
ref|XP_006295931.1|  hypothetical protein CARUB_v10025068mg             249   3e-79    
gb|EEC82085.1|  hypothetical protein OsI_26083                          251   4e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_009112166.1|  PREDICTED: ras-related protein RABH1a              249   4e-79    
gb|EEE67212.1|  hypothetical protein OsJ_24329                          251   5e-79    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99126.1|  predicted protein                                      251   3e-78    
dbj|BAJ92647.1|  predicted protein                                      249   4e-78    
ref|XP_002948506.1|  RabH/Rab6                                          247   4e-78    
emb|CDX76936.1|  BnaC08g35220D                                          249   5e-78    
ref|XP_001690213.1|  small rab-related GTPase                           245   2e-77    Chlamydomonas reinhardtii
ref|XP_002866645.1|  hypothetical protein ARALYDRAFT_496719             243   2e-76    
ref|XP_010437115.1|  PREDICTED: ras-related protein RABH1c              241   1e-75    
ref|XP_010431970.1|  PREDICTED: ras-related protein RABH1c-like         240   2e-75    
ref|XP_002866892.1|  hypothetical protein ARALYDRAFT_912477             240   3e-75    
gb|ESA21530.1|  hypothetical protein GLOINDRAFT_343112                  240   4e-75    
ref|NP_201304.1|  RAB GTPase homolog H1A                                239   4e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AGN12807.1|  Ras-related protein RABH1C                              239   5e-75    
emb|CDY18689.1|  BnaA09g07060D                                          239   5e-75    
ref|XP_011110515.1|  hypothetical protein H072_4618                     239   7e-75    
ref|XP_006281115.1|  hypothetical protein CARUB_v10027144mg             239   7e-75    
ref|XP_006394088.1|  hypothetical protein EUTSA_v10005261mg             238   9e-75    
gb|KFK30558.1|  hypothetical protein AALP_AA7G277600                    239   9e-75    
ref|XP_006411786.1|  hypothetical protein EUTSA_v10026225mg             239   1e-74    
ref|XP_002500129.1|  ras-related gtp-binding protein, alternative...    238   1e-74    Micromonas commoda
ref|XP_009678700.1|  PREDICTED: ras-related protein Rab-6A              236   2e-74    
ref|XP_008148176.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   3e-74    
ref|XP_005230482.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   3e-74    
ref|XP_005230481.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   4e-74    
gb|KFP61007.1|  Ras-related protein Rab-6A                              236   4e-74    
gb|KDD77143.1|  Ras family protein                                      237   5e-74    
ref|XP_007889377.1|  PREDICTED: ras-related protein Rab-6A isofor...    237   5e-74    
ref|XP_010411616.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   5e-74    
ref|NP_195699.1|  Ras-related protein RABH1c                            237   5e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006937019.1|  PREDICTED: ras-related protein Rab-6A              236   5e-74    
ref|XP_005579105.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   5e-74    
ref|XP_007889376.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   6e-74    
ref|NP_001230648.1|  ras-related protein Rab-6A isoform c               235   6e-74    
gb|KFP76916.1|  Ras-related protein Rab-6A                              236   7e-74    
ref|XP_004683244.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   7e-74    
ref|XP_006284510.1|  hypothetical protein CARUB_v10005710mg             236   8e-74    
ref|XP_009185177.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   8e-74    
ref|XP_006181660.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   8e-74    
ref|XP_008336818.1|  PREDICTED: ras-related protein Rab-6B isofor...    236   8e-74    
ref|XP_002593085.1|  hypothetical protein BRAFLDRAFT_210049             236   9e-74    Branchiostoma floridae
ref|XP_009005706.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   9e-74    
ref|XP_004641978.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   1e-73    
ref|XP_003910445.2|  PREDICTED: ras-related protein Rab-6A isofor...    235   1e-73    
ref|XP_002754841.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   1e-73    Callithrix jacchus [common marmoset]
ref|XP_007650493.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   1e-73    
ref|XP_003780961.1|  PREDICTED: ras-related protein Rab-6A isoform 2    236   1e-73    
ref|XP_003456835.1|  PREDICTED: ras-related protein Rab-6A-like i...    236   1e-73    
ref|XP_006100525.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   1e-73    
dbj|BAH13508.1|  unnamed protein product                                234   1e-73    Homo sapiens [man]
ref|XP_008262434.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   1e-73    
ref|XP_008946371.1|  PREDICTED: ras-related protein Rab-6A              234   1e-73    
gb|EDL16463.1|  RAB6, member RAS oncogene family, isoform CRA_b         234   2e-73    
ref|XP_005308574.1|  PREDICTED: ras-related protein Rab-6A isofor...    236   2e-73    
ref|XP_010574946.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_009303841.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_004708870.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   2e-73    
ref|XP_005038987.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_006100526.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_003780960.1|  PREDICTED: ras-related protein Rab-6A isoform 1    235   2e-73    
ref|NP_001230202.1|  ras-related protein Rab-6A                         235   2e-73    
ref|XP_007244836.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_006885629.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
gb|AAH26915.1|  Rab6 protein                                            234   2e-73    Mus musculus [mouse]
ref|XP_004319026.1|  PREDICTED: ras-related protein Rab-6A              234   2e-73    
ref|XP_008164834.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
gb|AFK36124.1|  unknown                                                 234   2e-73    
ref|NP_942599.1|  ras-related protein Rab-6A isoform b                  235   2e-73    Homo sapiens [man]
ref|XP_002708751.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001657425.1|  rab6                                               235   2e-73    Aedes aegypti
ref|XP_011117303.1|  hypothetical protein AOL_s00004g351                235   2e-73    
ref|XP_006004999.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   2e-73    
ref|XP_003763122.1|  PREDICTED: ras-related protein Rab-6A-like         235   3e-73    
ref|XP_005429232.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   3e-73    
ref|NP_001038105.1|  ras-related protein Rab-6A                         235   3e-73    Gallus gallus [bantam]
ref|XP_008918431.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   3e-73    
ref|XP_009303842.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   3e-73    
ref|XP_005025583.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   3e-73    
ref|XP_007244835.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   3e-73    
ref|XP_005806692.1|  PREDICTED: ras-related protein Rab-6A-like i...    235   3e-73    
ref|XP_006885628.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   3e-73    
ref|XP_003971157.1|  PREDICTED: ras-related protein Rab-6A-like i...    235   3e-73    
ref|XP_006004998.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   3e-73    
ref|XP_005500672.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   3e-73    
ref|XP_006820135.1|  PREDICTED: ras-related protein Rab-6A-like i...    235   3e-73    
ref|XP_009996280.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   3e-73    
ref|NP_002860.2|  ras-related protein Rab-6A isoform a                  234   3e-73    
ref|NP_001180044.1|  ras-related protein Rab-6A                         234   3e-73    
ref|XP_010020682.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   3e-73    
ref|XP_004683242.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   3e-73    
ref|XP_004641976.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   4e-73    
gb|AET50598.1|  hypothetical protein                                    234   4e-73    
ref|XP_008062859.1|  PREDICTED: ras-related protein Rab-6A              234   4e-73    
gb|AAV38503.1|  RAB6A, member RAS oncogene family                       234   4e-73    
ref|XP_004683243.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   4e-73    
ref|XP_008331201.1|  PREDICTED: ras-related protein Rab-6A              234   4e-73    
ref|NP_001080506.1|  RAB6A, member RAS oncogene family                  234   4e-73    
ref|XP_009954495.1|  PREDICTED: ras-related protein Rab-6A isofor...    235   4e-73    
ref|XP_009889296.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   4e-73    
ref|XP_002737729.1|  PREDICTED: ras-related protein Rab-6A-like i...    234   5e-73    
ref|XP_004708868.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   5e-73    
dbj|BAD97271.1|  RAB6A, member RAS oncogene family isoform a variant    234   5e-73    
ref|XP_006127589.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   5e-73    
ref|XP_010862959.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   5e-73    
ref|NP_989315.1|  RAB6A, member RAS oncogene family                     234   5e-73    
ref|XP_003463452.2|  PREDICTED: ras-related protein Rab-6A              234   5e-73    
ref|XP_005717265.1|  small GTP-binding protein of Rab family, Rab6      234   5e-73    
ref|XP_004641977.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   5e-73    
gb|KFH69191.1|  Ras-like protein Rab-6A                                 234   6e-73    
ref|XP_008200265.1|  PREDICTED: ras-related protein Rab6 isoform X2     234   6e-73    
ref|NP_077249.1|  ras-related protein Rab-6A isoform 2                  234   6e-73    
ref|XP_004708869.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   6e-73    
emb|CAG02943.1|  unnamed protein product                                234   7e-73    
gb|ACQ58510.1|  Ras-related protein Rab-6B                              234   7e-73    
ref|XP_010862956.1|  PREDICTED: ras-related protein Rab-6A isofor...    234   7e-73    
ref|XP_008275768.1|  PREDICTED: ras-related protein Rab-6B              234   7e-73    
gb|KFB47225.1|  rab6                                                    234   8e-73    
ref|XP_001363218.1|  PREDICTED: ras-related protein Rab-6A              234   8e-73    
dbj|GAM18139.1|  hypothetical protein SAMD00019534_013140               233   8e-73    
ref|XP_007907916.1|  PREDICTED: ras-related protein Rab-41 isofor...    234   9e-73    
ref|XP_002069232.1|  GK21078                                            234   9e-73    
ref|NP_001133408.1|  RAB6A, member RAS oncogene family                  234   9e-73    
ref|XP_004531259.1|  PREDICTED: ras-related protein Rab-6A-like         233   9e-73    
ref|XP_005867155.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    235   9e-73    
emb|CEG63493.1|  Putative Ras-like protein Rab-6A                       233   1e-72    
ref|NP_445818.1|  ras-related protein Rab-6A                            233   1e-72    
ref|XP_008946115.1|  PREDICTED: ras-related protein Rab-41 isofor...    232   1e-72    
ref|XP_002364292.1|  RAB6 protein                                       233   1e-72    
emb|CAG46781.1|  RAB6A                                                  233   1e-72    
ref|NP_477172.1|  Rab6, isoform A                                       233   1e-72    
ref|XP_791590.3|  PREDICTED: ras-related protein Rab-6A-like            233   1e-72    
ref|XP_007907915.1|  PREDICTED: ras-related protein Rab-41 isofor...    233   1e-72    
ref|XP_001238010.2|  AGAP011363-PA                                      233   2e-72    
ref|XP_005727236.1|  PREDICTED: ras-related protein Rab-6B-like i...    233   2e-72    
ref|XP_006681351.1|  hypothetical protein BATDEDRAFT_20546              233   2e-72    
ref|NP_001190616.1|  RAB GTPase homolog H1A                             233   2e-72    
gb|ACQ58631.1|  Ras-related protein Rab-6B                              233   2e-72    
ref|XP_006113737.1|  PREDICTED: ras-related protein Rab-6A-like i...    231   2e-72    
ref|XP_001657423.1|  rab6                                               233   2e-72    
ref|XP_010738107.1|  PREDICTED: ras-related protein Rab-6B              233   2e-72    
ref|XP_007057024.1|  PREDICTED: ras-related protein Rab-6B              231   2e-72    
ref|XP_010901238.1|  PREDICTED: ras-related protein Rab-6B              231   2e-72    
gb|KFP45480.1|  Ras-related protein Rab-6A                              231   3e-72    
ref|XP_007055340.1|  PREDICTED: ras-related protein Rab-6A-like i...    231   3e-72    
emb|CCX05769.1|  Similar to GTP-binding protein ryh1; acc. no. P1...    232   3e-72    
ref|XP_010446557.1|  PREDICTED: ras-related protein RABH1c-like         232   3e-72    
gb|KDR24391.1|  Ras-related protein Rab-6A                              232   3e-72    
ref|XP_010713392.1|  PREDICTED: ras-related protein Rab-41 isofor...    231   3e-72    
ref|XP_007616961.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    234   3e-72    
ref|XP_005997191.1|  PREDICTED: ras-related protein Rab-6B-like i...    232   3e-72    
ref|XP_005165989.1|  PREDICTED: ras-related protein Rab-6B isofor...    234   3e-72    
ref|XP_005804524.1|  PREDICTED: ras-related protein Rab-6B-like         231   4e-72    
ref|XP_008200264.1|  PREDICTED: ras-related protein Rab6 isoform X1     232   4e-72    
gb|KFQ52590.1|  Ras-related protein Rab-6A                              231   4e-72    
ref|XP_002002015.1|  GI14260                                            232   4e-72    
ref|XP_008055750.1|  PREDICTED: ras-related protein Rab-6B isofor...    231   4e-72    
ref|XP_004453944.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    233   4e-72    
gb|KFU88861.1|  Ras-related protein Rab-6A                              231   5e-72    
ref|XP_005429233.1|  PREDICTED: ras-related protein Rab-6A isofor...    232   5e-72    
ref|XP_007055338.1|  PREDICTED: ras-related protein Rab-6A-like i...    231   5e-72    
ref|XP_008499421.1|  PREDICTED: ras-related protein Rab-41 isofor...    231   5e-72    
ref|XP_004768141.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    233   5e-72    
ref|XP_005997190.1|  PREDICTED: ras-related protein Rab-6B-like i...    232   5e-72    
gb|KFV91396.1|  Ras-related protein Rab-6A                              231   5e-72    
ref|XP_006258014.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    233   5e-72    
ref|XP_009685930.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   6e-72    
pdb|4DKX|A  Chain A, Crystal Structure Of The Rab 6a'(Q72l)             232   6e-72    
ref|XP_010126040.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   6e-72    
ref|XP_008104570.1|  PREDICTED: ras-related protein Rab-6B isofor...    230   6e-72    
ref|XP_009994889.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   6e-72    
ref|XP_003639844.2|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    233   6e-72    
gb|AIC62015.1|  RAB6A                                                   231   6e-72    
ref|XP_009574029.1|  PREDICTED: ras-related protein Rab-6A-like i...    230   6e-72    
ref|XP_007571446.1|  PREDICTED: ras-related protein Rab-6B isofor...    231   6e-72    
ref|XP_007253729.1|  PREDICTED: ras-related protein Rab-6B              231   7e-72    
ref|XP_005097179.1|  PREDICTED: ras-related protein Rab-6A-like i...    231   8e-72    
emb|CDS08933.1|  Putative Ras-like protein Rab-6A                       231   9e-72    
ref|NP_001102245.1|  ras-related protein Rab-6B                         230   9e-72    
ref|XP_006008478.1|  PREDICTED: ras-related protein Rab-6B isofor...    231   1e-71    
gb|AJC97114.1|  Rab6A                                                   231   1e-71    
gb|KFP46031.1|  Ras-related protein Rab-6A                              230   1e-71    
ref|XP_004940611.1|  PREDICTED: ras-related protein Rab-6A-like i...    230   1e-71    
ref|XP_006883439.1|  PREDICTED: ras-related protein Rab-6B              229   1e-71    
ref|XP_005178934.1|  PREDICTED: ras-related protein Rab-6A-like         231   1e-71    
ref|NP_001040270.1|  ras small monomeric GTPase Rab6                    231   1e-71    
ref|XP_005303690.1|  PREDICTED: ras-related protein Rab-6B              231   1e-71    
ref|XP_010167810.1|  PREDICTED: ras-related protein Rab-6A isofor...    229   1e-71    
ref|XP_010971415.1|  PREDICTED: ras-related protein Rab-6A              231   1e-71    
ref|XP_009701734.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   1e-71    
ref|XP_010987653.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    232   1e-71    
emb|CDY63926.1|  BnaC07g51320D                                          231   1e-71    
ref|XP_009816706.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   1e-71    
ref|XP_008499422.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   1e-71    
ref|XP_002404303.1|  RAS-related protein, putative                      230   1e-71    
ref|XP_007907782.1|  PREDICTED: ras-related protein Rab-6B isofor...    229   1e-71    
ref|XP_007907717.1|  PREDICTED: ras-related protein Rab-6B isofor...    229   2e-71    
ref|XP_002111346.1|  rab6                                               230   2e-71    
gb|EHH16754.1|  hypothetical protein EGK_12093                          229   2e-71    
gb|KFM81481.1|  Ras-related protein Rab-6A                              230   2e-71    
gb|KFQ83280.1|  Ras-related protein Rab-6A                              229   2e-71    
gb|KFP11843.1|  Ras-related protein Rab-6A                              229   2e-71    
gb|AAH80215.1|  Rab6b protein                                           230   2e-71    
ref|XP_007907914.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   2e-71    
ref|XP_002716636.2|  PREDICTED: ras-related protein Rab-6B              230   2e-71    
ref|XP_010293713.1|  PREDICTED: ras-related protein Rab-41 isofor...    229   2e-71    
ref|XP_009647970.1|  PREDICTED: ras-related protein Rab-41 isofor...    229   2e-71    
gb|ERE74467.1|  ras-related protein Rab-6A-like protein                 229   2e-71    
ref|XP_004419412.1|  PREDICTED: ras-related protein Rab-6B isoform 1    230   2e-71    
ref|XP_003218408.1|  PREDICTED: ras-related protein Rab-6B isofor...    230   3e-71    
ref|XP_005406863.1|  PREDICTED: ras-related protein Rab-6B isofor...    229   3e-71    
ref|XP_007907913.1|  PREDICTED: ras-related protein Rab-41 isofor...    230   3e-71    
ref|XP_004940612.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   3e-71    
ref|XP_005966696.1|  PREDICTED: ras-related protein Rab-6B              230   3e-71    
ref|XP_009044447.1|  hypothetical protein LOTGIDRAFT_230007             229   3e-71    
ref|XP_006759855.1|  PREDICTED: ras-related protein Rab-6B              229   3e-71    
ref|XP_010713391.1|  PREDICTED: ras-related protein Rab-41 isofor...    231   3e-71    
ref|XP_003700005.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   3e-71    
ref|XP_006511800.1|  PREDICTED: ras-related protein Rab-6B isofor...    229   3e-71    
ref|XP_005284563.1|  PREDICTED: ras-related protein Rab-41 isofor...    229   3e-71    
ref|XP_007433445.1|  PREDICTED: ras-related protein Rab-6B              229   3e-71    
ref|XP_006511799.1|  PREDICTED: ras-related protein Rab-6B isofor...    230   3e-71    
ref|XP_005242678.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   3e-71    
ref|XP_009945827.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   3e-71    
gb|EDL16465.1|  RAB6, member RAS oncogene family, isoform CRA_d         228   3e-71    
ref|XP_005709303.1|  Rab family, other                                  228   3e-71    
ref|XP_001147918.2|  PREDICTED: ras-related protein Rab-6B isofor...    229   3e-71    
gb|EWM29714.1|  small gtp-binding protein                               233   4e-71    
ref|XP_005284565.1|  PREDICTED: ras-related protein Rab-41 isofor...    229   4e-71    
ref|XP_006179775.1|  PREDICTED: ras-related protein Rab-6B              229   4e-71    
gb|KFQ22776.1|  Ras-related protein Rab-6A                              228   4e-71    
ref|XP_005612104.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    233   5e-71    
ref|XP_003397813.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   5e-71    
ref|NP_776142.1|  ras-related protein Rab-6B                            229   5e-71    
ref|XP_003497685.1|  PREDICTED: ras-related protein Rab-6B isofor...    227   6e-71    
ref|XP_004482548.1|  PREDICTED: ras-related protein Rab-6B isoform 1    229   6e-71    
gb|ACI68506.1|  Ras-related protein Rab-6B                              229   6e-71    
ref|XP_010182583.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   6e-71    
ref|XP_003971158.1|  PREDICTED: ras-related protein Rab-6A-like i...    229   7e-71    
gb|KFD51416.1|  hypothetical protein M513_07629                         228   8e-71    
ref|XP_006020550.1|  PREDICTED: ras-related protein Rab-6A-like i...    227   8e-71    
ref|XP_005242679.1|  PREDICTED: ras-related protein Rab-6A-like i...    227   8e-71    
ref|XP_009534275.1|  hypothetical protein PHYSODRAFT_254677             228   9e-71    
ref|XP_007520332.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    232   9e-71    
gb|EIE83809.1|  GTP-binding protein Ryh1                                228   1e-70    
ref|XP_010146288.1|  PREDICTED: ras-related protein Rab-6A isofor...    227   1e-70    
ref|XP_002159099.2|  PREDICTED: ras-related protein Rab-6A-like         227   1e-70    
ref|XP_006028124.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    229   1e-70    
gb|KDE07987.1|  hypothetical protein MVLG_01692                         231   1e-70    
gb|KFQ64939.1|  Ras-related protein Rab-6A                              227   1e-70    
ref|XP_001604718.2|  PREDICTED: ras-related protein Rab6 isoform X2     228   1e-70    
ref|XP_003057806.1|  predicted protein                                  228   1e-70    
ref|XP_004573397.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   1e-70    
ref|XP_004067647.1|  PREDICTED: ras-related protein Rab-6B-like i...    228   1e-70    
ref|XP_010016116.1|  PREDICTED: ras-related protein Rab-6A              226   1e-70    
ref|XP_004590102.1|  PREDICTED: ras-related protein Rab-6A              230   1e-70    
ref|XP_005019607.1|  PREDICTED: ras-related protein Rab-6B-like i...    227   2e-70    
ref|XP_008902762.1|  hypothetical protein PPTG_09511                    229   2e-70    
ref|XP_003700004.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   2e-70    
ref|XP_008499423.1|  PREDICTED: ras-related protein Rab-41 isofor...    227   2e-70    
ref|XP_005907901.1|  PREDICTED: ras-related protein Rab-6B isofor...    228   2e-70    
ref|XP_010862960.1|  PREDICTED: ras-related protein Rab-6A isofor...    228   2e-70    
ref|XP_006004997.1|  PREDICTED: ras-related protein Rab-6A isofor...    228   2e-70    
ref|XP_007087511.1|  PREDICTED: ras-related protein Rab-6B              228   2e-70    
ref|XP_009286378.1|  PREDICTED: ras-related protein Rab-6A-like         229   2e-70    
ref|XP_009463524.1|  PREDICTED: ras-related protein Rab-41 isofor...    226   2e-70    
ref|XP_011053230.1|  PREDICTED: ras-related protein Rab6 isoform X2     228   2e-70    
ref|XP_004663384.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   2e-70    
ref|XP_006627860.1|  PREDICTED: ras-related protein Rab-6A-like i...    228   2e-70    
gb|KFW96079.1|  Ras-related protein Rab-6A                              226   2e-70    
gb|ABC68472.1|  Rab6A                                                   228   2e-70    
ref|XP_009498758.1|  PREDICTED: ras-related protein Rab-6A-like i...    226   2e-70    
gb|AAH78662.1|  RAB6B protein                                           227   2e-70    
ref|XP_007244838.1|  PREDICTED: ras-related protein Rab-6A isofor...    227   2e-70    
ref|XP_004940609.1|  PREDICTED: ras-related protein Rab-6A-like i...    227   2e-70    
ref|XP_007173772.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    229   2e-70    
gb|KFM13415.1|  Ras-related protein Rab-6A                              226   2e-70    
ref|XP_003284380.1|  Rab GTPase                                         227   3e-70    
ref|XP_010862958.1|  PREDICTED: ras-related protein Rab-6A isofor...    227   3e-70    
ref|XP_007616574.1|  PREDICTED: ras-related protein Rab-6B isofor...    229   3e-70    
ref|XP_003397812.1|  PREDICTED: ras-related protein Rab-6A-like i...    227   3e-70    
ref|XP_008336817.1|  PREDICTED: ras-related protein Rab-6B isofor...    228   3e-70    
ref|XP_007055337.1|  PREDICTED: ras-related protein Rab-6A-like i...    226   3e-70    
ref|XP_009487879.1|  PREDICTED: ras-related protein Rab-6A-like         226   3e-70    
ref|XP_006004996.1|  PREDICTED: ras-related protein Rab-6A isofor...    227   3e-70    
ref|XP_007244837.1|  PREDICTED: ras-related protein Rab-6A isofor...    227   3e-70    
gb|AFN54651.1|  Rab GTPase                                              227   3e-70    
ref|XP_011053229.1|  PREDICTED: ras-related protein Rab6 isoform X1     227   3e-70    
ref|XP_005723055.1|  PREDICTED: ras-related protein Rab-6B-like i...    226   3e-70    
ref|XP_005019606.1|  PREDICTED: ras-related protein Rab-6B-like i...    226   3e-70    
ref|XP_004300287.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    227   3e-70    
gb|KFV13624.1|  Ras-related protein Rab-6A                              226   3e-70    
ref|XP_005806693.1|  PREDICTED: ras-related protein Rab-6A-like i...    227   4e-70    
gb|EKC28791.1|  Ras-related protein Rab-6B                              227   4e-70    
pdb|3BBP|A  Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex         227   4e-70    
ref|XP_010202459.1|  PREDICTED: ras-related protein Rab-41              226   4e-70    
gb|KFV64588.1|  Ras-related protein Rab-6A                              226   4e-70    
ref|XP_009895161.1|  PREDICTED: ras-related protein Rab-41 isofor...    226   4e-70    
emb|CDY31610.1|  BnaA03g54420D                                          228   4e-70    
ref|NP_001155439.1|  rab6-like                                          227   4e-70    
emb|CBY19305.1|  unnamed protein product                                227   4e-70    



>ref|XP_011097570.1| PREDICTED: ras-related protein RABH1e [Sesamum indicum]
Length=207

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/169 (96%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDGKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT+N  +AEQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTSNAANAEQQGGGCAC  207



>ref|XP_004235062.1| PREDICTED: ras-related protein RABH1e-like [Solanum lycopersicum]
Length=207

 Score =   311 bits (796),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVS EEGDAK+REFGVM++ETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSTEEGDAKSREFGVMYVETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNT+ +EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTSQSEQQGGGCAC  207



>ref|XP_010267966.1| PREDICTED: ras-related protein RABH1e [Nelumbo nucifera]
Length=207

 Score =   310 bits (795),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+R+FGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSRDFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++ +EQQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQSEQQGGGCSC  207



>ref|XP_006366321.1| PREDICTED: ras-related protein RABH1e-like [Solanum tuberosum]
Length=207

 Score =   310 bits (795),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVS EEGDAK+REFGVM++ETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSTEEGDAKSREFGVMYVETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNT+ +EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTSQSEQQGGGCAC  207



>ref|XP_002307084.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_011031015.1| PREDICTED: ras-related protein RABH1e [Populus euphratica]
 gb|EEE94080.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=207

 Score =   310 bits (794),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVI+VLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGGDVIVVLVGNKTDLVDKRQVSIEEGDGKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++ AEQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQAEQQGGGCAC  207



>emb|CDP01457.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/169 (96%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGNDVIIVLVGNKTDLVDKRQVSIEEGDGKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTANSSQTEQQGGGCAC  207



>ref|XP_010269260.1| PREDICTED: ras-related protein RABH1e-like isoform X2 [Nelumbo 
nucifera]
Length=207

 Score =   309 bits (791),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+R+FGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSRDFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTK EDMVDVNLKPT N++ +EQQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKHEDMVDVNLKPTVNSSQSEQQGGGCSC  207



>ref|XP_009342518.1| PREDICTED: ras-related protein RABH1e-like [Pyrus x bretschneideri]
Length=207

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSHTEQQGGGCAC  207



>ref|XP_008353923.1| PREDICTED: ras-related protein RABH1e, partial [Malus domestica]
Length=174

 Score =   307 bits (786),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  6    QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  65

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  66   NTNKWVEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  125

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  126  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSHTEQQGGGCAC  174



>ref|XP_010087594.1| Ras-related protein [Morus notabilis]
 gb|EXB29449.1| Ras-related protein [Morus notabilis]
Length=207

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEV TERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVHTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCAC  207



>ref|XP_003525055.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
 ref|XP_007159658.1| hypothetical protein PHAVU_002G256300g [Phaseolus vulgaris]
 gb|ESW31652.1| hypothetical protein PHAVU_002G256300g [Phaseolus vulgaris]
Length=207

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+REFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSREFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  207



>gb|EYU23989.1| hypothetical protein MIMGU_mgv1a013931mg [Erythranthe guttata]
Length=206

 Score =   308 bits (788),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/169 (95%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  38   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  97

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  98   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDGKAREFGVMFIETSAKAGFN  157

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSST +EDMVDVNLKPT+N++  EQQGGGCAC
Sbjct  158  IKPLFRKIAAALPGMETLSSTNKEDMVDVNLKPTSNSSQMEQQGGGCAC  206



>ref|XP_010547607.1| PREDICTED: ras-related protein RABH1e [Tarenaya hassleriana]
Length=207

 Score =   308 bits (788),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEEGDNKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP+TN++ AEQQ GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPSTNSSQAEQQRGGCAC  207



>ref|XP_008343311.1| PREDICTED: ras-related protein RABH1e [Malus domestica]
Length=207

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT KW+EEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTXKWVEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSHTEQQGGGCAC  207



>ref|XP_003552057.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
Length=207

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQS
Sbjct  37   NYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQS  96

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAG
Sbjct  97   FLNTNKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAG  156

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++ AEQQGGGC+C
Sbjct  157  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQAEQQGGGCSC  207



>ref|XP_006428196.1| hypothetical protein CICLE_v10026499mg [Citrus clementina]
 ref|XP_006464236.1| PREDICTED: ras-related protein RABH1e-like [Citrus sinensis]
 gb|ESR41436.1| hypothetical protein CICLE_v10026499mg [Citrus clementina]
 gb|KDO56562.1| hypothetical protein CISIN_1g028546mg [Citrus sinensis]
Length=207

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTS+WIEEVRTERG DVIIVLVGNKTDLVDKRQVSIEEGD KA+EFGVMFIETSAKAGFN
Sbjct  99   NTSRWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEEGDGKAKEFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCAC  207



>ref|XP_010926288.1| PREDICTED: ras-related protein RABH1e [Elaeis guineensis]
Length=207

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT + + +EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVSASQSEQQSGGCSC  207



>ref|XP_004143465.1| PREDICTED: ras-related protein RABH1e-like [Cucumis sativus]
 ref|XP_004160133.1| PREDICTED: ras-related protein RABH1e-like [Cucumis sativus]
 ref|XP_008440593.1| PREDICTED: ras-related protein RABH1e [Cucumis melo]
 gb|KGN48748.1| hypothetical protein Csa_6G500400 [Cucumis sativus]
Length=207

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+REFGVMFIETSAKAGFN
Sbjct  99   NTTKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSST+QEDMVDVNLKP  N++ +EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTRQEDMVDVNLKPAVNSSQSEQQGGGCAC  207



>ref|XP_004288200.1| PREDICTED: ras-related protein RABH1e-like [Fragaria vesca subsp. 
vesca]
Length=207

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 168/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA++LPGMETLSSTKQEDMVDVNLKPT N+++A+QQGGGCAC
Sbjct  159  IKPLFRKIASSLPGMETLSSTKQEDMVDVNLKPTVNSSNADQQGGGCAC  207



>ref|XP_007047951.1| RAB GTPase H1E isoform 1 [Theobroma cacao]
 gb|EOX92108.1| RAB GTPase H1E isoform 1 [Theobroma cacao]
Length=208

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 165/170 (97%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTN-SAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++   EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQKTEQQGGGCAC  208



>ref|XP_010916878.1| PREDICTED: ras-related protein RABH1e-like [Elaeis guineensis]
Length=207

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEV TERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVHTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKAREVGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT NT+  EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNTSQTEQQSGGCSC  207



>ref|XP_002531261.1| protein with unknown function [Ricinus communis]
 gb|EEF31125.1| protein with unknown function [Ricinus communis]
Length=207

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVI+VLVGNKTDLVDKRQVSIEEGD KA+EFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEGDNKAKEFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSSTKQEDMVDVNLKP+ N++  EQQGGGCAC
Sbjct  159  IKPLFRKIASALPGMETLSSTKQEDMVDVNLKPSVNSSQNEQQGGGCAC  207



>ref|XP_009593307.1| PREDICTED: ras-related protein RABH1e [Nicotiana tomentosiformis]
Length=207

 Score =   306 bits (783),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KAREF +MFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGETKAREFNIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPT+N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTSNSSHTEQQGGGCAC  207



>gb|KHN44343.1| Ras-related protein RABH1e [Glycine soja]
Length=207

 Score =   306 bits (783),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQS
Sbjct  37   NYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQS  96

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAG
Sbjct  97   FLNTNKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAG  156

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  157  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  207



>ref|XP_003531349.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
 gb|KHN29057.1| Ras-related protein RABH1e [Glycine soja]
Length=207

 Score =   305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+REFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSREFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+LSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMESLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  207



>ref|XP_010025451.1| PREDICTED: ras-related protein RABH1e [Eucalyptus grandis]
 gb|KCW62115.1| hypothetical protein EUGRSUZ_H04781 [Eucalyptus grandis]
Length=207

 Score =   305 bits (781),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIE+GDAKAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEDGDAKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETL+STKQEDMVDVNLKPT N++  E QGGGC C
Sbjct  159  IKPLFRKIAAALPGMETLNSTKQEDMVDVNLKPTVNSSQNENQGGGCPC  207



>ref|XP_004240017.1| PREDICTED: ras-related protein RABH1e [Solanum lycopersicum]
Length=207

 Score =   305 bits (781),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLV+KRQVSIEEG++KAREF VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGTDVIIVLVGNKTDLVEKRQVSIEEGESKAREFNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPTT++++AEQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTTSSSNAEQQGGGCAC  207



>gb|ABK23720.1| unknown [Picea sitchensis]
Length=207

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++WIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN
Sbjct  99   NTARWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++ AEQ+ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQAEQKAGGCSC  207



>ref|XP_009764281.1| PREDICTED: ras-related protein RABH1e [Nicotiana sylvestris]
Length=207

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KAREF VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGETKAREFNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPT++++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTSSSSHTEQQGGGCAC  207



>ref|XP_004504075.1| PREDICTED: ras-related protein RABH1e-like [Cicer arietinum]
Length=207

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVR ERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+REFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRQERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSREFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  159  IKPLFRKIASALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  207



>ref|XP_010519539.1| PREDICTED: ras-related protein RABH1e-like [Tarenaya hassleriana]
Length=207

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSF 
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFF  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA ALPGMETLSSTKQEDMVDVNLKP+ N++ AEQQ GGCAC
Sbjct  159  IKPLFRKIAGALPGMETLSSTKQEDMVDVNLKPSANSSQAEQQRGGCAC  207



>ref|XP_006355553.1| PREDICTED: ras-related protein RABH1e-like [Solanum tuberosum]
Length=207

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLV+KRQVSIEEG+ KAREF VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGTDVIIVLVGNKTDLVEKRQVSIEEGETKAREFNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPTT++++AEQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTTSSSNAEQQGGGCAC  207



>emb|CBI25776.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV NRQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVGNRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD K+R+FGVMFIETSAKAGFN
Sbjct  70   NTSKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDTKSRDFGVMFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSSTKQEDMVDVNLKP+ N++  EQQGGGCAC
Sbjct  130  IKPLFRKIASALPGMETLSSTKQEDMVDVNLKPSVNSSQTEQQGGGCAC  178



>gb|KDP46827.1| hypothetical protein JCGZ_24036 [Jatropha curcas]
Length=207

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSF 
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFF  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD+KA+EFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDSKAKEFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSSTKQEDMVDVNL+ T N++ +EQQGGGCAC
Sbjct  159  IKPLFRKIASALPGMETLSSTKQEDMVDVNLRSTVNSSQSEQQGGGCAC  207



>gb|EPS66071.1| hypothetical protein M569_08708, partial [Genlisea aurea]
Length=206

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  38   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  97

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGD KAREFGVMFIE SAKAGFN
Sbjct  98   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDMKAREFGVMFIEASAKAGFN  157

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQE+MVDVNLKPT+N    EQQGGGCAC
Sbjct  158  IKPLFRKIAAALPGMETLSSTKQEEMVDVNLKPTSNAYQNEQQGGGCAC  206



>ref|XP_009340511.1| PREDICTED: ras-related protein RABH1e [Pyrus x bretschneideri]
Length=207

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNL+ T N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLRATVNSSQTEQQGGGCAC  207



>ref|XP_002271220.2| PREDICTED: ras-related protein RABH1e [Vitis vinifera]
Length=207

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV NRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVGNRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD K+R+FGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDTKSRDFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSSTKQEDMVDVNLKP+ N++  EQQGGGCAC
Sbjct  159  IKPLFRKIASALPGMETLSSTKQEDMVDVNLKPSVNSSQTEQQGGGCAC  207



>ref|XP_011090551.1| PREDICTED: ras-related protein RABH1e-like [Sesamum indicum]
Length=207

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVIIVLVGNKTDLVDKRQVSIE+GD KARE GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEDGDGKARESGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPT+N N  +QQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTSNANQNDQQGGGCAC  207



>ref|XP_006591505.1| PREDICTED: ras-related protein RABH1e-like isoform X1 [Glycine 
max]
Length=212

 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  44   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  103

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAGFN
Sbjct  104  NTNKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAGFN  163

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  164  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  212



>ref|XP_008782142.1| PREDICTED: ras-related protein RABH1e [Phoenix dactylifera]
Length=207

 Score =   302 bits (774),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVLVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAREFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETL S+KQEDMVDVNLKPT   +  EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLPSSKQEDMVDVNLKPTVTASQTEQQSGGCSC  207



>ref|XP_009802532.1| PREDICTED: ras-related protein RABH1e [Nicotiana sylvestris]
Length=207

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/169 (94%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVS EEGDAKARE GVM+IETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSTEEGDAKAREVGVMYIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTK EDMVDVNLKPTTNT+  EQQGG C C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKGEDMVDVNLKPTTNTSQNEQQGGDCVC  207



>ref|XP_007205911.1| hypothetical protein PRUPE_ppa011539mg [Prunus persica]
 gb|EMJ07110.1| hypothetical protein PRUPE_ppa011539mg [Prunus persica]
Length=206

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 165/169 (98%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPTTN++  EQQ GGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTTNSSHTEQQ-GGCAC  206



>ref|XP_010269259.1| PREDICTED: ras-related protein RABH1e-like isoform X1 [Nelumbo 
nucifera]
Length=214

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 166/176 (94%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLW-------DTAGQERFRSLIPSYIRdssvavvvydv  455
            QATIGIDFLSKTMYLEDRTVRLQLW       DTAGQERFRSLIPSYIRDSSVAVVVYDV
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWYAFFIFWDTAGQERFRSLIPSYIRDSSVAVVVYDV  98

Query  456  aNRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIET  635
            ANRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+R+FGVMFIET
Sbjct  99   ANRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSRDFGVMFIET  158

Query  636  SAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            SAKAGFNIKPLFRKIAAALPGMETLSSTK EDMVDVNLKPT N++ +EQQGGGC+C
Sbjct  159  SAKAGFNIKPLFRKIAAALPGMETLSSTKHEDMVDVNLKPTVNSSQSEQQGGGCSC  214



>ref|XP_009338093.1| PREDICTED: ras-related protein RABH1e-like [Pyrus x bretschneideri]
Length=207

 Score =   300 bits (769),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMY   RTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYTMYRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSHTEQQGGGCAC  207



>gb|KHG04027.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=207

 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKW+EEVRTERGSDVIIVLVGNKTDLVDKRQVSI+EGD+KARE GVMFIETSAKAGFN
Sbjct  99   NTSKWMEEVRTERGSDVIIVLVGNKTDLVDKRQVSIQEGDSKARELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQ+DMVDVNLK T N++  EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMERLSSTKQDDMVDVNLKSTVNSSQIEQQGGGCAC  207



>ref|XP_004502420.1| PREDICTED: ras-related protein RABH1e-like [Cicer arietinum]
Length=207

 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERGSDV+IVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAGFN
Sbjct  99   NTNRWVEEVRTERGSDVVIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK TTN++  EQQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKSTTNSSQTEQQGGGCSC  207



>ref|XP_008234005.1| PREDICTED: ras-related protein RABH1e [Prunus mume]
Length=206

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 164/169 (97%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD+K+REFGVMFIETSAKAGFN
Sbjct  99   NTNKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDSKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLKPT N++  EQQ GGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKPTINSSHTEQQ-GGCAC  206



>ref|XP_010532473.1| PREDICTED: ras-related protein RABH1e-like [Tarenaya hassleriana]
Length=207

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++WIEEVRTERG DVIIVLVGNKTDLV+KRQVSIEEGD KAREFGVMFIETSAKAGFN
Sbjct  99   NTTRWIEEVRTERGGDVIIVLVGNKTDLVEKRQVSIEEGDNKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA ALPGMETLSSTKQEDMVDVNLKP+TN++ +EQQ GGC+C
Sbjct  159  IKPLFRKIAGALPGMETLSSTKQEDMVDVNLKPSTNSSQSEQQRGGCSC  207



>ref|XP_008795552.1| PREDICTED: ras-related protein RABH1e [Phoenix dactylifera]
Length=207

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWIEEV TERG DVIIVLVGNKTDLVDKRQVSIEEG+AKAREFGVMFIETSAKAGFN
Sbjct  99   STSKWIEEVHTERGGDVIIVLVGNKTDLVDKRQVSIEEGEAKAREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT + +  EQ+ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVSASEMEQKSGGCSC  207



>ref|XP_006288665.1| hypothetical protein CARUB_v10001971mg [Capsella rubella]
 gb|EOA21563.1| hypothetical protein CARUB_v10001971mg [Capsella rubella]
Length=207

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR++GV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK +TN++  EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKASTNSSQGEQQRGGCSC  207



>ref|XP_002871412.1| hypothetical protein ARALYDRAFT_487852 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010422866.1| PREDICTED: ras-related protein RABH1e isoform X1 [Camelina sativa]
 ref|XP_010422867.1| PREDICTED: ras-related protein RABH1e isoform X2 [Camelina sativa]
 ref|XP_010491685.1| PREDICTED: ras-related protein RABH1e [Camelina sativa]
 gb|EFH47671.1| hypothetical protein ARALYDRAFT_487852 [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   298 bits (763),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR++GV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK +TN++  EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKTSTNSSQGEQQRGGCSC  207



>gb|AAW70387.1| At5g10260 [Arabidopsis thaliana]
 gb|ABD60712.1| At5g10260 [Arabidopsis thaliana]
Length=178

 Score =   296 bits (759),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR++GV+FIETSAKAGFN
Sbjct  70   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDYGVIFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK ++N+   EQQ GGCAC
Sbjct  130  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKTSSNSAQGEQQRGGCAC  178



>ref|NP_196588.3| ras-related protein RABH1e [Arabidopsis thaliana]
 sp|Q9LFT9.1|RAH1E_ARATH RecName: Full=Ras-related protein RABH1e; Short=AtRABH1e [Arabidopsis 
thaliana]
 emb|CAB96682.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AED91514.1| ras-related protein RABH1e [Arabidopsis thaliana]
Length=207

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR++GV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK ++N+   EQQ GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKTSSNSAQGEQQRGGCAC  207



>ref|XP_006399521.1| hypothetical protein EUTSA_v10014689mg [Eutrema salsugineum]
 gb|ESQ40974.1| hypothetical protein EUTSA_v10014689mg [Eutrema salsugineum]
Length=207

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTLRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+F+ETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFMETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKI+A+LPGME+LSSTKQ+DMVDVNLKP+TN++ AEQQ GGC+C
Sbjct  159  IKPLFRKISASLPGMESLSSTKQDDMVDVNLKPSTNSSQAEQQRGGCSC  207



>gb|KEH20835.1| RAB GTPase-like protein B1C [Medicago truncatula]
Length=207

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVR ERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK++EFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRQERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSKEFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSST +EDMVDVNLKPT ++++ EQQGGGC+C
Sbjct  159  IKPLFRKIASALPGMETLSSTNKEDMVDVNLKPTVHSSNTEQQGGGCSC  207



>ref|XP_010453053.1| PREDICTED: ras-related protein RABH1e-like [Camelina sativa]
Length=207

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR++GV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK +TN +  EQQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKTSTNASQGEQQRGGCSC  207



>ref|XP_010680547.1| PREDICTED: ras-related protein RABH1e [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV+NRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR+ GV+F+ETSAKAGFN
Sbjct  99   STSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDAGVIFLETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA++LPGMETLSSTKQEDMVDVNLKP +N++ +EQQGGGC C
Sbjct  159  IKPLFRKIASSLPGMETLSSTKQEDMVDVNLKPHSNSSQSEQQGGGCPC  207



>gb|KHG21500.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=208

 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 164/170 (96%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLED TVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDGTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKW+EEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KA+EFG+MFIETSAKAGFN
Sbjct  99   NTSKWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKAKEFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTN-SAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK + N++ + EQQGGGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKSSGNSSQNTEQQGGGCAC  208



>gb|AFK44388.1| unknown [Medicago truncatula]
Length=207

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQ WDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQPWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVR ERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK++EFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRQERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSKEFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGMETLSST +EDMVDVNLKPT ++++ EQQGGGC+C
Sbjct  159  IKPLFRKIASALPGMETLSSTNKEDMVDVNLKPTVHSSNTEQQGGGCSC  207



>ref|XP_006838450.1| hypothetical protein AMTR_s00002p00134180 [Amborella trichopoda]
 gb|ERN01019.1| hypothetical protein AMTR_s00002p00134180 [Amborella trichopoda]
Length=208

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  NT+  +QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKATNANTSQGQQQAGGCSC  208



>ref|XP_002878607.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54866.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK EDMVDVNLKPT+N++  +QQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKNEDMVDVNLKPTSNSSQGDQQGGGCSC  207



>gb|KCW76817.1| hypothetical protein EUGRSUZ_D01171 [Eucalyptus grandis]
Length=179

 Score =   289 bits (740),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  70   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTT-NTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N + ++QQ GGCAC
Sbjct  130  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTNPNASQSQQQSGGCAC  179



>ref|XP_011093480.1| PREDICTED: ras-related protein RABH1b [Sesamum indicum]
Length=208

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK + TN + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNTNASQSQQQSGGCAC  208



>emb|CDX96987.1| BnaC09g46380D [Brassica napus]
Length=206

 Score =   290 bits (742),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 163/169 (96%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMY+EDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYMEDRTLRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKI+AALPGM+TL STKQ DMVDVNLK +TN + AEQQGGGC+C
Sbjct  159  IKPLFRKISAALPGMDTL-STKQGDMVDVNLKSSTNASQAEQQGGGCSC  206



>ref|XP_007052416.1| Ras-related small GTP-binding family protein [Theobroma cacao]
 gb|EOX96573.1| Ras-related small GTP-binding family protein [Theobroma cacao]
Length=208

 Score =   290 bits (742),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTNANASQSQQQSGGCAC  208



>ref|XP_009404050.1| PREDICTED: ras-related protein RABH1e [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   290 bits (741),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+ YDV+NRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIAYDVSNRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVIIVLVGNKTDLV+KRQVS E+G+ K+REFGVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGGDVIIVLVGNKTDLVEKRQVSTEDGETKSREFGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAA+LPGMETL+STKQEDMVDVNLK T ++   +QQ GGC+C
Sbjct  159  IKPLFRKIAASLPGMETLASTKQEDMVDVNLKSTVSSTQTQQQSGGCSC  207



>ref|XP_009390286.1| PREDICTED: ras-related protein RABH1e-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   290 bits (741),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV+NRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWIEEV TERG DVIIVLVGNKTDLVDKRQVS EEG+AKARE GVMFIETSAKAGFN
Sbjct  99   STSKWIEEVHTERGGDVIIVLVGNKTDLVDKRQVSTEEGEAKAREVGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAA+LPGMETL+S KQEDMVDVNLKPT ++   +QQ GGC+C
Sbjct  159  IKPLFRKIAASLPGMETLASAKQEDMVDVNLKPTVSSPETQQQSGGCSC  207



>ref|XP_010052745.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABH1b [Eucalyptus 
grandis]
Length=210

 Score =   290 bits (741),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  101  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTT-NTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N + ++QQ GGCAC
Sbjct  161  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTNPNASQSQQQSGGCAC  210



>emb|CDP09376.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK + TN + A+QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNTNASQAQQQSGGCAC  208



>gb|KHG08795.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=208

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+ YDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD KARE GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGTDVIIVLVGNKTDLVDKRQVSIEEGDGKARELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNT-NSAEQQGGGCAC  803
            IKPLFRKIAAALPGM +LSSTKQ+DMVDVNLK + N+  + +Q+GGGCAC
Sbjct  159  IKPLFRKIAAALPGMGSLSSTKQDDMVDVNLKSSGNSYQNPDQKGGGCAC  208



>gb|KFK32828.1| hypothetical protein AALP_AA6G292500 [Arabis alpina]
Length=207

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK +DMVDVNLKPTT ++  +QQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKTDDMVDVNLKPTTKSSQGDQQGGGCSC  207



>ref|XP_007218411.1| hypothetical protein PRUPE_ppa011501mg [Prunus persica]
 gb|EMJ19610.1| hypothetical protein PRUPE_ppa011501mg [Prunus persica]
Length=208

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 162/171 (95%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK ++N NS+E Q   GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLK-SSNANSSESQAQSGGCAC  208



>gb|KFK25343.1| hypothetical protein AALP_AA8G100400 [Arabis alpina]
Length=206

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTLRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKI+AALPGME LS+ KQ DMVDVNLKP+TN++  EQQ GGCAC
Sbjct  159  IKPLFRKISAALPGMEALSA-KQGDMVDVNLKPSTNSSQGEQQRGGCAC  206



>ref|XP_011085344.1| PREDICTED: ras-related protein RABH1b-like [Sesamum indicum]
Length=208

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 164/171 (96%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA--EQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK ++NTN+A  +QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLK-SSNTNAAQSQQQSGGCAC  208



>gb|KFK37266.1| hypothetical protein AALP_AA4G235100 [Arabis alpina]
Length=208

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N +SA+QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASSAQQQSGGCAC  208



>gb|ADM76369.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76370.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76371.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76372.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76373.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76374.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76375.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76376.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76377.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76378.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76379.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76380.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76381.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76382.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76383.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76384.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76385.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76386.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76387.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76388.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76389.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76390.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76391.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76392.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76393.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76394.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76395.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76396.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76397.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76398.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76399.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76400.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76401.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76402.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76403.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76404.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76405.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76406.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76407.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76408.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76409.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76410.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76411.1| Rab-like protein, partial [Picea sitchensis]
 gb|ADM76412.1| Rab-like protein, partial [Picea sitchensis]
Length=160

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  324  SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLNTSKWIEEV  503
            SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVANRQSFLNT++WIEEV
Sbjct  1    SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFLNTARWIEEV  60

Query  504  RTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIA  683
            RTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIK LFRKIA
Sbjct  61   RTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKALFRKIA  120

Query  684  AALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            AALPGMETLSSTKQEDMVDVNLKPT N++ AEQ+ GGC+C
Sbjct  121  AALPGMETLSSTKQEDMVDVNLKPTVNSSQAEQKAGGCSC  160



>ref|XP_008784700.1| PREDICTED: ras-related protein RABH1b isoform X1 [Phoenix dactylifera]
Length=208

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 162/171 (95%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK  TN NS++ QG  GGC C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKA-TNVNSSQSQGPSGGCNC  208



>ref|XP_006404685.1| hypothetical protein EUTSA_v10000663mg [Eutrema salsugineum]
 gb|ESQ46138.1| hypothetical protein EUTSA_v10000663mg [Eutrema salsugineum]
Length=207

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK EDMVDVNLKPT+N++  +QQG GC+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKTEDMVDVNLKPTSNSSQGDQQGVGCSC  207



>ref|XP_009131149.1| PREDICTED: ras-related protein RABH1e [Brassica rapa]
 emb|CDX81166.1| BnaC03g04200D [Brassica napus]
 emb|CDX78373.1| BnaA03g02850D [Brassica napus]
Length=207

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTLRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKW+E+VRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+FIETSAKAGFN
Sbjct  99   NTSKWVEDVRTERGNDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKI+AALPGM+TLSS KQ DMVDVNLK + +++ AEQQ GGC+C
Sbjct  159  IKPLFRKISAALPGMDTLSSAKQGDMVDVNLKSSNHSSQAEQQSGGCSC  207



>ref|XP_004229706.1| PREDICTED: ras-related protein RABH1b [Solanum lycopersicum]
Length=208

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 163/171 (95%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK ++N+N+A+ Q   GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLK-SSNSNAAQSQAQSGGCAC  208



>ref|NP_179816.1| RAB GTPase-like protein H1D [Arabidopsis thaliana]
 sp|Q9SID8.1|RAH1D_ARATH RecName: Full=Ras-related protein RABH1d; Short=AtRABH1d [Arabidopsis 
thaliana]
 gb|AAD23614.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AEC07288.1| RAB GTPase-like protein H1D [Arabidopsis thaliana]
Length=207

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR ER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK EDMVDVNLKPT+N++  +QQGG C+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKNEDMVDVNLKPTSNSSQGDQQGGACSC  207



>ref|XP_009766624.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
 ref|XP_009766625.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
Length=208

 Score =   287 bits (735),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTT-NTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK +  N + ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNPNASQSQPQSGGCAC  208



>ref|XP_006445482.1| hypothetical protein CICLE_v10022269mg [Citrus clementina]
 ref|XP_006464378.1| PREDICTED: ras-related protein RABH1b-like [Citrus sinensis]
 gb|ESR58722.1| hypothetical protein CICLE_v10022269mg [Citrus clementina]
 gb|KDO85413.1| hypothetical protein CISIN_1g028466mg [Citrus sinensis]
Length=208

 Score =   287 bits (735),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQED+VDVNLK + TNT+ ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDLVDVNLKSSNTNTSQSQPQSGGCAC  208



>ref|XP_002526504.1| protein with unknown function [Ricinus communis]
 gb|EEF35895.1| protein with unknown function [Ricinus communis]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK + TN + ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNTNASQSQPQSGGCAC  208



>gb|EYU42316.1| hypothetical protein MIMGU_mgv1a013870mg [Erythranthe guttata]
 gb|EYU45202.1| hypothetical protein MIMGU_mgv1a013879mg [Erythranthe guttata]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK + TN + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNTNASQSQQQSGGCAC  208



>ref|XP_009790571.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK + TN + ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNTNASQSQAQSGGCAC  208



>ref|XP_009142275.1| PREDICTED: ras-related protein RABH1b-like [Brassica rapa]
 emb|CDY30479.1| BnaA04g25800D [Brassica napus]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTAKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N +SA+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASSAQQQSGGCSC  208



>ref|XP_006397642.1| hypothetical protein EUTSA_v10001633mg [Eutrema salsugineum]
 gb|ESQ39095.1| hypothetical protein EUTSA_v10001633mg [Eutrema salsugineum]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N +SA+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASSAQQQSGGCSC  208



>ref|XP_009604156.1| PREDICTED: ras-related protein RABH1b-like [Nicotiana tomentosiformis]
Length=208

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK + +N   ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNSNAFQSQPQSGGCAC  208



>ref|XP_010933532.1| PREDICTED: ras-related protein RABH1b-like [Elaeis guineensis]
Length=208

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 161/171 (94%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSSRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            +K LFRKIAAALPGMETLSSTKQEDMVDVNLK T+  NS + QG  GGC C
Sbjct  159  VKALFRKIAAALPGMETLSSTKQEDMVDVNLKATS-ANSTQSQGPSGGCNC  208



>ref|XP_011032019.1| PREDICTED: ras-related protein RABH1b-like [Populus euphratica]
Length=208

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLK T  + S  Q Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKSTAGSASQTQAQSGGCAC  208



>ref|XP_008784702.1| PREDICTED: ras-related protein RABH1b isoform X2 [Phoenix dactylifera]
Length=208

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 161/171 (94%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QVTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK  TN NS++ QG  GGC C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKA-TNVNSSQSQGPSGGCNC  208



>ref|XP_010472219.1| PREDICTED: ras-related protein RABH1d [Camelina sativa]
Length=207

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR ER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GV+FIETSAKAGFN
Sbjct  99   NTSKWIEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK +DMVDVNLKPT+N++  +QQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKTDDMVDVNLKPTSNSSQGDQQGGGCSC  207



>ref|XP_006385600.1| hypothetical protein POPTR_0003s08490g [Populus trichocarpa]
 gb|ERP63397.1| hypothetical protein POPTR_0003s08490g [Populus trichocarpa]
Length=179

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  70   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IKPLFRKIAAALPGME LSSTKQEDMVDVNLK T  + S  Q Q GGCAC
Sbjct  130  IKPLFRKIAAALPGMEALSSTKQEDMVDVNLKSTGGSASQNQAQSGGCAC  179



>ref|XP_008784703.1| PREDICTED: ras-related protein RABH1b isoform X3 [Phoenix dactylifera]
Length=208

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 161/171 (94%), Gaps = 3/171 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVD RQVSIEEG+AKAR+ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDNRQVSIEEGEAKARDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQG--GGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK  TN NS++ QG  GGC C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKA-TNVNSSQSQGPSGGCNC  208



>ref|XP_002528787.1| protein with unknown function [Ricinus communis]
 gb|EEF33609.1| protein with unknown function [Ricinus communis]
Length=208

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T+ T S  Q Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTSKTASQSQAQSGGCAC  208



>ref|XP_009400213.1| PREDICTED: ras-related protein RABH1b [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIV+VGNKTDLVDKRQVSIEEG+AKA+E GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVVVGNKTDLVDKRQVSIEEGEAKAQELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSST+QEDMVDVNLK T  N+  ++QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMENLSSTRQEDMVDVNLKATNANSYQSQQQSGGCSC  208



>ref|XP_002302484.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_011017314.1| PREDICTED: ras-related protein RABH1b [Populus euphratica]
 gb|EEE81757.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=208

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS+KQEDMVDVNLK +  N + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSSKQEDMVDVNLKSSNANASQSQQQSGGCAC  208



>ref|XP_010559077.1| PREDICTED: ras-related protein RABH1b [Tarenaya hassleriana]
Length=208

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVI+VLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIVVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQE+MVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEEMVDVNLKSSNANASQAQQQSGGCSC  208



>gb|KHN06578.1| Ras-related protein RABH1e [Glycine soja]
Length=157

 Score =   284 bits (726),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +3

Query  333  MYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLNTSKWIEEVRTE  512
            MYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFLNT+KW+EEVRTE
Sbjct  1    MYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRTE  60

Query  513  RGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAAAL  692
            RGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+REFG+MFIETSAKAGFNIKPLFRKIAAAL
Sbjct  61   RGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSREFGIMFIETSAKAGFNIKPLFRKIAAAL  120

Query  693  PGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            PGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  121  PGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  157



>ref|XP_010677218.1| PREDICTED: ras-related protein RABH1b [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDV+LK T++   ++ QG GCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVSLKSTSSAPQSQPQGSGCAC  207



>ref|XP_010269896.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
 ref|XP_010269897.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
 ref|XP_010269898.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
Length=208

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK TT   S  Q Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTTGGASQSQPQSGGCSC  208



>ref|XP_009122071.1| PREDICTED: ras-related protein RABH1e [Brassica rapa]
 gb|AAZ67607.1| 80A08_22 [Brassica rapa subsp. pekinensis]
 emb|CDX69850.1| BnaA10g21990D [Brassica napus]
Length=206

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMY+EDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYMEDRTLRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIE+VRTERGSDVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+FIETSAKAGFN
Sbjct  99   NTSKWIEDVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKI+AALPGM+TL ST+Q DMVDVNL+ +TN +  EQQGGGC+C
Sbjct  159  IKPLFRKISAALPGMDTL-STRQGDMVDVNLRSSTNASQGEQQGGGCSC  206



>ref|XP_009592200.1| PREDICTED: ras-related protein RABH1b [Nicotiana tomentosiformis]
Length=208

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK +  N + ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANASQSQAQSGGCAC  208



>ref|XP_009112539.1| PREDICTED: ras-related protein RABH1d [Brassica rapa]
 emb|CDY13772.1| BnaA09g42740D [Brassica napus]
Length=207

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLVDKRQVSIEEGD+K RE+GV+FIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERAGDVIIVLVGNKTDLVDKRQVSIEEGDSKGREYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGM++ S+ K EDMVDVNLK T+N++  +QQGGGC+C
Sbjct  159  IKPLFRKIAAALPGMDSYSNMKTEDMVDVNLKATSNSSQGDQQGGGCSC  207



>gb|KHG03959.1| Ras-related RABH1b -like protein [Gossypium arboreum]
Length=208

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSF 
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQ  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEE +AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEAEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTNANASQSQQQSGGCAC  208



>ref|XP_009390643.1| PREDICTED: ras-related protein RABH1b-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKA+E GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKAQELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSSTKQEDMVDVNL+ T  N+  ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMENLSSTKQEDMVDVNLRATNANSYQSQSQSGGCSC  208



>gb|AES72198.2| RAB GTPase-like protein B1C [Medicago truncatula]
Length=206

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 161/169 (95%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVR ERGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRAERGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGME+L STKQ+DMVDVNLK T  ++  EQQGGGC+C
Sbjct  159  IKPLFRKIASALPGMESL-STKQDDMVDVNLKSTAYSSRTEQQGGGCSC  206



>emb|CDX74672.1| BnaA05g04180D [Brassica napus]
Length=208

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELSVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQQQSGGCSC  208



>ref|XP_009143050.1| PREDICTED: ras-related protein RABH1b [Brassica rapa]
Length=208

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELSVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQQQSGGCSC  208



>ref|XP_010524453.1| PREDICTED: ras-related protein RABH1b-like [Tarenaya hassleriana]
Length=208

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIA ALPGMETLSSTKQEDMVDVNLK +  N + A QQ GGC+C
Sbjct  159  IKALFRKIAGALPGMETLSSTKQEDMVDVNLKSSNANASQAHQQPGGCSC  208



>ref|NP_181989.1| Ras-related protein RABH1B [Arabidopsis thaliana]
 ref|XP_002881970.1| hypothetical protein ARALYDRAFT_903887 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O80501.1|RAH1B_ARATH RecName: Full=Ras-related protein RABH1b; Short=AtRABH1b; AltName: 
Full=Ras-related protein Rab6A; Short=AtRab6A [Arabidopsis 
thaliana]
 gb|AAC27463.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|AAM65455.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|ABF83670.1| At2g44610 [Arabidopsis thaliana]
 dbj|BAE99055.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|EFH58229.1| hypothetical protein ARALYDRAFT_903887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10447.1| Ras-related protein RABH1B [Arabidopsis thaliana]
 emb|CDY48241.1| BnaC04g05000D [Brassica napus]
 emb|CDX95606.1| BnaC03g24870D [Brassica napus]
 emb|CDX83425.1| BnaA03g20810D [Brassica napus]
 prf||2008312A GTP-binding protein
Length=208

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQQQSGGCSC  208



>ref|XP_010531376.1| PREDICTED: ras-related protein RABH1d [Tarenaya hassleriana]
Length=207

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTS+WIEEVRTERG DVIIVLVGNKTDLV+KRQVSIEEGD+KARE+GVMFIETSAKAGFN
Sbjct  99   NTSRWIEEVRTERGGDVIIVLVGNKTDLVEKRQVSIEEGDSKAREYGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIA+ALPGM + + TK EDMVDVNLKPT+N++  +Q  GGC+C
Sbjct  159  IKPLFRKIASALPGMGSYTPTKSEDMVDVNLKPTSNSSQPQQAAGGCSC  207



>gb|KDP45957.1| hypothetical protein JCGZ_11860 [Jatropha curcas]
Length=208

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T+ + S  Q Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTSGSASQSQGQSGGCAC  208



>gb|KDP28909.1| hypothetical protein JCGZ_14680 [Jatropha curcas]
Length=208

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+ QSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASQSQAQSGGCAC  208



>emb|CBI16724.3| unnamed protein product [Vitis vinifera]
Length=179

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  70   NTAKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK + TN + ++ Q GGC+C
Sbjct  130  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNTNASQSQPQAGGCSC  179



>ref|XP_002968288.1| rab family GTPase [Selaginella moellendorffii]
 ref|XP_002976089.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ22994.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ30542.1| rab family GTPase [Selaginella moellendorffii]
Length=209

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 159/169 (94%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFL  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVM+IETSAKAGFN
Sbjct  103  NTARWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMYIETSAKAGFN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS KQED+VDV+LK  TN   +E + GGCAC
Sbjct  163  IKALFRKIAAALPGMEALSSAKQEDLVDVSLK--TNPPPSETKAGGCAC  209



>ref|XP_010661434.1| PREDICTED: ras-related protein RABH1b [Vitis vinifera]
Length=208

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK + TN + ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNTNASQSQPQAGGCSC  208



>ref|XP_010429146.1| PREDICTED: ras-related protein RABH1d-like [Camelina sativa]
Length=207

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR ER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GV+FIETSAKAGFN
Sbjct  99   NTSKWIEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK +DMVDVNLKPT+N++  +QQ GGC+C
Sbjct  159  IKPLFRKIAAALPGMESYSNTKTDDMVDVNLKPTSNSSQGDQQVGGCSC  207



>gb|AAA74117.1| putative [Nicotiana tabacum]
Length=208

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTV LQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVALQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK +  N + ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANASQSQAQSGGCAC  208



>gb|KHG27267.1| Ras-related RABH1b -like protein [Gossypium arboreum]
Length=208

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSF 
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQ  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVS+EE +AKAR+  VMFIETSAKAGFN
Sbjct  99   NTTKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSVEEAEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N++ ++Q+ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTNANSSQSQQEAGGCAC  208



>ref|XP_006294994.1| hypothetical protein CARUB_v10024066mg [Capsella rubella]
 gb|EOA27892.1| hypothetical protein CARUB_v10024066mg [Capsella rubella]
Length=208

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLV+KRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVEKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQQQSGGCSC  208



>ref|XP_003517383.1| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN42638.1| Ras-related protein RABH1b [Glycine soja]
Length=207

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK TT +  ++ Q  GCAC
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSTTGSAQSQPQPSGCAC  207



>ref|XP_006853127.1| hypothetical protein AMTR_s00038p00155900 [Amborella trichopoda]
 gb|ERN14594.1| hypothetical protein AMTR_s00038p00155900 [Amborella trichopoda]
Length=335

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+ YDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT KWIEEVRTERGSDVIIVLVGNKTDLVDKRQVS+EEGDAKA + GVMFIETSAKAG N
Sbjct  99   NTPKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSVEEGDAKAHDLGVMFIETSAKAGLN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGG  794
            IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK T N +  EQQ GG
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKTTINASQMEQQPGG  204



>ref|XP_003539133.2| PREDICTED: ras-related protein RABH1b [Glycine max]
 gb|KHN34874.1| Ras-related protein RABH1b [Glycine soja]
Length=207

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK T  +  ++ Q  GCAC
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSTNGSAQSQPQSSGCAC  207



>gb|ACF86139.1| unknown [Zea mays]
Length=190

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQS
Sbjct  19   NQQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQS  78

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAG
Sbjct  79   FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAG  138

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            FNIK LFRKIAAALPGMETLSS KQEDMVDVNL+    N++ ++ Q GGC+C
Sbjct  139  FNIKALFRKIAAALPGMETLSSAKQEDMVDVNLRSGNANSSQSQAQAGGCSC  190



>ref|XP_010238113.1| PREDICTED: ras-related protein RABH1b [Brachypodium distachyon]
Length=208

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK    N++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSGNANSSQSQAQAGGCSC  208



>ref|XP_010506389.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
 ref|XP_010508276.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
 ref|XP_010518063.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
Length=208

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLV+KRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVEKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + ++QQ GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASMSQQQSGGCSC  208



>ref|XP_006591506.1| PREDICTED: ras-related protein RABH1e-like isoform X2 [Glycine 
max]
 ref|XP_006591507.1| PREDICTED: ras-related protein RABH1e-like isoform X3 [Glycine 
max]
 ref|XP_006591508.1| PREDICTED: ras-related protein RABH1e-like isoform X4 [Glycine 
max]
Length=157

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  333  MYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLNTSKWIEEVRTE  512
            MYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFLNT+KWIEEVRTE
Sbjct  1    MYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTE  60

Query  513  RGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAAAL  692
            RGSDVIIVLVGNKTDLV+KRQVSIEEGDAK+RE G+MFIETSAKAGFNIKPLFRKIAAAL
Sbjct  61   RGSDVIIVLVGNKTDLVEKRQVSIEEGDAKSRESGIMFIETSAKAGFNIKPLFRKIAAAL  120

Query  693  PGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            PGMETLSSTKQEDMVDVNLKPT N++  EQQGGGC+C
Sbjct  121  PGMETLSSTKQEDMVDVNLKPTVNSSQTEQQGGGCSC  157



>ref|XP_009133677.1| PREDICTED: ras-related protein RABH1b-like [Brassica rapa]
Length=208

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFR IAA+LPGMETLSSTKQEDMVDVNLK +  N + A+QQ GGC+C
Sbjct  159  IKALFRNIAASLPGMETLSSTKQEDMVDVNLKSSNANASLAQQQSGGCSC  208



>ref|XP_011018653.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Populus 
euphratica]
Length=208

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IKPLFRKIAAALPGME LSST QEDMVDVNLK +   +S  Q Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMEALSSTNQEDMVDVNLKSSGGASSQTQPQAGGCAC  208



>ref|XP_001785261.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ49913.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=213

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  47   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  106

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERGSDVII+LVGNKTDLVDKRQVSIEEGDAKA+EFGVMFIETS+KAGFN
Sbjct  107  NTARWVEEVRTERGSDVIIMLVGNKTDLVDKRQVSIEEGDAKAKEFGVMFIETSSKAGFN  166

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS K +D+VDVNLKPTTN   AE + GGCAC
Sbjct  167  IKALFRKIAAALPGMEALSSHK-DDLVDVNLKPTTNPQ-AEGKAGGCAC  213



>ref|NP_001150271.1| ras-related protein Rab-6A [Zea mays]
 ref|XP_002460730.1| hypothetical protein SORBIDRAFT_02g033930 [Sorghum bicolor]
 ref|XP_004957769.1| PREDICTED: ras-related protein RABH1b-like [Setaria italica]
 gb|ACF84814.1| unknown [Zea mays]
 gb|ACG38463.1| ras-related protein Rab-6A [Zea mays]
 gb|EER97251.1| hypothetical protein SORBIDRAFT_02g033930 [Sorghum bicolor]
 tpg|DAA40903.1| TPA: Ras protein Rab-6A [Zea mays]
Length=208

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNL+    N++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLRSGNANSSQSQAQAGGCSC  208



>ref|XP_007156617.1| hypothetical protein PHAVU_002G003500g [Phaseolus vulgaris]
 gb|ESW28611.1| hypothetical protein PHAVU_002G003500g [Phaseolus vulgaris]
Length=207

 Score =   280 bits (715),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNL  TT    ++ Q  GCAC
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLVSTTGNAQSQPQSSGCAC  207



>ref|XP_004148503.1| PREDICTED: ras-related protein RABH1b-like [Cucumis sativus]
 ref|XP_004171228.1| PREDICTED: ras-related protein RABH1b-like [Cucumis sativus]
 ref|XP_008465921.1| PREDICTED: ras-related protein RABH1b [Cucumis melo]
 gb|KGN60432.1| hypothetical protein Csa_3G910690 [Cucumis sativus]
Length=208

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQ-QGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T +  +  Q Q  GCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTGSGAAQSQPQSSGCAC  208



>gb|KHN31372.1| Ras-related protein RABH1e [Glycine soja]
Length=253

 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 167/217 (77%), Gaps = 46/217 (21%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQS
Sbjct  37   NYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQS  96

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKR--------------------------  572
            FLNT+KWIEEVRTERGSDVIIVLVGNKTDLV+KR                          
Sbjct  97   FLNTNKWIEEVRTERGSDVIIVLVGNKTDLVEKRASPGAAVKLCLGDLLVMSSNPETASL  156

Query  573  ----QVSIEEGDAKAREFGVMFIETSAKAGFNIK----------------PLFRKIAAAL  692
                QVSIEEGDAK+RE G+MFIETSAKAGFNIK                PLFRKIAAAL
Sbjct  157  HMQGQVSIEEGDAKSRESGIMFIETSAKAGFNIKCWRKLLVREVTYVSNSPLFRKIAAAL  216

Query  693  PGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            PGMETLSSTKQEDMVDVNLKPT N++ AEQQGGGC+C
Sbjct  217  PGMETLSSTKQEDMVDVNLKPTVNSSQAEQQGGGCSC  253



>ref|XP_008668055.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Zea mays]
Length=185

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = +3

Query  294  MQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSF  473
             +ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSF
Sbjct  15   FEATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSF  74

Query  474  LNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            LNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGF
Sbjct  75   LNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGF  134

Query  654  NIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            NIK LFRKIAAALPGMETLSS KQEDMVDVNL+    N++ ++ Q GGC+C
Sbjct  135  NIKALFRKIAAALPGMETLSSAKQEDMVDVNLRSGNANSSQSQAQAGGCSC  185



>ref|NP_001142363.1| hypothetical protein [Zea mays]
 gb|ACF88306.1| unknown [Zea mays]
 tpg|DAA62791.1| TPA: hypothetical protein ZEAMMB73_332722 [Zea mays]
Length=208

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIDEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNL+    N++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLRSGNANSSQSQAQAGGCSC  208



>ref|XP_001759775.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ75279.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=211

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSF+
Sbjct  45   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFM  104

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERGSDVII+LVGNKTDLVDKRQVSIEEGDAKA+EFGVMFIETS+KAGFN
Sbjct  105  NTARWVEEVRTERGSDVIIMLVGNKTDLVDKRQVSIEEGDAKAKEFGVMFIETSSKAGFN  164

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMET+SS K +D+VDVNLKPT NT + E + GGCAC
Sbjct  165  IKALFRKIAAALPGMETMSSHK-DDLVDVNLKPTLNTQT-EGKPGGCAC  211



>ref|XP_007209608.1| hypothetical protein PRUPE_ppa011535mg [Prunus persica]
 ref|XP_008229518.1| PREDICTED: ras-related protein RABH1b-like [Prunus mume]
 gb|EMJ10807.1| hypothetical protein PRUPE_ppa011535mg [Prunus persica]
Length=207

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERGSDVIIVLVGNKTDLVDKRQVS+EEG+AK R+  VMFIETSAKAGFN
Sbjct  99   NTSKWIDEVRTERGSDVIIVLVGNKTDLVDKRQVSVEEGEAKGRDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  + S  Q   GC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSTGGSASQSQAQSGCSC  207



>ref|XP_007155742.1| hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris]
 gb|ESW27736.1| hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris]
Length=206

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL+ + N +S + Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSATKQEDMVDVNLRSSGNHDS-QSQSGGCAC  206



>ref|XP_008232300.1| PREDICTED: ras-related protein RABH1b [Prunus mume]
Length=208

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK    N++ ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANSSQSQAQSGGCAC  208



>tpg|DAA62790.1| TPA: hypothetical protein ZEAMMB73_332722, partial [Zea mays]
Length=249

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIDEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNL+    N++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLRSGNANSSQSQAQAGGCSC  208



>ref|XP_006354635.1| PREDICTED: ras-related protein RABH1b-like [Solanum tuberosum]
Length=208

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSS KQEDMVDVNLK   ++ + ++ Q GGCAC
Sbjct  159  IKPLFRKIAAALPGMETLSSAKQEDMVDVNLKSSNSSASQSQAQSGGCAC  208



>gb|AES94384.2| RAB GTPase-like protein B1C [Medicago truncatula]
Length=207

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIE+G+AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEDGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQED+VDVNLK ++    ++ Q  GC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDLVDVNLKSSSGNAQSQTQSSGCSC  207



>ref|XP_008364780.1| PREDICTED: ras-related protein RABH1b [Malus domestica]
Length=208

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK     ++ ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNAXSSQSQAQSGGCAC  208



>ref|XP_008369810.1| PREDICTED: ras-related protein RABH1b [Malus domestica]
 ref|XP_009339633.1| PREDICTED: ras-related protein RABH1b [Pyrus x bretschneideri]
Length=208

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK    N++ ++ Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANSSQSQAQSGGCAC  208



>ref|XP_006436829.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 ref|XP_006485362.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Citrus 
sinensis]
 gb|ESR50069.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 gb|KDO41079.1| hypothetical protein CISIN_1g028507mg [Citrus sinensis]
Length=208

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AK+RE  VMFIETSAKAGFN
Sbjct  99   NTSKWIDEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKSRELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTT-NTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLSSTKQE+MVDVNL+ TT N + ++ Q  GC+C
Sbjct  159  IKPLFRKIAAALPGMETLSSTKQEEMVDVNLRSTTGNASQSQSQSSGCSC  208



>gb|AFK37167.1| unknown [Medicago truncatula]
Length=206

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 160/169 (95%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLV+KRQVS EEG+AK+RE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVEKRQVSTEEGEAKSRELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL+ +T+ +S + Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSTTKQEDMVDVNLRSSTSHDS-QPQSGGCSC  206



>ref|XP_003517384.1| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN42637.1| Ras-related protein RABH1b [Glycine soja]
Length=206

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+ YDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIAYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVIIVLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIIVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNL+ +    S + Q GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLRSSGGYQS-QPQSGGCAC  206



>ref|XP_009625739.1| PREDICTED: ras-related protein RABH1e-like, partial [Nicotiana 
tomentosiformis]
Length=155

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/153 (95%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +3

Query  345  DRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLNTSKWIEEVRTERGSD  524
            DRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFLNTSKWIEEVRTERGSD
Sbjct  3    DRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSD  62

Query  525  VIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAAALPGME  704
            VIIVLVGNKTDLVDKRQVS EEGDAKAREFGVM+IETSAKAGFNIKPLFRKIAAAL GME
Sbjct  63   VIIVLVGNKTDLVDKRQVSTEEGDAKAREFGVMYIETSAKAGFNIKPLFRKIAAALSGME  122

Query  705  TLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            TLSSTK EDMVDVNLKPTTNT+  EQQGGGCAC
Sbjct  123  TLSSTKGEDMVDVNLKPTTNTSQNEQQGGGCAC  155



>ref|XP_001782940.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ52238.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=213

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  47   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  106

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTS+WIEEV TERGSDVII+LVGNKTDLVDKRQVSIEEGDAKA+E GVMFIETS+KAGFN
Sbjct  107  NTSRWIEEVLTERGSDVIIMLVGNKTDLVDKRQVSIEEGDAKAKEVGVMFIETSSKAGFN  166

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS K +D+VDVNLKPTTN    E + GGCAC
Sbjct  167  IKALFRKIAAALPGMEALSSHK-DDLVDVNLKPTTNPQ-GEGKAGGCAC  213



>gb|AAZ66935.1| 117M18_16 [Brassica rapa]
Length=216

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 9/178 (5%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQL--W-------DTAGQERFRSLIPSYIRdssvavvvy  449
            QATIGIDFLSKTMYLEDRT+RLQL  W       DTAGQERFRSLIPSYIRDSSVAV+VY
Sbjct  39   QATIGIDFLSKTMYLEDRTLRLQLCLWCLICAFQDTAGQERFRSLIPSYIRDSSVAVIVY  98

Query  450  dvaNRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFI  629
            DVANRQSFLNTSKW+E+VRTERG+DVIIVLVGNKTDLVDKRQVSIEEGD KAR+FGV+FI
Sbjct  99   DVANRQSFLNTSKWVEDVRTERGNDVIIVLVGNKTDLVDKRQVSIEEGDNKARDFGVIFI  158

Query  630  ETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            ETSAKAGFNIKPLFRKI+AALPGM+TLSS KQ DMVDVNLK + +++ AEQQ GGC+C
Sbjct  159  ETSAKAGFNIKPLFRKISAALPGMDTLSSAKQGDMVDVNLKSSNHSSQAEQQSGGCSC  216



>ref|XP_007156620.1| hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris]
 gb|ESW28614.1| hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris]
Length=206

 Score =   275 bits (702),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+ YDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIAYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVIIVLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIIVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNL+ +   +S +   GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLRSSAGHDS-QPDSGGCAC  206



>ref|XP_004508989.1| PREDICTED: ras-related protein RABH1b-like [Cicer arietinum]
Length=206

 Score =   275 bits (702),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL+ + + +S + Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSTTKQEDMVDVNLRSSASHDS-QPQSGGCSC  206



>gb|EYU40319.1| hypothetical protein MIMGU_mgv1a013860mg [Erythranthe guttata]
Length=208

 Score =   275 bits (702),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N + ++QQ GGCAC
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANGSQSQQQSGGCAC  208



>gb|KEH31569.1| RAB GTPase-like protein B1C [Medicago truncatula]
Length=206

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLV+KRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVEKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL+ +T+ +S + Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSTTKQEDMVDVNLRSSTSHDS-QPQSGGCSC  206



>ref|XP_001783133.1| predicted protein [Physcomitrella patens]
 gb|EDQ52070.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERGSDVII+LVGNKTDL+DKRQVSIEEGDAKA+EFGVMFIETS+KAGFN
Sbjct  103  NTARWVEEVRTERGSDVIIMLVGNKTDLLDKRQVSIEEGDAKAKEFGVMFIETSSKAGFN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS+K +D+VDVNLK T+N   A+ + G C+C
Sbjct  163  IKALFRKIAAALPGMEALSSSK-DDLVDVNLKSTSNAQ-ADSKAGACSC  209



>ref|XP_010919837.1| PREDICTED: ras-related protein RABH1b [Elaeis guineensis]
Length=208

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEE +AKAR+ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEAEAKARDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK T  N++ ++   GGC C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKATNVNSSQSQGSSGGCNC  208



>ref|XP_003549965.2| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN01660.1| Ras-related protein RABH1b [Glycine soja]
 gb|KHN21041.1| Ras-related protein RABH1b [Glycine soja]
Length=206

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL+ ++ ++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSTTKQEDMVDVNLR-SSGSHDSQPQSGGCSC  206



>ref|XP_010544549.1| PREDICTED: ras-related protein RABH1b [Tarenaya hassleriana]
Length=213

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 158/175 (90%), Gaps = 6/175 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVI+VLVGNKTDLVDKRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKP-----LFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK       F KIAAALPGMETLSSTKQEDMVDVNL+ +  N +  +QQ GGC+C
Sbjct  159  IKVKRFLLRFSKIAAALPGMETLSSTKQEDMVDVNLRSSNANASRTQQQAGGCSC  213



>ref|XP_005645434.1| ras-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20890.1| ras-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=212

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  42   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  101

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++WIEEVRTERGSDVI+VLVGNKTDLVDKRQVSIEEGDAKAREF VMFIETSAKAGFN
Sbjct  102  NTARWIEEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEGDAKAREFNVMFIETSAKAGFN  161

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNT  767
            IK LFRKIAAALPGME+LS+ KQED+VDVNL  T N+
Sbjct  162  IKALFRKIAAALPGMESLSAAKQEDLVDVNLSATANS  198



>ref|XP_004511760.1| PREDICTED: ras-related protein RABH1b-like [Cicer arietinum]
Length=206

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLV+KRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVEKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQED+VDVNLK +   +S + Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSTKQEDLVDVNLKSSGGHDS-QTQSGGCSC  206



>ref|NP_001059699.1| Os07g0496000 [Oryza sativa Japonica Group]
 dbj|BAC21376.1| GTP-binding protein Rab6 [Oryza sativa Japonica Group]
 dbj|BAF21613.1| Os07g0496000 [Oryza sativa Japonica Group]
Length=208

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK    N++ ++ Q GGC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANSSQSQAQAGGCSC  208



>ref|XP_009385937.1| PREDICTED: ras-related protein RABH1b-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 157/170 (92%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQV IEEG+AKA+E GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVPIEEGEAKAQELGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-TTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS KQEDMVDVNL+    N++ ++ Q GGC C
Sbjct  159  IKALFRKIAAALPGMENLSSAKQEDMVDVNLRSLNANSSQSQSQSGGCRC  208



>ref|XP_002461043.1| hypothetical protein SORBIDRAFT_02g039720 [Sorghum bicolor]
 gb|EER97564.1| hypothetical protein SORBIDRAFT_02g039720 [Sorghum bicolor]
Length=209

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 161/170 (95%), Gaps = 2/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERG DVIIVLVGNKTDLVDKRQVS EEG++KA+E  VMFIETSAKAGFN
Sbjct  101  NTSKWIDEVRTERGGDVIIVLVGNKTDLVDKRQVSTEEGESKAKELNVMFIETSAKAGFN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGG-GCAC  803
            IKPLFRKIAAALPGMETLS+ K EDMVDVNLKPT++ ++++QQ G GCAC
Sbjct  161  IKPLFRKIAAALPGMETLSA-KSEDMVDVNLKPTSSQSNSQQQAGSGCAC  209



>emb|CDY23446.1| BnaC04g49740D [Brassica napus]
Length=601

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  432  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  491

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVRTERGSDVI+VLVGNKTDLVDKRQVSIEE +AKARE  V+FIETSAKAGFN
Sbjct  492  NTAKWIDEVRTERGSDVIVVLVGNKTDLVDKRQVSIEEAEAKARELNVIFIETSAKAGFN  551

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSSTKQEDMVDVNLK +  N +SA+QQ GGC+C
Sbjct  552  IKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASSAQQQSGGCSC  601



>emb|CBI33936.3| unnamed protein product [Vitis vinifera]
Length=179

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 157/170 (92%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  70   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGG-GCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK ++ + S  Q    GC+C
Sbjct  130  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSSGSASQSQTQARGCSC  179



>gb|ACU20573.1| unknown [Glycine max]
Length=213

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTAKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQ  785
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK T  +  ++ Q
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSTNGSAQSQPQ  201



>ref|XP_002281823.1| PREDICTED: ras-related protein RABH1b [Vitis vinifera]
 emb|CAN75036.1| hypothetical protein VITISV_014840 [Vitis vinifera]
Length=208

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 157/170 (92%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKARE  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGG-GCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK ++ + S  Q    GC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSSGSASQSQTQARGCSC  208



>gb|KHG28240.1| Ras-related RABH1b -like protein [Gossypium arboreum]
Length=208

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQS
Sbjct  37   NYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQS  96

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNTS WIEEVR ERGSDVII+LVGNKTDLVDKRQVS+EEG+AKAR+  VMFIE SAKAG
Sbjct  97   FLNTSNWIEEVRAERGSDVIIMLVGNKTDLVDKRQVSVEEGEAKARDINVMFIEASAKAG  156

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            FNIK LFRKIAAALPGMETLSSTK EDMVDVNLK   +N + ++Q+ GGCAC
Sbjct  157  FNIKALFRKIAAALPGMETLSSTKHEDMVDVNLKSSNSNGSQSQQESGGCAC  208



>ref|XP_001754098.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ80999.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=211

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV+NRQSFL
Sbjct  45   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFL  104

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVRTERG+DVI++LVGNKTDLVDKRQVSIEEGDAKA+E  VMFIETS+KAGFN
Sbjct  105  NTARWVEEVRTERGNDVIVMLVGNKTDLVDKRQVSIEEGDAKAKELQVMFIETSSKAGFN  164

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIA ALPGME LSS K +D+VDVNLKPT+N   AE + GGCAC
Sbjct  165  IKALFRKIAVALPGMEALSSHK-DDLVDVNLKPTSNA-LAEAKEGGCAC  211



>ref|XP_006657723.1| PREDICTED: ras-related protein RABH1b-like [Oryza brachyantha]
Length=208

 Score =   269 bits (688),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGMETLSS KQEDMVDVNLK    N++ ++ Q  GC+C
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANSSQSQAQAAGCSC  208



>ref|XP_003611426.1| Ras-related protein Rab-6 [Medicago truncatula]
Length=226

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 160/188 (85%), Gaps = 19/188 (10%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWIEEVRTERGSDVIIVLVGNKTDLV+KRQVSIE+G+AKARE  VMFIETSAKAGFN
Sbjct  99   NTTKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEDGEAKARELNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP-------------------TTNTNSAE  779
            IK LFRKIAAALPGMETLSS KQED+VDVNLK                    +++ + ++
Sbjct  159  IKALFRKIAAALPGMETLSSAKQEDLVDVNLKSSSGNAQSQTQSNMVDVNLKSSSCHESQ  218

Query  780  QQGGGCAC  803
             Q GGC+C
Sbjct  219  PQSGGCSC  226



>gb|EMT32151.1| Ras-related protein RABH1B [Aegilops tauschii]
Length=308

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = +3

Query  288  YNMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQ  467
            + + ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQ
Sbjct  136  HPLHATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQ  195

Query  468  SFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKA  647
            SFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKA
Sbjct  196  SFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKA  255

Query  648  GFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            GFNIK LFRKIAAALPGMETLSS KQEDMVDVNLK    N++ ++ Q GGC+C
Sbjct  256  GFNIKALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANSSQSQAQAGGCSC  308



>gb|EMS65503.1| Ras-related protein RABH1b [Triticum urartu]
Length=226

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +3

Query  300  ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLN  479
            ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFLN
Sbjct  58   ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLN  117

Query  480  TSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNI  659
            TSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEG+ KA++ GVMFIETSAKAGFNI
Sbjct  118  TSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGEGKAKDLGVMFIETSAKAGFNI  177

Query  660  KPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            K LFRKIAAALPGMETLSS KQEDMVDVNLK    N++ ++ Q GGC+C
Sbjct  178  KALFRKIAAALPGMETLSSAKQEDMVDVNLKSSNANSSQSQAQAGGCSC  226



>ref|XP_010941190.1| PREDICTED: ras-related protein RABH1b-like isoform X2 [Elaeis 
guineensis]
Length=208

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVIIVLVGNKTDLVDKRQVSIEEG+AKA++ GVMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEEGEAKAQDLGVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            +K LFRKIAAALPGME LSS KQEDMVDVNLK  TT+ + ++QQ GGC+C
Sbjct  159  VKALFRKIAAALPGMENLSSAKQEDMVDVNLKTTTTSASQSQQQSGGCSC  208



>ref|XP_008811389.1| PREDICTED: ras-related protein RABH1b-like [Phoenix dactylifera]
Length=178

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  9    QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  68

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTERG DVIIVLVGNKTDLVDKRQVSIEEG+AKA++ GVMFIETSAKAGFN
Sbjct  69   NTSKWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEEGEAKAQDLGVMFIETSAKAGFN  128

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            +K LFRKIAAALPGME LSS KQEDMVDVNLK  TT+ + ++QQ GGC+C
Sbjct  129  VKALFRKIAAALPGMENLSSAKQEDMVDVNLKTTTTSASQSQQQSGGCSC  178



>gb|ABF94403.1| Ras-related protein Rab-6A, putative, expressed [Oryza sativa 
Japonica Group]
Length=215

 Score =   265 bits (677),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 153/176 (87%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSFL
Sbjct  40   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFL  99

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            + SKWIEEV T+RG DVIIVLVGNKTDLVDKRQ+S +EG+AKA+E G MF+ETSAKAGFN
Sbjct  100  SISKWIEEVNTQRGGDVIIVLVGNKTDLVDKRQISTDEGEAKAQEHGAMFMETSAKAGFN  159

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTN-------SAEQQGGGCAC  803
            IKPLFRKIAA+LPGME LSS KQEDMVD+NL+P  +           EQ+ GGC+C
Sbjct  160  IKPLFRKIAASLPGMEALSSAKQEDMVDINLRPAASGQIPSGAEAQEEQKAGGCSC  215



>gb|EPS71048.1| hypothetical protein M569_03713 [Genlisea aurea]
Length=209

 Score =   265 bits (676),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 4/172 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI+EVR ERGSDVIIVLVGNKTDLV+KRQVSIEEG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTAKWIQEVRAERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNS---AEQQGGGCAC  803
            IK LFRKIA ALPGMETLSS KQEDMVD+NLK +TN N+    +Q GGGCAC
Sbjct  159  IKALFRKIAGALPGMETLSSAKQEDMVDINLK-STNANASQSQQQSGGGCAC  209



>ref|XP_004985388.1| PREDICTED: ras-related protein RABH1e-like [Setaria italica]
Length=214

 Score =   265 bits (676),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 157/175 (90%), Gaps = 6/175 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSFL
Sbjct  40   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFL  99

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEV T+RG DV+I LVGNKTD+VDKR+VS +EG+AKA+E G MFIETSAKAGFN
Sbjct  100  NTSKWIEEVNTQRGGDVLIFLVGNKTDIVDKRKVSTDEGEAKAQEHGAMFIETSAKAGFN  159

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            IKPLFRKIA +LPG++ +SS KQEDMVD+NL+P+T ++++      EQ+ GGC+C
Sbjct  160  IKPLFRKIAGSLPGLDAISSAKQEDMVDINLRPSTGSSASGANAQVEQKSGGCSC  214



>ref|XP_008670587.1| PREDICTED: ras-related protein RABH1b-like [Zea mays]
 tpg|DAA41500.1| TPA: hypothetical protein ZEAMMB73_483526 [Zea mays]
Length=209

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 160/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NRQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWI+EVRTERG DVIIVLVGNKTDLVDKRQVS EEG++KA+E  VMFIETSAKAGFN
Sbjct  101  NTSKWIDEVRTERGGDVIIVLVGNKTDLVDKRQVSTEEGESKAKELNVMFIETSAKAGFN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGMETLS+ KQEDMVDVNLK  ++ +NS +Q+G GCAC
Sbjct  161  IKPLFRKIAAALPGMETLSA-KQEDMVDVNLKSTSSQSNSQQQEGSGCAC  209



>gb|ABF94402.1| Ras-related protein Rab-6A, putative, expressed [Oryza sativa 
Japonica Group]
Length=215

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 152/176 (86%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV  +QSFL
Sbjct  40   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTGKQSFL  99

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            + SKWIEEV T+RG DVIIVLVGNKTDLVDKRQ+S +EG+AKA+E G MF+ETSAKAGFN
Sbjct  100  SISKWIEEVNTQRGGDVIIVLVGNKTDLVDKRQISTDEGEAKAQEHGAMFMETSAKAGFN  159

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTN-------SAEQQGGGCAC  803
            IKPLFRKIAA+LPGME LSS KQEDMVD+NL+P  +           EQ+ GGC+C
Sbjct  160  IKPLFRKIAASLPGMEALSSAKQEDMVDINLRPAASGQIPSGAEAQEEQKAGGCSC  215



>ref|NP_001235476.1| uncharacterized protein LOC100527651 [Glycine max]
 gb|ACU16782.1| unknown [Glycine max]
Length=213

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR+ERGSDVI+VLVGNKTDLVDKRQVS EEG+AK+RE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGG  791
            IK LFRKI AALPGMETLS+TKQEDMVDVNL+ + + +S  Q  G
Sbjct  159  IKALFRKIDAALPGMETLSTTKQEDMVDVNLRSSGSHDSQPQSRG  203



>ref|XP_006649538.1| PREDICTED: ras-related protein RABH1e-like [Oryza brachyantha]
Length=214

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 154/176 (88%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSF 
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFF  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWIEEV T+RG DV+IVLVGNKTDLVDKRQVS +EG+AKA+E G MF+ETSA+AG+N
Sbjct  99   STSKWIEEVNTQRGGDVLIVLVGNKTDLVDKRQVSTDEGEAKAQEQGAMFLETSARAGYN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTN-------SAEQQGGGCAC  803
            IKPLFRKIAA+LPGM+ LSS +QEDMVD+NL+P  +          AEQ+ GGC+C
Sbjct  159  IKPLFRKIAASLPGMDALSSARQEDMVDINLRPAASGQIPSGAEAQAEQKAGGCSC  214



>ref|XP_003558615.2| PREDICTED: ras-related protein RABH1e-like isoform X2 [Brachypodium 
distachyon]
Length=224

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSFL
Sbjct  49   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFL  108

Query  477  NTSKWIEEVRTER-GSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            +TS WI+EV+TER G+DV+IVLVGNKTDLVDKRQV  +EG+AKA+E GVMFIETSAKAGF
Sbjct  109  HTSTWIDEVKTERAGTDVLIVLVGNKTDLVDKRQVPTDEGEAKAQEHGVMFIETSAKAGF  168

Query  654  NIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            N+KPLFRKIA +LPGM+ LSS KQEDMVD+NL+P + + +       EQ+ GGC+C
Sbjct  169  NVKPLFRKIATSLPGMDALSSAKQEDMVDINLRPASGSKAPGAAAQQEQKAGGCSC  224



>ref|XP_005844627.1| GTP binding protein [Chlorella variabilis]
 gb|EFN52525.1| GTP binding protein [Chlorella variabilis]
Length=211

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV +RQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVTSRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            N  +W+EEVR ERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKARE  VMFIETSAKAGFN
Sbjct  101  NIQRWVEEVRAERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKARELNVMFIETSAKAGFN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGG--CAC  803
            IK LFRKIAAALPGME L+S KQED+VD+NL P++   +      G  CAC
Sbjct  161  IKALFRKIAAALPGMEALNSAKQEDLVDINLAPSSAAKAGAGGSAGSTCAC  211



>gb|AFK47940.1| unknown [Lotus japonicus]
Length=191

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVANRQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KW+EEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAK+REFG+MFIETSAKAGFN
Sbjct  99   NTNKWVEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSREFGIMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPT  758
            IKPLFRKIAAALPG +     + EDMVDVNLKPT
Sbjct  159  IKPLFRKIAAALPGWKHF-LLQTEDMVDVNLKPT  191



>ref|XP_001751907.1| predicted protein [Physcomitrella patens]
 gb|EDQ83342.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 151/169 (89%), Gaps = 7/169 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVY      SFL
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVY-----DSFL  97

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT +W+EEVRTERGSDVII+LVGNKTDLVDKRQVS+EEGDAKA EFGVMFIETS+ AGFN
Sbjct  98   NTVRWVEEVRTERGSDVIIMLVGNKTDLVDKRQVSVEEGDAKANEFGVMFIETSSNAGFN  157

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME LSS K +D+VDV+LKPT+N  + E + GGCAC
Sbjct  158  IKALFRKIAAALPGMEALSSHK-DDLVDVSLKPTSNPQT-EGKAGGCAC  204



>ref|NP_001147620.1| LOC100281229 [Zea mays]
 gb|ACG28130.1| ras-related protein Rab-6A [Zea mays]
 tpg|DAA43832.1| TPA: hypothetical protein ZEAMMB73_661349 [Zea mays]
Length=213

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 156/175 (89%), Gaps = 6/175 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEV T+RG DV+I LVGNKTDLVDKR+VS +EG+AKA+E G MF+ETSAKAGFN
Sbjct  99   NTSKWIEEVNTQRGGDVLIFLVGNKTDLVDKRKVSTDEGEAKAQEHGAMFMETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            +KPLFRKIA +LPG++ LSS KQEDMVD+NL+P + ++++      EQ+ GGC+C
Sbjct  159  VKPLFRKIAGSLPGLDALSSGKQEDMVDINLRPASGSSASGAAAQLEQKSGGCSC  213



>ref|XP_001780867.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ54346.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=210

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV+NRQSF+
Sbjct  41   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFV  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++W+EEVR ERG DV++VLVGNKTDLVDKRQVS+EEG+ KARE   + IETSAKAGFN
Sbjct  101  NTARWVEEVRAERGKDVVLVLVGNKTDLVDKRQVSVEEGETKARELSALMIETSAKAGFN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAE-QQGGGCAC  803
            IK LFRKIA ALPGME+++ +KQ+D VD+NLK T+N   +E Q  GGCAC
Sbjct  161  IKSLFRKIAGALPGMESVNPSKQDDYVDINLKTTSNNTQSEGQTAGGCAC  210



>gb|EPS72171.1| hypothetical protein M569_02585 [Genlisea aurea]
Length=207

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDR +RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA RQSF+
Sbjct  39   QATIGIDFLSKTMYLEDRAIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAIRQSFI  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVR ERGSDVIIVLVGNKTDLVDKRQVSI+EG+AKAR+  VMFIETSAKAGFN
Sbjct  99   NTSKWIEEVRNERGSDVIIVLVGNKTDLVDKRQVSIQEGEAKARDLNVMFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LF+KIA ALPGMET S   +E MVDVNL  +     +++Q GGCAC
Sbjct  159  VKALFQKIAGALPGMETSSVGNREGMVDVNLNSSDTNVQSQRQSGGCAC  207



>gb|AFK45067.1| unknown [Lotus japonicus]
Length=210

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYD+A+RQ+FL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDIASRQTFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEV +ERGSDVIIVLVGNKTDLV+KRQVS EE +AKARE  VMFIE SAKAGFN
Sbjct  99   NTSKWIEEVHSERGSDVIIVLVGNKTDLVEKRQVSTEEAEAKARELNVMFIEASAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNL  749
            IK LFRKIAAALPGMETLS+TKQEDMVDVNL
Sbjct  159  IKALFRKIAAALPGMETLSTTKQEDMVDVNL  189



>ref|XP_010941189.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Elaeis 
guineensis]
Length=225

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 160/187 (86%), Gaps = 18/187 (10%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaN-----  461
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+     
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMFLPH  98

Query  462  ------------RQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKA  605
                        RQ+FLNTSKWIEEVRTERG DVIIVLVGNKTDLVDKRQVSIEEG+AKA
Sbjct  99   GHILQTSIARTCRQTFLNTSKWIEEVRTERGGDVIIVLVGNKTDLVDKRQVSIEEGEAKA  158

Query  606  REFGVMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLK-PTTNTNSAEQ  782
            ++ GVMFIETSAKAGFN+K LFRKIAAALPGME LSS KQEDMVDVNLK  TT+ + ++Q
Sbjct  159  QDLGVMFIETSAKAGFNVKALFRKIAAALPGMENLSSAKQEDMVDVNLKTTTTSASQSQQ  218

Query  783  QGGGCAC  803
            Q GGC+C
Sbjct  219  QSGGCSC  225



>gb|EYU40320.1| hypothetical protein MIMGU_mgv1a013860mg [Erythranthe guttata]
Length=198

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = +3

Query  327  KTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFLNTSKWIEEVR  506
            +TMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFLNTSKWIEEVR
Sbjct  39   QTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVR  98

Query  507  TERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAA  686
            TERGSDVIIVLVGNKTDLVDKRQVSIEEG+AKAR+  VMFIETSAKAGFNIK LFRKIAA
Sbjct  99   TERGSDVIIVLVGNKTDLVDKRQVSIEEGEAKARDLNVMFIETSAKAGFNIKALFRKIAA  158

Query  687  ALPGMETLSSTKQEDMVDVNLKPT-TNTNSAEQQGGGCAC  803
            ALPGMETLSSTKQEDMVDVNLK +  N + ++QQ GGCAC
Sbjct  159  ALPGMETLSSTKQEDMVDVNLKSSNANGSQSQQQSGGCAC  198



>ref|XP_010229052.1| PREDICTED: ras-related protein RABH1e-like isoform X1 [Brachypodium 
distachyon]
Length=343

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 7/176 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSFL
Sbjct  168  QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFL  227

Query  477  NTSKWIEEVRTER-GSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            +TS WI+EV+TER G+DV+IVLVGNKTDLVDKRQV  +EG+AKA+E GVMFIETSAKAGF
Sbjct  228  HTSTWIDEVKTERAGTDVLIVLVGNKTDLVDKRQVPTDEGEAKAQEHGVMFIETSAKAGF  287

Query  654  NIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            N+KPLFRKIA +LPGM+ LSS KQEDMVD+NL+P + + +       EQ+ GGC+C
Sbjct  288  NVKPLFRKIATSLPGMDALSSAKQEDMVDINLRPASGSKAPGAAAQQEQKAGGCSC  343



>gb|KFM27875.1| Ras-related protein RABH1e [Auxenochlorella protothecoides]
Length=211

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV NRQSF+
Sbjct  42   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVTNRQSFV  101

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            N  +W+EEVR ERGSDVIIV VGNKTDLV+KRQVSIEEGD +A+E G++FIETSAKAGFN
Sbjct  102  NIQRWVEEVRGERGSDVIIVAVGNKTDLVEKRQVSIEEGDTRAKELGILFIETSAKAGFN  161

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKP  755
            IK LFRKIAAALPGME+L  +KQED+VD+NL P
Sbjct  162  IKALFRKIAAALPGMESLGGSKQEDLVDINLAP  194



>emb|CDX81264.1| BnaC09g06750D [Brassica napus]
Length=204

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTM  ED T RLQLWDTAGQERF+SLIPSYIRDSSVAV+VYDVAN+QS
Sbjct  34   NYQATIGIDFLSKTMRHEDTTFRLQLWDTAGQERFKSLIPSYIRDSSVAVIVYDVANKQS  93

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            F+N SKWIE+VR ERG+ VII LVGNKTDLV +RQVSIEEGD KARE G +FIETSAKAG
Sbjct  94   FINASKWIEDVRAERGNQVIIALVGNKTDLVHRRQVSIEEGDNKARELGALFIETSAKAG  153

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLF KIA+AL G ET + T+QED+VDVNLKP TN + +EQQ G C+C
Sbjct  154  FNIKPLFCKIASALQGTETQTWTRQEDLVDVNLKPMTNLSHSEQQQGNCSC  204



>ref|XP_006295931.1| hypothetical protein CARUB_v10025068mg [Capsella rubella]
 gb|EOA28829.1| hypothetical protein CARUB_v10025068mg [Capsella rubella]
Length=195

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 148/169 (88%), Gaps = 12/169 (7%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTM            DTAGQERFRSLIPSYIRDSSVAVVVYDVANR SFL
Sbjct  39   QATIGIDFLSKTM------------DTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFL  86

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLV+KRQVSIEEGD+K RE+GV+FIETSAKAGFN
Sbjct  87   NTSKWIEEVRTERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVIFIETSAKAGFN  146

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IKPLFRKIAAALPGME+ S+TK +DMVDVNLKPT+N++  +QQG GC+C
Sbjct  147  IKPLFRKIAAALPGMESYSNTKTDDMVDVNLKPTSNSSQGDQQGRGCSC  195



>gb|EEC82085.1| hypothetical protein OsI_26083 [Oryza sativa Indica Group]
Length=244

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 158/206 (77%), Gaps = 37/206 (18%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKR----------------------------  572
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDK                             
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKSYYAMIEQYNNLAQNSLPYNFSWIKLKVC  158

Query  573  --------QVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQE  728
                    QVSIEEG+ KA++ GVMFIETSAKAGFNIK LFRKIAAALPGMETLSS KQE
Sbjct  159  DSKQCHVMQVSIEEGEGKAKDLGVMFIETSAKAGFNIKALFRKIAAALPGMETLSSAKQE  218

Query  729  DMVDVNLK-PTTNTNSAEQQGGGCAC  803
            DMVDVNLK    N++ ++ Q GGC+C
Sbjct  219  DMVDVNLKSSNANSSQSQAQAGGCSC  244



>ref|XP_009112166.1| PREDICTED: ras-related protein RABH1a [Brassica rapa]
Length=204

 Score =   249 bits (637),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIGIDFLSKTM  ED T RLQLWDTAGQERF+SLIPSYIRDSSVAV+VYDVAN+QS
Sbjct  34   NYQATIGIDFLSKTMRHEDTTFRLQLWDTAGQERFKSLIPSYIRDSSVAVIVYDVANKQS  93

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            F+N SKWIE+V  ERG+ VII LVGNKTDLV +RQVSIEEGD KARE G +FIETSAKAG
Sbjct  94   FINASKWIEDVHAERGNQVIIALVGNKTDLVHRRQVSIEEGDTKARELGALFIETSAKAG  153

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLF KIA+AL G ET + T+QED+VDVNLKP TN++ ++QQ G C+C
Sbjct  154  FNIKPLFCKIASALQGTETQTWTRQEDLVDVNLKPMTNSSHSQQQQGNCSC  204



>gb|EEE67212.1| hypothetical protein OsJ_24329 [Oryza sativa Japonica Group]
Length=244

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 158/206 (77%), Gaps = 37/206 (18%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+V+DVA+RQSFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKR----------------------------  572
            NTSKWIEEVRTERGSDVIIVLVGNKTDLVDK                             
Sbjct  99   NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKSYYAMIEQYDNLAQNSLPYNFSWIKLKVC  158

Query  573  --------QVSIEEGDAKAREFGVMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQE  728
                    QVSIEEG+ KA++ GVMFIETSAKAGFNIK LFRKIAAALPGMETLSS KQE
Sbjct  159  DSKQCHVMQVSIEEGEGKAKDLGVMFIETSAKAGFNIKALFRKIAAALPGMETLSSAKQE  218

Query  729  DMVDVNLK-PTTNTNSAEQQGGGCAC  803
            DMVDVNLK    N++ ++ Q GGC+C
Sbjct  219  DMVDVNLKSSNANSSQSQAQAGGCSC  244



>dbj|BAJ99126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 6/175 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV + QSFL
Sbjct  124  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDTQSFL  183

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWI+EV T RG DV+IVLVGNKTDLVD+RQV  +EG+AKA+E G +F+ETSAKAGFN
Sbjct  184  HTSKWIDEVNTARGKDVLIVLVGNKTDLVDQRQVPTDEGEAKAKEHGALFMETSAKAGFN  243

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            IK LFR IAA+LPGM+ +SS KQEDMVD+NL+P +    +      E++ GGC+C
Sbjct  244  IKALFRTIAASLPGMDAVSSAKQEDMVDINLRPASGPAGSGTAGQQEEKAGGCSC  298



>dbj|BAJ92647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 6/175 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV + QSFL
Sbjct  100  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDTQSFL  159

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            +TSKWI+EV T RG DV+IVLVGNKTDLVD+RQV  +EG+AKA+E G +F+ETSAKAGFN
Sbjct  160  HTSKWIDEVNTARGKDVLIVLVGNKTDLVDQRQVPTDEGEAKAKEHGALFMETSAKAGFN  219

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA------EQQGGGCAC  803
            IK LFR IAA+LPGM+ +SS KQEDMVD+NL+P +    +      E++ GGC+C
Sbjct  220  IKALFRTIAASLPGMDAVSSAKQEDMVDINLRPASGPAGSGTAGQQEEKAGGCSC  274



>ref|XP_002948506.1| RabH/Rab6 [Volvox carteri f. nagariensis]
 gb|EFJ50381.1| RabH/Rab6 [Volvox carteri f. nagariensis]
Length=211

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYD+ NRQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++WI+EVRTERG+DVII LVGNKTDL+DKRQVSIEEGDAKARE  V FIETSAKAG N
Sbjct  101  NTARWIQEVRTERGNDVIIFLVGNKTDLIDKRQVSIEEGDAKARELNVNFIETSAKAGLN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            IK LFRKIAAALPGME+++  KQE M +V L  +T T  A+       C
Sbjct  161  IKALFRKIAAALPGMESVTQNKQEQMEEVKLTTSTVTLDAKPPPPASTC  209



>emb|CDX76936.1| BnaC08g35220D [Brassica napus]
Length=275

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV+NR SFL
Sbjct  39   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRLSFL  98

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKWIEEVRTER  DVIIVLVGNKTDLVDKRQVSIEEGD+K RE+GV+FIETSAKAGFN
Sbjct  99   NTSKWIEEVRTERAGDVIIVLVGNKTDLVDKRQVSIEEGDSKGREYGVIFIETSAKAGFN  158

Query  657  IKPLFRKIAAALPGMETLSSTKQEDM  734
            IKPLFRKIAAALPGM++ S+ K EDM
Sbjct  159  IKPLFRKIAAALPGMDSYSNMKTEDM  184



>ref|XP_001690213.1| small rab-related GTPase [Chlamydomonas reinhardtii]
 gb|EDP09951.1| small rab-related GTPase [Chlamydomonas reinhardtii]
Length=211

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYD+ NRQSFL
Sbjct  41   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFL  100

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT++WI+EVRTERG+DVII LVGNKTDL+DKRQVSIEEGDAKARE  V FIETSAKAG N
Sbjct  101  NTARWIQEVRTERGNDVIIFLVGNKTDLIDKRQVSIEEGDAKARELNVNFIETSAKAGLN  160

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNT--NSAEQQGGGCAC  803
            IK LFRKIAAALPGME+++  KQE M +V L  +T T  +        C+C
Sbjct  161  IKALFRKIAAALPGMESVTQNKQEQMEEVKLTTSTVTLDSKPPPPPATCSC  211



>ref|XP_002866645.1| hypothetical protein ARALYDRAFT_496719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42904.1| hypothetical protein ARALYDRAFT_496719 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            + QATIGIDFLSKTM  EDRT RLQLWDTAGQERF+SL+PSYIRDSSVAV+VYDVA++QS
Sbjct  35   SYQATIGIDFLSKTMRYEDRTFRLQLWDTAGQERFKSLVPSYIRDSSVAVIVYDVASKQS  94

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNTSKWIEEVR ERGS VIIVLVGNKTDLV+KRQVSIEEGD KAREFG +F+ETSAKAG
Sbjct  95   FLNTSKWIEEVRAERGSHVIIVLVGNKTDLVNKRQVSIEEGDNKAREFGALFMETSAKAG  154

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAE-QQGGGCAC  803
            FNIKPLF KI +AL G E +S TK ED+VDVNLKP   ++ A+ QQ   C+C
Sbjct  155  FNIKPLFCKITSALQGNEAVSWTKPEDLVDVNLKPLIISSQADHQQESNCSC  206



>ref|XP_010437115.1| PREDICTED: ras-related protein RABH1c [Camelina sativa]
Length=212

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDVANRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFL  98

Query  477  NTSKWIEEVRTERGS-DVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWIE+V  ERG  DVIIVLVGNKTDLVDKRQVSI EG+ KA+E+GVMFIETSAK  F
Sbjct  99   NTSKWIEDVHRERGQGDVIIVLVGNKTDLVDKRQVSISEGEDKAKEYGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLSS-TKQEDMVDVNLKPTTN  764
            NIK LFRKIAAALPG+++ SS TK EDMVDVNL+ T+N
Sbjct  159  NIKALFRKIAAALPGVDSYSSATKSEDMVDVNLRTTSN  196



>ref|XP_010431970.1| PREDICTED: ras-related protein RABH1c-like [Camelina sativa]
Length=210

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 3/172 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDVANRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFL  98

Query  477  NTSKWIEEVRTERGS-DVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWIE+V  ERG  DVIIVLVGNKTDLVDKRQVSI EG+ KA+E+G+MFIETSAK  F
Sbjct  99   NTSKWIEDVHRERGQGDVIIVLVGNKTDLVDKRQVSISEGEDKAKEYGLMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLSS-TKQEDMVDVNLKPTTN-TNSAEQQGGGCAC  803
            NIK LFRKIAAALPG+++ SS TK EDMVDVNL+ T+N +   ++ GGGC+C
Sbjct  159  NIKALFRKIAAALPGVDSYSSVTKSEDMVDVNLRTTSNPSQGEQEGGGGCSC  210



>ref|XP_002866892.1| hypothetical protein ARALYDRAFT_912477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43151.1| hypothetical protein ARALYDRAFT_912477 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDV+NRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFL  98

Query  477  NTSKWIEEVRTERG-SDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWI++V  ERG SDVIIVLVGNKTDLV+KRQVSI EG+ K +E+GVMFIETSAK  F
Sbjct  99   NTSKWIDDVHRERGQSDVIIVLVGNKTDLVEKRQVSISEGEDKGKEYGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLS-STKQEDMVDVNLKPTTNTN  770
            NIK LFRKIAAALPG++T S +TK EDMVDVNLK T+N++
Sbjct  159  NIKALFRKIAAALPGVDTYSLATKSEDMVDVNLKTTSNSS  198



>gb|ESA21530.1| hypothetical protein GLOINDRAFT_343112 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX69780.1| Ypt6p [Rhizophagus irregularis DAOM 197198w]
Length=210

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYD+ NR SF+
Sbjct  45   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRNSFM  104

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NT+KWI++VR ERG+DVIIVLVGNKTDL DKRQV+ EEG+ KA+EF VMFIETSAKAG N
Sbjct  105  NTAKWIDDVRAERGNDVIIVLVGNKTDLNDKRQVTTEEGEKKAKEFNVMFIETSAKAGHN  164

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFRKIA ALPGME   +  Q  ++DVN+   T  NS   +G  CAC
Sbjct  165  VKTLFRKIAQALPGMENTMNEPQNQLIDVNINSGTQNNS---EGNSCAC  210



>ref|NP_201304.1| RAB GTPase homolog H1A [Arabidopsis thaliana]
 sp|Q9LV79.1|RAH1A_ARATH RecName: Full=Ras-related protein RABH1a; Short=AtRABH1a [Arabidopsis 
thaliana]
 dbj|BAA97311.1| GTP binding protein-like [Arabidopsis thaliana]
 gb|AED97979.1| RAB GTPase homolog H1A [Arabidopsis thaliana]
Length=206

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            + QATIGIDFLSKT   EDRT RLQLWDTAGQERF+SL+PSYIRDSSVAV+VYDVA++QS
Sbjct  35   SYQATIGIDFLSKTTRYEDRTFRLQLWDTAGQERFKSLVPSYIRDSSVAVIVYDVASKQS  94

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            F+NTSKWIEEVR ERGS VIIVLVGNKTDLV+KRQVSIEEG+ KAREFG +F+ETSAKAG
Sbjct  95   FINTSKWIEEVRAERGSYVIIVLVGNKTDLVNKRQVSIEEGENKAREFGALFMETSAKAG  154

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSA-EQQGGGCAC  803
            FNIKPLF KI +AL G E +S TKQED+VDVNLKP   ++ A  QQ   C+C
Sbjct  155  FNIKPLFCKITSALQGNEAVSWTKQEDLVDVNLKPLMFSSQANHQQESNCSC  206



>gb|AGN12807.1| Ras-related protein RABH1C [Leavenworthia alabamica]
Length=214

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDV+ RQSFL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSKRQSFL  98

Query  477  NTSKWIEEVRTERG-SDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWIE+VR ERG  DVIIVLVGNKTDL D+RQVSI EG+ K +E+GVMFIETSAK  F
Sbjct  99   NTSKWIEDVRRERGQGDVIIVLVGNKTDLADQRQVSITEGEDKGKEYGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLSS-TKQEDMVDVNLKPTTNTN  770
            NIK LFRKIAAALPGM++ SS TK EDMVDVNLK T+N++
Sbjct  159  NIKSLFRKIAAALPGMDSYSSVTKSEDMVDVNLKTTSNSS  198



>emb|CDY18689.1| BnaA09g07060D [Brassica napus]
Length=217

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 148/184 (80%), Gaps = 13/184 (7%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLW-------------DTAGQERFRSLIPSYIRdss  431
            N QATIGIDFLSKTM  ED T RLQLW             DTAGQERF+SLIPSYIRDSS
Sbjct  34   NYQATIGIDFLSKTMRHEDTTFRLQLWYIHLLILFVVLVLDTAGQERFKSLIPSYIRDSS  93

Query  432  vavvvydvaNRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKARE  611
            VAV+VYDVAN+QSF+N SKWIE+V  ERG+ VII LVGNKTDLV +RQVSIEEGD KARE
Sbjct  94   VAVIVYDVANKQSFINASKWIEDVHAERGNQVIIALVGNKTDLVHRRQVSIEEGDTKARE  153

Query  612  FGVMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGG  791
             G +FIETSAKAGFNIKPLF KIA+AL G ET++  +QED+VDVNLKP TN++ ++QQ G
Sbjct  154  LGALFIETSAKAGFNIKPLFCKIASALQGTETVTWRRQEDLVDVNLKPMTNSSHSQQQQG  213

Query  792  GCAC  803
             C+C
Sbjct  214  NCSC  217



>ref|XP_011110515.1| hypothetical protein H072_4618 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41482.1| hypothetical protein H072_4618 [Dactylellina haptotyla CBS 200.50]
Length=210

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYD+ NRQSFL
Sbjct  46   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFL  105

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            NTSKW+++VR ERG+DVIIVLVGNKTDL DKRQV+ EEG+ KA+EF VMFIETSAKAG N
Sbjct  106  NTSKWVDDVRGERGNDVIIVLVGNKTDLNDKRQVTTEEGEKKAKEFKVMFIETSAKAGHN  165

Query  657  IKPLFRKIAAALPGME-TLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LF++IA ALPGME  L     + M+DVN+KP T +N+     G CAC
Sbjct  166  VKTLFKRIAQALPGMEGPLGEDAGKHMIDVNIKPETGSNT-----GDCAC  210



>ref|XP_006281115.1| hypothetical protein CARUB_v10027144mg [Capsella rubella]
 gb|EOA14013.1| hypothetical protein CARUB_v10027144mg [Capsella rubella]
Length=205

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            N QATIG+DFLSKTM  EDRT RLQLWDTAGQERF+S++PSYIRDSSVAV+VYDVA++Q+
Sbjct  34   NYQATIGVDFLSKTMRYEDRTFRLQLWDTAGQERFQSIVPSYIRDSSVAVIVYDVADKQT  93

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            FLNTSKWI+EVR ERGS VI+VLVGNKTDL+ KRQVSIEEGD KA EFG +F+ETSAKAG
Sbjct  94   FLNTSKWIQEVRAERGSHVIVVLVGNKTDLIHKRQVSIEEGDNKASEFGALFMETSAKAG  153

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLF KI +AL G E +S TKQED+VDVNLK +T ++ AE      +C
Sbjct  154  FNIKPLFCKITSALQGNEAVSGTKQEDLVDVNLKASTKSSRAEHDQVESSC  204



>ref|XP_006394088.1| hypothetical protein EUTSA_v10005261mg, partial [Eutrema salsugineum]
 gb|ESQ31374.1| hypothetical protein EUTSA_v10005261mg, partial [Eutrema salsugineum]
Length=198

 Score =   238 bits (608),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvy-dvaNRQSF  473
            QATIGIDFL+KTM  EDR  RLQLWDTAGQERF+SLIPSYIRDSSVAV+VY  VAN+QSF
Sbjct  28   QATIGIDFLAKTMRHEDRIFRLQLWDTAGQERFKSLIPSYIRDSSVAVIVYDVVANKQSF  87

Query  474  LNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKR-QVSIEEGDAKAREFGVMFIETSAKAG  650
            +NTSKWIE+VR ERGS VIIVLVGNKTDLV +  + SIEEGD KARE G +FIETSAK G
Sbjct  88   INTSKWIEDVRAERGSHVIIVLVGNKTDLVHRSFKFSIEEGDNKAREVGALFIETSAKVG  147

Query  651  FNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            FNIKPLF KI +AL G+ET + TKQED+VDVNLKP TN++ AEQQ G C+C
Sbjct  148  FNIKPLFCKITSALQGIETHTWTKQEDLVDVNLKPLTNSSQAEQQQGNCSC  198



>gb|KFK30558.1| hypothetical protein AALP_AA7G277600 [Arabis alpina]
Length=214

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDV+NRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFL  98

Query  477  NTSKWIEEVRTERGS-DVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWI++V  ERGS DVIIVLVGNKTDLVDKRQVSI EG+ K +E+GV+FIETSAK  F
Sbjct  99   NTSKWIDDVHRERGSNDVIIVLVGNKTDLVDKRQVSISEGENKGKEYGVLFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLSST-KQEDMVDVNLKPTTNTNS  773
            NIK LFRKIAAALPGM++ SS  K EDMVDVNLK  +N +S
Sbjct  159  NIKALFRKIAAALPGMDSYSSVAKSEDMVDVNLKTNSNPSS  199



>ref|XP_006411786.1| hypothetical protein EUTSA_v10026225mg [Eutrema salsugineum]
 dbj|BAJ34631.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53239.1| hypothetical protein EUTSA_v10026225mg [Eutrema salsugineum]
Length=213

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDVANRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFL  98

Query  477  NTSKWIEEVRTERGS-DVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            N SKWI++V  ERGS DVIIVLVGNKTDLV+KRQVSI EG+ K +E GVMFIETSAK  F
Sbjct  99   NISKWIDDVHRERGSGDVIIVLVGNKTDLVEKRQVSISEGEDKGKEHGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLSS-TKQEDMVDVNLKPTTNTN  770
            NIK LFRKIAAALPGM++ SS TK EDMVDVNLK T+N++
Sbjct  159  NIKALFRKIAAALPGMDSYSSATKSEDMVDVNLKTTSNSS  198



>ref|XP_002500129.1| ras-related gtp-binding protein, alternative splice [Micromonas 
sp. RCC299]
 gb|ACO61387.1| ras-related gtp-binding protein, alternative splice [Micromonas 
sp. RCC299]
Length=204

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 146/174 (84%), Gaps = 9/174 (5%)
 Frame = +3

Query  291  NMQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQS  470
            + QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDV++R S
Sbjct  37   SYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSSRSS  96

Query  471  FLNTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAG  650
            F NTS+WI+EVRTERGSDVI+VLVGNKTDL DKR+VS+EEGDA+ARE GVMFIETSAKAG
Sbjct  97   FANTSRWIDEVRTERGSDVIVVLVGNKTDLTDKREVSVEEGDARAREAGVMFIETSAKAG  156

Query  651  FNIKPLFRKIAAALPGMETLS--STKQED-MVDVNLKPTTNTNSAEQQGGGCAC  803
            FN+K LFRKIAAALPGME  +  + K ED +VDV L       +       CAC
Sbjct  157  FNVKALFRKIAAALPGMEAPAAPAAKVEDRLVDVKL------TAPAPPASSCAC  204



>ref|XP_009678700.1| PREDICTED: ras-related protein Rab-6A, partial [Struthio camelus 
australis]
Length=166

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  1    QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  60

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  61   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  120

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  121  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  166



>ref|XP_008148176.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Eptesicus fuscus]
Length=175

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+   +   +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQDQPVSE---GGCSC  175



>ref|XP_005230482.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Falco peregrinus]
 ref|XP_005445989.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Falco cherrug]
 ref|XP_005493476.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Zonotrichia 
albicollis]
 ref|XP_007428991.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Python bivittatus]
 ref|XP_007428992.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Python bivittatus]
 ref|XP_008494014.1| PREDICTED: ras-related protein Rab-6A [Calypte anna]
 ref|XP_009090956.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Serinus canaria]
 ref|XP_009284380.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Aptenodytes 
forsteri]
 ref|XP_009327300.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Pygoscelis 
adeliae]
 ref|XP_009491318.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Pelecanus crispus]
 ref|XP_009474740.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Nipponia nippon]
 ref|XP_009503988.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Phalacrocorax 
carbo]
 ref|XP_009564703.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Cuculus canorus]
 ref|XP_009575331.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Fulmarus glacialis]
 ref|XP_009632880.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Egretta garzetta]
 ref|XP_009699804.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Cariama cristata]
 ref|XP_009810598.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Gavia stellata]
 ref|XP_009914947.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009931615.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Opisthocomus 
hoazin]
 ref|XP_009954493.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Leptosomus 
discolor]
 ref|XP_009954496.1| PREDICTED: ras-related protein Rab-6A isoform X5 [Leptosomus 
discolor]
 ref|XP_010179542.1| PREDICTED: ras-related protein Rab-6B isoform X2 [Mesitornis 
unicolor]
 ref|XP_010287735.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Phaethon lepturus]
 ref|XP_010308849.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Balearica regulorum 
gibbericeps]
Length=175

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  175



>ref|XP_005230481.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Falco peregrinus]
 ref|XP_005445988.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Falco cherrug]
 ref|XP_005493477.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Zonotrichia 
albicollis]
 ref|XP_007062357.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Chelonia mydas]
 ref|XP_007428993.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Python bivittatus]
 ref|XP_008121927.1| PREDICTED: ras-related protein Rab-6A [Anolis carolinensis]
 ref|XP_008642859.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Corvus brachyrhynchos]
 ref|XP_008918430.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Manacus vitellinus]
 ref|XP_009069531.1| PREDICTED: ras-related protein Rab-6A [Acanthisitta chloris]
 ref|XP_009090955.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Serinus canaria]
 ref|XP_009284379.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009327299.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Pygoscelis 
adeliae]
 ref|XP_009491317.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Pelecanus crispus]
 ref|XP_009474739.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Nipponia nippon]
 ref|XP_009503987.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Phalacrocorax 
carbo]
 ref|XP_009564701.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Cuculus canorus]
 ref|XP_009575330.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Fulmarus glacialis]
 ref|XP_009632879.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Egretta garzetta]
 ref|XP_009699796.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Cariama cristata]
 ref|XP_009810597.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Gavia stellata]
 ref|XP_009901219.1| PREDICTED: ras-related protein Rab-6A [Picoides pubescens]
 ref|XP_009914946.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Haliaeetus 
albicilla]
 ref|XP_009931616.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Opisthocomus 
hoazin]
 ref|XP_009954491.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Leptosomus 
discolor]
 ref|XP_009954494.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Leptosomus 
discolor]
 ref|XP_010179541.1| PREDICTED: ras-related protein Rab-6B isoform X1 [Mesitornis 
unicolor]
 ref|XP_010287734.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Phaethon lepturus]
 ref|XP_010308848.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Balearica regulorum 
gibbericeps]
 ref|XP_010704603.1| PREDICTED: ras-related protein Rab-6A [Meleagris gallopavo]
Length=175

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  175



>gb|KFP61007.1| Ras-related protein Rab-6A, partial [Cariama cristata]
Length=185

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  20   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  79

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  80   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  139

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  140  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  185



>gb|KDD77143.1| Ras family protein [Helicosporidium sp. ATCC 50920]
Length=204

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVV+DV NRQSFL
Sbjct  35   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVFDVTNRQSFL  94

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
            + S+W EEVR ERGSDVI+VLVGNKTDL +KR VS EEG+A+A E GV FIETSAKAGFN
Sbjct  95   SVSRWTEEVRAERGSDVILVLVGNKTDLPEKRVVSCEEGEARAAELGVHFIETSAKAGFN  154

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNL-KPTTNTNSAEQQGGGCAC  803
            +K LFRKIA  LPGME  +  + ED+VD+NL  P            GCAC
Sbjct  155  VKALFRKIATTLPGMEGAAGARAEDLVDINLAHPAATKTGTPAASTGCAC  204



>ref|XP_007889377.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Callorhinchus 
milii]
Length=208

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQV+IEEG+ KA+E  VMFIETSAKAG+N
Sbjct  103  QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVAIEEGERKAKELNVMFIETSAKAGYN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+ T     +E   GGC+C
Sbjct  163  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKTQEQPVSE---GGCSC  208



>ref|XP_010411616.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Corvus cornix 
cornix]
Length=192

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  27   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  86

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  87   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  146

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  147  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  192



>ref|NP_195699.1| Ras-related protein RABH1c [Arabidopsis thaliana]
 sp|Q9SMR4.1|RAH1C_ARATH RecName: Full=Ras-related protein RABH1c; Short=AtRABH1c [Arabidopsis 
thaliana]
 gb|AAK17177.1|AF325109_1 small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAK62397.1|AF386952_1 small GTP-binding protein-like [Arabidopsis thaliana]
 emb|CAB38902.1| small GTP-binding protein-like [Arabidopsis thaliana]
 emb|CAB80652.1| small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAN15362.1| small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AEE87134.1| Ras-related protein RABH1c [Arabidopsis thaliana]
Length=214

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDV+NRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFL  98

Query  477  NTSKWIEEVRTERG-SDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWIE+V  ERG S+VIIVLVGNKTDLV+KRQVSI EG+ K +E+GVMFIETSAK  F
Sbjct  99   NTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEGEDKGKEYGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLS-STKQEDMVDVNLKPTTNTN  770
            NIK LFRKIAAALPG+++ S +TK +DMVDVNLK T+N++
Sbjct  159  NIKALFRKIAAALPGVDSYSLATKSDDMVDVNLKTTSNSS  198



>ref|XP_006937019.1| PREDICTED: ras-related protein Rab-6A [Felis catus]
 ref|XP_007113349.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Physeter catodon]
 ref|XP_008577670.1| PREDICTED: ras-related protein Rab-6C isoform X1 [Galeopterus 
variegatus]
 ref|XP_009245095.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Pongo abelii]
Length=175

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  175



>ref|XP_005579105.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Macaca fascicularis]
Length=188

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  23   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  82

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  83   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  142

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  143  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  188



>ref|XP_007889376.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Callorhinchus 
milii]
Length=208

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQV+IEEG+ KA+E  VMFIETSAKAG+N
Sbjct  103  QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVAIEEGERKAKELNVMFIETSAKAGYN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+ T     +E   GGC+C
Sbjct  163  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKTQEQPVSE---GGCSC  208



>ref|NP_001230648.1| ras-related protein Rab-6A isoform c [Homo sapiens]
 ref|XP_004090672.1| PREDICTED: ras-related protein Rab-6A [Nomascus leucogenys]
 ref|XP_004391822.1| PREDICTED: ras-related protein Rab-6A isoform 3 [Odobenus rosmarus 
divergens]
 ref|XP_005690016.1| PREDICTED: ras-related protein Rab-6A [Capra hircus]
 ref|XP_006141034.1| PREDICTED: ras-related protein Rab-6A [Tupaia chinensis]
 ref|XP_006885630.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Elephantulus 
edwardii]
 ref|XP_008577671.1| PREDICTED: ras-related protein Rab-6C isoform X2 [Galeopterus 
variegatus]
 ref|XP_009245094.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Pongo abelii]
Length=175

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  175



>gb|KFP76916.1| Ras-related protein Rab-6A, partial [Acanthisitta chloris]
Length=186

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  21   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  80

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  81   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  140

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  141  VKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSE---GGCSC  186



>ref|XP_004683244.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Condylura cristata]
Length=175

 Score =   235 bits (600),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEPPVSE---GGCSC  175



>ref|XP_006284510.1| hypothetical protein CARUB_v10005710mg [Capsella rubella]
 gb|EOA17408.1| hypothetical protein CARUB_v10005710mg [Capsella rubella]
Length=216

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            Q TIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVA+VVYDVANRQ+FL
Sbjct  39   QPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFL  98

Query  477  NTSKWIEEVRTERG-SDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGF  653
            NTSKWIE+V  ERG  DVIIVLVGNKTDLVDKRQVSI EG+ K +E+GVMFIETSAK  F
Sbjct  99   NTSKWIEDVHRERGQGDVIIVLVGNKTDLVDKRQVSISEGEDKGKEYGVMFIETSAKENF  158

Query  654  NIKPLFRKIAAALPGMETLS-STKQEDMVDVNLKPTTN  764
            NIK LFRKIAAALPG+++ S  TK EDMVDVNL+ T+N
Sbjct  159  NIKALFRKIAAALPGVDSYSLGTKSEDMVDVNLRTTSN  196



>ref|XP_009185177.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Papio anubis]
Length=197

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  32   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  91

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  92   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  151

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  152  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  197



>ref|XP_006181660.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Camelus ferus]
 ref|XP_006203412.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Vicugna pacos]
Length=187

 Score =   235 bits (600),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  22   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  81

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  82   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  141

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  142  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  187



>ref|XP_008336818.1| PREDICTED: ras-related protein Rab-6B isoform X2 [Cynoglossus 
semilaevis]
Length=208

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYDV N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDVTNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             TSKWIE+VR+ERGSDVII+LVGNKTDL DKRQ++IEEG+ +A+E  VMFIETSAK G N
Sbjct  103  QTSKWIEDVRSERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELNVMFIETSAKTGHN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME +  T +E M+D+ L    +T+S E   GGC C
Sbjct  163  VKQLFRRVAAALPGMENVQETSKEGMIDIKLDKLQDTHSTE---GGCPC  208



>ref|XP_002593085.1| hypothetical protein BRAFLDRAFT_210049 [Branchiostoma floridae]
 gb|EEN49096.1| hypothetical protein BRAFLDRAFT_210049 [Branchiostoma floridae]
Length=196

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  29   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNANSFH  88

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             TSKWI++VRTERGSDVII+LVGNKTDL DKRQVS+E+G+ KA+E  VMFIETSAK G+N
Sbjct  89   QTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSLEDGERKAKELNVMFIETSAKTGYN  148

Query  657  IKPLFRKIAAALPGMETLSSTK-QEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+    K +EDM++V LK T      + Q GGCAC
Sbjct  149  VKQLFRRVAAALPGMESSQDQKNKEDMIEVKLKDT--PQEPQSQEGGCAC  196



>ref|XP_009005706.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Callithrix 
jacchus]
Length=198

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  33   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  92

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  93   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  152

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  153  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  198



>ref|XP_004641978.1| PREDICTED: ras-related protein Rab-6A isoform X3 [Octodon degus]
Length=175

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+        E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVTE---GGCSC  175



>ref|XP_003910445.2| PREDICTED: ras-related protein Rab-6A isoform X2 [Papio anubis]
Length=197

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  32   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  91

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  92   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  151

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  152  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  197



>ref|XP_002754841.1| PREDICTED: ras-related protein Rab-6A isoform X2 [Callithrix 
jacchus]
Length=198

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  33   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  92

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  93   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  152

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  153  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  198



>ref|XP_007650493.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Cricetulus 
griseus]
Length=194

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  29   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  88

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  89   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  148

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+       +E   GGC+C
Sbjct  149  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE---GGCSC  194



>ref|XP_003780961.1| PREDICTED: ras-related protein Rab-6A isoform 2 [Otolemur garnettii]
Length=208

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  103  QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNL-KPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L KP   T S     GGC+C
Sbjct  163  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEPTVSE----GGCSC  208



>ref|XP_003456835.1| PREDICTED: ras-related protein Rab-6A-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_004573396.1| PREDICTED: ras-related protein Rab-6A-like isoform X1 [Maylandia 
zebra]
 ref|XP_005735662.1| PREDICTED: ras-related protein Rab-6A-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005922101.1| PREDICTED: ras-related protein Rab-6A-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006802192.1| PREDICTED: ras-related protein Rab-6A-like isoform X2 [Neolamprologus 
brichardi]
Length=208

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  103  QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGM+T     +EDM+D+ L+      ++E   GGC+C
Sbjct  163  VKQLFRRVAAALPGMDTTQDKSREDMIDIKLEKPPEQPTSE---GGCSC  208



>ref|XP_006100525.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Myotis lucifugus]
 ref|XP_008148174.1| PREDICTED: ras-related protein Rab-6A isoform X1 [Eptesicus fuscus]
Length=208

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDS+VAVVVYD+ N  SF 
Sbjct  43   QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQ  102

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  103  QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  162

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM+D+ L+   +   +E   GGC+C
Sbjct  163  VKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQDQPVSE---GGCSC  208



>dbj|BAH13508.1| unnamed protein product [Homo sapiens]
Length=175

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  297  QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRdssvavvvydvaNRQSFL  476
            QATIGIDFLSKTMYLEDRT+RLQLWDTAGQERFRSLIPSYIRDS+ AVVVYD+ N  SF 
Sbjct  10   QATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ  69

Query  477  NTSKWIEEVRTERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKAREFGVMFIETSAKAGFN  656
             T+KWI++VRTERGSDVII+LVGNKTDL DKRQVSIEEG+ KA+E  VMFIETSAKAG+N
Sbjct  70   QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYN  129

Query  657  IKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTTNTNSAEQQGGGCAC  803
            +K LFR++AAALPGME+     +EDM D+ L+       +E   GGC+C
Sbjct  130  VKQLFRRVAAALPGMESTQDRSREDMTDIKLEKPQEQPVSE---GGCSC  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566195601152