BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21389_g1_i2 len=461 path=[541:0-106 648:107-324 1686:325-460]

Length=461
                                                                      Score     E

emb|CDP19035.1|  unnamed protein product                                109   2e-39   
emb|CDP20403.1|  unnamed protein product                                113   2e-39   
ref|XP_011071563.1|  PREDICTED: isoleucine N-monooxygenase 1-like       121   5e-39   
ref|XP_006356653.1|  PREDICTED: isoleucine N-monooxygenase 1-like       121   7e-39   
emb|CDP18411.1|  unnamed protein product                                109   2e-38   
ref|XP_011071676.1|  PREDICTED: isoleucine N-monooxygenase 1-like       119   4e-38   
ref|XP_009601899.1|  PREDICTED: LOW QUALITY PROTEIN: isoleucine N...    124   6e-38   
ref|XP_004245410.1|  PREDICTED: isoleucine N-monooxygenase 1-like       125   7e-38   
emb|CDP18412.1|  unnamed protein product                                112   1e-37   
emb|CDP18413.1|  unnamed protein product                                112   2e-37   
ref|XP_011084186.1|  PREDICTED: isoleucine N-monooxygenase 1-like       119   2e-37   
ref|XP_011071674.1|  PREDICTED: isoleucine N-monooxygenase 1-like       117   3e-37   
emb|CDP12474.1|  unnamed protein product                                107   4e-37   
ref|XP_009782885.1|  PREDICTED: isoleucine N-monooxygenase 2-like       125   6e-37   
ref|XP_009765490.1|  PREDICTED: isoleucine N-monooxygenase 2-like...    125   7e-37   
ref|XP_009623062.1|  PREDICTED: isoleucine N-monooxygenase 2-like       122   9e-37   
emb|CDP19033.1|  unnamed protein product                                106   1e-36   
ref|XP_006367541.1|  PREDICTED: isoleucine N-monooxygenase 1-like       122   1e-36   
ref|XP_002523441.1|  cytochrome P450, putative                          106   2e-36   Ricinus communis
emb|CDP12475.1|  unnamed protein product                                105   2e-36   
emb|CAN75997.1|  hypothetical protein VITISV_022990                     106   3e-36   Vitis vinifera
ref|XP_002276655.1|  PREDICTED: phenylalanine N-monooxygenase-like      105   3e-36   Vitis vinifera
ref|XP_004237225.1|  PREDICTED: isoleucine N-monooxygenase 1-like       127   6e-36   
ref|XP_002523438.1|  cytochrome P450, putative                          104   1e-35   Ricinus communis
ref|XP_004237294.1|  PREDICTED: isoleucine N-monooxygenase 1-like       126   1e-35   
ref|XP_009369526.1|  PREDICTED: isoleucine N-monooxygenase 1-like       100   1e-35   
gb|KCW62239.1|  hypothetical protein EUGRSUZ_H04899                   99.8    3e-35   
ref|XP_008349637.1|  PREDICTED: isoleucine N-monooxygenase 1-like       102   3e-35   
ref|XP_002264201.1|  PREDICTED: phenylalanine N-monooxygenase           100   4e-35   Vitis vinifera
ref|XP_008359055.1|  PREDICTED: isoleucine N-monooxygenase 1-like       102   4e-35   
ref|XP_004252024.1|  PREDICTED: isoleucine N-monooxygenase 1-like       125   4e-35   
gb|EYU45627.1|  hypothetical protein MIMGU_mgv1a004405mg                110   5e-35   
ref|XP_007017085.1|  Cytochrome p450 79a2, putative                     103   6e-35   
ref|XP_010253086.1|  PREDICTED: phenylalanine N-monooxygenase           102   7e-35   
gb|KCW74807.1|  hypothetical protein EUGRSUZ_E03537                   99.8    9e-35   
ref|XP_007146888.1|  hypothetical protein PHAVU_006G078900g             100   9e-35   
ref|XP_011071673.1|  PREDICTED: isoleucine N-monooxygenase 1-like       109   1e-34   
gb|KHG05899.1|  Phenylalanine N-monooxygenase -like protein             105   1e-34   
ref|XP_010059403.1|  PREDICTED: tyrosine N-monooxygenase-like         99.8    1e-34   
ref|XP_002319424.1|  hypothetical protein POPTR_0013s15320g             102   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_007146890.1|  hypothetical protein PHAVU_006G079100g             100   1e-34   
gb|AHF20913.1|  cytochrome P450                                         103   1e-34   
ref|XP_008385013.1|  PREDICTED: isoleucine N-monooxygenase 2-like     95.9    2e-34   
ref|XP_006387420.1|  hypothetical protein POPTR_1061s00200g             103   2e-34   
ref|XP_007011296.1|  Cytochrome p450 79a2                               107   2e-34   
ref|XP_007011304.1|  Cytochrome p450 79a2                               108   2e-34   
ref|XP_009758130.1|  PREDICTED: isoleucine N-monooxygenase 2-like       114   3e-34   
ref|XP_010027351.1|  PREDICTED: tyrosine N-monooxygenase-like           100   3e-34   
ref|XP_007011302.1|  Cytochrome p450 79a2                               107   5e-34   
ref|XP_010027355.1|  PREDICTED: tyrosine N-monooxygenase-like         98.6    5e-34   
ref|XP_010030372.1|  PREDICTED: tyrosine N-monooxygenase-like         99.4    5e-34   
ref|XP_011021045.1|  PREDICTED: isoleucine N-monooxygenase 2-like       101   6e-34   
gb|KCW62254.1|  hypothetical protein EUGRSUZ_H04914                   98.2    6e-34   
gb|KCW54304.1|  hypothetical protein EUGRSUZ_I00267                   99.4    6e-34   
ref|XP_002274952.2|  PREDICTED: phenylalanine N-monooxygenase-like      105   9e-34   Vitis vinifera
ref|XP_008385015.1|  PREDICTED: isoleucine N-monooxygenase 1-like       102   1e-33   
ref|XP_010025546.1|  PREDICTED: tyrosine N-monooxygenase-like         98.6    1e-33   
gb|KCW62253.1|  hypothetical protein EUGRSUZ_H04913                   98.6    1e-33   
gb|AHI88992.1|  CYP79D6v4                                             99.4    1e-33   
ref|XP_007011298.1|  Cytochrome p450 79a2                               103   1e-33   
ref|XP_011098372.1|  PREDICTED: phenylalanine N-monooxygenase-like      108   2e-33   
ref|XP_002523435.1|  cytochrome P450, putative                          100   2e-33   Ricinus communis
ref|XP_009599475.1|  PREDICTED: isoleucine N-monooxygenase 2-like       117   2e-33   
ref|XP_009600260.1|  PREDICTED: phenylalanine N-monooxygenase-like      111   3e-33   
ref|XP_006376556.1|  hypothetical protein POPTR_0013s15310g             100   3e-33   
gb|AHF20912.1|  cytochrome P450                                         100   3e-33   
ref|XP_011005474.1|  PREDICTED: cytochrome P450 79B1-like             98.6    8e-33   
ref|XP_002305081.2|  Cytochrome P450 79B2 family protein              99.0    9e-33   Populus trichocarpa [western balsam poplar]
gb|KCW75037.1|  hypothetical protein EUGRSUZ_E03811                   97.1    1e-32   
ref|XP_008366287.1|  PREDICTED: isoleucine N-monooxygenase 1-like     99.0    1e-32   
ref|XP_002269843.2|  PREDICTED: phenylalanine N-monooxygenase         95.1    1e-32   Vitis vinifera
ref|XP_010030373.1|  PREDICTED: valine N-monooxygenase 1-like         97.8    1e-32   
ref|XP_009785456.1|  PREDICTED: isoleucine N-monooxygenase 2-like       114   1e-32   
ref|XP_010030374.1|  PREDICTED: tyrosine N-monooxygenase-like           100   1e-32   
ref|XP_011098373.1|  PREDICTED: valine N-monooxygenase 1-like           107   1e-32   
gb|KCW62252.1|  hypothetical protein EUGRSUZ_H04912                   94.4    1e-32   
gb|KEH34488.1|  cytochrome P450 family protein                          105   2e-32   
ref|XP_003543894.1|  PREDICTED: isoleucine N-monooxygenase 2-like       103   2e-32   
gb|KCW54305.1|  hypothetical protein EUGRSUZ_I00268                   97.8    2e-32   
emb|CAN61661.1|  hypothetical protein VITISV_000261                   94.7    2e-32   Vitis vinifera
emb|CAN74072.1|  hypothetical protein VITISV_035799                   99.4    2e-32   Vitis vinifera
ref|XP_010027354.1|  PREDICTED: tyrosine N-monooxygenase-like         93.6    2e-32   
gb|KEH34486.1|  cytochrome P450 family protein                          101   3e-32   
ref|XP_002274698.2|  PREDICTED: phenylalanine N-monooxygenase-like    98.6    3e-32   Vitis vinifera
gb|KHG04035.1|  Tyrosine N-monooxygenase                              91.3    3e-32   
ref|XP_010059479.1|  PREDICTED: tyrosine N-monooxygenase-like         97.4    4e-32   
gb|KCW74950.1|  hypothetical protein EUGRSUZ_E03692                   97.4    4e-32   
ref|XP_002523444.1|  conserved hypothetical protein                   95.1    4e-32   Ricinus communis
ref|XP_011075711.1|  PREDICTED: valine N-monooxygenase 1-like           104   4e-32   
ref|XP_002274641.1|  PREDICTED: phenylalanine N-monooxygenase-like      100   6e-32   Vitis vinifera
ref|XP_009342222.1|  PREDICTED: isoleucine N-monooxygenase 1-like     99.8    6e-32   
gb|KCW62248.1|  hypothetical protein EUGRSUZ_H04908                   91.7    7e-32   
ref|XP_009780952.1|  PREDICTED: isoleucine N-monooxygenase 2-like       111   8e-32   
ref|XP_006363576.1|  PREDICTED: isoleucine N-monooxygenase 1-like       128   8e-32   
ref|XP_003633447.1|  PREDICTED: phenylalanine N-monooxygenase-like    99.0    8e-32   
gb|KHN24730.1|  Isoleucine N-monooxygenase 2                            100   1e-31   
ref|XP_003537358.1|  PREDICTED: isoleucine N-monooxygenase 2-like       100   1e-31   
gb|KDP45690.1|  hypothetical protein JCGZ_17297                       94.7    2e-31   
dbj|BAP15883.1|  cytochrome P450 79A68                                  104   2e-31   
ref|XP_008241408.1|  PREDICTED: isoleucine N-monooxygenase 2            104   2e-31   
ref|XP_007207880.1|  hypothetical protein PRUPE_ppa021326mg           95.1    3e-31   
gb|ADM34983.1|  CYP79D16                                              95.1    3e-31   
ref|XP_006492162.1|  PREDICTED: phenylalanine N-monooxygenase-like    90.5    3e-31   
ref|XP_007203073.1|  hypothetical protein PRUPE_ppa023521mg             104   3e-31   
gb|EMT15372.1|  Tyrosine N-monooxygenase                              92.8    6e-31   
ref|XP_008231301.1|  PREDICTED: isoleucine N-monooxygenase 2-like     93.6    6e-31   
ref|XP_006480303.1|  PREDICTED: uncharacterized protein LOC102610907  89.7    7e-31   
ref|XP_006435922.1|  hypothetical protein CICLE_v10031307mg           89.0    1e-30   
ref|XP_006435920.1|  hypothetical protein CICLE_v10031309mg           89.0    1e-30   
ref|XP_006363575.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    124   1e-30   
gb|EMT13826.1|  Tyrosine N-monooxygenase                              95.5    2e-30   
ref|XP_004509432.1|  PREDICTED: isoleucine N-monooxygenase 2-like     85.1    2e-30   
ref|XP_006367899.1|  PREDICTED: isoleucine N-monooxygenase 2-like       124   2e-30   
ref|XP_006435921.1|  hypothetical protein CICLE_v10031099mg           88.2    2e-30   
ref|XP_006486168.1|  PREDICTED: phenylalanine N-monooxygenase-like    88.2    2e-30   
ref|XP_003556848.1|  PREDICTED: isoleucine N-monooxygenase 2-like     99.8    2e-30   
ref|XP_007134794.1|  hypothetical protein PHAVU_010G076800g           92.0    2e-30   
dbj|BAP15884.1|  cytochrome P450 79D16                                91.7    2e-30   
gb|EMT08477.1|  Tyrosine N-monooxygenase                              91.7    2e-30   
gb|KDO39922.1|  hypothetical protein CISIN_1g035533mg                 88.2    2e-30   
ref|XP_006428266.1|  hypothetical protein CICLE_v10013842mg           87.8    3e-30   
ref|XP_006420514.1|  hypothetical protein CICLE_v10004690mg           90.5    3e-30   
ref|XP_002274920.1|  PREDICTED: phenylalanine N-monooxygenase-like    93.6    3e-30   Vitis vinifera
ref|XP_002466099.1|  hypothetical protein SORBIDRAFT_01g001200        89.7    4e-30   Sorghum bicolor [broomcorn]
ref|XP_010543679.1|  PREDICTED: phenylalanine N-monooxygenase           103   4e-30   
ref|XP_006486508.1|  PREDICTED: phenylalanine N-monooxygenase-like    87.4    4e-30   
gb|KHN48839.1|  Isoleucine N-monooxygenase 2                          98.2    5e-30   
ref|XP_002438593.1|  hypothetical protein SORBIDRAFT_10g022470        91.3    6e-30   Sorghum bicolor [broomcorn]
ref|XP_006486167.1|  PREDICTED: phenylalanine N-monooxygenase-like    87.4    7e-30   
ref|XP_006435923.1|  hypothetical protein CICLE_v10031311mg           87.4    8e-30   
ref|XP_006437149.1|  hypothetical protein CICLE_v10033385mg           88.6    8e-30   
ref|XP_006484922.1|  PREDICTED: phenylalanine N-monooxygenase-like    88.6    8e-30   
gb|KDP45692.1|  hypothetical protein JCGZ_17299                       95.1    2e-29   
gb|EMT03570.1|  Tyrosine N-monooxygenase                              92.4    2e-29   
sp|Q6J540.1|C79D4_LOTJA  RecName: Full=Isoleucine N-monooxygenase...  96.3    3e-29   Lotus japonicus
gb|KDP45703.1|  hypothetical protein JCGZ_17310                       95.9    3e-29   
gb|AHY21766.1|  cytochrome P450 79D15                                 94.7    4e-29   
gb|AHY21764.1|  cytochrome P450 79D15                                 94.4    4e-29   
gb|AHY21765.1|  cytochrome P450 79D15                                 94.4    4e-29   
gb|ACB15194.1|  cytochrome P450                                       94.4    4e-29   Trifolium isthmocarpum
ref|XP_004237224.2|  PREDICTED: isoleucine N-monooxygenase 1-like       120   4e-29   
gb|KEH34365.1|  cytochrome P450 family protein                        94.0    5e-29   
sp|Q6J541.1|C79D3_LOTJA  RecName: Full=Isoleucine N-monooxygenase...  95.5    5e-29   Lotus japonicus
ref|XP_007203677.1|  hypothetical protein PRUPE_ppa026605mg           94.7    5e-29   
gb|AHY21797.1|  cytochrome P450 79D15                                 94.4    5e-29   
gb|AHY21794.1|  cytochrome P450 79D15                                 94.4    6e-29   
ref|XP_004509509.1|  PREDICTED: isoleucine N-monooxygenase 2-like     80.1    6e-29   
ref|XP_007011293.1|  Cytochrome p450 79a2                             87.0    6e-29   
ref|XP_010110140.1|  Isoleucine N-monooxygenase 2                     99.4    6e-29   
gb|AHF22089.1|  CYP79D33                                              89.4    6e-29   
gb|AHY21767.1|  cytochrome P450 79D15                                 94.0    6e-29   
gb|AHY21763.1|  cytochrome P450 79D15                                 93.6    7e-29   
gb|ACB15193.1|  cytochrome P450                                       94.0    7e-29   Trifolium isthmocarpum
gb|AHY21773.1|  cytochrome P450 79D15                                 93.6    7e-29   
gb|AJD25192.1|  cytochrome P450 CYP79D40                              98.2    7e-29   
ref|XP_003629157.1|  Cytochrome P450                                  85.5    8e-29   
ref|XP_003629158.1|  Cytochrome P450                                  85.1    8e-29   
ref|XP_010045992.1|  PREDICTED: valine N-monooxygenase 1-like         92.4    8e-29   
gb|ACG50668.1|  cytochrome P450 CYP79A2                               93.2    9e-29   Brassica rapa subsp. chinensis [bok-choy]
gb|KCW84703.1|  hypothetical protein EUGRSUZ_B01522                   92.4    9e-29   
gb|AHY21754.1|  cytochrome P450 79D15                                 95.5    1e-28   
gb|AHY21761.1|  cytochrome P450 79D15                                 95.5    1e-28   
gb|AHY21753.1|  cytochrome P450 79D15                                 95.5    1e-28   
ref|XP_004509430.1|  PREDICTED: isoleucine N-monooxygenase 2-like     79.0    1e-28   
ref|XP_003629369.1|  Cytochrome P450                                  86.3    1e-28   
ref|XP_004966053.1|  PREDICTED: tyrosine N-monooxygenase-like         94.0    1e-28   
gb|KDP29694.1|  hypothetical protein JCGZ_18629                       87.4    2e-28   
gb|AHY21742.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|AHY21746.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|KDP29692.1|  hypothetical protein JCGZ_18627                       88.6    2e-28   
gb|ACB15165.1|  cytochrome P450                                       94.4    2e-28   Trifolium repens [creeping white clover]
gb|AHY21808.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|ACB15159.1|  cytochrome P450                                       94.4    2e-28   Trifolium repens [creeping white clover]
gb|AHY21758.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|AHY21757.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|AHY21807.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|AHY21778.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|AHY21755.1|  cytochrome P450 79D15                                 94.4    2e-28   
gb|ACB15154.1|  cytochrome P450                                       94.4    3e-28   Trifolium repens [creeping white clover]
gb|AHY21762.1|  cytochrome P450 79D15                                 94.4    3e-28   
gb|ACB15168.1|  cytochrome P450                                       94.4    3e-28   Trifolium repens [creeping white clover]
ref|XP_002534163.1|  cytochrome P450, putative                        87.8    3e-28   Ricinus communis
ref|XP_004295627.1|  PREDICTED: isoleucine N-monooxygenase 2-like     97.8    3e-28   
sp|Q9M7B8.1|C79D1_MANES  RecName: Full=Valine N-monooxygenase 1; ...  86.7    3e-28   Manihot esculenta [manioc]
gb|KDP45698.1|  hypothetical protein JCGZ_17305                       92.0    3e-28   
gb|AAV97889.1|  N-hydroxylating cytochrome P450 CYP79D1               86.7    3e-28   Manihot esculenta [manioc]
gb|AHY21774.1|  cytochrome P450 79D15                                 93.6    4e-28   
gb|KGN66526.1|  Cytochrome P450                                       92.8    4e-28   
emb|CBI24258.3|  unnamed protein product                                106   4e-28   
emb|CDY04945.1|  BnaAnng01270D                                        93.6    4e-28   
gb|KEH20391.1|  cytochrome P450 family protein                        85.5    5e-28   
ref|XP_004154686.1|  PREDICTED: isoleucine N-monooxygenase 1-like     92.0    5e-28   
emb|CBI24260.3|  unnamed protein product                                103   5e-28   
gb|KDP45693.1|  hypothetical protein JCGZ_17300                       89.7    6e-28   
ref|XP_009354043.1|  PREDICTED: isoleucine N-monooxygenase 2-like     92.0    6e-28   
gb|ACB15157.1|  cytochrome P450                                       93.2    6e-28   Trifolium repens [creeping white clover]
gb|ACR10256.1|  cytochrome P450 79a2                                  95.5    6e-28   Brassica rapa subsp. pekinensis [bai cai]
gb|AHY21751.1|  cytochrome P450 79D15                                 93.2    6e-28   
ref|XP_009125594.1|  PREDICTED: phenylalanine N-monooxygenase-like    95.5    6e-28   
gb|AHY21806.1|  cytochrome P450 79D15                                 93.2    6e-28   
gb|ABD84027.1|  cytochrome P450                                       86.7    7e-28   Bambusa ventricosa [Buddha bamboo]
gb|AHY21782.1|  cytochrome P450 79D15                                 92.8    7e-28   
ref|XP_010491059.1|  PREDICTED: phenylalanine N-monooxygenase-like      100   8e-28   
ref|XP_007011306.1|  Cytochrome p450 79a2                             82.8    9e-28   
ref|XP_004139123.1|  PREDICTED: isoleucine N-monooxygenase 1-like     92.0    9e-28   
gb|AHY21802.1|  cytochrome P450 79D15                                 94.4    1e-27   
gb|AHY21788.1|  cytochrome P450 79D15                                 94.4    1e-27   
ref|XP_006464296.1|  PREDICTED: phenylalanine N-monooxygenase-like    91.7    1e-27   
gb|EMT08478.1|  Tyrosine N-monooxygenase                              85.1    1e-27   
ref|XP_010456404.1|  PREDICTED: phenylalanine N-monooxygenase         99.8    1e-27   
ref|XP_004967230.1|  PREDICTED: tyrosine N-monooxygenase-like         94.0    1e-27   
ref|XP_010531370.1|  PREDICTED: tryptophan N-monooxygenase 1          93.2    1e-27   
gb|KDP29696.1|  hypothetical protein JCGZ_18631                       84.3    1e-27   
ref|XP_006428115.1|  hypothetical protein CICLE_v10025240mg           91.3    1e-27   
gb|KDP45699.1|  hypothetical protein JCGZ_17306                       87.8    2e-27   
gb|ACB15182.1|  cytochrome P450                                       94.4    2e-27   Trifolium repens [creeping white clover]
ref|NP_680351.1|  cytochrome P450, family 79, subfamily A, polype...  92.0    2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AHY21785.1|  cytochrome P450 79D15                                 94.4    2e-27   
gb|EYU45628.1|  hypothetical protein MIMGU_mgv1a023130mg                116   2e-27   
gb|ACB15153.1|  cytochrome P450                                       94.0    2e-27   Trifolium repens [creeping white clover]
gb|ACB15162.1|  cytochrome P450                                       94.0    2e-27   Trifolium repens [creeping white clover]
ref|XP_002873202.1|  CYP79A2                                          96.7    2e-27   
ref|XP_008456975.1|  PREDICTED: isoleucine N-monooxygenase 1            100   2e-27   
ref|XP_009122135.1|  PREDICTED: phenylalanine N-monooxygenase         99.0    2e-27   
gb|AHY21801.1|  cytochrome P450 79D15                                 93.2    3e-27   
gb|AHY21790.1|  cytochrome P450 79D15                                 94.4    3e-27   
gb|ACB15183.1|  cytochrome P450                                       93.2    3e-27   Trifolium repens [creeping white clover]
gb|KHN24731.1|  Isoleucine N-monooxygenase 1                          93.2    3e-27   
ref|XP_010526660.1|  PREDICTED: tryptophan N-monooxygenase 1-like     96.3    4e-27   
ref|XP_004154649.1|  PREDICTED: isoleucine N-monooxygenase 1-like     90.1    4e-27   
ref|XP_006591735.1|  PREDICTED: isoleucine N-monooxygenase 1-like     92.8    4e-27   
gb|AHY21799.1|  cytochrome P450 79D15                                 92.8    4e-27   
gb|ACB15184.1|  cytochrome P450                                       93.2    4e-27   Trifolium repens [creeping white clover]
gb|AHY21800.1|  cytochrome P450 79D15                                 92.4    4e-27   
emb|CDX70164.1|  BnaA10g25130D                                        97.8    4e-27   
gb|AHY21803.1|  cytochrome P450 79D15                                 92.4    4e-27   
gb|ACB15191.1|  cytochrome P450                                       94.4    4e-27   Trifolium nigrescens subsp. petrisavii
emb|CDX98829.1|  BnaC09g50060D                                        97.8    5e-27   
ref|XP_006464327.1|  PREDICTED: phenylalanine N-monooxygenase-like    92.4    6e-27   
gb|AAF66544.1|AF140610_1  cytochrome P450 CYP79E2                     85.9    6e-27   Triglochin maritima
gb|KGN50755.1|  hypothetical protein Csa_5G223620                       100   7e-27   
ref|XP_006428111.1|  hypothetical protein CICLE_v10025237mg           91.7    7e-27   
ref|XP_007099523.1|  Cytochrome p450 79a2, putative                   87.8    7e-27   
gb|AGO81716.1|  CYP79A2                                               97.4    8e-27   
gb|AHY21793.1|  cytochrome P450 79D15                                 92.8    8e-27   
ref|XP_004165284.1|  PREDICTED: isoleucine N-monooxygenase 2-like     99.4    9e-27   
ref|XP_010106336.1|  Isoleucine N-monooxygenase 2                     93.6    9e-27   
ref|XP_004146467.1|  PREDICTED: isoleucine N-monooxygenase 2-like     99.0    9e-27   
emb|CBI35228.3|  unnamed protein product                              99.8    1e-26   
gb|ACB15190.1|  cytochrome P450                                       94.4    1e-26   Trifolium nigrescens subsp. petrisavii
gb|AHY21786.1|  cytochrome P450 79D15                                 94.4    1e-26   
gb|AHY21791.1|  cytochrome P450 79D15                                 94.4    1e-26   
sp|Q9FLC8.1|C79A2_ARATH  RecName: Full=Phenylalanine N-monooxygen...  97.4    1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KGN66525.1|  hypothetical protein Csa_1G618390                     90.1    1e-26   
ref|NP_568153.1|  cytochrome P450 CYP79A2                             97.4    2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AHY21787.1|  cytochrome P450 79D15                                 94.4    2e-26   
gb|KGN66528.1|  hypothetical protein Csa_1G620390                     85.9    2e-26   
ref|XP_008450367.1|  PREDICTED: isoleucine N-monooxygenase 1-like     88.6    2e-26   
gb|ACB15192.1|  cytochrome P450                                       92.0    2e-26   Trifolium nigrescens subsp. petrisavii
ref|XP_002863110.1|  predicted protein                                91.3    2e-26   
ref|XP_004151661.1|  PREDICTED: isoleucine N-monooxygenase 1-like     85.1    2e-26   
dbj|BAJ86038.1|  predicted protein                                    86.7    3e-26   
gb|ACB15189.1|  cytochrome P450                                       93.2    3e-26   Trifolium nigrescens subsp. petrisavii
gb|AHY21795.1|  cytochrome P450 79D15                                 93.2    3e-26   
gb|AHY21798.1|  cytochrome P450 79D15                                 93.2    3e-26   
gb|KDP20491.1|  hypothetical protein JCGZ_05367                       81.3    3e-26   
gb|EMT05143.1|  Tyrosine N-monooxygenase                              91.7    3e-26   
emb|CAH66094.1|  OSIGBa0114I04.1                                      87.4    3e-26   Oryza sativa [red rice]
gb|KFK24947.1|  hypothetical protein AALP_AA8G046600                  90.1    3e-26   
gb|AAF66543.1|AF140609_1  cytochrome P450 CYP79E1                     84.3    5e-26   Triglochin maritima
sp|Q9M7B7.1|C79D2_MANES  RecName: Full=Valine N-monooxygenase 2; ...  88.6    5e-26   Manihot esculenta [manioc]
gb|AAV97888.1|  N-hydroxylating cytochrome P450 CYP79D2               88.6    5e-26   Manihot esculenta [manioc]
ref|NP_001052148.1|  Os04g0171800                                     86.3    5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ70085.1|  cytochrome P450                                       85.5    6e-26   Hordeum vulgare subsp. vulgare [barley]
emb|CAI44620.1|  B1168G10.4                                           86.3    6e-26   Oryza sativa [red rice]
gb|EAZ29960.1|  hypothetical protein OsJ_14015                        86.3    6e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ACM24114.1|  cytochrome P450                                       86.7    6e-26   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008659696.1|  PREDICTED: tyrosine N-monooxygenase-like         77.0    8e-26   
ref|XP_010555368.1|  PREDICTED: tryptophan N-monooxygenase 2-like     94.0    8e-26   
ref|XP_006605683.1|  PREDICTED: isoleucine N-monooxygenase 2-like     95.5    9e-26   
gb|AGC13081.1|  cytochrome P450 79B2                                  90.5    1e-25   
dbj|BAK01740.1|  predicted protein                                    85.1    1e-25   
ref|XP_007145972.1|  hypothetical protein PHAVU_006G002300g           95.9    1e-25   
ref|XP_008450287.1|  PREDICTED: phenylalanine N-monooxygenase-lik...  92.8    2e-25   
ref|XP_008450288.1|  PREDICTED: phenylalanine N-monooxygenase-lik...  92.8    2e-25   
ref|XP_006486510.1|  PREDICTED: phenylalanine N-monooxygenase-like    88.6    3e-25   
ref|XP_010110139.1|  Phenylalanine N-monooxygenase                    90.9    3e-25   
emb|CDP17747.1|  unnamed protein product                                104   3e-25   
ref|XP_006283476.1|  hypothetical protein CARUB_v10004524mg           92.4    4e-25   
gb|KDO38547.1|  hypothetical protein CISIN_1g040505mg                 91.7    4e-25   
ref|XP_002878610.1|  CYP79B3                                          94.4    5e-25   
ref|XP_009129057.1|  PREDICTED: cytochrome P450 79B1                  90.5    5e-25   
gb|ACR10253.1|  cytochrome P450 79b2                                  90.5    6e-25   
emb|CDX69373.1|  BnaC01g00800D                                        90.5    6e-25   
ref|XP_006404690.1|  hypothetical protein EUTSA_v10000114mg           92.0    6e-25   
ref|XP_010446562.1|  PREDICTED: tryptophan N-monooxygenase 1-like     91.3    6e-25   
gb|AGN12803.1|  tryptophan N-hydroxylase 1                            89.7    6e-25   
sp|O81345.1|C79B1_SINAL  RecName: Full=Cytochrome P450 79B1           89.7    7e-25   
ref|XP_010446588.1|  PREDICTED: tryptophan N-monooxygenase 1-like...  91.3    7e-25   
ref|XP_010437120.1|  PREDICTED: tryptophan N-monooxygenase 1-like     91.3    7e-25   
ref|XP_002866896.1|  CYP79B2                                          91.7    7e-25   
ref|XP_006398988.1|  hypothetical protein EUTSA_v10015246mg           95.1    8e-25   
gb|AAD22364.1|  putative cytochrome P450                              92.4    8e-25   
ref|XP_002464334.1|  hypothetical protein SORBIDRAFT_01g016480        82.4    8e-25   
ref|XP_007146891.1|  hypothetical protein PHAVU_006G0792001g          91.3    9e-25   
dbj|BAF01576.1|  putative cytochrome P450                             92.4    9e-25   
gb|AGS49165.1|  cytochrome P450 CYP79B2                               92.4    9e-25   
gb|AGN12785.1|  tryptophan N-hydroxylase 1                            89.4    1e-24   
ref|XP_006411796.1|  hypothetical protein EUTSA_v10024861mg           88.2    2e-24   
ref|XP_006289651.1|  hypothetical protein CARUB_v10003209mg           98.6    2e-24   
ref|NP_179820.2|  tryptophan N-monooxygenase 2                        92.4    2e-24   
ref|XP_009140345.1|  PREDICTED: tryptophan N-monooxygenase 2          91.3    2e-24   
emb|CDY25587.1|  BnaA04g12790D                                        91.3    2e-24   
gb|ACR10255.1|  cytochrome P450 79b3                                  90.9    2e-24   
ref|XP_010059539.1|  PREDICTED: tryptophan N-monooxygenase 1-like     94.4    2e-24   
gb|AAN76810.1|AF453287_1  cytochrome P450                             88.2    3e-24   
ref|XP_010431975.1|  PREDICTED: tryptophan N-monooxygenase 1          89.4    3e-24   
gb|AAG59648.1|AC084319_6  putative cytochrome p450tyr                 93.2    3e-24   
ref|NP_001050517.1|  Os03g0570100                                     93.2    3e-24   
emb|CDX90374.1|  BnaA08g16100D                                        87.4    4e-24   
ref|XP_004151554.1|  PREDICTED: isoleucine N-monooxygenase 1-like     81.3    4e-24   
gb|ADW54459.1|  cytochrome P450 79B1                                  87.0    4e-24   
emb|CDY63922.1|  BnaC07g51280D                                        87.0    4e-24   
ref|XP_004154687.1|  PREDICTED: isoleucine N-monooxygenase 1-like     81.3    4e-24   
gb|KGN66527.1|  hypothetical protein Csa_1G619390                     81.3    5e-24   
emb|CDP21660.1|  unnamed protein product                              95.1    5e-24   
emb|CAN67567.1|  hypothetical protein VITISV_017718                     101   5e-24   
ref|XP_009138546.1|  PREDICTED: cytochrome P450 79B1-like             86.7    6e-24   
emb|CBI24346.3|  unnamed protein product                              94.7    7e-24   
ref|XP_008808383.1|  PREDICTED: phenylalanine N-monooxygenase-like    91.3    7e-24   
gb|AFV31131.1|  cytochrome P450 79B1                                  86.3    8e-24   
ref|NP_195705.1|  tryptophan N-monooxygenase 1                        87.8    9e-24   
emb|CDY39472.1|  BnaC03g60820D                                        87.0    1e-23   
gb|KFK30571.1|  hypothetical protein AALP_AA7G279100                  87.4    1e-23   
gb|AGM16417.1|  cytochrome P450 79B2                                  89.0    2e-23   
gb|EEE59378.1|  hypothetical protein OsJ_11493                        90.1    2e-23   
ref|XP_006296223.1|  hypothetical protein CARUB_v10025388mg           86.7    2e-23   
ref|XP_008450479.1|  PREDICTED: tyrosine N-monooxygenase-like           105   2e-23   
gb|KGN66523.1|  hypothetical protein Csa_1G617390                       103   2e-23   
gb|KFK32823.1|  hypothetical protein AALP_AA6G292300                  87.4    2e-23   
ref|XP_010416994.1|  PREDICTED: tryptophan N-monooxygenase 2-like     87.0    3e-23   
ref|XP_002523434.1|  conserved hypothetical protein                     102   3e-23   
gb|EMT14945.1|  Tyrosine N-monooxygenase                              86.7    4e-23   
ref|XP_010472222.1|  PREDICTED: tryptophan N-monooxygenase 2          87.0    4e-23   
ref|XP_004139121.1|  PREDICTED: isoleucine N-monooxygenase 2-like       103   8e-23   
ref|XP_008450368.1|  PREDICTED: isoleucine N-monooxygenase 1-like     76.3    1e-22   
ref|XP_003576934.1|  PREDICTED: tyrosine N-monooxygenase-like         88.6    1e-22   
dbj|BAK06438.1|  predicted protein                                    83.2    3e-22   
dbj|BAK08222.1|  predicted protein                                    84.3    3e-22   
ref|XP_002446424.1|  hypothetical protein SORBIDRAFT_06g015920        73.6    5e-22   
gb|EMT14944.1|  Tyrosine N-monooxygenase                              81.3    1e-21   
gb|EMT14947.1|  Tyrosine N-monooxygenase                              84.0    1e-21   
gb|EMT13893.1|  Tyrosine N-monooxygenase                              80.1    1e-21   
ref|XP_002464329.1|  hypothetical protein SORBIDRAFT_01g016460        79.7    2e-21   
gb|EMS45429.1|  Tyrosine N-monooxygenase                              82.8    2e-21   
ref|XP_002464333.1|  hypothetical protein SORBIDRAFT_01g016470        79.7    2e-21   
gb|EMT11661.1|  Tyrosine N-monooxygenase                              80.1    3e-21   
ref|XP_002449720.1|  hypothetical protein SORBIDRAFT_05g022070        83.2    3e-21   
gb|EMT29768.1|  Tyrosine N-monooxygenase                              82.0    4e-21   
ref|XP_007011295.1|  Cytochrome p450 79a2, putative                   81.3    1e-20   
ref|XP_004983125.1|  PREDICTED: tyrosine N-monooxygenase-like iso...  69.7    2e-20   
ref|XP_010088366.1|  Isoleucine N-monooxygenase 2                     91.7    3e-20   
gb|KDP45702.1|  hypothetical protein JCGZ_17309                       95.1    5e-20   
ref|XP_003576933.1|  PREDICTED: tyrosine N-monooxygenase-like         86.3    5e-20   
gb|EEC70622.1|  hypothetical protein OsI_01880                        79.3    6e-20   
emb|CDY14122.1|  BnaC02g02390D                                        95.5    6e-20   
gb|KDP45691.1|  hypothetical protein JCGZ_17298                       66.6    8e-20   
gb|KEH34491.1|  cytochrome P450 family protein                        93.6    3e-19   
gb|KEH34489.1|  cytochrome P450 family protein, putative              79.3    3e-19   
ref|XP_002521214.1|  conserved hypothetical protein                   89.0    1e-18   
gb|EYU45630.1|  hypothetical protein MIMGU_mgv1a018745mg              75.9    1e-18   
ref|XP_002450980.1|  hypothetical protein SORBIDRAFT_05g022010        63.2    4e-18   
ref|XP_009354042.1|  PREDICTED: isoleucine N-monooxygenase 2-like     90.1    5e-18   
ref|XP_003580014.1|  PREDICTED: tyrosine N-monooxygenase-like         78.2    5e-18   
gb|EMT03957.1|  Tyrosine N-monooxygenase                              89.7    8e-18   
gb|EMS67140.1|  Tyrosine N-monooxygenase                              89.7    8e-18   
ref|XP_008644689.1|  PREDICTED: tyrosine N-monooxygenase-like         77.0    8e-18   
ref|XP_010532014.1|  PREDICTED: tyrosine N-monooxygenase-like         74.3    1e-17   
ref|XP_009142023.1|  PREDICTED: dihomomethionine N-hydroxylase-like   76.6    1e-17   
emb|CDY06898.1|  BnaA04g24170D                                        76.3    1e-17   
gb|KCW54308.1|  hypothetical protein EUGRSUZ_I00272                   86.7    2e-17   
ref|XP_007011301.1|  Cytochrome p450 79a2, putative                   58.9    4e-17   
ref|XP_010539173.1|  PREDICTED: dihomomethionine N-hydroxylase-like   87.8    4e-17   
gb|AGN12777.1|  tryptophan N-hydroxylase 1                            87.4    4e-17   
gb|KFK37030.1|  hypothetical protein AALP_AA4G203000                  73.6    7e-17   
ref|XP_006411457.1|  hypothetical protein EUTSA_v10017915mg           71.2    2e-16   
gb|EAZ27538.1|  hypothetical protein OsJ_11492                        65.9    3e-16   
gb|KFK25907.1|  hypothetical protein AALP_AA8G178100                  70.5    5e-16   
gb|EEC75602.1|  hypothetical protein OsI_12311                        66.6    8e-16   
ref|XP_010431572.1|  PREDICTED: tryptophan N-monooxygenase 2-like     80.5    9e-16   
ref|XP_010517680.1|  PREDICTED: dihomomethionine N-hydroxylase-like   66.2    6e-15   
gb|EMT22070.1|  hypothetical protein F775_52105                       60.8    8e-15   
ref|XP_010532335.1|  PREDICTED: dihomomethionine N-hydroxylase-like   80.5    8e-15   
ref|NP_001052147.1|  Os04g0171600                                     79.7    2e-14   
emb|CDY14795.1|  BnaC04g47920D                                        79.7    2e-14   
gb|EEE60606.1|  hypothetical protein OsJ_14012                        79.7    2e-14   
emb|CAI44618.1|  B1168G10.2                                           79.7    2e-14   
tpg|DAA51522.1|  TPA: putative cytochrome P450 superfamily protein    70.5    2e-14   
gb|EEC74210.1|  hypothetical protein OsI_09370                        79.3    4e-14   
ref|XP_006293982.1|  hypothetical protein CARUB_v10022973mg           65.5    4e-14   
ref|XP_010508657.1|  PREDICTED: dihomomethionine N-hydroxylase-like   63.2    4e-14   
gb|EMS49024.1|  Tyrosine N-monooxygenase                              78.2    6e-14   
ref|XP_010537826.1|  PREDICTED: dihomomethionine N-hydroxylase-like   78.6    6e-14   
ref|XP_008665466.1|  PREDICTED: tyrosine N-monooxygenase-like         70.5    7e-14   
emb|CDY14123.1|  BnaC02g02400D                                        56.6    1e-13   
ref|XP_006651559.1|  PREDICTED: tyrosine N-monooxygenase-like         77.4    1e-13   
ref|XP_006301603.1|  hypothetical protein CARUB_v10022042mg           63.2    1e-13   
ref|XP_010532334.1|  PREDICTED: dihomomethionine N-hydroxylase-like   77.0    2e-13   
emb|CDY31634.1|  BnaA05g09130D                                        66.6    2e-13   
emb|CBI25374.3|  unnamed protein product                              77.0    2e-13   
ref|XP_008666868.1|  PREDICTED: tyrosine N-monooxygenase-like         70.9    2e-13   
ref|XP_010532013.1|  PREDICTED: dihomomethionine N-hydroxylase-like   76.6    3e-13   
ref|XP_010905900.1|  PREDICTED: tyrosine N-monooxygenase-like         75.5    3e-13   
ref|NP_176122.2|  cytochrome p450 79c2                                62.4    5e-13   
ref|XP_007011294.1|  Cytochrome p450 79a2                             66.2    5e-13   
ref|XP_002523436.1|  conserved hypothetical protein                   72.4    8e-13   
gb|ACG29984.1|  cytochrome P450 CYP79A33                              73.9    2e-12   
ref|XP_008644663.1|  PREDICTED: tyrosine N-monooxygenase-like         73.9    2e-12   
ref|XP_007011299.1|  Cytochrome p450 79a2, putative                   59.7    2e-12   
ref|XP_010418874.1|  PREDICTED: hexahomomethionine N-hydroxylase-...  57.0    1e-11   
ref|XP_009132654.1|  PREDICTED: dihomomethionine N-hydroxylase        71.6    1e-11   
ref|XP_010523407.1|  PREDICTED: dihomomethionine N-hydroxylase-like   71.2    2e-11   
gb|AAC17056.1|  Similar to cytochrome P450tyr gb|U32624 from Sorg...  70.5    2e-11   
ref|XP_002886713.1|  CYP79C2                                          70.9    3e-11   
ref|XP_010474492.1|  PREDICTED: dihomomethionine N-hydroxylase        69.3    7e-11   
ref|NP_178055.2|  cytochrome P450, family 79, subfamily C, polype...  68.9    1e-10   
gb|KCW44853.1|  hypothetical protein EUGRSUZ_L01579                   65.5    1e-10   
ref|XP_010519775.1|  PREDICTED: dihomomethionine N-hydroxylase-like   68.2    2e-10   
emb|CDY69944.1|  BnaCnng66040D                                        65.1    2e-10   
ref|XP_002887782.1|  CYP79C1                                          67.8    2e-10   
ref|XP_002466900.1|  hypothetical protein SORBIDRAFT_01g016160        59.7    3e-10   
ref|XP_006301545.1|  hypothetical protein CARUB_v10021979mg           67.8    3e-10   
ref|XP_010513418.1|  PREDICTED: hexahomomethionine N-hydroxylase      67.4    4e-10   
gb|EYU32253.1|  hypothetical protein MIMGU_mgv1a004391mg              58.9    6e-10   
gb|EMT03571.1|  Tyrosine N-monooxygenase                              65.9    6e-10   
gb|KFK37032.1|  hypothetical protein AALP_AA4G203300                  66.6    8e-10   
emb|CAN74071.1|  hypothetical protein VITISV_035798                   60.8    1e-09   
ref|XP_009144065.1|  PREDICTED: dihomomethionine N-hydroxylase-like   66.2    1e-09   
ref|XP_010529568.1|  PREDICTED: dihomomethionine N-hydroxylase-like   65.5    2e-09   
ref|XP_004979299.1|  PREDICTED: premnaspirodiene oxygenase-like       64.3    3e-09   
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like       64.3    4e-09   
emb|CDY43061.1|  BnaA03g12080D                                        63.9    5e-09   
ref|XP_006362136.1|  PREDICTED: cytochrome P450 71A1-like             54.7    7e-09   
gb|EMT29010.1|  Tyrosine N-monooxygenase                              62.8    7e-09   
gb|ADG38975.1|  AT4G39950-like protein                                48.1    8e-09   
gb|AJD25165.1|  cytochrome P450 CYP71D412                             63.2    8e-09   
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like       63.2    8e-09   
gb|EMS58282.1|  Cytochrome P450 71A18                                 60.1    9e-09   
ref|XP_008242317.1|  PREDICTED: flavonoid 3'-monooxygenase-like       63.2    1e-08   
gb|ADG38972.1|  AT4G39950-like protein                                47.8    1e-08   
gb|ADG38969.1|  AT4G39950-like protein                                47.8    1e-08   
gb|AEN82828.1|  AT4G39950-like protein                                47.8    1e-08   
ref|XP_007202840.1|  hypothetical protein PRUPE_ppa014596mg           62.8    1e-08   
gb|ACG50669.1|  cytochrome P450 CYP79F1                               61.2    1e-08   
gb|EMT24111.1|  hypothetical protein F775_52527                       62.8    1e-08   
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like       62.4    2e-08   
ref|XP_006495418.1|  PREDICTED: cytochrome P450 71D10-like            60.1    2e-08   
dbj|BAD16679.1|  cytochrome P450                                      62.4    2e-08   
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like       62.4    2e-08   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like            62.4    2e-08   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g           62.0    2e-08   
ref|XP_002962909.1|  hypothetical protein SELMODRAFT_78910            57.8    2e-08   
ref|XP_002962366.1|  hypothetical protein SELMODRAFT_78680            57.8    3e-08   
gb|ABR18208.1|  unknown                                               61.6    3e-08   
gb|ABK25352.1|  unknown                                               61.6    3e-08   
ref|XP_002977226.1|  hypothetical protein SELMODRAFT_106240           57.8    4e-08   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g           61.2    4e-08   
ref|XP_002962369.1|  hypothetical protein SELMODRAFT_78844            57.8    4e-08   
ref|XP_002450437.1|  hypothetical protein SORBIDRAFT_05g005480        61.2    4e-08   
ref|XP_002979992.1|  hypothetical protein SELMODRAFT_111723           50.4    4e-08   
gb|EMT02883.1|  hypothetical protein F775_52211                       61.2    4e-08   
gb|EPS67290.1|  hypothetical protein M569_07486                       61.2    4e-08   
ref|XP_011023171.1|  PREDICTED: cytochrome P450 703A2                 54.7    4e-08   
gb|AIM47554.1|  CYP726A24                                             61.2    4e-08   
emb|CDP21012.1|  unnamed protein product                              61.2    4e-08   
emb|CDY35090.1|  BnaA06g11000D                                        60.1    6e-08   
gb|EYU22741.1|  hypothetical protein MIMGU_mgv1a005534mg              60.5    6e-08   
gb|AGC13082.1|  cytochrome P450 79F1                                  58.2    6e-08   
emb|CAA04116.1|  cytochrome P450                                      49.3    7e-08   
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like       60.5    7e-08   
dbj|BAJ89591.1|  predicted protein                                    60.5    7e-08   
ref|XP_002979994.1|  hypothetical protein SELMODRAFT_111866           52.0    7e-08   
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7           60.1    9e-08   
ref|XP_003600323.1|  Cytochrome P450                                  60.1    9e-08   
ref|XP_003636936.1|  Cytochrome P450                                  60.1    9e-08   
gb|EPS66524.1|  hypothetical protein M569_08252                       60.1    9e-08   
gb|KDO50396.1|  hypothetical protein CISIN_1g048376mg                 58.2    9e-08   
gb|KDP42334.1|  hypothetical protein JCGZ_02807                       60.1    9e-08   
gb|KHN42024.1|  Cytochrome P450 71D8                                  59.7    1e-07   
ref|XP_008660082.1|  PREDICTED: premnaspirodiene oxygenase-like i...  60.1    1e-07   
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like             60.1    1e-07   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like       60.1    1e-07   
ref|XP_003566220.1|  PREDICTED: cytochrome P450 71A1-like             60.1    1e-07   
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6           59.7    1e-07   
emb|CAA04117.1|  cytochrome P450                                      48.9    1e-07   
gb|AFK44017.1|  unknown                                               58.9    1e-07   
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like       59.7    1e-07   
ref|XP_007142403.1|  hypothetical protein PHAVU_008G277500g           59.7    1e-07   
ref|XP_002890163.1|  CYP79F2                                          59.7    1e-07   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like            59.7    1e-07   



>emb|CDP19035.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   109 bits (273),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+ G +VIPVTSPELAR+F KKQDS+FSSRPVCMSA+L S G+L++   P GDQ+
Sbjct  92   EIACIRIFGVHVIPVTSPELARQFCKKQDSIFSSRPVCMSAELCSGGFLTTGLSPLGDQY  151

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  152  KKMKRMVVSCVLSPA  166


 Score = 79.3 bits (194),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA++LV Y+Y+QC  + TGG+  V+ R VT+ YCGNVI KM+FNKRFFG  M
Sbjct  171  LHSKRAEEADHLVNYVYNQCKDNATGGL--VDIRLVTQHYCGNVIRKMIFNKRFFGKGM  227



>emb|CDP20403.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   113 bits (283),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC R+ G ++IPVTSPELAREF KK DS+FS+RPVCMSA+L S GYL++I  P GDQ+
Sbjct  54   EIACFRIFGVHIIPVTSPELAREFFKKHDSIFSNRPVCMSAELSSEGYLTTILSPLGDQY  113

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  114  KKMKRIIVSSVLSPA  128


 Score = 75.5 bits (184),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA++LV Y+Y+QC    TGG+  V+ R  TR Y GNVI KM+FNKRFFG  M
Sbjct  133  LHSKRTEEADHLVNYVYNQCKDDATGGL--VDIRLATRHYFGNVIRKMIFNKRFFGKGM  189



>ref|XP_011071563.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   121 bits (304),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLG  YVIPVTSPELAREFLKK D +F+SRP  +SA L SNGYL++IF P GDQW
Sbjct  75   EIACFRLGNAYVIPVTSPELAREFLKKHDVIFASRPDALSAKLTSNGYLTAIFSPNGDQW  134

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S VLSPA  R+
Sbjct  135  KKMRRVLTSEVLSPAMHRW  153


 Score = 66.2 bits (160),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KR EEA+++++Y+Y QC    T G+  VN R V + YCGN+  K++F+KRFFG  M
Sbjct  154  LYGKRCEEADHMIRYVYKQCQSQFTDGL--VNVRVVAQHYCGNLARKLIFSKRFFGTGM  210



>ref|XP_006356653.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=495

 Score =   121 bits (304),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIP+TSPELA EFL   DS+FSSRP+CMSA LISNGYL+S+F+P GDQW
Sbjct  52   EIACIRLGTIHVIPITSPELACEFLHTLDSIFSSRPICMSASLISNGYLTSVFVPMGDQW  111

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VL+P S ++
Sbjct  112  MKMRRILASHVLTPTSFQW  130


 Score = 65.5 bits (158),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 6/75 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVMe  48
            L  KR EEA+NL ++IY+QC         V+N R +TR YCGNVI  M+F+KR F +++E
Sbjct  131  LRSKRDEEADNLHRFIYNQCK-----NQSVINLRNLTRYYCGNVIRNMIFSKRLF-DIIE  184

Query  47   eeeeEILKALFALLQ  3
            E+ +E++ ALF LL+
Sbjct  185  EDRDELVDALFTLLK  199



>emb|CDP18411.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   109 bits (273),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+ G ++IPVTSPELAREFLKKQDS+FSSRPV MSA+L S G+L++I  P GDQ+
Sbjct  91   EIACIRIFGVHIIPVTSPELAREFLKKQDSIFSSRPVFMSAELCSEGFLTTILSPLGDQY  150

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  151  KKMKRMVVSSVLSPA  165


 Score = 75.9 bits (185),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA++L  Y+Y+QC  + TGG+  V+ R VT+ YCGNV  KM+FNKRFFG  M
Sbjct  170  LHSKRAEEADHLANYVYNQCKGNATGGL--VDIRLVTQHYCGNVTRKMIFNKRFFGKGM  226



>ref|XP_011071676.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=530

 Score =   119 bits (298),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLG  Y+IPVTSPELAREFLK+ D +F+SRP  +SA L SNGYL++IF P GDQW
Sbjct  76   EIACFRLGNAYIIPVTSPELAREFLKEHDVIFASRPDALSAKLTSNGYLTAIFSPNGDQW  135

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S VLSPA  R+
Sbjct  136  KKMRRVLTSEVLSPAMHRW  154


 Score = 65.1 bits (157),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KR EEA+++++Y+Y QC    T G+  VN R V + YCGN+  K++F+KRFFG  M
Sbjct  155  LYGKRCEEADHMMRYVYKQCQSPMTDGL--VNVRVVAQHYCGNLARKLIFSKRFFGTGM  211



>ref|XP_009601899.1| PREDICTED: LOW QUALITY PROTEIN: isoleucine N-monooxygenase 2-like 
[Nicotiana tomentosiformis]
Length=528

 Score =   124 bits (312),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG   VIPVTSPELA EFLK QDSVFSSRP+CMSA+L+ NGYL+S+FLP  DQW
Sbjct  89   EIACIRLGNVLVIPVTSPELACEFLKNQDSVFSSRPICMSANLVINGYLTSVFLPICDQW  148

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR++ S VLSP SL++
Sbjct  149  TKMRRIVASLVLSPTSLQW  167


 Score = 59.3 bits (142),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 9/75 (12%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVMe  48
            L  KR E+A++L++Y+Y++C         V+N R VTR YCGNVI  M+F+KR FG   E
Sbjct  168  LSHKRNEDADHLLRYVYNECXQPT-----VINLRKVTRYYCGNVIWNMIFSKRLFGKEAE  222

Query  47   eeeeEILKALFALLQ  3
            E+    + ALF LL+
Sbjct  223  EQ----VGALFTLLE  233



>ref|XP_004245410.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=488

 Score =   125 bits (313),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VI VTSPELAREFL  QDS+FSSRP+CMSA LI+NGYL+ IF P GDQW
Sbjct  44   EIACIRLGNIHVITVTSPELAREFLHTQDSIFSSRPICMSASLINNGYLTPIFAPMGDQW  103

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLSP SL +
Sbjct  104  KKMRRILASHVLSPTSLEW  122


 Score = 58.9 bits (141),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 6/75 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVMe  48
            +  KR EEA+NL ++IY+QC         ++N R +TR YCGNVI  M F+K FF ++ E
Sbjct  123  IRSKRDEEADNLHRFIYNQCE-----NQSIINLRNLTRYYCGNVIRNMTFSKPFF-DITE  176

Query  47   eeeeEILKALFALLQ  3
            E+ +E + A+F LL+
Sbjct  177  EDRDEQVDAVFTLLK  191



>emb|CDP18412.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   112 bits (281),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLGG +VIPVTSPE+AREFLKKQDS+FSSRPVCMSA+L S+ YLS++  P+G+Q 
Sbjct  7    EIACFRLGGIHVIPVTSPEIAREFLKKQDSIFSSRPVCMSAELPSSKYLSAVLSPSGNQQ  66

Query  280  AKMRRVLHSRVLSPASLRF  224
             KM++++ S VLSPA  R+
Sbjct  67   KKMKKIVISSVLSPAKHRW  85


 Score = 70.1 bits (170),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KR++EA++LV YI +QCN S TGG   VN R   R YCGNV  +M F+KRFFG
Sbjct  86   LHGKRIKEADHLVNYILNQCNNSLTGGE--VNIRIAARHYCGNVTRRMFFDKRFFG  139



>emb|CDP18413.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   112 bits (281),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLGG +VIPVTSPE+AREFLKKQDS+FSSRPVCMSA+L S+ YLS++  P+G+Q 
Sbjct  74   EIACFRLGGIHVIPVTSPEIAREFLKKQDSIFSSRPVCMSAELPSSKYLSAVLSPSGNQQ  133

Query  280  AKMRRVLHSRVLSPASLRF  224
             KM++++ S VLSPA  R+
Sbjct  134  KKMKKIVISSVLSPAKHRW  152


 Score = 69.7 bits (169),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KR++EA++LV YI +QCN S TGG   VN R   R YCGNV  +M F+KRFFG
Sbjct  153  LHGKRIKEADHLVNYILNQCNNSLTGGE--VNIRIAARHYCGNVTRRMFFDKRFFG  206



>ref|XP_011084186.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=523

 Score =   119 bits (297),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVTSPELAREFLKK+D  F+SRP  +SA L SNGYL++ F P GDQW
Sbjct  76   EIACIRLGNAYVIPVTSPELAREFLKKEDVNFASRPEALSAKLTSNGYLTAAFCPNGDQW  135

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ S VLSPA  R+
Sbjct  136  KKMRRVIASEVLSPAMHRW  154


 Score = 63.2 bits (152),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA+++V+Y+Y QC      G+  VN R V + YCGN+   ++F+KRFFG  M
Sbjct  155  LHRKRCEEADHVVRYVYKQCQSPIRNGL--VNVRVVAQHYCGNLTRNLIFSKRFFGTGM  211



>ref|XP_011071674.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   117 bits (293),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLG  YVIPVTSPELAREFLKK D +F+SRP  +SA L SNGYL++IF P  DQW
Sbjct  75   EIACFRLGNAYVIPVTSPELAREFLKKHDVIFASRPDALSAKLTSNGYLTAIFSPNDDQW  134

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S VLSPA
Sbjct  135  RKMRRVLASEVLSPA  149


 Score = 64.3 bits (155),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KR EEA+++ +Y+Y QC    T G+  VN R V + YCGN+  K++F+KRFFG  M
Sbjct  154  LYGKRCEEADHVTRYVYKQCQSPITDGL--VNVRVVAQHYCGNLTRKLIFSKRFFGTGM  210



>emb|CDP12474.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   107 bits (268),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC R+ G ++IPVTSPELAREF KK DS+FS+RPVCMSA+L S G+L++   P GDQ+
Sbjct  90   EIACFRIFGVHIIPVTSPELAREFFKKHDSIFSNRPVCMSAELSSEGFLTTGLSPLGDQY  149

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  150  KKMKRMIVSSVLSPA  164


 Score = 73.6 bits (179),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA++LV Y+Y+QC    T G+  V+ R  TR Y GNVI KM+FNKRFFG  M
Sbjct  169  LHSKRAEEADHLVNYVYNQCKDDATAGL--VDIRLATRHYLGNVIRKMIFNKRFFGKGM  225



>ref|XP_009782885.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=543

 Score =   125 bits (313),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPELA  FLK QDS+FSSRP+CMSA+L+SNGYL+S+FLP GDQW
Sbjct  89   EIACIRLGNVHVIPVTSPELACLFLKNQDSIFSSRPICMSANLVSNGYLTSLFLPMGDQW  148

Query  280  AKMRRVLHSRVLSPASLR  227
             KMRR+L S VLS  S +
Sbjct  149  MKMRRILSSHVLSATSFQ  166


 Score = 55.5 bits (132),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA+++++++Y+QC         V+N R VTR YC NVI+ M+F+KR  G
Sbjct  168  LRRKRDEEADHILRFVYEQC----INKRLVINLRKVTRYYCANVINNMIFSKRLLG  219



>ref|XP_009765490.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765491.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=543

 Score =   125 bits (313),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPELA  FLK QDS+FSSRP+CMSA+L+SNGYL+S+FLP GDQW
Sbjct  89   EIACIRLGNVHVIPVTSPELACLFLKNQDSIFSSRPICMSANLVSNGYLTSLFLPMGDQW  148

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLS  S ++
Sbjct  149  MKMRRILSSHVLSATSFQW  167


 Score = 55.5 bits (132),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA+++++++Y+QC         V+N R VTR YC NVI+ M+F+KR  G
Sbjct  168  LRRKRDEEADHILRFVYEQC----INKRLVINLRKVTRYYCANVINNMIFSKRLLG  219



>ref|XP_009623062.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=543

 Score =   122 bits (307),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CIRLG  +VIPVTSPELA  FLK QDS+FSSRP+CMSA+L+SNGYL+S+FLP GDQW
Sbjct  89   EICCIRLGNVHVIPVTSPELACLFLKNQDSIFSSRPICMSANLVSNGYLTSLFLPMGDQW  148

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLS  S ++
Sbjct  149  MKMRRILSSHVLSATSFQW  167


 Score = 57.0 bits (136),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA+++++++YDQC         V+N R VTR YC NVI+ M+F+KR  G
Sbjct  168  LRRKRDEEADHILRFVYDQC----VNKRIVINLRKVTRYYCANVINNMIFSKRLLG  219



>emb|CDP19033.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   106 bits (264),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+ G ++IPVTSPELAREF KKQDS+FSSRPV MSA+L S G+L++   P GDQ+
Sbjct  7    EIACIRIFGVHIIPVTSPELAREFCKKQDSIFSSRPVFMSAELCSEGFLTTALSPMGDQY  66

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  67   KKMKRMVVSSVLSPA  81


 Score = 73.6 bits (179),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L  KR EEA++LV Y+Y+QC  + TGG+  V+ R VT+ YCGNVI KM+FN RFFG  M
Sbjct  86   LQCKRAEEADHLVNYVYNQCKYNATGGL--VDIRLVTQHYCGNVIRKMIFNIRFFGKGM  142



>ref|XP_006367541.1| PREDICTED: isoleucine N-monooxygenase 1-like, partial [Solanum 
tuberosum]
Length=507

 Score =   122 bits (305),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI LG  +VIP+TSPELA EFLK QDS+FSSRP+CMSA LISN YL+S+FLP GDQW
Sbjct  65   EIACIFLGKVHVIPITSPELACEFLKIQDSIFSSRPICMSASLISNNYLTSVFLPIGDQW  124

Query  280  AKMRRVLHSRVLSPASLRFTIKGWKKP  200
             KMR++L S VLSP S +     W +P
Sbjct  125  MKMRKILASHVLSPTSFQ-----WLRP  146


 Score = 57.4 bits (137),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 9/76 (12%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR-FFGNVM  51
            L  KR E  ++LV+++Y+QC         V+N R VTR YCGNVI  M++NKR  FG++ 
Sbjct  144  LRPKRDEAIDDLVQFVYNQCI-----NQQVINLRKVTRCYCGNVIRNMIYNKRSLFGSIE  198

Query  50   eeeeeEILKALFALLQ  3
            EEE+   + ALF LL+
Sbjct  199  EEEQ---VDALFTLLK  211



>ref|XP_002523441.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38900.1| cytochrome P450, putative [Ricinus communis]
Length=329

 Score =   106 bits (265),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPE++REFLK QD+VF+SRP+ MS DL ++GYL++  +P G+QW
Sbjct  86   EIACIRLGNVHVIPVTSPEISREFLKVQDAVFASRPLTMSTDLTTSGYLTTTLVPLGEQW  145

Query  280  AKMRRVLHSRVLSPASLRF  224
             KM+RVL ++VLS    ++
Sbjct  146  KKMKRVLVTQVLSAEKYKW  164


 Score = 72.4 bits (176),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
             + KR+EEA++LV+Y+Y+QC  +  GG   V+ R   R YCGNVI KMVFNKRFFG  M
Sbjct  165  FYGKRLEEADHLVRYVYNQCKTAEEGGS--VDVRITGRHYCGNVIRKMVFNKRFFGEGM  221



>emb|CDP12475.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   105 bits (263),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC R+ G ++IPVTSPELAREF KK DS+FS+RPVCMSA+L S G+L++   P GDQ+
Sbjct  90   EIACFRIFGVHIIPVTSPELAREFFKKHDSIFSNRPVCMSAELSSEGFLTTGLSPLGDQY  149

Query  280  AKMRRVLHSRVLSPA  236
             KM+R++ S VLSPA
Sbjct  150  KKMKRMIVSSVLSPA  164


 Score = 73.2 bits (178),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KR EEA++LV Y+Y+QC    T G+  V+ R  TR Y GNVI KM+FNKRFFG  M
Sbjct  169  LHSKRAEEADHLVNYVYNQCKDDATSGL--VDIRLATRHYLGNVIRKMIFNKRFFGKGM  225



>emb|CAN75997.1| hypothetical protein VITISV_022990 [Vitis vinifera]
Length=495

 Score =   106 bits (264),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPVTSPE+++EFLKK D+VF+SRP+ M+++  S G+L++  +P GDQW
Sbjct  39   EIACIQLGNVHVIPVTSPEISKEFLKKHDAVFASRPITMASEYSSGGFLTTAVVPWGDQW  98

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S V++P++ R+
Sbjct  99   KKMRRVLASNVINPSTFRW  117


 Score = 72.0 bits (175),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGM--HVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKRVEE +NLV+Y+Y+QC IS +      V+N R   RQY GN I KM+ N R+FG
Sbjct  118  LHDKRVEEXDNLVRYVYNQCKISTSNNCLGSVINLRNTARQYSGNAIRKMILNTRYFG  175



>ref|XP_002276655.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=554

 Score =   105 bits (263),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPVTSPE+++EFLKK D+VF+SRP+ M+++  S G+L++  +P GDQW
Sbjct  98   EIACIQLGNVHVIPVTSPEISKEFLKKHDAVFASRPITMASEYSSGGFLTTAVVPWGDQW  157

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S V++P++ R+
Sbjct  158  KKMRRVLASNVINPSTFRW  176


 Score = 72.8 bits (177),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGM--HVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKRVEE +NLV+Y+Y+QC IS +      V+N R   RQY GN I KM+ N R+FG
Sbjct  177  LHDKRVEETDNLVRYVYNQCKISTSNNCLGSVINLRNTARQYSGNAIRKMILNTRYFG  234



>ref|XP_004237225.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=521

 Score =   127 bits (318),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+G  +VIPVTSPELA EFLK QDSVFSSRP+CMSA+LISN Y++SIFLP GDQW
Sbjct  83   EIACIRVGNYHVIPVTSPELACEFLKSQDSVFSSRPICMSANLISNNYITSIFLPIGDQW  142

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLSP + ++
Sbjct  143  MKMRRILASHVLSPTTFQW  161


 Score = 50.4 bits (119),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 10/76 (13%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR-FFGNVM  51
            L  KR EEA+NL +++Y+   IS       +N R VTR YCGNVI  M+F+KR  FG+ +
Sbjct  162  LSCKRDEEADNLHRFVYNNQCIS-------INLRRVTRCYCGNVIRNMIFSKRSSFGSTI  214

Query  50   eeeeeEILKALFALLQ  3
            EEEE+  + A+F LL+
Sbjct  215  EEEEQ--VDAVFTLLE  228



>ref|XP_002523438.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38897.1| cytochrome P450, putative [Ricinus communis]
Length=370

 Score =   104 bits (260),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPE++REFLK QD+VF+SRP+ MS DL + GYL++  +P G+QW
Sbjct  108  EIACIRLGNVHVIPVTSPEISREFLKVQDAVFASRPLTMSTDLTARGYLTTGLVPLGEQW  167

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL ++ LS    ++
Sbjct  168  KKMRRVLVTQFLSAEKCKW  186


 Score = 72.0 bits (175),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
             + KR+EEA++LV+Y+Y+QC  +  GG   V+ R   R YCGNVI KMVFNKRFFG  M
Sbjct  187  FYGKRLEEADHLVRYVYNQCKTAEEGGS--VDVRITGRHYCGNVIRKMVFNKRFFGEGM  243



>ref|XP_004237294.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=443

 Score =   126 bits (317),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR G   VIPVTSPELA EFLK QDSVFSSRP+CMSA L++NG+L+SIFLP+GDQW
Sbjct  4    EIACIRFGNFNVIPVTSPELACEFLKTQDSVFSSRPLCMSASLVNNGFLTSIFLPSGDQW  63

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLSP SL++
Sbjct  64   MKMRRILASHVLSPTSLQW  82


 Score = 50.1 bits (118),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVMe  48
            L  KR EEA++L ++IY+Q          V+N R +TR YCGNV+  M+F+KR    ++E
Sbjct  83   LRHKRDEEADHLNRFIYNQ---------PVLNVRKLTRYYCGNVVKNMIFSKRSLFGIIE  133

Query  47   eeeeEILKALFALLQ  3
            +EEE+I  A+F L++
Sbjct  134  KEEEQI-DAVFTLIE  147



>ref|XP_009369526.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score =   100 bits (248),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP+ +S  LI+ GY +++ +P G+QW
Sbjct  82   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPLSISTFLITKGYKTAVMVPFGEQW  141

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +L+P
Sbjct  142  KKMRKVIASELLTP  155


 Score = 75.9 bits (185),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKRVEEA+++VKY+Y+QCN +  GG  +VN R  T+ YC NVI KMV NKR+FG  M
Sbjct  161  LADKRVEEADHIVKYVYNQCNNNEGGG--IVNLRLATQHYCANVIKKMVLNKRYFGEEM  217



>gb|KCW62239.1| hypothetical protein EUGRSUZ_H04899 [Eucalyptus grandis]
Length=531

 Score = 99.8 bits (247),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T++IPVT P +A+EFL+KQDS+F+SRPV M++  +++ YL++   P G+QW
Sbjct  78   EIACIRLGSTHIIPVTCPTIAQEFLRKQDSLFASRPVTMASGTLTSSYLTTALSPYGEQW  137

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S VL PA
Sbjct  138  KKMRRVLVSEVLCPA  152


 Score = 75.5 bits (184),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLVKY+++ C  SG    H VN R  TR YCGNV  +++FNKR+FG
Sbjct  157  LHDKRAEEADNLVKYVFNLCKTSG----HQVNLRATTRHYCGNVARRLMFNKRYFG  208



>ref|XP_008349637.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   102 bits (254),  Expect(2) = 3e-35, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP  +S  LI+ GY++++ +P G+QW
Sbjct  81   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPXSISTFLITKGYITTVMVPFGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  141  KKMRKVITSELLSP  154


 Score = 72.4 bits (176),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKRVEEA+++V+Y+Y+QC  +  GG  +VN R  T+ YC NVI KMV NKR+FG  M
Sbjct  160  LTDKRVEEADHIVQYVYNQCKNNEGGG--IVNLRLATQHYCANVIKKMVLNKRYFGEEM  216



>ref|XP_002264201.1| PREDICTED: phenylalanine N-monooxygenase [Vitis vinifera]
Length=550

 Score =   100 bits (248),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CI+LG  +VIPVTSPE++REFLKK D+V +SRP+ M  +  S G+L++  +P G+QW
Sbjct  98   EIECIQLGDVHVIPVTSPEISREFLKKHDTVLASRPITMVTEYSSGGFLTTAVVPWGEQW  157

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S+V++P++ R+
Sbjct  158  KKMRRVLASKVINPSTFRW  176


 Score = 74.7 bits (182),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGM--HVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKRVEEA+NLV+Y+Y+QC IS +      V+N R   RQY GN I KM+ N R+FG
Sbjct  177  LHDKRVEEADNLVRYVYNQCKISTSNNCLGSVINVRNTVRQYSGNAIRKMILNTRYFG  234



>ref|XP_008359055.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=637

 Score =   102 bits (254),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP  +S  LI+ GY++++ +P G+QW
Sbjct  184  EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPPSISTFLITKGYITTVMVPFGEQW  243

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  244  KKMRKVITSELLSP  257


 Score = 72.4 bits (176),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKRVEEA+++V Y+Y+QC  +  GG  +VN R  T+ YC NVI KMV NKR+FG  M
Sbjct  263  LTDKRVEEADHIVXYVYNQCKNNEGGG--IVNLRLATQHYCANVIKKMVLNKRYFGEEM  319



>ref|XP_004252024.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=526

 Score =   125 bits (313),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI +G  +VIPVTSPELA EFLK QDSVFSSRP+CMSA LISN YL+S+FLP GDQW
Sbjct  80   EIACIYVGNVHVIPVTSPELACEFLKIQDSVFSSRPICMSAKLISNNYLTSVFLPIGDQW  139

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMR++L S VLSP+SL++
Sbjct  140  MKMRKILASHVLSPSSLQW  158


 Score = 49.7 bits (117),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
            L  KR E  ++LV+++Y QC          +N R VTR YCGN I  MV+NKR
Sbjct  159  LRPKRDEAIDDLVEFVYKQCI-----NQQFINLRKVTRCYCGNAIRNMVYNKR  206



>gb|EYU45627.1| hypothetical protein MIMGU_mgv1a004405mg [Erythranthe guttata]
Length=529

 Score =   110 bits (275),  Expect(2) = 5e-35, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLGGT+VIPVTSPEL+REFLK+ D +F+SRP CMSA L S  YLS++  P GDQW
Sbjct  77   EIACFRLGGTHVIPVTSPELSREFLKEHDLIFASRPHCMSARLTSCNYLSTVIGPIGDQW  136

Query  280  AKMRRVLHSRVLSPA  236
             KMRR+L S  LS A
Sbjct  137  KKMRRILSSHALSSA  151


 Score = 63.9 bits (154),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQC-NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LHDKR +EA++LV+Y+Y Q  +        +VN R  T+ YCGNVI KMVF KRFFG  M
Sbjct  156  LHDKRDKEADHLVRYVYTQLLSPQNNNKNGLVNLRVATQHYCGNVIRKMVFGKRFFGAGM  215



>ref|XP_007017085.1| Cytochrome p450 79a2, putative [Theobroma cacao]
 gb|EOY34704.1| Cytochrome p450 79a2, putative [Theobroma cacao]
Length=557

 Score =   103 bits (258),  Expect(2) = 6e-35, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IACIR G  +VIPVT PE++REFLKKQD+VF+SRP+ MS D+ + G+L++  +P GDQW 
Sbjct  105  IACIRFGNVHVIPVTCPEISREFLKKQDAVFASRPISMSTDVTTKGFLTTALVPLGDQWK  164

Query  277  KMRRVLHSRVLSPASLRF  224
            KM++V+ + +LSP   R+
Sbjct  165  KMKKVMVTDLLSPTKHRW  182


 Score = 70.1 bits (170),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LH+KR EEA+NLV+Y+Y+QC     G   +VN R   +QYCGN+  K++FN+R+FG 
Sbjct  183  LHEKRAEEADNLVRYVYNQCKTLDKG--RLVNVRVAAQQYCGNLPRKLLFNRRYFGE  237



>ref|XP_010253086.1| PREDICTED: phenylalanine N-monooxygenase [Nelumbo nucifera]
Length=588

 Score =   102 bits (254),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
             IACIRLG  ++IPV  PE+AREFLKKQD++F+SRP+ M     S G+LS    P GDQW
Sbjct  108  NIACIRLGNVHIIPVNCPEIAREFLKKQDALFASRPITMGTQYSSRGFLSIAVAPWGDQW  167

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRV+ S V++PA LR+ +
Sbjct  168  KKMRRVVASEVITPARLRWLL  188


 Score = 71.2 bits (173),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 9/66 (14%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGT---GGMH------VVNARTVTRQYCGNVISKMVFN  75
            L DKRVEEA+NL++YI++QCN S +   G M       VV+ R   RQY GNVI KM+FN
Sbjct  187  LLDKRVEEADNLIRYIFNQCNSSNSKLNGTMAARAAGGVVDVRVAVRQYSGNVIRKMMFN  246

Query  74   KRFFGN  57
            KR+FG 
Sbjct  247  KRYFGQ  252



>gb|KCW74807.1| hypothetical protein EUGRSUZ_E03537 [Eucalyptus grandis]
Length=473

 Score = 99.8 bits (247),  Expect(2) = 9e-35, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI+C R+G T VIPVT P++AREFLKKQD+ F SRP+ M+A   S GY++++  P G+QW
Sbjct  21   EISCFRIGNTNVIPVTDPKIAREFLKKQDATFMSRPISMAAWAFSGGYMTTVMSPYGEQW  80

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++ PA
Sbjct  81   KKMRRVLTSEIICPA  95


 Score = 73.6 bits (179),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NL+K++++QC   G      VN R VTR YCGNVI ++VFNKR+FG
Sbjct  100  LHDKRAEEADNLLKHVFNQCKSPGQ-----VNLRHVTRHYCGNVIRRLVFNKRYFG  150



>ref|XP_007146888.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
 gb|ESW18882.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
Length=537

 Score =   100 bits (248),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVTSP +A EFL+KQD+ F+SR + MS +L+++GY ++IF+P GDQW
Sbjct  85   EIACIRLGNAYVIPVTSPTIATEFLRKQDATFASRSLSMSTELVTSGYSTTIFVPFGDQW  144

Query  280  AKMRRVLHSRVLSP  239
             KM++++   +LSP
Sbjct  145  KKMKKIVTKDLLSP  158


 Score = 73.2 bits (178),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NL+ Y+Y++C +   G   +VN RT  R YCGN+I K+ FN R+FG
Sbjct  164  LHDKRTEEADNLMFYVYNKCKMVNDGISGLVNVRTAARHYCGNLIRKITFNARYFG  219



>ref|XP_011071673.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=528

 Score =   109 bits (273),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T+VI VTSPELAREFL+KQD +F+SR   +SA L SNGYL++IF P  DQW
Sbjct  75   EIACIRLGNTHVIFVTSPELAREFLRKQDVIFASRADVLSAKLTSNGYLTAIFSPNCDQW  134

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ ++VLSP + R+
Sbjct  135  KKMRRVIATKVLSPTAHRW  153


 Score = 63.5 bits (153),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH KRVEE+++LV+Y++ Q     T G   VN R   + YCGN+  K++FNKRFFG+ M
Sbjct  154  LHGKRVEESDHLVRYVFKQSQSPLTNGF--VNVRVAAQHYCGNMARKLIFNKRFFGSGM  210



>gb|KHG05899.1| Phenylalanine N-monooxygenase -like protein [Gossypium arboreum]
Length=549

 Score =   105 bits (261),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSPE+AREFLKK D+VF+SRPV M+ +  S G+L+   +P GDQW
Sbjct  95   DIACIRLANTHVIPVTSPEIAREFLKKHDAVFASRPVTMATEYSSRGFLTIAVVPWGDQW  154

Query  280  AKMRRVLHSRVLSPASLR  227
             KMR+V+ S +++PA LR
Sbjct  155  KKMRKVMASEIITPARLR  172


 Score = 67.8 bits (164),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L DKR EE +NLV++IY+QC  +G G   V+N R   RQ  GN+I KM+FN+RFFG 
Sbjct  174  LLDKRTEEVDNLVRFIYNQCKSNG-GSSAVINLRLAARQCTGNIIRKMMFNRRFFGE  229



>ref|XP_010059403.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score = 99.8 bits (247),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI+C R+G T VIPVT P++AREFLKKQD+ F SRP+ M+A   S GY++++  P G+QW
Sbjct  76   EISCFRIGNTNVIPVTDPKIAREFLKKQDATFMSRPISMAAWAFSGGYMTTVMSPYGEQW  135

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++ PA
Sbjct  136  KKMRRVLTSEIICPA  150


 Score = 73.6 bits (179),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NL+K++++QC   G      VN R VTR YCGNVI ++VFNKR+FG
Sbjct  155  LHDKRAEEADNLLKHVFNQCKSPGQ-----VNLRHVTRHYCGNVIRRLVFNKRYFG  205



>ref|XP_002319424.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
 gb|EEE95347.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
Length=528

 Score =   102 bits (254),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG   VIPV  P++A EFLK QD+ F+SRP  M+ DLIS GYL++I  P+GDQW
Sbjct  77   EIACIRLGNVLVIPVICPDIACEFLKAQDNTFASRPNTMTTDLISRGYLATILSPSGDQW  136

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  137  NKMKKVLMTHVLSP  150


 Score = 70.5 bits (171),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  R YC NV  KM+FNKRFFG  M
Sbjct  156  LYSKRVEEADHLVHYVYNQCKKSVHQG-GIVNLRTAARHYCANVTRKMLFNKRFFGEGM  213



>ref|XP_007146890.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
 gb|ESW18884.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
Length=538

 Score =   100 bits (249),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVTSP +A EFL+KQD+ F+SR + MS +LIS+GY ++ F P GDQW
Sbjct  84   EIACIRLGNAYVIPVTSPTIATEFLRKQDATFASRSLSMSTELISSGYSTTAFAPFGDQW  143

Query  280  AKMRRVLHSRVLSP  239
             KM+++L + +LSP
Sbjct  144  KKMKKILTNDLLSP  157


 Score = 72.4 bits (176),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA NL  Y+Y++C +   G   +VN RT  R YCGN+I K+ FN R+FG
Sbjct  163  LHDKRTEEAQNLTFYVYNKCKMVNDGISGLVNVRTAARHYCGNLIRKITFNTRYFG  218



>gb|AHF20913.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   103 bits (258),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ DLIS+GYL++I  P+GDQW
Sbjct  77   EIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPNTMATDLISSGYLATILSPSGDQW  136

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  137  NKMKKVLMTHVLSP  150


 Score = 68.6 bits (166),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  + YC NV  KM+FNKRFFG  M
Sbjct  156  LYSKRVEEADHLVHYVYNQCKKSVHQG-GIVNLRTAAQHYCANVTRKMLFNKRFFGEGM  213



>ref|XP_008385013.1| PREDICTED: isoleucine N-monooxygenase 2-like, partial [Malus 
domestica]
Length=508

 Score = 95.9 bits (237),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP  +S  L++ GY ++  +P G+QW
Sbjct  56   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPRIISTFLVTKGYKTAALVPFGEQW  115

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +L+P
Sbjct  116  KKMRKVITSELLTP  129


 Score = 76.6 bits (187),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKRVEEA+++VKY+Y+QCN +  GG  +VN R  T+ YC NVI KMV NKR+FG  M
Sbjct  135  LTDKRVEEADHIVKYVYNQCNNNEGGG--IVNLRXATQHYCANVIKKMVLNKRYFGEEM  191



>ref|XP_006387420.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
 gb|ERP46334.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
Length=541

 Score =   103 bits (257),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ DLIS+GYL++I  P+GDQW
Sbjct  90   EIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPNTMATDLISSGYLATILSPSGDQW  149

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  150  NKMKKVLMTHVLSP  163


 Score = 68.6 bits (166),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  + YC NV  KM+FNKRFFG  M
Sbjct  169  LYSKRVEEADHLVHYVYNQCKKSVHQG-GIVNLRTAAQHYCANVTRKMLFNKRFFGEGM  226



>ref|XP_007011296.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20106.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   107 bits (266),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +VIPVTSPE+AREFLKK D+VF+SRP+ M+ +L S G+LS+I +P GDQW
Sbjct  96   DIACIRLANIHVIPVTSPEIAREFLKKYDAVFASRPLTMATELASRGFLSTILVPWGDQW  155

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRV+ S ++ P +L + +
Sbjct  156  KKMRRVVTSNIMRPETLSWLL  176


 Score = 65.5 bits (158),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR +EA+NLV++IY+QC    N S  G   V++ R   RQY GNVIS+M+FNKR+FG
Sbjct  178  KRTQEADNLVRFIYNQCVNPENDSSNGS--VIDLRLAVRQYTGNVISRMMFNKRYFG  232



>ref|XP_007011304.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20114.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   108 bits (271),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +VIPVTSPE+AREFLKK D+VF+SRPV M+ +L+S GYLS+  +P GDQW
Sbjct  96   DIACIRLANIHVIPVTSPEIAREFLKKYDAVFASRPVTMATELVSRGYLSTALVPWGDQW  155

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S ++ PA L
Sbjct  156  KKMRKVIASNIIKPARL  172


 Score = 63.5 bits (153),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR +EA+NLV++IY+QC    N S  G   V+N R   RQY GNVI KM+F++R+FG 
Sbjct  178  KRTQEADNLVRFIYNQCINPENDSSNGS--VINLRLAVRQYTGNVIRKMMFDRRYFGQ  233



>ref|XP_009758130.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=390

 Score =   114 bits (285),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  + IPVTSPELA  FLK QDS+FSS P+CM A+L+SNG L+S+FLP GDQW
Sbjct  74   EIACIRLGNVHAIPVTSPELACLFLKNQDSIFSSSPICMYANLVSNGCLTSLFLPMGDQW  133

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLS  S ++
Sbjct  134  MKMRRILPSHVLSATSFQW  152


 Score = 57.4 bits (137),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+++++++YDQC         V+N R VTR YC NVI+ M+F+KR  G
Sbjct  156  KRDEEADHIIRFVYDQC----INKRLVINLRKVTRYYCANVINNMIFSKRLLG  204



>ref|XP_010027351.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW62237.1| hypothetical protein EUGRSUZ_H04897 [Eucalyptus grandis]
Length=531

 Score =   100 bits (249),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG T+VIPVT P +AREFL+KQDS+F+SRPV M++  +S+ YL++   P G+QW
Sbjct  78   DIACIRLGSTHVIPVTCPTIAREFLRKQDSLFASRPVTMASGTLSSSYLTTALSPYGEQW  137

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S V+ PA
Sbjct  138  QKMRRVLVSEVVCPA  152


 Score = 71.2 bits (173),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NL+KY+++ C  SG    H VN R+ TR Y GNV  +++FNKR+FG
Sbjct  157  LHDKRAEEADNLMKYVFNLCKTSG----HQVNLRSTTRHYTGNVTRRLMFNKRYFG  208



>ref|XP_007011302.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20112.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=398

 Score =   107 bits (266),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +VIPVTSPE+AREFLKK D+VF+SRPV M+ +L S G+LS+  +P GDQW
Sbjct  96   DIACIRLANIHVIPVTSPEIAREFLKKYDAVFASRPVTMATELASRGFLSTALVPWGDQW  155

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S +L PA L
Sbjct  156  KKMRKVIASNILKPARL  172


 Score = 63.9 bits (154),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 7/60 (12%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KR +EA+NLV++IY+QC    N S  G   V+N R   RQY GNVI KM+F+KR+FG
Sbjct  176  LH-KRTQEADNLVRFIYNQCINPENDSSNGS--VINLRLAVRQYTGNVIRKMMFHKRYFG  232



>ref|XP_010027355.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=546

 Score = 98.6 bits (244),  Expect(2) = 5e-34, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC  +G T+VIPVT P++AREFLKKQD+ F+SRPV M+A   S GY +++  P G+QW 
Sbjct  95   IACFCIGNTHVIPVTDPKIAREFLKKQDATFASRPVSMAARAFSGGYATAVISPYGEQWK  154

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  155  KMRRVLTSEIICPA  168


 Score = 72.4 bits (176),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGNVI ++VFNKR+FG 
Sbjct  173  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNVIRRLVFNKRYFGE  224



>ref|XP_010030372.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=509

 Score = 99.4 bits (246),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVT P +AREFLKK D+ FSSRP  M+      G+L++I  P GDQW
Sbjct  55   DIACIRLGNVHVIPVTCPNIAREFLKKHDATFSSRPTSMATRTCGGGFLTTILSPYGDQW  114

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++SPA
Sbjct  115  MKMRRVLVSEIISPA  129


 Score = 71.6 bits (174),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 9/80 (11%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVMe  48
            L DKR EEA+NLVKYIY+Q   S      +VN RT TRQY GNVI K++F+KR+FG    
Sbjct  134  LKDKRTEEADNLVKYIYNQSKSSS----RIVNVRTATRQYTGNVIRKLMFSKRYFGEERA  189

Query  47   eeeeEI-----LKALFALLQ  3
            +    I     ++A+F +L+
Sbjct  190  DGGPTIAEEEHIEAIFTILK  209



>ref|XP_011021045.1| PREDICTED: isoleucine N-monooxygenase 2-like [Populus euphratica]
Length=541

 Score =   101 bits (252),  Expect(2) = 6e-34, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ DLIS GYL++   P+GDQW
Sbjct  90   EIACIRLGNVHVIPVICPDIASEFLKAQDNTFASRPRTMATDLISRGYLTTALSPSGDQW  149

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  150  NKMKKVLMTHVLSP  163


 Score = 68.9 bits (167),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNIS-GTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   GG  +VN RT  + YC NV  KM+FNKRFFG  M
Sbjct  169  LYSKRVEEADHLVHYVYNQCKKSLHQGG--IVNLRTAAQHYCANVTRKMLFNKRFFGEGM  226



>gb|KCW62254.1| hypothetical protein EUGRSUZ_H04914 [Eucalyptus grandis]
Length=519

 Score = 98.2 bits (243),  Expect(2) = 6e-34, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC  +G T+VIPVT P++AREFLKKQD+ F+SRPV M+A   S GY +++  P G+QW 
Sbjct  68   IACFCIGNTHVIPVTDPKIAREFLKKQDATFASRPVSMAARAFSGGYATAVISPYGEQWK  127

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  128  KMRRVLTSEIICPA  141


 Score = 72.4 bits (176),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGNVI ++VFNKR+FG 
Sbjct  146  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNVIRRLVFNKRYFGE  197



>gb|KCW54304.1| hypothetical protein EUGRSUZ_I00267 [Eucalyptus grandis]
Length=529

 Score = 99.4 bits (246),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVT P +AREFLKK D+ FSSRP  M+      G+L++I  P GDQW
Sbjct  75   DIACIRLGNVHVIPVTCPNIAREFLKKHDATFSSRPTSMATRTCGGGFLTTILSPYGDQW  134

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++SPA
Sbjct  135  MKMRRVLVSEIISPA  149


 Score = 71.2 bits (173),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L DKR EEA+NLVKYIY+Q   S      +VN RT TRQY GNVI K++F+KR+FG 
Sbjct  154  LKDKRTEEADNLVKYIYNQSKSSS----RIVNVRTATRQYTGNVIRKLMFSKRYFGE  206



>ref|XP_002274952.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   105 bits (262),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+AREFLKK D+VF+SRP+ M++D +S G+L+++  P G+QW
Sbjct  40   EIACIKLGNVHVIPVISPEIAREFLKKHDAVFASRPITMTSDHLSRGFLTTVLSPWGEQW  99

Query  280  AKMRRVLHSRVLSPA  236
             KMRR++ S VL PA
Sbjct  100  KKMRRIITSEVLKPA  114


 Score = 64.7 bits (156),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMH-----VVNARTVTRQYCGNVISKMVFNKRFF  63
            L  KR EEA+NLV++IY+QC  S     +     VVN R   RQY GNV+ KM+F++R+F
Sbjct  119  LLQKRTEEADNLVRFIYNQCKFSSITSHNFTESSVVNVRNTVRQYTGNVVRKMMFSRRYF  178

Query  62   GN  57
            G 
Sbjct  179  GE  180



>ref|XP_008385015.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   102 bits (253),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP  +S  LI+ GY++++ +P G+QW
Sbjct  81   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPXSISTFLITKGYITTVMVPFGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  141  KKMRKVITSELLSP  154


 Score = 67.8 bits (164),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            L DKRVEEA+++V Y+Y+QC  +  GG  +VN R  T+ YC NVI KMV NKR+F
Sbjct  160  LTDKRVEEADHIVXYVYNQCKNNEGGG--IVNLRLATQHYCANVIKKMVLNKRYF  212



>ref|XP_010025546.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score = 98.6 bits (244),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VIPVT P++A+E LKKQD+ F+SRPV M+A   S GY++++  P G+QW 
Sbjct  77   IACFRIGNTHVIPVTDPKIAQEILKKQDATFASRPVSMAARAFSGGYVTAVISPYGEQWK  136

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  137  KMRRVLTSEIICPA  150


 Score = 71.2 bits (173),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGN I ++VFNKR+FG
Sbjct  155  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNAIRRLVFNKRYFG  205



>gb|KCW62253.1| hypothetical protein EUGRSUZ_H04913 [Eucalyptus grandis]
Length=473

 Score = 98.6 bits (244),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VIPVT P++A+E LKKQD+ F+SRPV M+A   S GY++++  P G+QW 
Sbjct  22   IACFRIGNTHVIPVTDPKIAQEILKKQDATFASRPVSMAARAFSGGYVTAVISPYGEQWK  81

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  82   KMRRVLTSEIICPA  95


 Score = 71.2 bits (173),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGN I ++VFNKR+FG
Sbjct  100  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNAIRRLVFNKRYFG  150



>gb|AHI88992.1| CYP79D6v4 [Populus nigra]
Length=528

 Score = 99.4 bits (246),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ +LIS GYL++   P+GDQW
Sbjct  77   EIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPHTMTTNLISRGYLTTALSPSGDQW  136

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  137  NKMKKVLMTHVLSP  150


 Score = 70.1 bits (170),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  + YC NV  KM+FNKRFFG  M
Sbjct  156  LYSKRVEEADHLVHYVYNQCKKSAHQG-GIVNLRTAAQHYCANVTRKMLFNKRFFGEGM  213



>ref|XP_007011298.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20108.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=534

 Score =   103 bits (258),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +VIPVTSPE+AREFLKK D+ F+SRPV M+ +  S G+LS+  +P GDQW
Sbjct  76   DIACIRLANIHVIPVTSPEIAREFLKKYDAAFASRPVTMATEFASRGFLSTALVPWGDQW  135

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S ++ PA L
Sbjct  136  KKMRKVIASNIIKPARL  152


 Score = 65.5 bits (158),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR +EA+NLV++IY+QC    N S  G   V+N R   RQY GNVI KM+FNKR+FG 
Sbjct  158  KRTQEADNLVRFIYNQCINPENDSSNGS--VINLRLAVRQYTGNVIRKMMFNKRYFGQ  213



>ref|XP_011098372.1| PREDICTED: phenylalanine N-monooxygenase-like [Sesamum indicum]
Length=535

 Score =   108 bits (270),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T+VI VTSPELAREFL+KQD +F+SRP  MS +L SNG+L++   P G+QW
Sbjct  76   EIACIRLGNTHVIVVTSPELAREFLRKQDVIFASRPNSMSGNLTSNGFLTTAISPMGNQW  135

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ S VLSP
Sbjct  136  KKMRRIIASEVLSP  149


 Score = 60.8 bits (146),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KR EE  +LV+Y+Y+Q       G+  VN R   + YCGNVI K+VF KRFFG
Sbjct  155  LHAKRREETEHLVRYVYNQSQNPLVNGL--VNVRVAAQHYCGNVIRKLVFGKRFFG  208



>ref|XP_002523435.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38894.1| cytochrome P450, putative [Ricinus communis]
Length=390

 Score =   100 bits (249),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPE++REFL+ QD++F+SRP+ MS DL + GYL++  +P G+QW
Sbjct  99   EIACIRLGNVHVIPVTSPEISREFLEVQDALFASRPLTMSTDLTTRGYLATGAVPLGEQW  158

Query  280  AKMRRVLHSRVLS  242
             KMRRVL ++ LS
Sbjct  159  KKMRRVLVTQFLS  171


 Score = 68.2 bits (165),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
             + KR+E A++LV+Y+Y+QC     GG   VN R   R YCGNV  KMVFNKRFFG  M
Sbjct  178  FYGKRLEAADHLVRYVYNQCKTVEEGGS--VNVRVTGRHYCGNVTRKMVFNKRFFGEGM  234



>ref|XP_009599475.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=544

 Score =   117 bits (294),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T+VI VTSPELA  FLK+QDS+FSSR +CMSA LISNGYL+S+FLP GDQW
Sbjct  89   EIACIRLGSTHVIAVTSPELACHFLKEQDSLFSSRRICMSATLISNGYLTSVFLPMGDQW  148

Query  280  AKMRRVLHSRVLSPAS  233
             KMRR L S VLS +S
Sbjct  149  MKMRRFLASHVLSQSS  164


 Score = 50.8 bits (120),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA++L++++Y+Q     +     +N R VTR YC NV+  M+F+KR  G
Sbjct  168  LRHKRDEEADHLLRFVYNQ--YCSSNEPVTINLRKVTRYYCANVVKNMIFSKRLLG  221



>ref|XP_009600260.1| PREDICTED: phenylalanine N-monooxygenase-like [Nicotiana tomentosiformis]
Length=699

 Score =   111 bits (278),  Expect(2) = 3e-33, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI LG  +VIPVTSPE A  FLK QDS+ SSRP+CMSA+L+SNGYL+S FLP GDQ 
Sbjct  22   EIACICLGNVHVIPVTSPEFACLFLKNQDSILSSRPICMSANLVSNGYLTSGFLPMGDQS  81

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLS  S ++
Sbjct  82   IKMRRILSSHVLSATSFQW  100


 Score = 56.6 bits (135),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA+++++++YDQC         V+N R VTR YC NVI+ M+F+KR  G
Sbjct  101  LRRKRDEEADHILRFVYDQC----INKRLVINLRKVTRYYCANVINNMIFSKRLLG  152



>ref|XP_006376556.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
 gb|ERP54353.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
Length=528

 Score =   100 bits (249),  Expect(2) = 3e-33, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ DLIS GYL++   P+GDQW
Sbjct  77   EIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPHTMTTDLISRGYLTTALSPSGDQW  136

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  137  NKMKKVLMTHVLSP  150


 Score = 67.8 bits (164),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  + YC N+  KM+FNKRFFG  M
Sbjct  156  LYSKRVEEADHLVHYVYNQCKKSVHQG-GIVNLRTAAQHYCANLTRKMLFNKRFFGEGM  213



>gb|AHF20912.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   100 bits (249),  Expect(2) = 3e-33, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPV  P++A EFLK QD+ F+SRP  M+ DLIS GYL++   P+GDQW
Sbjct  77   EIACIRLGNVHVIPVICPDIACEFLKAQDNTFASRPHTMTTDLISRGYLTTALSPSGDQW  136

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + VLSP
Sbjct  137  NKMKKVLMTHVLSP  150


 Score = 67.8 bits (164),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L+ KRVEEA++LV Y+Y+QC  S   G  +VN RT  + YC N+  KM+FNKRFFG  M
Sbjct  156  LYSKRVEEADHLVHYVYNQCKKSVHQG-GIVNLRTAAQHYCANLTRKMLFNKRFFGEGM  213



>ref|XP_011005474.1| PREDICTED: cytochrome P450 79B1-like [Populus euphratica]
Length=527

 Score = 98.6 bits (244),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +A EFLK+QD VFSSRP  +S+ L SNGYL+++  P GDQW
Sbjct  78   EIACIRLGNIHVIPVTCPNIACEFLKEQDDVFSSRPKTISSYLASNGYLATVVSPFGDQW  137

Query  280  AKMRRVLHSRVLSP  239
             KM+ V+  +VLSP
Sbjct  138  KKMKTVMAKQVLSP  151


 Score = 68.6 bits (166),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KRVEE +NLV+ +Y QC  S   G  +VN R +++ YC NVI K++FNKR+FG
Sbjct  157  LHKKRVEEGDNLVRLVYKQCQESDQDG--IVNLRFISQHYCANVIRKLMFNKRYFG  210



>ref|XP_002305081.2| Cytochrome P450 79B2 family protein [Populus trichocarpa]
 gb|EEE85592.2| Cytochrome P450 79B2 family protein [Populus trichocarpa]
Length=527

 Score = 99.0 bits (245),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +A EFLK+QD VFSSRP  +S+ L SNGYL+++  P GDQW
Sbjct  78   EIACIRLGNIHVIPVTCPNIACEFLKEQDDVFSSRPETISSYLASNGYLATVVSPFGDQW  137

Query  280  AKMRRVLHSRVLSP  239
             KM+ V+ ++VLSP
Sbjct  138  KKMKSVMATQVLSP  151


 Score = 67.4 bits (163),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH KRVEE +NLV+ +Y QC  S   G  +VN R  ++ YC NVI K++FNKR+FG
Sbjct  157  LHKKRVEEGDNLVRLVYKQCQESDQDG--IVNLRFTSQHYCANVIRKLMFNKRYFG  210



>gb|KCW75037.1| hypothetical protein EUGRSUZ_E03811 [Eucalyptus grandis]
Length=457

 Score = 97.1 bits (240),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VIPVT P++AREFLKKQD+ F+SRPV M+A   S  Y++++  P G+QW 
Sbjct  22   IACFRIGNTHVIPVTDPKIAREFLKKQDARFASRPVSMAAQAFSGSYMTAVISPYGEQWK  81

Query  277  KMRRVLHSRVLSPA  236
            KMR VL S ++ PA
Sbjct  82   KMRHVLTSEIICPA  95


 Score = 69.3 bits (168),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L+DKR EEA+NLVK +++QC   G      VN R  TR YCGNVI ++VFNKR+FG 
Sbjct  100  LYDKRAEEADNLVKQVFNQCKSLGQ-----VNLRHTTRHYCGNVIRRLVFNKRYFGE  151



>ref|XP_008366287.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=399

 Score = 99.0 bits (245),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP  +S  LI+ GY++++ +P G+QW
Sbjct  81   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPXSISTFLITKGYITTVMVPFGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  141  KKMRKVITSELLSP  154


 Score = 67.4 bits (163),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            L DKRVEEA+++VKY+Y+QC  +  GG  +VN R  T+ YC NVI KM  NKR+F
Sbjct  160  LTDKRVEEADHIVKYVYNQCKNNEGGG--IVNLRLATQHYCANVIKKMXLNKRYF  212



>ref|XP_002269843.2| PREDICTED: phenylalanine N-monooxygenase [Vitis vinifera]
Length=493

 Score = 95.1 bits (235),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE++REFLKK D++F+SRPV M+++  S G+L+   +P G QW
Sbjct  39   EIACIQLGNVHVIPVISPEISREFLKKHDAIFASRPVTMASEYSSGGFLTIAVVPKGTQW  98

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ S V++  + ++
Sbjct  99   KKMRRVVASDVINETTFKW  117


 Score = 71.2 bits (173),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+NLV++IY+QC    +    ++N R   RQY GNVI KM+ N R+FG 
Sbjct  118  LHDKRVEEADNLVRFIYNQCKTFTSPS--IINVRNTVRQYSGNVIRKMILNTRYFGE  172



>ref|XP_010030373.1| PREDICTED: valine N-monooxygenase 1-like [Eucalyptus grandis]
Length=533

 Score = 97.8 bits (242),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  ++IPVT PE+AREFLKK D+ FSS P  ++    S G+L++I  P GDQW
Sbjct  79   DIACIRLGNVHIIPVTCPEIAREFLKKHDATFSSSPTSLATQTCSGGFLTTILSPYGDQW  138

Query  280  AKMRRVLHSRVLSPA  236
             KMRRV+ S ++SPA
Sbjct  139  MKMRRVIVSEIISPA  153


 Score = 68.2 bits (165),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L DKR EEA+NLVKYIY++   S       VN RT TRQY GNVI K++F+KR+FG 
Sbjct  158  LKDKRTEEADNLVKYIYNRSKSSS----RTVNVRTATRQYTGNVIRKLMFSKRYFGE  210



>ref|XP_009785456.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=195

 Score =   114 bits (284),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VI VTSPELA +FL++QDS+FSSR  CMSA L+SNGYL+S+FLP GDQW
Sbjct  28   EIACIRLGSFHVIVVTSPELACQFLREQDSLFSSRRTCMSATLVSNGYLTSVFLPIGDQW  87

Query  280  AKMRRVLHSRVLSPAS  233
             KMRR L S VLS +S
Sbjct  88   MKMRRFLGSHVLSQSS  103


 Score = 52.4 bits (124),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = -1

Query  242  SGEPPLHDKRVEEANNLVKYIYDQ-CNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRF  66
            S    L  KR EEA++L++++Y+Q C+I        +N R VTR YC NV+  M+F+KR 
Sbjct  102  SSHQWLRHKRDEEADHLLRFVYNQYCSIDEPV---TINLRKVTRYYCANVVKNMIFSKRL  158

Query  65   FGN  57
             G 
Sbjct  159  LGK  161



>ref|XP_010030374.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW54306.1| hypothetical protein EUGRSUZ_I00270 [Eucalyptus grandis]
Length=509

 Score =   100 bits (250),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVT PE+AREFLKK D  FSSRP  M+    S G+L++I  P GDQW
Sbjct  55   DIACIRLGNVHVIPVTCPEIAREFLKKHDVTFSSRPTSMATRTYSGGFLTTILSPYGDQW  114

Query  280  AKMRRVLHSRVLSPA  236
             KMRRV+ S ++SPA
Sbjct  115  MKMRRVIVSEIISPA  129


 Score = 65.1 bits (157),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L DKR EEA+NLVKYIY++     T     VN RT  RQY  NVI K++F+KR+FG 
Sbjct  134  LKDKRTEEADNLVKYIYNR----STSSSRTVNVRTAARQYTANVIRKLMFSKRYFGE  186



>ref|XP_011098373.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   107 bits (267),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T+VI VTSPELAREFL+KQD +F+SRP  MSA+L SNG+L+    P G+QW
Sbjct  76   EIACIRLGNTHVIVVTSPELAREFLRKQDVIFASRPKSMSANLTSNGFLTIATAPMGNQW  135

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S VLSP
Sbjct  136  KKMRKVIASEVLSP  149


 Score = 58.5 bits (140),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            LH KR EE ++LV+Y+Y+Q       G+  VN R V + YCGNV  K+VF KRFF
Sbjct  155  LHAKRCEETDHLVRYVYNQSQNPLLNGL--VNVRVVAQHYCGNVSRKLVFGKRFF  207



>gb|KCW62252.1| hypothetical protein EUGRSUZ_H04912 [Eucalyptus grandis]
Length=473

 Score = 94.4 bits (233),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VI VT P++A+EFLKKQD+ F+SRP  M+A   S GY++++  P G+QW 
Sbjct  22   IACFRIGNTHVITVTDPKIAQEFLKKQDATFASRPGLMAARAFSGGYVTAVISPYGEQWK  81

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  82   KMRRVLTSEIICPA  95


 Score = 71.6 bits (174),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGN+I ++VFNKR+FG
Sbjct  100  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNMIRRLVFNKRYFG  150



>gb|KEH34488.1| cytochrome P450 family protein [Medicago truncatula]
Length=528

 Score =   105 bits (261),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +A EFL+K D  F+SRPV M++D+ISNGYL+S+F+P G+QW
Sbjct  81   EIACIRLGNVHVIPVTYPTIAHEFLRKHDIDFASRPVSMASDIISNGYLTSVFVPFGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KM+ V+ + +LSP
Sbjct  141  KKMKNVVANNLLSP  154


 Score = 60.8 bits (146),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L  KR EEA+NL+ Y+Y++CN    GG+  VN R  T+ +CGNV  K+ FN R+FG  M
Sbjct  160  LQHKRNEEADNLIFYVYNKCN---NGGL--VNVRIATQHFCGNVFRKLFFNTRYFGKGM  213



>ref|XP_003543894.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
 gb|KHN02647.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   103 bits (256),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVT P +AREFL+KQD+ F+SR   +S DLISNGY ++IF P G QW
Sbjct  85   EIACIRLGNAYVIPVTCPTIAREFLRKQDATFASRSQSVSTDLISNGYSTTIFGPFGAQW  144

Query  280  AKMRRVLHSRVLSP  239
             KM+++L + +LSP
Sbjct  145  KKMKKILTNDLLSP  158


 Score = 62.8 bits (151),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQC-NI-SGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH +R EEA+NL+ ++Y++C N+  G GG+  VN R+V R YCGN+  K++FN R+FG
Sbjct  164  LHGQRTEEADNLMFHVYNKCKNVNDGVGGL--VNIRSVARHYCGNLTRKIIFNTRYFG  219



>gb|KCW54305.1| hypothetical protein EUGRSUZ_I00268 [Eucalyptus grandis]
Length=505

 Score = 97.8 bits (242),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  ++IPVT PE+AREFLKK D+ FSS P  ++    S G+L++I  P GDQW
Sbjct  51   DIACIRLGNVHIIPVTCPEIAREFLKKHDATFSSSPTSLATQTCSGGFLTTILSPYGDQW  110

Query  280  AKMRRVLHSRVLSPA  236
             KMRRV+ S ++SPA
Sbjct  111  MKMRRVIVSEIISPA  125


 Score = 68.2 bits (165),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L DKR EEA+NLVKYIY++   S       VN RT TRQY GNVI K++F+KR+FG 
Sbjct  130  LKDKRTEEADNLVKYIYNRSKSSS----RTVNVRTATRQYTGNVIRKLMFSKRYFGE  182



>emb|CAN61661.1| hypothetical protein VITISV_000261 [Vitis vinifera]
Length=572

 Score = 94.7 bits (234),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE++REFLKK D++F+SRPV M+++  S G+L+   +P G QW
Sbjct  118  EIACIQLGNVHVIPVISPEISREFLKKHDAIFASRPVTMASEYSSGGFLTIAVVPKGTQW  177

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ S V++  + ++
Sbjct  178  KKMRRVVASDVINETTFKW  196


 Score = 70.9 bits (172),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+NLV++IY+QC    +    ++N R   RQY GNVI KM+ N R+FG 
Sbjct  197  LHDKRVEEADNLVRFIYNQCKTFTSPS--IINVRNTVRQYSGNVIRKMILNTRYFGE  251



>emb|CAN74072.1| hypothetical protein VITISV_035799 [Vitis vinifera]
Length=457

 Score = 99.4 bits (246),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+AREFLKK D+VF+SRP+ M++  +S G+L++   P G+QW
Sbjct  96   EIACIKLGNVHVIPVISPEIAREFLKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQW  155

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ S VL P
Sbjct  156  KKMRRIIISEVLKP  169


 Score = 66.2 bits (160),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMH-----VVNARTVTRQYCGNVISKMVFNKRFF  63
            L  KR EEA+NLV++IY+QC  S     +     VVN R   RQY GNV+ KM+F++R+F
Sbjct  175  LLQKRTEEADNLVRFIYNQCKFSSITSHNFTDSSVVNVRNAVRQYTGNVVRKMMFSRRYF  234

Query  62   GNV  54
            G V
Sbjct  235  GEV  237



>ref|XP_010027354.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=687

 Score = 93.6 bits (231),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VI VT P++A+EFLKKQD+ F+SRP  M+A   S GY++++  P G+QW 
Sbjct  236  IACFRIGNTHVITVTDPKIAQEFLKKQDATFASRPGLMAARAFSGGYVTAVISPYGEQWK  295

Query  277  KMRRVLHSRVLSPA  236
            KMRRVL S ++ PA
Sbjct  296  KMRRVLTSEIICPA  309


 Score = 71.6 bits (174),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLVK++++QC   G      VN R  TR YCGN+I ++VFNKR+FG
Sbjct  314  LHDKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNMIRRLVFNKRYFG  364



>gb|KEH34486.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   101 bits (251),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG   VIPVT P +AREFL+K D+ F+SRP+ M++D+ISNGY++SI +P G+QW
Sbjct  86   EIACIRLGNVNVIPVTCPSIAREFLRKHDADFASRPITMASDIISNGYVTSILVPYGEQW  145

Query  280  AKMRRVLHSRVLS  242
             KM++VL   + S
Sbjct  146  KKMKKVLVKDLFS  158


 Score = 63.5 bits (153),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR EEA+NL+ Y+Y++CN  G     +VN R  T+ YCGNV  K+ FN R+FG  M
Sbjct  165  LQDKRNEEADNLMFYVYNKCNNGG-----LVNVRIATQHYCGNVYRKLFFNTRYFGKGM  218



>ref|XP_002274698.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=563

 Score = 98.6 bits (244),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+AREFLKK D+VF+SRP+ M++  +S G+L++   P G+QW
Sbjct  108  EIACIKLGNVHVIPVISPEIAREFLKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQW  167

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ S VL P
Sbjct  168  KKMRRIIISEVLKP  181


 Score = 66.2 bits (160),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMH-----VVNARTVTRQYCGNVISKMVFNKRFF  63
            L  KR EEA+NLV++IY+QC  S     +     VVN R   RQY GNV+ KM+F++R+F
Sbjct  187  LLQKRTEEADNLVRFIYNQCKFSSITSHNFTDSSVVNVRNAVRQYTGNVVRKMMFSRRYF  246

Query  62   GNV  54
            G V
Sbjct  247  GEV  249



>gb|KHG04035.1| Tyrosine N-monooxygenase [Gossypium arboreum]
Length=550

 Score = 91.3 bits (225),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IACIR G  +VI +T PE++ +FLK QD+VF+SRPV MS D+ + GYL++  +P GDQW 
Sbjct  98   IACIRFGNVHVIVITCPEISCQFLKNQDAVFASRPVSMSTDVTTKGYLTTALVPFGDQWK  157

Query  277  KMRRVLHSRVLSPASLRF  224
            KM++VL   +LS    R+
Sbjct  158  KMKKVLMGELLSTTRHRW  175


 Score = 73.6 bits (179),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+NLV+Y+Y+ C  +  GG+  VN R  ++QYCGNV  KM+FN+R+FG 
Sbjct  176  LHDKRVEEADNLVRYVYNLC--TSAGGL--VNVRVASQQYCGNVPRKMLFNRRYFGE  228



>ref|XP_010059479.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=524

 Score = 97.4 bits (241),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VIPV+ P++AREFLKKQD+ F+SRPV M+A   S  Y++++  P G+QW 
Sbjct  73   IACFRIGNTHVIPVSDPKIAREFLKKQDARFASRPVSMAAQAFSGSYMTAVISPYGEQWK  132

Query  277  KMRRVLHSRVLSPA  236
            KMR VL S+++ PA
Sbjct  133  KMRHVLTSQIICPA  146


 Score = 67.4 bits (163),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L+ KR EEA+NLVK++++QC   G      VN R  TR YCGNVI ++VFNKR+FG 
Sbjct  151  LYGKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNVIRRLVFNKRYFGE  202



>gb|KCW74950.1| hypothetical protein EUGRSUZ_E03692, partial [Eucalyptus grandis]
Length=515

 Score = 97.4 bits (241),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VIPV+ P++AREFLKKQD+ F+SRPV M+A   S  Y++++  P G+QW 
Sbjct  64   IACFRIGNTHVIPVSDPKIAREFLKKQDARFASRPVSMAAQAFSGSYMTAVISPYGEQWK  123

Query  277  KMRRVLHSRVLSPA  236
            KMR VL S+++ PA
Sbjct  124  KMRHVLTSQIICPA  137


 Score = 67.4 bits (163),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L+ KR EEA+NLVK++++QC   G      VN R  TR YCGNVI ++VFNKR+FG 
Sbjct  142  LYGKRAEEADNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNVIRRLVFNKRYFGE  193



>ref|XP_002523444.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38903.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score = 95.1 bits (235),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPEL+RE LK QD+ F+SRP+ MS  L + GYL++  +P G+QW
Sbjct  108  EIACIRLGNVHVIPVTSPELSREILKAQDAAFASRPLTMSTHLSTRGYLTTALVPLGEQW  167

Query  280  AKMRRVL  260
             KM+RVL
Sbjct  168  KKMKRVL  174


 Score = 69.3 bits (168),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
             + KR+EEA++LV Y+Y+QC  +  GG+  V+ R   R YC NVI KMVFNKRFFG  M
Sbjct  176  FYGKRLEEADHLVPYVYNQCKTAEEGGL--VDVRITGRHYCRNVIRKMVFNKRFFGEGM  232



>ref|XP_011075711.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=522

 Score =   104 bits (260),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T+VI VTSP+LARE L+KQD +F+SR   +SA L SNGYL++IF P  DQW
Sbjct  71   EIACIRLGNTHVIFVTSPQLARELLRKQDVIFASRADVLSARLASNGYLTAIFSPNCDQW  130

Query  280  AKMRRVLHSRVLSP  239
             KMRRV+ S VLSP
Sbjct  131  KKMRRVIASGVLSP  144


 Score = 59.7 bits (143),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LH+KR +E ++LVKY++ Q   +G     +VN R   + YCGN+  K++FNKRFFG  M
Sbjct  150  LHNKRSKEVDHLVKYVFKQSLTNG-----LVNVRVAAQHYCGNMTRKLIFNKRFFGTGM  203



>ref|XP_002274641.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=494

 Score =   100 bits (249),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+AREFLKK D+VF+SRP+ M++  +S G+L++   P G+QW
Sbjct  40   EIACIKLGNVHVIPVISPEIAREFLKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQW  99

Query  280  AKMRRVLHSRVLSPA  236
             KMRR++ S VL PA
Sbjct  100  KKMRRIIISEVLKPA  114


 Score = 63.5 bits (153),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGG----MHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EEA+NLV++IY+QC  S +        VVN R   RQY GN++ KM+F++R+FG
Sbjct  119  LLQKRTEEADNLVRFIYNQCKSSTSTDNFMDSSVVNVRNAVRQYTGNIVRKMMFSRRYFG  178

Query  59   N  57
             
Sbjct  179  E  179



>ref|XP_009342222.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score = 99.8 bits (247),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG T VIP+T P+L+RE LKKQD++F+SRP+ +S  LI+ GY +++ +P G+QW
Sbjct  82   EIACIRLGNTNVIPITCPQLSREILKKQDAIFASRPLSISTFLITKGYKTAVMVPFGEQW  141

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +L+P
Sbjct  142  KKMRKVIASELLTP  155


 Score = 64.3 bits (155),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKRVEEA+++VKY+Y+QCN +  GG+  +  R  T+ YC NVI KMV NKR+FG  M
Sbjct  161  LADKRVEEADHIVKYVYNQCNNNEGGGIGNL--RLATQHYCANVIKKMVLNKRYFGEEM  217



>gb|KCW62248.1| hypothetical protein EUGRSUZ_H04908 [Eucalyptus grandis]
Length=232

 Score = 91.7 bits (226),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            IAC R+G T+VI VT P++A+EFLKK+D+ F+SRP+ M+A   S GY++++  P G QW 
Sbjct  78   IACFRIGNTHVITVTDPKIAQEFLKKKDATFASRPILMAAQGFSGGYVTAVISPFGKQWK  137

Query  277  KMRRVLHSRVLSP  239
            KMRRVL S ++ P
Sbjct  138  KMRRVLTSEIICP  150


 Score = 72.4 bits (176),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 9/62 (15%)
 Frame = -1

Query  233  PP----LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRF  66
            PP    LHDKR EEANNLVK++++QC   G      VN R  TR YCGN+I ++VFNKR+
Sbjct  150  PPRHKWLHDKRAEEANNLVKHVFNQCKSLGQ-----VNLRHTTRHYCGNMIRRLVFNKRY  204

Query  65   FG  60
            FG
Sbjct  205  FG  206



>ref|XP_009780952.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=534

 Score =   111 bits (277),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPELA  FLK QDS+FSSRP+CMSA+L+SNGYL+   +P GDQW
Sbjct  89   EIACIRLGNVHVIPVTSPELACLFLKNQDSIFSSRPICMSANLVSNGYLNLGSVPMGDQW  148

Query  280  AKMRRVLHSRVLSPASLRF  224
             K RR++ S VLS  S ++
Sbjct  149  MKRRRIISSHVLSATSFQW  167


 Score = 52.4 bits (124),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN-VM  51
            L  KR EEA++L++++Y QC         V+N R VTR Y  NVI  M+F+KR  G  V 
Sbjct  168  LRHKRDEEADHLLRFVYHQC----INKCLVINLRKVTRYYSANVIKNMIFSKRLLGPLVE  223

Query  50   eeeeeEILKALFALLQ  3
             EEE+E + A+F LL+
Sbjct  224  SEEEDEQVDAIFTLLE  239



>ref|XP_006363576.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=506

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPELA EFLK QDSVFSSRP+CMSA LISN Y++SIFLP GDQW
Sbjct  67   EIACIRLGNVHVIPVTSPELACEFLKLQDSVFSSRPICMSASLISNSYITSIFLPIGDQW  126

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRR+L S VLSP+S ++
Sbjct  127  MKMRRILASHVLSPSSFQW  145



>ref|XP_003633447.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score = 99.0 bits (245),  Expect(2) = 8e-32, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+AREFLKK D+VF+SRP+ M++  +S G+L++   P G+QW
Sbjct  40   EIACIKLGNVHVIPVISPEIAREFLKKHDAVFASRPITMASHHLSRGFLTTALSPWGEQW  99

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ S VL P
Sbjct  100  KKMRRIIISEVLKP  113


 Score = 64.7 bits (156),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMH-----VVNARTVTRQYCGNVISKMVFNKRFF  63
            L  KR EEA+NLV++IY+QC  S     +     VVN R   RQY GNV+ KM+F++R+F
Sbjct  119  LLQKRTEEADNLVRFIYNQCKFSSITSHNITDSSVVNVRNAVRQYTGNVVRKMMFSRRYF  178

Query  62   GN  57
            G 
Sbjct  179  GE  180



>gb|KHN24730.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   100 bits (248),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVT P +A EFL+KQD+ F+SR   +S DLISNGY +++F P G QW
Sbjct  85   EIACIRLGNAYVIPVTCPTIASEFLRKQDATFASRSQTVSTDLISNGYSTAVFGPFGAQW  144

Query  280  AKMRRVLHSRVLSP  239
             KM+++L + +LSP
Sbjct  145  KKMKKILTNNLLSP  158


 Score = 62.8 bits (151),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQC-NI-SGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH +R EEA+NL+ ++Y++C N+  G GG+  VN R+V R YCGN+  K++FN R+FG
Sbjct  164  LHGQRTEEADNLMFHVYNKCKNVNDGVGGL--VNIRSVARHYCGNLTRKIIFNTRYFG  219



>ref|XP_003537358.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
Length=537

 Score =   100 bits (248),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  YVIPVT P +A EFL+KQD+ F+SR   +S DLISNGY +++F P G QW
Sbjct  85   EIACIRLGNAYVIPVTCPTIASEFLRKQDATFASRSQTVSTDLISNGYSTAVFGPFGAQW  144

Query  280  AKMRRVLHSRVLSP  239
             KM+++L + +LSP
Sbjct  145  KKMKKILTNNLLSP  158


 Score = 62.8 bits (151),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQC-NI-SGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LH +R EEA+NL+ ++Y++C N+  G GG+  VN R+V R YCGN+  K++FN R+FG
Sbjct  164  LHGQRTEEADNLMFHVYNKCKNVNDGVGGL--VNIRSVARHYCGNLTRKIIFNTRYFG  219



>gb|KDP45690.1| hypothetical protein JCGZ_17297 [Jatropha curcas]
Length=543

 Score = 94.7 bits (234),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P+++ E LK QD+ F++RP+ MS    S GYL++   P GDQW
Sbjct  91   EIACIRLGNVHVIPVTCPKISCELLKAQDANFATRPISMSTRFTSKGYLATALAPFGDQW  150

Query  280  AKMRRVLHSRVLSPASLR  227
             KMR VL +++LSPA  R
Sbjct  151  KKMRGVLVTQLLSPAKQR  168


 Score = 67.4 bits (163),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
             +  RVEEAN+LV+Y Y+QCN  G     +V+ R   + YCGNVI KM+FNKRFFG
Sbjct  170  FYGTRVEEANHLVRYAYNQCNEGG-----LVDVRVAAQHYCGNVIRKMMFNKRFFG  220



>dbj|BAP15883.1| cytochrome P450 79A68 [Prunus mume]
Length=533

 Score =   104 bits (260),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+AREFLKK D+VF+SRPV M+   +S+GYL+++  P GDQW
Sbjct  82   DIACIRLGNVHVIPVTSPEIAREFLKKNDAVFASRPVTMATKTLSSGYLTTVVGPWGDQW  141

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRVL +   +P+ + + +
Sbjct  142  RKMRRVLVAEAFNPSRVHWLL  162


 Score = 57.4 bits (137),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+NLVK++Y+QC+ +  G   VVN R   + Y G+++ KM+FN+ +FG
Sbjct  164  KRNEEADNLVKFLYNQCSANQNGA--VVNVRIAAQFYSGSIMRKMIFNRTYFG  214



>ref|XP_008241408.1| PREDICTED: isoleucine N-monooxygenase 2 [Prunus mume]
Length=533

 Score =   104 bits (260),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+AREFLKK D+VF+SRPV M+   +S+GYL+++  P GDQW
Sbjct  82   DIACIRLGNVHVIPVTSPEIAREFLKKNDAVFASRPVTMATKTLSSGYLTTVVGPWGDQW  141

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRVL +   +P+ + + +
Sbjct  142  RKMRRVLVAEAFNPSRVHWLL  162


 Score = 57.4 bits (137),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+NLVK++Y+QC+ +  G   VVN R   + Y G+++ KM+FN+ +FG
Sbjct  164  KRNEEADNLVKFLYNQCSANQNGA--VVNVRIAAQFYSGSIMRKMIFNRTYFG  214



>ref|XP_007207880.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
 gb|EMJ09079.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
Length=514

 Score = 95.1 bits (235),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRL   +VIPV+ P L+RE LKKQD+ F++RP+ +S  LI+ GY++++ +P G+QW
Sbjct  63   EIACIRLANVHVIPVSCPILSREILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  123  KKMRKVITSELLSP  136


 Score = 67.0 bits (162),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR+EEA++LV+Y+++QCN     G  +V+ R  T+ YC NVI +M+FN+R+F   M
Sbjct  142  LTDKRIEEADHLVRYVFNQCN--NEEGSGIVDLRLATQHYCANVIKRMIFNQRYFTEEM  198



>gb|ADM34983.1| CYP79D16 [Prunus dulcis]
Length=534

 Score = 95.1 bits (235),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRL   +VIPV+ P L+RE LKKQD+ F++RP+ +S  LI+ GY++++ +P G+QW
Sbjct  83   EIACIRLANVHVIPVSCPILSREILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQW  142

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  143  KKMRKVITSELLSP  156


 Score = 66.6 bits (161),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR+EEA++LV+Y+++QCN     G  +V+ R  T+ YC NVI +M+FN+R+F   M
Sbjct  162  LTDKRIEEADHLVRYVFNQCN--NEEGRGIVDLRLATQHYCANVIKRMIFNQRYFTEEM  218



>ref|XP_006492162.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=542

 Score = 90.5 bits (223),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F+SRP+ M  +  S G+LS   +P G+QW 
Sbjct  84   ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFASRPLTMGTEYSSRGFLSIAVVPWGEQWK  143

Query  277  KMRRVLHSRVLSPASLR  227
            KM++V+ S VL+ + LR
Sbjct  144  KMKKVVASHVLNSSRLR  160


 Score = 71.2 bits (173),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            +R EEA+NLV++IY+QC +S  G    V+ R  TRQYCGNV+ KM+FN+R+FG 
Sbjct  165  RRTEEADNLVRFIYNQCKVSPIGS--DVDVRLATRQYCGNVMRKMMFNRRYFGE  216



>ref|XP_007203073.1| hypothetical protein PRUPE_ppa023521mg, partial [Prunus persica]
 gb|EMJ04272.1| hypothetical protein PRUPE_ppa023521mg, partial [Prunus persica]
Length=493

 Score =   104 bits (259),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+AREFLKK D+VF+SRPV M+   +S+GYL+++  P GDQW
Sbjct  42   DIACIRLGNVHVIPVTSPEIAREFLKKNDAVFASRPVTMATKTLSSGYLTTVVGPWGDQW  101

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRVL +   +P+ + + +
Sbjct  102  RKMRRVLVADAFNPSRVHWLL  122


 Score = 57.4 bits (137),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+NLVK++Y+QC+ +  G   VVN R   + Y G+++ KM+FN+ +FG
Sbjct  124  KRNEEADNLVKFLYNQCSANQNGA--VVNVRIAAQFYSGSIMRKMIFNRTYFG  174



>gb|EMT15372.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=534

 Score = 92.8 bits (229),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC RLGG +V+P+T P++ARE LKKQD  F SRP+  ++D IS GY   +  P GDQW
Sbjct  77   DIACFRLGGVHVVPITCPKIAREVLKKQDKNFLSRPLTFASDAISCGYKDVVLTPFGDQW  136

Query  280  AKMRRVLHSRVLSPA  236
             KMR+VL S ++ P+
Sbjct  137  MKMRKVLTSEIICPS  151


 Score = 68.2 bits (165),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCN--ISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EA+NL +YIY+      S T G+  VN R VTR YCGNVI ++VF +R+FG 
Sbjct  156  LHDKRADEADNLTRYIYNLTTGGSSSTLGLANVNVRHVTRHYCGNVIRRLVFGQRYFGE  214



>ref|XP_008231301.1| PREDICTED: isoleucine N-monooxygenase 2-like [Prunus mume]
Length=534

 Score = 93.6 bits (231),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +VIPV+ P L+RE LKKQD+ F++RP+ +S  LI+ GY++++ +P G+QW
Sbjct  83   QIACIRLANVHVIPVSCPILSREILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQW  142

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  143  KKMRKVITSELLSP  156


 Score = 67.0 bits (162),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR+EEA++LV+Y+++QCN     G  +V+ R  T+ YC NVI +M+FN+R+F   M
Sbjct  162  LTDKRIEEADHLVRYVFNQCN--NDEGSGIVDLRLATQHYCANVIKRMIFNQRYFTEEM  218



>ref|XP_006480303.1| PREDICTED: uncharacterized protein LOC102610907 [Citrus sinensis]
Length=1231

 Score = 89.7 bits (221),  Expect(2) = 7e-31, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+A E LK  DS F++RP+ M  +  S G+LS   +P G QW
Sbjct  770  DIACIRLGNVHVIPVTSPEIALEALKDNDSTFATRPLTMGTEYSSRGFLSIAVVPLGQQW  829

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S VL  A L
Sbjct  830  KKMRKVVASHVLCSARL  846


 Score = 70.9 bits (172),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV+++Y+QC  SG+G   VVN R   RQYCGNV+  M+FN+R+FG 
Sbjct  852  KRREEADNLVRFVYNQCCKSGSGS--VVNVRHAARQYCGNVMRNMMFNRRYFGE  903



>ref|XP_006435922.1| hypothetical protein CICLE_v10031307mg [Citrus clementina]
 gb|ESR49162.1| hypothetical protein CICLE_v10031307mg [Citrus clementina]
Length=503

 Score = 89.0 bits (219),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  43   ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  102

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  103  KMRKMVASHVLSSARL  118


 Score = 70.9 bits (172),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  124  KRREEADNLVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  176



>ref|XP_006435920.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
 gb|ESR49160.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
Length=502

 Score = 89.0 bits (219),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  43   ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  102

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  103  KMRKMVASHVLSSARL  118


 Score = 70.9 bits (172),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  124  KRREEADNLVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  176



>ref|XP_006363575.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine N-monooxygenase-like 
[Solanum tuberosum]
Length=518

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVTSPELA EFLK QDSVFSSRP+CMSA LISN Y++SIFLP GDQW
Sbjct  80   EIACIRLGNVHVIPVTSPELACEFLKIQDSVFSSRPICMSASLISNSYITSIFLPIGDQW  139

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMR +L S VLSP S ++
Sbjct  140  MKMRGILASHVLSPTSFQW  158



>gb|EMT13826.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=534

 Score = 95.5 bits (236),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC RLGG +VIP+T P++ARE LKKQD  F SRP+  ++D IS GY  ++  P GDQW
Sbjct  77   DIACFRLGGVHVIPITCPKIAREVLKKQDKNFLSRPLTFASDAISCGYKDAVLTPVGDQW  136

Query  280  AKMRRVLHSRVLSPA  236
             KMR+VL S ++ P+
Sbjct  137  MKMRKVLTSEIICPS  151


 Score = 63.2 bits (152),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNI--SGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            LHDKR +EA+NL +YIY+   +  S T G+  +N R VT+ YCGNVI ++ F +R+F
Sbjct  156  LHDKRADEADNLTRYIYNLTAVGSSSTLGLANINVRHVTQHYCGNVIRRLAFGQRYF  212



>ref|XP_004509432.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score = 85.1 bits (209),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VI V+SP++AREF  KQD++F+SRP+  S + I  G++++   P GDQW
Sbjct  84   EIACIRLGNIHVILVSSPQIAREFFIKQDAIFASRPISWSNEYIG-GFMTTALSPFGDQW  142

Query  280  AKMRRVLHSRVLSP  239
             KM++++ + ++SP
Sbjct  143  KKMKKIISNEIVSP  156


 Score = 73.9 bits (180),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRV+EA+NLV+Y+Y+QC  +G     +VN R V RQY GNVI +++FN R+FGN
Sbjct  162  LHDKRVKEADNLVRYVYNQCKKNGG----LVNVRDVARQYSGNVIRRLIFNIRYFGN  214



>ref|XP_006367899.1| PREDICTED: isoleucine N-monooxygenase 2-like [Solanum tuberosum]
Length=485

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 5/87 (6%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+G  +VIPVTSPELA EFLK  DS+FSSRP+CMSA+L+SNGYL+SIFLP+GDQW
Sbjct  84   EIACIRVGNYHVIPVTSPELACEFLKIHDSIFSSRPICMSANLVSNGYLTSIFLPSGDQW  143

Query  280  AKMRRVLHSRVLSPASLRFTIKGWKKP  200
             KM+ +L S VLSP S +     W +P
Sbjct  144  MKMKNMLTSHVLSPKSFQ-----WLRP  165


 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 11/85 (13%)
 Frame = -1

Query  254  PRAFSGEPPLHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFN  75
            P++F     L  KR EEA++L +++Y+QC         V+N R VTR YCGNVI  M+F+
Sbjct  157  PKSFQW---LRPKRDEEADHLHRFVYNQC-----SNQLVINLREVTRYYCGNVIRNMIFS  208

Query  74   KR-FFGNVMeeeeeEILKALFALLQ  3
            KR  FG + E+EE+    ALF +L+
Sbjct  209  KRSLFGIIEEQEEQ--FDALFTILE  231



>ref|XP_006435921.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
 gb|ESR49161.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
Length=569

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  110  ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  169

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  170  KMRKMVASHVLSSARL  185


 Score = 70.5 bits (171),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  191  KRREEADNLVRFIYNQCRESASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  243



>ref|XP_006486168.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=482

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  62   ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  121

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  122  KMRKMVASHVLSSARL  137


 Score = 70.5 bits (171),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  143  KRREEADNLVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  195



>ref|XP_003556848.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
Length=523

 Score = 99.8 bits (247),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +AREFL+KQD+ F+SRP  ++  LIS GYLS+  +P G+QW
Sbjct  71   EIACIRLGNVHVIPVTCPTIAREFLRKQDATFASRPNSITTSLISRGYLSTTLVPFGEQW  130

Query  280  AKMRRVLHSRVLSPAS  233
             KMRR++ + +LS  +
Sbjct  131  KKMRRIVSNDLLSTTT  146


 Score = 58.9 bits (141),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L +KRVEEA+NLV YIY++C  +    + +VN R V + Y  NVI K++F+ R+FG
Sbjct  150  LENKRVEEADNLVFYIYNKCKNNVNDNVCLVNVRYVAQHYSCNVIKKLIFSTRYFG  205



>ref|XP_007134794.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
 gb|ESW06788.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
Length=533

 Score = 92.0 bits (227),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG TYVIPV  P +AREFL +QD+ F+SR +    DL+S+ YL++I +P G+QW
Sbjct  80   EIACIRLGNTYVIPVICPTIAREFLSEQDATFASRSLTPCTDLVSSRYLTTILVPFGEQW  139

Query  280  AKMRRVLHSRVLS  242
             KM+++L + +LS
Sbjct  140  KKMKKILSTALLS  152


 Score = 66.6 bits (161),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNI--SGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNV  54
            LHDKR EEA+NL+ Y+Y++      G GG+  VN R+V R YC NVI K+VFN R+FG  
Sbjct  159  LHDKRTEEADNLMFYVYNKSITVKDGVGGL--VNIRSVARLYCANVIRKIVFNTRYFGKG  216

Query  53   M  51
            M
Sbjct  217  M  217



>dbj|BAP15884.1| cytochrome P450 79D16 [Prunus mume]
Length=534

 Score = 91.7 bits (226),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL   +V PV+ P L+RE LKKQD+ F++RP+ +S  LI+ GY++++ +P G+QW
Sbjct  83   QIACIRLANVHVTPVSCPILSREILKKQDATFATRPLSISTFLITKGYITTVMVPFGEQW  142

Query  280  AKMRRVLHSRVLSP  239
             KMR+V+ S +LSP
Sbjct  143  KKMRKVITSELLSP  156


 Score = 67.0 bits (162),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR+EEA++LV+Y+++QCN     G  +V+ R  T+ YC NVI +M+FN+R+F   M
Sbjct  162  LTDKRIEEADHLVRYVFNQCN--NDEGSGIVDLRLATQHYCANVIKRMIFNQRYFTEEM  218



>gb|EMT08477.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=514

 Score = 91.7 bits (226),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I C RLG  +V+P+T P++ARE LKKQD  FSSRP+  ++  IS+GY  ++  P GDQW
Sbjct  42   DITCFRLGSVHVVPITCPKIAREVLKKQDKNFSSRPLTFASGAISSGYKDAVLSPFGDQW  101

Query  280  AKMRRVLHSRVLSPA  236
             KMR+VL S ++ P+
Sbjct  102  MKMRKVLTSEIICPS  116


 Score = 67.0 bits (162),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCN---ISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EA+NL +YIY+       S T G+  +N R V R YCGNVI ++VF +R+FG 
Sbjct  121  LHDKRADEADNLTRYIYNLTTGGLSSSTSGLANINVRHVARHYCGNVIRRLVFGQRYFGE  180



>gb|KDO39922.1| hypothetical protein CISIN_1g035533mg [Citrus sinensis]
Length=503

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  ++IPVTSP++A E LK  DS F++RP+ M  +  S G+LS   +P G QW
Sbjct  56   DIACIRLGNVHIIPVTSPKIALEVLKDNDSTFATRPLTMGTEYSSRGFLSIAVVPLGQQW  115

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S VL  A L
Sbjct  116  KKMRKVVASHVLCSARL  132


 Score = 70.5 bits (171),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV+++Y+QC  SG+G   VVN R   RQYCGNV+  M+FN+R+FG 
Sbjct  138  KRREEADNLVRFVYNQCCKSGSGS--VVNVRHAARQYCGNVMRNMMFNRRYFGE  189



>ref|XP_006428266.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
 gb|ESR41506.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
Length=508

 Score = 87.8 bits (216),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIR G  +VIPVTSPE+A E LK  DS F++RP+ M  +  S G+LS   +P G QW
Sbjct  47   DIACIRQGNVHVIPVTSPEIALEVLKDNDSTFATRPLTMGTEYSSRGFLSIAVVPLGQQW  106

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S VL  A L
Sbjct  107  KKMRKVVASHVLCSARL  123


 Score = 70.9 bits (172),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV+++Y+QC  SG+G   VVN R   RQYCGNV+  M+FN+R+FG 
Sbjct  129  KRREEADNLVRFVYNQCCKSGSGS--VVNVRHAARQYCGNVMRNMMFNRRYFGE  180



>ref|XP_006420514.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|ESR33754.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|KDO43050.1| hypothetical protein CISIN_1g009152mg [Citrus sinensis]
Length=542

 Score = 90.5 bits (223),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIRLG  +VIPVTSPE+A E LK  DS+F+SRP+ M  +  S G+LS   +P G+QW 
Sbjct  84   ISCIRLGNVHVIPVTSPEIALEVLKDNDSIFASRPLTMGTEYSSRGFLSIAVVPWGEQWK  143

Query  277  KMRRVLHSRVLSPASLR  227
            KM++V+ S VL+ + LR
Sbjct  144  KMKKVVASHVLNSSRLR  160


 Score = 67.8 bits (164),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            +R EEA+NLV++IY+QC  S  G    V+ R  TRQYCGNV+ KM+FN+R+FG 
Sbjct  165  RRTEEADNLVRFIYNQCKDSPIG--LDVDVRLATRQYCGNVMRKMMFNRRYFGE  216



>ref|XP_002274920.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score = 93.6 bits (231),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPV SPE+ARE LK+ D+VF+SRP+ M++  +S G+L++   P G+QW
Sbjct  40   EIACIKLGNVHVIPVISPEIAREILKEHDAVFASRPITMASHHLSRGFLTTALSPWGEQW  99

Query  280  AKMRRVLHSRVLSP  239
             KMRR + S VL P
Sbjct  100  KKMRRTIISEVLKP  113


 Score = 64.7 bits (156),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMH-----VVNARTVTRQYCGNVISKMVFNKRFF  63
            L  KR EEA+NLV++IY+QC  S     +     VVN R   RQY GNV+ KM+F++R+F
Sbjct  119  LLQKRTEEADNLVRFIYNQCKFSSITSHNFTDSSVVNVRNAVRQYTGNVVRKMMFSRRYF  178

Query  62   GN  57
            G 
Sbjct  179  GE  180



>ref|XP_002466099.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
 sp|Q43135.3|C79A1_SORBI RecName: Full=Tyrosine N-monooxygenase; AltName: Full=Cytochrome 
P450 79A1; AltName: Full=Cytochrome P450Tyr [Sorghum bicolor]
 gb|AAA85440.1| cytochrome P-450 [Sorghum bicolor]
 gb|EER93097.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
Length=558

 Score = 89.7 bits (221),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC++LGG +V+ +T PE+ARE L+KQD+ F SRP+  +++  S GY +++  P GDQW
Sbjct  104  DIACVKLGGVHVVSITCPEIAREVLRKQDANFISRPLTFASETFSGGYRNAVLSPYGDQW  163

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++ P+
Sbjct  164  KKMRRVLTSEIICPS  178


 Score = 68.2 bits (165),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EA+NL +Y+Y+    + TG +  V+ R V R YCGNVI +++FN+R+FG 
Sbjct  183  LHDKRTDEADNLTRYVYNLATKAATGDV-AVDVRHVARHYCGNVIRRLMFNRRYFGE  238



>ref|XP_010543679.1| PREDICTED: phenylalanine N-monooxygenase [Tarenaya hassleriana]
Length=536

 Score =   103 bits (256),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRL  T+VIPVTSP +AREFLKKQDSVF+SRP+ M  +  S GYL+   +P G+QW
Sbjct  80   EIACIRLANTHVIPVTSPRIAREFLKKQDSVFASRPLTMGTEYCSRGYLTIAVVPQGEQW  139

Query  280  AKMRRVLHSRVLSPASLRFT  221
             KMR+++ S V++  +L++T
Sbjct  140  KKMRKMVASHVINAKTLQWT  159


 Score = 54.7 bits (130),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  224  HDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            H+KR+EEA+NL ++I ++C  +      +++ R VTRQY GNV  K++F  R FG
Sbjct  160  HEKRIEEADNLTRFINNKCVRNSRDCSALIDLRLVTRQYSGNVARKILFGVRHFG  214



>ref|XP_006486508.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=502

 Score = 87.4 bits (215),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIR G  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  43   ISCIRFGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  102

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  103  KMRKMVASHVLSSARL  118


 Score = 70.9 bits (172),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  124  KRREEADNLVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  176



>gb|KHN48839.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=473

 Score = 98.2 bits (243),  Expect(2) = 5e-30, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +AREFL+KQD+ F+SRP  ++  LIS GYL++  +P G+QW
Sbjct  21   EIACIRLGNVHVIPVTCPTIAREFLRKQDATFASRPNSITTSLISRGYLTTTLVPFGEQW  80

Query  280  AKMRRVLHSRVLSPAS  233
             KMRR++ + +LS  +
Sbjct  81   KKMRRIVSNDLLSTTT  96


 Score = 58.9 bits (141),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L +KRVEEA+NLV YIY++C  +    + +VN R V + Y  NVI K++F+ R+FG
Sbjct  100  LENKRVEEADNLVFYIYNKCKNNVNDNVCLVNVRYVAQHYSCNVIKKLIFSTRYFG  155



>ref|XP_002438593.1| hypothetical protein SORBIDRAFT_10g022470 [Sorghum bicolor]
 gb|EER89960.1| hypothetical protein SORBIDRAFT_10g022470 [Sorghum bicolor]
Length=547

 Score = 91.3 bits (225),  Expect(2) = 6e-30, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI+LGG +VIP+T P++A E LK QD+ F+SRP+ M++  +S  Y  ++  P GDQW
Sbjct  85   DIACIKLGGVHVIPITCPKIALEVLKNQDANFASRPLTMASKTLSRSYRDAVMCPYGDQW  144

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S V+ P+  R+
Sbjct  145  KKMRRVLASEVVCPSRHRW  163


 Score = 65.9 bits (159),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR +EA+NL +Y+Y+    SG+G   VV+ R + R YCGN++ ++VFN R+FG
Sbjct  164  LHDKRADEADNLTRYVYNLAK-SGSG---VVDVRHIARHYCGNIVRRLVFNTRYFG  215



>ref|XP_006486167.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=521

 Score = 87.4 bits (215),  Expect(2) = 7e-30, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIR G  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  62   ISCIRFGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  121

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  122  KMRKMVASHVLSSARL  137


 Score = 69.7 bits (169),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+N+V++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG
Sbjct  143  KRREEADNIVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFG  194



>ref|XP_006435923.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
 gb|ESR49163.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
Length=501

 Score = 87.4 bits (215),  Expect(2) = 8e-30, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I+CIR G  +VIPVTSPE+A E LK  DS+F++RP+ M  +  S G+LS   +P G QW 
Sbjct  43   ISCIRFGNVHVIPVTSPEIALEVLKDNDSIFATRPLTMGTEYSSRGFLSVAVVPWGQQWK  102

Query  277  KMRRVLHSRVLSPASL  230
            KMR+++ S VLS A L
Sbjct  103  KMRKMVASHVLSSARL  118


 Score = 69.7 bits (169),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+N+V++IY+QC  S +    VV+ R  TR YCGNVI KM+FN+R+FG 
Sbjct  124  KRREEADNIVRFIYNQCRKSASAAT-VVDVRLATRHYCGNVIRKMMFNRRYFGE  176



>ref|XP_006437149.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
 gb|ESR50389.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
Length=621

 Score = 88.6 bits (218),  Expect(2) = 8e-30, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+A E LK  DSVF++RP+ M  +  S  +LS   +P G QW
Sbjct  164  DIACIRLGNVHVIPVTSPEIALEVLKDNDSVFATRPLTMGTEYSSRRFLSIAVVPLGQQW  223

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S VL  A L
Sbjct  224  KKMRKVVASHVLCSARL  240


 Score = 68.2 bits (165),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV+++Y QC   G+G   VVN R   RQYCGNV+  M+FN+R+FG 
Sbjct  246  KRREEADNLVRFVYSQCCKRGSGS--VVNVRHAARQYCGNVMRNMMFNRRYFGE  297



>ref|XP_006484922.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=556

 Score = 88.6 bits (218),  Expect(2) = 8e-30, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVTSPE+A E LK  DSVF++RP+ M  +  S  +LS   +P G QW
Sbjct  99   DIACIRLGNVHVIPVTSPEIALEVLKDNDSVFATRPLTMGTEYSSRRFLSIAVVPLGQQW  158

Query  280  AKMRRVLHSRVLSPASL  230
             KMR+V+ S VL  A L
Sbjct  159  KKMRKVVASHVLCSARL  175


 Score = 68.2 bits (165),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+NLV+++Y QC   G+G   VVN R   RQYCGNV+  M+FN+R+FG 
Sbjct  181  KRREEADNLVRFVYSQCCKRGSGS--VVNVRHAARQYCGNVMRNMMFNRRYFGE  232



>gb|KDP45692.1| hypothetical protein JCGZ_17299 [Jatropha curcas]
Length=465

 Score = 95.1 bits (235),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC+R+G  +VIPV+ P+++ EFLK QDS F++RP+ MS  + S GYL+++  P GDQW
Sbjct  73   EIACVRIGNVHVIPVSCPKISCEFLKAQDSNFATRPITMSTRVTSKGYLTTVLTPYGDQW  132

Query  280  AKMRRVLHSRVLSPA  236
             KM+R+L +++LSPA
Sbjct  133  KKMKRILVTQMLSPA  147


 Score = 60.8 bits (146),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
            KRVE A++LV+Y+Y QC+  G     +V+ R   R YCGNVI KMVFNKR
Sbjct  155  KRVEGADHLVRYVYKQCSEGG-----LVDVRIAARHYCGNVIRKMVFNKR  199



>gb|EMT03570.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=831

 Score = 92.4 bits (228),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC RLGG +V+ +T P++ARE LKKQD  FSSRP+  ++  IS+GY  ++  P GDQW
Sbjct  78   DIACFRLGGVHVVSITCPKIAREVLKKQDKNFSSRPLTFASGAISSGYKDAVLSPFGDQW  137

Query  280  AKMRRVLHSRVLSPA  236
             KMR+VL S ++ P+
Sbjct  138  MKMRKVLTSEIICPS  152


 Score = 63.2 bits (152),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCN---ISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EA+NL +YIY+       S T  +  VN R V R YCGNVI ++VF +R+FG 
Sbjct  157  LHDKRADEADNLTRYIYNLTARGLSSSTSRLANVNVRHVARHYCGNVIRRLVFGQRYFGE  216



>sp|Q6J540.1|C79D4_LOTJA RecName: Full=Isoleucine N-monooxygenase 2; AltName: Full=Cytochrome 
P450 79D4 [Lotus japonicus]
 gb|AAT11921.1| cytochrome P450 [Lotus japonicus]
Length=536

 Score = 96.3 bits (238),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRL  T VIPVT P +A EFLKK D+ F+SRP  MS D+ S+G+L+++ +P G+QW
Sbjct  81   EIACIRLANTIVIPVTCPTIACEFLKKHDASFASRPKIMSTDIASDGFLTTVLVPYGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  141  KKMKRVLVNNLLSP  154


 Score = 58.5 bits (140),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NL+ YIY++C      G  +VN R   + Y GNV  K++FN R+FG VM
Sbjct  163  KRNEEADNLMFYIYNKCCKDVNDGPGLVNIRIAAQHYGGNVFRKLIFNTRYFGKVM  218



>gb|KDP45703.1| hypothetical protein JCGZ_17310 [Jatropha curcas]
Length=519

 Score = 95.9 bits (237),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P+++ E LK QDS F++RP+ MS  + S GYL+++  P GDQW
Sbjct  67   EIACIRLGNVHVIPVTCPKISCEILKAQDSNFATRPITMSTRVTSKGYLTTVLAPYGDQW  126

Query  280  AKMRRVLHSRVLSPA  236
             KM+R+L +++LSPA
Sbjct  127  KKMKRILVTQMLSPA  141


 Score = 59.3 bits (142),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 11/59 (19%)
 Frame = -1

Query  245  FSGEPPLHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
            FSG      KRVE A++LV+Y+Y QC+  G     +V+ R   R YCGNVI KMVFNKR
Sbjct  146  FSG------KRVEGADHLVRYVYKQCSEGG-----LVDVRIAARHYCGNVIRKMVFNKR  193



>gb|AHY21766.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21775.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21776.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21777.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 94.7 bits (234),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSADL S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADLASYGFNTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21764.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21771.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21765.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21769.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21770.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACB15194.1| cytochrome P450 [Trifolium isthmocarpum]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>ref|XP_004237224.2| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=517

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIR+G  +VIPVTSPELA EFLK QDS+FS RP+CMSA L+SNGYL+ IF+P+GDQW
Sbjct  74   EIACIRVGNYHVIPVTSPELACEFLKGQDSIFSFRPLCMSASLVSNGYLTPIFVPSGDQW  133

Query  280  AKMRRVLHSRVLSPASLRF  224
             KM+++L S VLSP S ++
Sbjct  134  MKMKKILTSHVLSPTSFQW  152


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = -1

Query  254  PRAFSGEPPLHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFN  75
            P +F     LH KR EEA++L + +Y+QC+        V+N R VTR +CGNVI  M+F+
Sbjct  147  PTSFQW---LHCKRKEEADHLHRLVYNQCS-----NQLVINLREVTRYHCGNVIRNMIFS  198

Query  74   KRFFGNVMeeeeeEILKALFALLQ  3
            KR    ++E++EE+I  A+F L++
Sbjct  199  KRSLFGIIEQDEEQI-DAVFTLIE  221



>gb|KEH34365.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score = 94.0 bits (232),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  ++IPVT P +ARE L+K D+ F+SRP  M++ +IS+GYL+S   P G+QW
Sbjct  83   EIACIRLGNVHIIPVTCPTIAREILRKHDADFASRPTTMASGIISSGYLTSAIAPFGEQW  142

Query  280  AKMRRVLHSRVLSPASLRF  224
             KM++++ + +LSP   R+
Sbjct  143  KKMKKIIVNDLLSPQRYRW  161


 Score = 60.5 bits (145),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR EEA+NL+ Y+Y++CN        +V+ R  ++ YCGNV  KM FN R+FG  M
Sbjct  162  LQDKRNEEADNLIFYVYNKCN-----NGDLVSVRLASQHYCGNVYRKMYFNTRYFGKGM  215



>sp|Q6J541.1|C79D3_LOTJA RecName: Full=Isoleucine N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79D3 [Lotus japonicus]
 gb|AAT11920.1| cytochrome P450 [Lotus japonicus]
Length=535

 Score = 95.5 bits (236),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRL  T VIPVT P +A EFLKK D+ F+SRP  MS D+ S+G+++++ +P G+QW
Sbjct  81   EIACIRLANTIVIPVTCPTIACEFLKKHDASFASRPKIMSTDIASDGFITTVLVPYGEQW  140

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  141  KKMKRVLVNNLLSP  154


 Score = 58.9 bits (141),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NL+ YIY++C      G  +VN R   + Y GNV  K++FN R+FG VM
Sbjct  163  KRNEEADNLMFYIYNKCCKDVNDGPGLVNIRIAAQHYGGNVFRKLIFNSRYFGKVM  218



>ref|XP_007203677.1| hypothetical protein PRUPE_ppa026605mg, partial [Prunus persica]
 gb|EMJ04876.1| hypothetical protein PRUPE_ppa026605mg, partial [Prunus persica]
Length=498

 Score = 94.7 bits (234),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI+LG  +VIPV SPE+AREFLKK D+VF+SRPV M+ +L+S+G+L++  +P G QW
Sbjct  48   DIACIKLGNVHVIPVKSPEIAREFLKKNDAVFASRPVTMATELLSSGFLTTGVVPWGGQW  107

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMR+VL + V + + +++ +
Sbjct  108  KKMRKVLIADVFNHSMVQWLV  128


 Score = 59.3 bits (142),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+NLVK++Y+QC+ +  G   VVN RT  + Y G V+ +M+FN R+FG
Sbjct  130  KRNEEADNLVKFLYNQCSSNPNGS--VVNVRTAAQFYSGGVMRRMIFNTRYFG  180



>gb|AHY21797.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score = 94.4 bits (233),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLINNLLSP  136


 Score = 59.7 bits (143),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  KMVFNKR+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNG---LVNIRTAAQHYGGNVFRKMVFNKRYFGKGM  197



>gb|AHY21794.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score = 94.4 bits (233),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLINNLLSP  136


 Score = 59.7 bits (143),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  KMVFNKR+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNG---LVNIRTAAQHYGGNVFRKMVFNKRYFGKGM  197



>ref|XP_004509509.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score = 80.1 bits (196),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CIRLG  +VI V+SPE+ARE   KQD++F+SR    S   I++GYL++IF P G QW
Sbjct  84   EITCIRLGKVHVILVSSPEIAREVFIKQDAIFASRANSWSNAYITSGYLATIFTPFGKQW  143

Query  280  AKMRRVLHSRVLSPASLR  227
             KM++++ + ++S  SLR
Sbjct  144  KKMKKLIVTELVS--SLR  159


 Score = 73.6 bits (179),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LH KRVEEA+NLV+++Y+QCN +G     +VN R V+RQY GNVI +++FN R+FGN
Sbjct  163  LHGKRVEEADNLVRHVYNQCNKNGG----LVNVRDVSRQYSGNVIRRLIFNTRYFGN  215



>ref|XP_007011293.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20103.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score = 87.0 bits (214),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I C+RL  T+V+ VTSP +AREFLKK DSVF+SRPV M+ +  S  +L+   +P GDQW
Sbjct  97   DILCVRLASTHVVAVTSPAIAREFLKKNDSVFASRPVTMATEYSSRRFLTIAVVPWGDQW  156

Query  280  AKMRRVLHSRVLSPASLR  227
             KMRRV+   ++S + L 
Sbjct  157  KKMRRVVTCEIVSASKLH  174


 Score = 67.0 bits (162),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISG---TGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L + R EEA+NLV++IY+QC  +G   +    VVN R   RQY GNVI KM+FN+R+FG 
Sbjct  176  LLENRTEEADNLVRFIYNQCKSNGGDNSTASAVVNLRLAMRQYSGNVIRKMIFNRRYFGE  235



>ref|XP_010110140.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
 gb|EXC25309.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
Length=482

 Score = 99.4 bits (246),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  460  EIACIRL-GGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            +IAC RL G ++VI VTSPE+AREFLKK D+VF+ RP  M+  ++S GYL++   P G+Q
Sbjct  31   DIACFRLVGNSHVIAVTSPEIAREFLKKHDAVFALRPETMATCIVSKGYLTTALCPGGEQ  90

Query  283  WAKMRRVLHSRVLSPASLRFTI  218
            W KMRR+L S VLSP+++R+ +
Sbjct  91   WKKMRRILASHVLSPSTMRWLL  112


 Score = 54.7 bits (130),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L D R +EA+NLV+Y+Y+QC+ +  G   VVN RT  + Y  N + +M+F +R+FG
Sbjct  111  LLDMRNQEADNLVRYLYNQCSKNLKGD--VVNVRTAAQHYPANAMRRMMFGRRYFG  164



>gb|AHF22089.1| CYP79D33 [Maesa lanceolata]
Length=550

 Score = 89.4 bits (220),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CIRLG  +VI VT+PE+A EFLK+QD VFSSRP+ +   + S GY ++   P G+QW
Sbjct  97   EIICIRLGNVHVIAVTAPEIALEFLKQQDIVFSSRPISLPPKIASGGYKTTALSPWGEQW  156

Query  280  AKMRRVLHSRVLS  242
             KMRRVL S VLS
Sbjct  157  KKMRRVLASEVLS  169


 Score = 64.3 bits (155),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR EE+++LV+Y+Y+QC++ G     VVN R  T+ YCGN+I K++F +RFFG
Sbjct  176  LQCKRDEESDHLVRYVYNQCHMKGG----VVNVRIATQHYCGNMIRKIIFGRRFFG  227



>gb|AHY21767.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21768.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
 gb|AHY21772.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 94.0 bits (232),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + V+PVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21763.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 93.6 bits (231),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + V+PVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACB15193.1| cytochrome P450 [Trifolium isthmocarpum]
Length=509

 Score = 94.0 bits (232),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + V+PVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21773.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 93.6 bits (231),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFNTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 60.1 bits (144),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AJD25192.1| cytochrome P450 CYP79D40 [Salvia miltiorrhiza]
Length=522

 Score = 98.2 bits (243),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI C+RLGG +VI V SPEL+REFLKK D+ F+SRP  +SA LIS+GY + I  P G+QW
Sbjct  76   EILCVRLGGVHVIAVASPELSREFLKKHDAAFASRPDAVSARLISDGYSALILSPAGEQW  135

Query  280  AKMRRVLHSRVLSPASLR  227
             KMRRV+ S VL+    R
Sbjct  136  KKMRRVMVSEVLAAGVFR  153


 Score = 55.5 bits (132),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 7/59 (12%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
             H  R EEA++LV+Y+Y + N         VN R   R YC N+I KMVF +RFFG  M
Sbjct  155  FHSTRREEADHLVRYVYSRRN-------GAVNVRDAARHYCANLIRKMVFGERFFGAGM  206



>ref|XP_003629157.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03633.1| cytochrome P450 family protein [Medicago truncatula]
Length=527

 Score = 85.5 bits (210),  Expect(2) = 8e-29, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VI ++ PE+ARE   KQD++F+SRP   S + ++NGYL++   P G+QW
Sbjct  76   DIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQW  135

Query  280  AKMRRVLHSRVLSP  239
             K+++V+ + ++SP
Sbjct  136  KKVKKVISNELVSP  149


 Score = 68.2 bits (165),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+N+V+Y+Y++C  +  GG  +VN     + Y GNVI +++ NKR+FGN
Sbjct  155  LHDKRVEEADNIVRYVYNKC--TKIGGDGIVNVSVAAQYYSGNVIRRLLLNKRYFGN  209



>ref|XP_003629158.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03634.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score = 85.1 bits (209),  Expect(2) = 8e-29, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VI ++ PE+ARE   KQD++F+SRP   S + ++NGYL++   P G+QW
Sbjct  80   DIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQW  139

Query  280  AKMRRVLHSRVLSP  239
             K+++V+ + ++SP
Sbjct  140  KKVKKVISNELVSP  153


 Score = 68.2 bits (165),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+N+V+Y+Y++C  +  GG  +VN     + Y GNVI +++ NKR+FGN
Sbjct  159  LHDKRVEEADNIVRYVYNKC--TKIGGDGIVNVSVAAQYYSGNVIRRLLLNKRYFGN  213



>ref|XP_010045992.1| PREDICTED: valine N-monooxygenase 1-like [Eucalyptus grandis]
Length=499

 Score = 92.4 bits (228),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVT PE+A+EFLKK D+ FSSRP  M+  + S GYL++   P G+Q 
Sbjct  81   DIACIRLGNVHVIPVTCPEIAQEFLKKHDATFSSRPTSMATRIYSRGYLTAGITPYGNQS  140

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S  +SPA
Sbjct  141  KKMRRVLVSEKISPA  155


 Score = 60.8 bits (146),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L DKR  EA+NLV+YIY++   S +G    VN RTVTRQY GNVI K+VF KR  G
Sbjct  160  LMDKRTGEADNLVRYIYNRSK-SSSG---TVNVRTVTRQYTGNVIRKLVFGKRCIG  211



>gb|ACG50668.1| cytochrome P450 CYP79A2 [Brassica rapa subsp. chinensis]
Length=326

 Score = 93.2 bits (230),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI L  T VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  73   DIACIPLANTNVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQW  132

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S ++T++
Sbjct  133  KKMRRVVASHVTSQKSFKWTLE  154


 Score = 60.1 bits (144),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +KR EEA+NL++YI + C  +   G  V++ R V RQYCGN+  KM+F  R FG
Sbjct  154  EKRTEEADNLIRYINNLCVKNQGNGFEVIDLRLVVRQYCGNIARKMLFGVRHFG  207



>gb|KCW84703.1| hypothetical protein EUGRSUZ_B01522 [Eucalyptus grandis]
Length=488

 Score = 92.4 bits (228),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VIPVT PE+A+EFLKK D+ FSSRP  M+  + S GYL++   P G+Q 
Sbjct  75   DIACIRLGNVHVIPVTCPEIAQEFLKKHDATFSSRPTSMATRIYSRGYLTAGITPYGNQS  134

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S  +SPA
Sbjct  135  KKMRRVLVSEKISPA  149


 Score = 60.8 bits (146),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L DKR  EA+NLV+YIY++   S +G    VN RTVTRQY GNVI K+VF KR  G
Sbjct  154  LMDKRTGEADNLVRYIYNRSK-SSSG---TVNVRTVTRQYTGNVIRKLVFGKRCIG  205



>gb|AHY21754.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21756.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21759.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 95.5 bits (236),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL S +LSP
Sbjct  123  KKMKRVLVSNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21761.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 95.5 bits (236),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL S +LSP
Sbjct  123  KKMKRVLVSNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21753.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 95.5 bits (236),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL S +LSP
Sbjct  123  KKMKRVLVSNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>ref|XP_004509430.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=531

 Score = 79.0 bits (193),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CIRLG  +VI V+SPE+ARE   KQD++F+SR    S   I++GYL++IF P G QW
Sbjct  84   EITCIRLGKVHVILVSSPEIAREVFIKQDAIFASRANSWSNAYITSGYLATIFTPFGKQW  143

Query  280  AKMRRVLHSRVLSPASLR  227
             KM++++   ++S  SLR
Sbjct  144  KKMKKLIVKELVS--SLR  159


 Score = 73.9 bits (180),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LH KRVEEA+NLV+++Y+QCN +G     +VN R V+RQY GNVI +++FN R+FGN
Sbjct  163  LHGKRVEEADNLVRHVYNQCNKNGG----LVNVRDVSRQYSGNVIRRLIFNTRYFGN  215



>ref|XP_003629369.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03845.1| cytochrome P450 family protein [Medicago truncatula]
Length=530

 Score = 86.3 bits (212),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VI ++ PE+ARE   KQD++F+SRP   S + ++NGYL++   P G+QW
Sbjct  80   DIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQW  139

Query  280  AKMRRVLHSRVLSP  239
             K+++V+ + ++SP
Sbjct  140  KKVKKVISNELVSP  153


 Score = 66.6 bits (161),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+N+V+Y+Y++C  +  GG  +VN     + Y G+VI +++ NKR+FGN
Sbjct  159  LHDKRVEEADNIVRYVYNKC--TKIGGDGIVNVSVAAQYYSGDVIRRLLLNKRYFGN  213



>ref|XP_004966053.1| PREDICTED: tyrosine N-monooxygenase-like [Setaria italica]
Length=545

 Score = 94.0 bits (232),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC++LGG +VIP+T P +ARE LKKQD+ F+ RP+ +++   S GY+ ++  P GDQW
Sbjct  89   DIACVKLGGVHVIPITCPMIAREVLKKQDANFACRPLSLASKTFSRGYMDAVMSPYGDQW  148

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S V+ P+  R+
Sbjct  149  RKMRRVLASEVVCPSRHRW  167


 Score = 58.9 bits (141),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR  EA+NL +++Y+        G   V+ R V R YCGNV+ ++VFN+R+FG 
Sbjct  168  LHDKRAAEADNLTRFVYN-LAGGAGSGGAAVDVRHVARHYCGNVVRRLVFNRRYFGE  223



>gb|KDP29694.1| hypothetical protein JCGZ_18629 [Jatropha curcas]
Length=542

 Score = 87.4 bits (215),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I  IR G T VIPV  P +ARE LKK D++FS+RP+ +SA  +S GY ++I +P  DQW
Sbjct  95   DICLIRFGRTNVIPVNCPIIARELLKKNDAIFSNRPMILSAKEMSGGYQTAIVVPNNDQW  154

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMR++L S ++SPA  ++
Sbjct  155  KKMRKILTSEIVSPAKHKW  173


 Score = 65.1 bits (157),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLV YI++Q   +       VN R V R YCGNVI KM+F+KR+FG
Sbjct  174  LHDKRAEEADNLVFYIHNQYKANNN-----VNLRLVARHYCGNVIRKMMFSKRYFG  224



>gb|AHY21742.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21743.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21744.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21745.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21747.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21748.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21749.1| cytochrome P450 79D15, partial [Trifolium occidentale]
 gb|AHY21750.1| cytochrome P450 79D15, partial [Trifolium occidentale]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 58.2 bits (139),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KREEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21746.1| cytochrome P450 79D15, partial [Trifolium occidentale]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 58.2 bits (139),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRKEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|KDP29692.1| hypothetical protein JCGZ_18627 [Jatropha curcas]
Length=333

 Score = 88.6 bits (218),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I  IR G T VIPV  P +ARE LKK D++FS+RP+ +SA  +S GY ++I +P  DQW
Sbjct  92   DICLIRFGRTNVIPVNCPIIARELLKKNDAIFSNRPMILSAKEMSGGYQTTIVVPNNDQW  151

Query  280  AKMRRVLHSRVLSPA  236
             KMR++L S ++SPA
Sbjct  152  KKMRKILTSEIISPA  166


 Score = 63.5 bits (153),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NLV YI++Q   +       VN R   R YCGNVI KM+F+KR+FG
Sbjct  171  LHDKRTEEADNLVFYIHNQYKANNN-----VNLRLAARHYCGNVIRKMMFSKRYFG  221



>gb|ACB15165.1| cytochrome P450 [Trifolium repens]
 gb|ACB15185.1| cytochrome P450 [Trifolium repens]
 gb|ACB15186.1| cytochrome P450 [Trifolium repens]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21808.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACB15159.1| cytochrome P450 [Trifolium repens]
 gb|ACB15161.1| cytochrome P450 [Trifolium repens]
 gb|ACB15164.1| cytochrome P450 [Trifolium repens]
 gb|ACB15178.1| cytochrome P450 [Trifolium repens]
 gb|ACB15181.1| cytochrome P450 [Trifolium repens]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21758.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21757.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21807.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21778.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21779.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21780.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21781.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21784.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21755.1| cytochrome P450 79D15, partial [Trifolium montanum]
 gb|AHY21760.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACB15154.1| cytochrome P450 [Trifolium repens]
 gb|ACB15169.1| cytochrome P450 [Trifolium repens]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|AHY21762.1| cytochrome P450 79D15, partial [Trifolium montanum]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACB15168.1| cytochrome P450 [Trifolium repens]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>ref|XP_002534163.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF28220.1| cytochrome P450, putative [Ricinus communis]
Length=338

 Score = 87.8 bits (216),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI  IRLG T ++PV+ P LARE LKK D++FSSRP+  SA  +S  Y ++I +P  DQW
Sbjct  91   EICLIRLGRTNIVPVSCPILARELLKKNDAIFSSRPMIFSAKCMSGEYSTTIVVPNNDQW  150

Query  280  AKMRRVLHSRVLSPA  236
             KMR++L S ++SPA
Sbjct  151  KKMRKILTSEIVSPA  165


 Score = 63.9 bits (154),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            L DKR EEANNLV Y+++Q   +       VN R  TR YCGNVI KM+F+KRFFG  M
Sbjct  170  LLDKRTEEANNLVFYLHNQYESNKN-----VNLRIATRHYCGNVIRKMIFSKRFFGKGM  223



>ref|XP_004295627.1| PREDICTED: isoleucine N-monooxygenase 2-like [Fragaria vesca 
subsp. vesca]
Length=529

 Score = 97.8 bits (242),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC+RLG  +VI V SPE+AREFLKK D++F+SRP+ M+  L+S+GYL++  +P G QW
Sbjct  71   DIACVRLGNVHVIAVKSPEIAREFLKKHDAIFASRPITMATHLLSSGYLTAGVVPMGQQW  130

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRVL + V + + +R+ +
Sbjct  131  KKMRRVLIADVFNQSRVRWLL  151


 Score = 53.9 bits (128),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L DKR  EA+NL+K++Y QC+ S  G   VVN RT  + +  N + ++ FN R+FG
Sbjct  150  LLDKRNIEADNLMKFLYSQCSNSENGS--VVNVRTAAQHFSANTMRRLFFNTRYFG  203



>sp|Q9M7B8.1|C79D1_MANES RecName: Full=Valine N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79D1 [Manihot esculenta]
 gb|AAF27289.1|AF140613_1 N-hydroxylating cytochrome P450 [Manihot esculenta]
Length=542

 Score = 86.7 bits (213),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I  IR G T  +P++ P LARE LKK D++FS+RP  +SA  +S GYL++I +P  DQW
Sbjct  95   DICLIRFGRTNFVPISCPVLAREILKKNDAIFSNRPKTLSAKSMSGGYLTTIVVPYNDQW  154

Query  280  AKMRRVLHSRVLSPA  236
             KMR++L S ++SPA
Sbjct  155  KKMRKILTSEIISPA  169


 Score = 65.1 bits (157),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LHDKR EEA+NLV YI++Q   +       VN RT TR Y GNVI KMVF+KR+FG  M
Sbjct  174  LHDKRAEEADNLVFYIHNQFKANKN-----VNLRTATRHYGGNVIRKMVFSKRYFGKGM  227



>gb|KDP45698.1| hypothetical protein JCGZ_17305 [Jatropha curcas]
Length=534

 Score = 92.0 bits (227),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P+++ E LK QD+ F++RP+ MS    S GYL++I  P GDQW
Sbjct  82   EIACIRLGNVHVIPVTCPKISCEILKAQDANFATRPISMSTRFTSKGYLTTILAPFGDQW  141

Query  280  AKMRRVLHSRVLSPASLR  227
             KMR VL + +LS A  R
Sbjct  142  KKMRTVLVTEMLSAAKQR  159


 Score = 59.7 bits (143),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 5/49 (10%)
 Frame = -1

Query  215  RVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
            RVEEAN+LV+Y+Y+QCN  G     +V+ R   + YCGNV  KM+FNKR
Sbjct  165  RVEEANHLVRYVYNQCNEGG-----LVDVRVAAQHYCGNVTRKMMFNKR  208



>gb|AAV97889.1| N-hydroxylating cytochrome P450 CYP79D1 [Manihot esculenta]
Length=542

 Score = 86.7 bits (213),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I  IR G T  +P++ P LARE LKK D++FS+RP  +SA  +S GYL++I +P  DQW
Sbjct  95   DICLIRFGRTNFVPISCPVLAREILKKNDAIFSNRPKTLSAKSMSGGYLTTIVVPYNDQW  154

Query  280  AKMRRVLHSRVLSPA  236
             KMR++L S ++SPA
Sbjct  155  KKMRKILTSEIISPA  169


 Score = 65.1 bits (157),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 5/59 (8%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            LHDKR EEA+NLV YI++Q   +       VN RT TR Y GNVI KMVF+KR+FG  M
Sbjct  174  LHDKRAEEADNLVFYIHNQFKANKN-----VNLRTATRHYGGNVIRKMVFSKRYFGKGM  227



>gb|AHY21774.1| cytochrome P450 79D15, partial [Trifolium isthmocarpum]
Length=508

 Score = 93.6 bits (231),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFNTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.8 bits (138),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++ N R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNGDAGLVNIRTAAQHYGGNVFRKLILNTRYFGKGM  200



>gb|KGN66526.1| Cytochrome P450 [Cucumis sativus]
Length=345

 Score = 92.8 bits (229),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSR-PVCMSADLISNGYLSSIFLPTGDQ  284
            EIA IRL  TY+IPVTSPELA EFLK  DSVF SR  V    D++++G +S+I  PTG Q
Sbjct  93   EIASIRLRNTYIIPVTSPELALEFLKTYDSVFGSRSSVSKDVDMLTSGSVSAILSPTGSQ  152

Query  283  WAKMRRVLHSRVLSPASLR  227
            W+KM+R+L S++L+P++L 
Sbjct  153  WSKMKRILTSKILNPSTLH  171


 Score = 58.5 bits (140),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R  EA+ L+ YI++Q   +G G   V+N R++T+ YCGN++ +MVFN+R++G
Sbjct  176  QRTAEADALLHYIFNQTRKNGGGA--VINVRSITQHYCGNIVRRMVFNRRYYG  226



>emb|CBI24258.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   106 bits (264),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPVTSPE+++EFLKK D+VF+SRP+ M+++  S G+L++  +P GDQW
Sbjct  175  EIACIQLGNVHVIPVTSPEISKEFLKKHDAVFASRPITMASEYSSGGFLTTAVVPWGDQW  234

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S V++P++ R+
Sbjct  235  KKMRRVLASNVINPSTFRW  253


 Score = 44.7 bits (104),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGG  147
            LHDKRVEE +NLV+Y+Y+QC IS +  
Sbjct  254  LHDKRVEETDNLVRYVYNQCKISTSNN  280



>emb|CDY04945.1| BnaAnng01270D [Brassica napus]
Length=236

 Score = 93.6 bits (231),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI L  T VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  79   DIACIPLANTNVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQW  138

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S ++T++
Sbjct  139  KKMRRVVASHVTSQKSFKWTLE  160


 Score = 57.4 bits (137),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +KR EEA+NLV+YI + C  +   G  V++ R V RQY GNV  KM+F  R FG
Sbjct  160  EKRTEEADNLVRYINNLCVKNQGNGFEVIDLRLVVRQYSGNVARKMLFGVRHFG  213



>gb|KEH20391.1| cytochrome P450 family protein [Medicago truncatula]
Length=518

 Score = 85.5 bits (210),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRLG  +VI ++ PE+ARE   KQD++F+SRP   S + ++NGYL++   P G+QW
Sbjct  80   DIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQW  139

Query  280  AKMRRVLHSRVLSP  239
             K+++V+ + ++SP
Sbjct  140  KKVKKVISNELVSP  153


 Score = 65.5 bits (158),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKRVEEA+N+V+Y+Y++C  +  GG  +VN     + Y G VI +++ NKR+FGN
Sbjct  159  LHDKRVEEADNIVRYVYNKC--TKIGGDGIVNVSVAAQYYSGYVIRRLLLNKRYFGN  213



>ref|XP_004154686.1| PREDICTED: isoleucine N-monooxygenase 1-like [Cucumis sativus]
Length=519

 Score = 92.0 bits (227),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSR-PVCMSADLISNGYLSSIFLPTGDQ  284
            EIA IRL  TY+IPVTSPELA EFLK  DSVF SR  V    D++++G +S+I  PTG Q
Sbjct  63   EIASIRLRNTYIIPVTSPELALEFLKTYDSVFGSRSSVSKDVDMLTSGSVSAILSPTGSQ  122

Query  283  WAKMRRVLHSRVLSPASLR  227
            W+KM+R+L S++L+P++L 
Sbjct  123  WSKMKRILTSKILNPSTLH  141


 Score = 58.9 bits (141),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R  EA+ L+ YI++Q   +G G   V+N R++T+ YCGN++ +MVFN+R++G
Sbjct  146  QRTAEADALLHYIFNQTRKNGGGA--VINVRSITQHYCGNIVRRMVFNRRYYG  196



>emb|CBI24260.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   103 bits (258),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACI+LG  +VIPVTSPE++RE LKK D+VF+SRP+ M+ +  S G+L++  +P GDQW
Sbjct  114  EIACIQLGDVHVIPVTSPEISREVLKKHDTVFASRPITMATEYSSGGFLTTAVVPWGDQW  173

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S+V++P++ R+
Sbjct  174  KKMRRVLASKVINPSTFRW  192


 Score = 46.6 bits (109),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGT  153
            LHDKRVEEA+NLV+Y+Y+QC IS +
Sbjct  193  LHDKRVEEADNLVRYVYNQCKISTS  217



>gb|KDP45693.1| hypothetical protein JCGZ_17300 [Jatropha curcas]
Length=494

 Score = 89.7 bits (221),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLG  +VI VT P ++ EFLK QDS F++RP+ MS+ + +  Y++++  P GDQW
Sbjct  42   EIACFRLGNVHVITVTCPNISCEFLKAQDSNFATRPITMSSGVTTKEYITTVLTPCGDQW  101

Query  280  AKMRRVLHSRVLSPA  236
             KM+R+L +++L PA
Sbjct  102  KKMKRILVTQMLCPA  116


 Score = 61.2 bits (147),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
             + KRVEEA +LV+Y+Y QC+  G     +V+ R   R YCGNVI KMVFNKR
Sbjct  121  FYGKRVEEAEHLVRYVYKQCSEGG-----LVDVRIAARHYCGNVIRKMVFNKR  168



>ref|XP_009354043.1| PREDICTED: isoleucine N-monooxygenase 2-like [Pyrus x bretschneideri]
Length=518

 Score = 92.0 bits (227),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI+LG  +VI V SPE+AREFLKK D+VF+SRPV M+  ++S+GY+++  +P G QW
Sbjct  68   DIACIKLGNVHVIAVKSPEIAREFLKKNDAVFASRPVTMATHILSSGYVTTGVVPWGSQW  127

Query  280  AKMRRVLHSRVLSPASLRFTI  218
             KMRRVL + V + + + + +
Sbjct  128  KKMRRVLIADVFNQSRVHWLL  148


 Score = 58.5 bits (140),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R EEA+NLVK++Y+QC+++  G   VVN RT    Y G V+ +M+FN R+FG
Sbjct  150  QRNEEADNLVKFLYNQCSVNPNGS--VVNVRTAALFYSGGVMRRMIFNSRYFG  200



>gb|ACB15157.1| cytochrome P450 [Trifolium repens]
 gb|ACB15158.1| cytochrome P450 [Trifolium repens]
 gb|ACB15160.1| cytochrome P450 [Trifolium repens]
Length=509

 Score = 93.2 bits (230),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ACR10256.1| cytochrome P450 79a2 [Brassica rapa subsp. pekinensis]
Length=529

 Score = 95.5 bits (236),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI L  T VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  79   DIACIPLANTNVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQW  138

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S ++T++
Sbjct  139  KKMRRVVASHVTSQKSFKWTLE  160


 Score = 55.5 bits (132),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +KR EEA+NLV+YI + C  +   G  V++ R V RQY GNV   M+F  R FG
Sbjct  160  EKRTEEADNLVRYINNLCVKNQGNGFEVIDLRLVVRQYSGNVARNMLFGVRHFG  213



>gb|AHY21751.1| cytochrome P450 79D15, partial [Trifolium uniflorum]
 gb|AHY21752.1| cytochrome P450 79D15, partial [Trifolium uniflorum]
Length=509

 Score = 93.2 bits (230),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>ref|XP_009125594.1| PREDICTED: phenylalanine N-monooxygenase-like [Brassica rapa]
Length=532

 Score = 95.5 bits (236),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI L  T VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  79   DIACIPLANTNVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTIAVEPQGEQW  138

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S ++T++
Sbjct  139  KKMRRVVASHVTSQKSFKWTLE  160


 Score = 55.1 bits (131),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +KR EEA+NLV+YI + C  +   G  V++ R V RQY GNV   M+F  R FG
Sbjct  160  EKRTEEADNLVRYINNLCVKNQGNGFEVIDLRLVVRQYSGNVARNMLFGVRHFG  213



>gb|AHY21806.1| cytochrome P450 79D15, partial [Trifolium repens]
Length=508

 Score = 93.2 bits (230),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>gb|ABD84027.1| cytochrome P450 [Bambusa ventricosa]
Length=519

 Score = 86.7 bits (213),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IAC+R GG +V+ VT P++ARE LKKQD+ F SRP+  ++   S GY +++  P GDQW
Sbjct  67   DIACVRSGGIHVVAVTCPKIAREVLKKQDANFVSRPLTFASRTFSCGYKNAVLSPFGDQW  126

Query  280  AKMRRVLHSRVLSPA  236
             KMRRVL S ++ P+
Sbjct  127  KKMRRVLTSEIICPS  141


 Score = 63.9 bits (154),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EA+NL +Y+Y+    SG      V+ R V R YCGNVI ++VF KR+FG 
Sbjct  146  LHDKRDDEADNLTRYVYNLTRRSGAS----VDVRHVARHYCGNVIRRLVFGKRYFGE  198



>gb|AHY21782.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
 gb|AHY21783.1| cytochrome P450 79D15, partial [Trifolium ambiguum]
Length=508

 Score = 92.8 bits (229),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MS D+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSTDIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 57.4 bits (137),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  200



>ref|XP_010491059.1| PREDICTED: phenylalanine N-monooxygenase-like [Camelina sativa]
Length=532

 Score =   100 bits (248),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  TYVIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  78   DIACIRLANTYVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTVAVEPQGEQW  137

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S   TI+
Sbjct  138  KKMRRVVASHVTSKKSFTLTIQ  159


 Score = 49.7 bits (117),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 2/55 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC--NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+N V+YI +    N     G  V++ R V RQY GNV  KM+F  R FG
Sbjct  160  KRTEEADNFVRYINNLTAKNRGDANGFGVIDLRLVVRQYSGNVARKMMFGVRHFG  214



>ref|XP_007011306.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20116.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score = 82.8 bits (203),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I C+RL   +VI VTSP +A EFLKK DSVF+SRPV M+ +  S  +L+   +P GDQW
Sbjct  97   DILCVRLANIHVIAVTSPVIALEFLKKNDSVFASRPVTMATEYSSRRFLTIAVVPWGDQW  156

Query  280  AKMRRVLHSRVLSPASLR  227
             KMRRV+   +LS + L 
Sbjct  157  KKMRRVVTCEILSTSKLH  174


 Score = 67.0 bits (162),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISG---TGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L + R EEA+NLV++IY+QC  +G   +    VVN R   RQY GNVI KM+FN+R+FG 
Sbjct  176  LLENRTEEADNLVRFIYNQCKSNGHDNSTASAVVNLRLAMRQYSGNVIRKMIFNRRYFGE  235



>ref|XP_004139123.1| PREDICTED: isoleucine N-monooxygenase 1-like [Cucumis sativus]
Length=463

 Score = 92.0 bits (227),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSR-PVCMSADLISNGYLSSIFLPTGDQ  284
            EIA IRL  TY+IPVTSPELA EFLK  DSVF SR  V    D++++G +S+I  PTG Q
Sbjct  7    EIASIRLRNTYIIPVTSPELALEFLKTYDSVFGSRSSVSKDVDMLTSGSVSAILSPTGSQ  66

Query  283  WAKMRRVLHSRVLSPASLR  227
            W+KM+R+L S++L+P++L 
Sbjct  67   WSKMKRILTSKILNPSTLH  85


 Score = 58.2 bits (139),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R  EA+ L+ YI++Q   +G G   V+N R++T+ YCGN++ +MVFN+R++G
Sbjct  90   QRTAEADALLHYIFNQTCKNGGGA--VINVRSITQHYCGNIVRRMVFNRRYYG  140



>gb|AHY21802.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score = 94.4 bits (233),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K+VFN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLVFNTRYFGKGM  201



>gb|AHY21788.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=508

 Score = 94.4 bits (233),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C         +VN RT  + Y GNV  K++ N R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDAGLVNIRTAAQHYGGNVFRKLILNTRYFGKGM  200



>ref|XP_006464296.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=552

 Score = 91.7 bits (226),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I CIRLG  +VIPVTSPE+A EFLK  DSVF+SRP+ M  + +S G+LS   +P G QW 
Sbjct  101  ICCIRLGNVHVIPVTSPEIALEFLKVHDSVFASRPLTMGTEYLSGGFLSIAVVPWGQQWK  160

Query  277  KMRRVLHSRVLSPASL  230
            KMR+V+ S VL    L
Sbjct  161  KMRKVVASHVLHSVRL  176


 Score = 58.2 bits (139),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA  LV ++Y+QC  +      V+N R V R+YCGNVI K++F++R+FG 
Sbjct  182  KRREEAEELVSFVYNQCIRNNVDS--VINVRLVARRYCGNVIRKIMFSRRYFGE  233



>gb|EMT08478.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=460

 Score = 85.1 bits (209),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IA  RLGG +V+P+T P++ RE LKKQD  FSSRP+  ++  IS+GY   +  P GDQW
Sbjct  32   DIAYFRLGGVHVVPITCPKITREVLKKQDKNFSSRPLTFASSAISSGYKDVVLSPFGDQW  91

Query  280  AKMRRVLHSRVLSPA  236
             KM +VL S ++ P+
Sbjct  92   MKMCKVLTSEIICPS  106


 Score = 64.3 bits (155),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCN---ISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR +EANNL +YIY+       S T G+  VN R V R YCGNVI ++VF + +FG 
Sbjct  111  LHDKRADEANNLTRYIYNLTAGELSSSTSGLANVNFRHVARHYCGNVIRRLVFGQWYFGE  170



>ref|XP_010456404.1| PREDICTED: phenylalanine N-monooxygenase, partial [Camelina sativa]
Length=513

 Score = 99.8 bits (247),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  TYVIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  62   DIACIRLANTYVIPVTSPRIAREILKKQDSIFATRPLTMGTEYCSRGYLTVAVEPQGEQW  121

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S   T++
Sbjct  122  KKMRRVVASHVTSKKSFTLTLQ  143


 Score = 49.7 bits (117),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            KR EEA+N V+YI +  +     G  V++ R V RQY GNV  KM+F  R FG
Sbjct  144  KRTEEADNFVRYI-NNLSAKNRNGFGVIDLRLVVRQYSGNVARKMMFGVRHFG  195



>ref|XP_004967230.1| PREDICTED: tyrosine N-monooxygenase-like [Setaria italica]
Length=541

 Score = 94.0 bits (232),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACI+LGG +VIP+T P +ARE L+KQD+ F+SRP+  +++  S GY +++  P GDQW
Sbjct  87   DIACIKLGGVHVIPITCPAIAREVLRKQDTTFASRPLTFASETFSGGYRNAVLSPYGDQW  146

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S ++ P+  ++
Sbjct  147  RKMRRVLASEIVCPSRHKW  165


 Score = 55.5 bits (132),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L  KR +EA+N+ +Y+Y        G    V+ R V R YCGNVI ++VFN+R FG 
Sbjct  166  LCSKRADEADNITRYVYSLVKTKSGGA---VDVRHVARHYCGNVIRRLVFNRRHFGE  219



>ref|XP_010531370.1| PREDICTED: tryptophan N-monooxygenase 1 [Tarenaya hassleriana]
Length=545

 Score = 93.2 bits (230),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC+RLG T+VIPVT P++ARE  K+QD++F+SRP+  +  ++SNGY + +  P G+Q+
Sbjct  95   EIACVRLGNTHVIPVTCPQIAREMFKQQDAIFASRPLSYAQKVLSNGYKTCVITPFGEQF  154

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ + ++ PA  R+
Sbjct  155  KKMRRVVMTEIVCPARHRW  173


 Score = 56.2 bits (134),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            LHDKR EE ++L  ++Y+    S T     V+ R V+R YCGNVI K+ F  R FG+
Sbjct  174  LHDKRAEETDHLTAWLYNMVKSSST-----VDFRDVSRHYCGNVIKKLFFGTRTFGS  225



>gb|KDP29696.1| hypothetical protein JCGZ_18631 [Jatropha curcas]
Length=542

 Score = 84.3 bits (207),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I   R G T VIPV  P  ARE LK  D++FS+RP+ +SA  IS GY ++I +P  DQW
Sbjct  95   DICLFRFGRTNVIPVICPIFARELLKTNDAIFSNRPMILSAKEISGGYQTTIVVPNNDQW  154

Query  280  AKMRRVLHSRVLSPA  236
             KMR++L S ++SPA
Sbjct  155  KKMRKILPSEIISPA  169


 Score = 64.7 bits (156),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EEA+NL+ YI++Q   +       VN R V R YCGNVI KMVF+KR+FG
Sbjct  174  LHDKRAEEADNLLFYIHNQYKANNN-----VNLRLVARHYCGNVIRKMVFSKRYFG  224



>ref|XP_006428115.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
 gb|ESR41355.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
Length=583

 Score = 91.3 bits (225),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I CIRLG  +VIPVTSPE+A EFLK  DSVF+SRP+ M  + +S G+LS   +P G QW 
Sbjct  132  ICCIRLGNVHVIPVTSPEIALEFLKVHDSVFASRPLTMGTEYLSGGFLSIAVVPWGQQWK  191

Query  277  KMRRVLHSRVLSPASL  230
            KMR+V+ S VL    L
Sbjct  192  KMRKVVASHVLHSVRL  207


 Score = 58.2 bits (139),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA  LV ++Y+QC  +      V+N R V R+YCGNVI K++F++R+FG 
Sbjct  213  KRREEAEELVSFVYNQCIRNNVDS--VINVRLVARRYCGNVIRKIMFSRRYFGE  264



>gb|KDP45699.1| hypothetical protein JCGZ_17306 [Jatropha curcas]
Length=465

 Score = 87.8 bits (216),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC RLG  +VI VT P ++ EFLK QDS F++RP+ +S+ + S  YL++   P GDQW
Sbjct  21   EIACFRLGNVHVITVTCPNISCEFLKAQDSNFATRPITISSGVTSKEYLTTALTPCGDQW  80

Query  280  AKMRRVLHSRVLSPA  236
             KM+R+L +++L PA
Sbjct  81   KKMKRILVTQMLCPA  95


 Score = 61.6 bits (148),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKR  69
             + KRVEEA +LV+Y+Y QC+  G     +V+ R   R YCGNVI KMVFNKR
Sbjct  100  FYGKRVEEAEHLVRYVYKQCSEGG-----LVDVRIAARHYCGNVIRKMVFNKR  147



>gb|ACB15182.1| cytochrome P450 [Trifolium repens]
Length=505

 Score = 94.4 bits (233),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C      G+  VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKC--CKDAGL--VNIRTAAQHYGGNVFRKLIFNTRYFGKGM  196



>ref|NP_680351.1| cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene 
[Arabidopsis thaliana]
 gb|AED94026.1| cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene 
[Arabidopsis thaliana]
Length=490

 Score = 92.0 bits (227),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDSVF+ RP+ M  +  S GYL+      G+QW
Sbjct  79   DIACIRLANTHVIPVTSPRIAREILKKQDSVFAIRPLTMGTEYCSRGYLTIAVQSQGEQW  138

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V S  S +  ++
Sbjct  139  KKMRRVVASHVTSKKSFKLMLE  160


 Score = 56.6 bits (135),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQC--NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +KR EEA+NLV+YI ++C  N     G+ V++ R V RQY GNV  KM+F  R FG
Sbjct  160  EKRTEEADNLVRYINNRCVKNRGNGNGLAVIDLRFVVRQYSGNVARKMMFGIRHFG  215



>gb|AHY21785.1| cytochrome P450 79D15, partial [Trifolium suffocatum]
Length=504

 Score = 94.4 bits (233),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPAIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C      G+  VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKC--CKDAGL--VNIRTAAQHYGGNVFRKLIFNTRYFGKGM  196



>gb|EYU45628.1| hypothetical protein MIMGU_mgv1a023130mg [Erythranthe guttata]
Length=526

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIAC R G T+VIPVTSPEL+REFLKK D +F+SRP CMS  L SNGYLS+I  P GDQW
Sbjct  67   EIACFRFGKTHVIPVTSPELSREFLKKHDLIFASRPDCMSGRLTSNGYLSAIISPYGDQW  126

Query  280  AKMRRVLHSRVLSPA  236
             KMRR+L S  LSPA
Sbjct  127  KKMRRILSSHALSPA  141


 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 49/89 (55%), Gaps = 14/89 (16%)
 Frame = -1

Query  293  RRSMGENAKSSPLPRAFSGEPPLHDKRVEEANNLVKYIYDQC--------NISGTGGMHV  138
            RR +  +A S  + + F      H+KR EEA++LV+Y+Y Q         N +      +
Sbjct  130  RRILSSHALSPAMHKKF------HEKRGEEADHLVRYVYTQLLSSRNNNTNSNNNNNNGL  183

Query  137  VNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            VN R  T+ YCGNVI KMVF KRFFG  M
Sbjct  184  VNLRVATQHYCGNVIRKMVFGKRFFGAGM  212



>gb|ACB15153.1| cytochrome P450 [Trifolium repens]
 gb|ACB15155.1| cytochrome P450 [Trifolium repens]
 gb|ACB15156.1| cytochrome P450 [Trifolium repens]
 gb|ACB15172.1| cytochrome P450 [Trifolium repens]
 gb|ACB15175.1| cytochrome P450 [Trifolium repens]
 gb|ACB15176.1| cytochrome P450 [Trifolium repens]
Length=505

 Score = 94.0 bits (232),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C      G+  VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKC--CKDAGL--VNIRTAAQHYGGNVFRKLIFNTRYFGKGM  196



>gb|ACB15162.1| cytochrome P450 [Trifolium repens]
 gb|ACB15163.1| cytochrome P450 [Trifolium repens]
 gb|ACB15166.1| cytochrome P450 [Trifolium repens]
 gb|ACB15167.1| cytochrome P450 [Trifolium repens]
 gb|ACB15170.1| cytochrome P450 [Trifolium repens]
 gb|ACB15171.1| cytochrome P450 [Trifolium repens]
 gb|ACB15173.1| cytochrome P450 [Trifolium repens]
 gb|ACB15174.1| cytochrome P450 [Trifolium repens]
 gb|ACB15177.1| cytochrome P450 [Trifolium repens]
 gb|ACB15179.1| cytochrome P450 [Trifolium repens]
 gb|ACB15180.1| cytochrome P450 [Trifolium repens]
 gb|ACB15187.1| cytochrome P450 [Trifolium repens]
 gb|ACB15188.1| cytochrome P450 [Trifolium repens]
Length=505

 Score = 94.0 bits (232),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C      G+  VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKC--CKDAGL--VNIRTAAQHYGGNVFRKLIFNTRYFGKGM  196



>ref|XP_002873202.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49461.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score = 96.7 bits (239),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDSVF++RP+ M  +  S GYL+    P G+QW
Sbjct  78   DIACIRLANTHVIPVTSPRIAREILKKQDSVFATRPLTMGTEYCSRGYLTVAVEPQGEQW  137

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
              MRRV+ S V S  S + T++
Sbjct  138  KMMRRVVASHVTSKKSFQLTLQ  159


 Score = 51.6 bits (122),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC--NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA+N V+YI ++   N     G  V++ R V RQY GNV  KM+F  R FGN
Sbjct  160  KRTEEADNFVRYINNRSVKNRGNGNGFVVIDLRLVVRQYSGNVARKMMFGIRHFGN  215



>ref|XP_008456975.1| PREDICTED: isoleucine N-monooxygenase 1 [Cucumis melo]
Length=520

 Score =   100 bits (249),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLG-GTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            EIACIRLG  T++IPV SPEL+ EFL   DSVF SR + M+A+++SNGYLS++  P G+Q
Sbjct  73   EIACIRLGSNTHIIPVASPELSLEFLNTHDSVFGSRSISMTAEIVSNGYLSTVLSPMGEQ  132

Query  283  WAKMRRVLHSRVLSPASLR  227
            W KMR++L S+VL+P +L 
Sbjct  133  WKKMRKILVSQVLNPPTLH  151


 Score = 48.1 bits (113),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 8/61 (13%)
 Frame = -1

Query  233  PPLHD---KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            P LH    +R +EA+ L++YI+       T     +N R++ R YCG VI +M+F++R++
Sbjct  148  PTLHQMVGQRTDEADILLRYIFGL-----TRNGEAINIRSIVRHYCGTVIRRMIFSRRYY  202

Query  62   G  60
            G
Sbjct  203  G  203



>ref|XP_009122135.1| PREDICTED: phenylalanine N-monooxygenase [Brassica rapa]
Length=525

 Score = 99.0 bits (245),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  78   DIACIRLANTHVIPVTSPRIAREILKKQDSIFATRPLTMGTEYSSRGYLTIAVEPQGEQW  137

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V    S R+T++
Sbjct  138  KKMRRVVASHVTCQKSFRWTLE  159


 Score = 49.7 bits (117),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            ++R EEA+NLV+YI   C      G   ++ R V RQY GNV  KM+F  R FG
Sbjct  159  EQRTEEADNLVRYINKLCK-----GSEGIDVRHVVRQYSGNVARKMLFGVRHFG  207



>gb|AHY21801.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
 gb|AHY21804.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
 gb|AHY21805.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score = 93.2 bits (230),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K+VFN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLVFNTRYFGKGM  201



>gb|AHY21790.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. petrisavii]
Length=505

 Score = 94.4 bits (233),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLVNNLLSP  136


 Score = 53.5 bits (127),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++ N R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNG---LVNIRTAAQHYGGNVFRKLILNTRYFGKGM  197



>gb|ACB15183.1| cytochrome P450 [Trifolium repens]
Length=510

 Score = 93.2 bits (230),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  201



>gb|KHN24731.1| Isoleucine N-monooxygenase 1 [Glycine soja]
Length=508

 Score = 93.2 bits (230),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +A EFL+K D  F+SRP+ M+ D++S+GY++   +P G+QW
Sbjct  57   EIACIRLGNVHVIPVTCPSIACEFLRKHDVDFASRPLTMATDIMSSGYVTIAIVPFGEQW  116

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ + + SP
Sbjct  117  KKMRRIVVNELFSP  130


 Score = 55.1 bits (131),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR  EA+N++ Y+Y++C     GG+  VN R V + YC NV  K++FN R+FG
Sbjct  136  LQGKRNGEADNIMFYVYNKCKNVNNGGL--VNVRDVAQHYCCNVTRKLIFNTRYFG  189



>ref|XP_010526660.1| PREDICTED: tryptophan N-monooxygenase 1-like [Tarenaya hassleriana]
Length=531

 Score = 96.3 bits (238),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG TYVIPVT P++ARE  K+QD++F+SRP+  +  ++SNGY + +  P G+Q+
Sbjct  81   EIACIRLGNTYVIPVTCPQIAREMFKQQDAIFASRPLSYAQKVLSNGYKTCVITPFGEQF  140

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRV+ + ++ PA  R+
Sbjct  141  KKMRRVVMTEIVCPARHRW  159


 Score = 51.6 bits (122),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 5/56 (9%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            LHDKR EE ++L  ++Y+    S       ++ R V+R YCGNVI K+ F  R FG
Sbjct  160  LHDKRAEETDHLTAWLYNMVKNSNP-----IDFRFVSRHYCGNVIKKLFFGTRTFG  210



>ref|XP_004154649.1| PREDICTED: isoleucine N-monooxygenase 1-like [Cucumis sativus]
Length=550

 Score = 90.1 bits (222),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSR-PVCMSADLISNGYLSSIFLPTGDQ  284
            EIA IRLG TY+IPVTSPELA EFLK  DSVF SR  +    D+++ G +S+I  P+G Q
Sbjct  93   EIASIRLGNTYLIPVTSPELALEFLKTYDSVFGSRSSISKDVDMLTGGCVSAILSPSGPQ  152

Query  283  WAKMRRVLHSRVLSPASLR  227
            W KM+R+L S +L+P++L 
Sbjct  153  WRKMKRILTSEILNPSTLH  171


 Score = 57.8 bits (138),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R  EA+ L+ YI++Q   +G G   V+N R++T+ YCGN++ +MVFN+R++G
Sbjct  176  QRTAEADALLHYIFNQTCKNGGGA--VINVRSITQHYCGNIVRRMVFNRRYYG  226



>ref|XP_006591735.1| PREDICTED: isoleucine N-monooxygenase 1-like [Glycine max]
Length=529

 Score = 92.8 bits (229),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG  +VIPVT P +A EFL+K D  F+SRP+ M+ D++S+GY++   +P G+QW
Sbjct  78   EIACIRLGNVHVIPVTCPSIACEFLRKHDVNFASRPLTMATDIMSSGYVTIAIVPFGEQW  137

Query  280  AKMRRVLHSRVLSP  239
             KMRR++ + + SP
Sbjct  138  KKMRRIVVNELFSP  151


 Score = 55.1 bits (131),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            L  KR  EA+N++ Y+Y++C     GG+  VN R V + YC NV  K++FN R+FG
Sbjct  157  LQGKRNGEADNIMFYVYNKCKNVNNGGL--VNVRDVAQHYCCNVTRKLIFNTRYFG  210



>gb|AHY21799.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=504

 Score = 92.8 bits (229),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C      G+  VN RT  + Y GNV  K+VFN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKC--CKDAGL--VNIRTAAQHYGGNVFRKLVFNTRYFGKGM  196



>gb|ACB15184.1| cytochrome P450 [Trifolium repens]
Length=510

 Score = 93.2 bits (230),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 54.7 bits (130),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K++FN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLIFNTRYFGKGM  201



>gb|AHY21800.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score = 92.4 bits (228),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + V+PVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K+VFN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLVFNTRYFGKGM  201



>emb|CDX70164.1| BnaA10g25130D [Brassica napus]
Length=486

 Score = 97.8 bits (242),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  78   DIACIRLANTHVIPVTSPRIAREILKKQDSIFATRPLTMGTEYSSRGYLTIAVEPQGEQW  137

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V    S R+T++
Sbjct  138  KKMRRVVASHVTCQKSFRWTLE  159


 Score = 49.7 bits (117),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            ++R EEA+NLV+YI   C      G   ++ R V RQY GNV  KM+F  R FG
Sbjct  159  EQRTEEADNLVRYINKLCK-----GSEGIDVRHVVRQYSGNVARKMLFGVRHFG  207



>gb|AHY21803.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. nigrescens]
Length=509

 Score = 92.4 bits (228),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + V+PVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVVPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 55.1 bits (131),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC----NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C    N    G   +VN RT  + Y GNV  K+VFN R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNDDDAG---LVNIRTAAQHYGGNVFRKLVFNTRYFGKGM  201



>gb|ACB15191.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score = 94.4 bits (233),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  64   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  123

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  124  KKMKRVLVNNLLSP  137


 Score = 53.1 bits (126),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQC-NISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C N +G     +VN RT  + Y GNV  K++ N R+FG  M
Sbjct  146  KRNEEADNLVFYIYNKCCNDAG-----LVNIRTAAQHYGGNVFRKLILNTRYFGKGM  197



>emb|CDX98829.1| BnaC09g50060D [Brassica napus]
Length=486

 Score = 97.8 bits (242),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  78   DIACIRLANTHVIPVTSPRIAREILKKQDSIFATRPLTMGTEYSSRGYLTIAVEPQGEQW  137

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V    S R+T++
Sbjct  138  KKMRRVVASHVTCQKSFRWTLE  159


 Score = 50.1 bits (118),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            ++R EEA+NLV+YI   C      G   ++ R V RQY GNV  KM+F  R FG
Sbjct  159  EQRTEEADNLVRYINKLCK-----GSEGIDVRHVVRQYSGNVARKMLFGVRHFG  207



>ref|XP_006464327.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=554

 Score = 92.4 bits (228),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I CIRLG  +VIPVTSPE+A EFLK  DSVF+SRP+ M  + +S G+LS   +P G QW 
Sbjct  103  ICCIRLGNVHVIPVTSPEIALEFLKVNDSVFASRPLTMGTEYLSGGFLSITVVPWGQQWK  162

Query  277  KMRRVLHSRVLSPASLRF  224
            KMR+V+ S VL+  SLR 
Sbjct  163  KMRKVVSSHVLN--SLRL  178


 Score = 55.1 bits (131),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA++LV ++Y+Q   +      V+N R V R+YCGNVI K++F++R+FG 
Sbjct  184  KRREEADDLVSFVYNQYFRNNVDS--VINVRLVARRYCGNVIRKIMFSRRYFGE  235



>gb|AAF66544.1|AF140610_1 cytochrome P450 CYP79E2 [Triglochin maritima]
Length=533

 Score = 85.9 bits (211),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I CIRLGG +V+PV  PE+AREFLK  DS F+SRPV +     S G+ S   +P G+QW 
Sbjct  84   IGCIRLGGVHVVPVNCPEIAREFLKVHDSDFASRPVTVVTRYSSRGFRSIAVVPLGEQWK  143

Query  277  KMRRVLHSRVLSPASLRFTI  218
            KMRRV+ S +++   L++ +
Sbjct  144  KMRRVVASEIINAKRLQWQL  163


 Score = 61.6 bits (148),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  215  RVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFF  63
            R EEA+N+V+YI  QCN SG     +++ R   R YC NVI +M+F KR+F
Sbjct  166  RTEEADNIVRYITYQCNTSGDTSGAIIDVRFALRHYCANVIRRMLFGKRYF  216



>gb|KGN50755.1| hypothetical protein Csa_5G223620 [Cucumis sativus]
Length=326

 Score =   100 bits (248),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLG-GTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            EIACIRLG  T++IPV SPEL+ EFL   DSVF SR + M+A+++SNGYLS++  P G+Q
Sbjct  73   EIACIRLGSNTHIIPVASPELSLEFLNTHDSVFGSRSISMTAEIVSNGYLSTVLSPMGEQ  132

Query  283  WAKMRRVLHSRVLSPASLR  227
            W KMR++L S+VL+ ++L 
Sbjct  133  WKKMRKILASQVLNSSTLH  151


 Score = 47.0 bits (110),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R +EA+ L++YI+       T     +N R++ R YCG VI +M+F++R++G
Sbjct  156  QRTDEADILLRYIFGL-----TKNGEAINIRSIVRHYCGTVIRRMIFSRRYYG  203



>ref|XP_006428111.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
 gb|ESR41351.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
Length=585

 Score = 91.7 bits (226),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  457  IACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQWA  278
            I CIRLG  +VIPVTSPE+A EFLK  DSVF+SRP+ M  + +S G+LS   +P G QW 
Sbjct  134  ICCIRLGNVHVIPVTSPEIALEFLKVNDSVFASRPLTMGTEYLSGGFLSITVVPWGQQWK  193

Query  277  KMRRVLHSRVLSPASLRF  224
            KMR+V+ S VL+  SLR 
Sbjct  194  KMRKVVSSHVLN--SLRL  209


 Score = 55.1 bits (131),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            KR EEA++LV ++Y+Q   +      V+N R V R+YCGNVI K++F++R+FG 
Sbjct  215  KRREEADDLVSFVYNQYFRNNVDS--VINVRLVARRYCGNVIRKIMFSRRYFGE  266



>ref|XP_007099523.1| Cytochrome p450 79a2, putative [Theobroma cacao]
 gb|EOY20507.1| Cytochrome p450 79a2, putative [Theobroma cacao]
Length=278

 Score = 87.8 bits (216),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +I C+RL  T+V+ VTSP +AREFLKK DSVF+SRPV M+ +  S  +L+   +P GDQW
Sbjct  53   DILCVRLANTHVVAVTSPVIAREFLKKNDSVFASRPVTMATEYSSRRFLTIAVVPWGDQW  112

Query  280  AKMRRVLHSRVLSPASLR  227
             KMR+V+   ++S + LR
Sbjct  113  KKMRKVVTCEIVSASKLR  130


 Score = 58.9 bits (141),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISG---TGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L + R EEA+NL ++IY+Q   +G   +    VVN R   RQY GNV+ KM+FN+R+FG 
Sbjct  132  LLENRTEEADNLFRFIYNQFKSNGDDNSTSSAVVNLRLAMRQYSGNVMRKMIFNRRYFGE  191



>gb|AGO81716.1| CYP79A2 [Brassica napus]
Length=320

 Score = 97.4 bits (241),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            +IACIRL  T+VIPVTSP +ARE LKKQDS+F++RP+ M  +  S GYL+    P G+QW
Sbjct  72   DIACIRLANTHVIPVTSPRIAREILKKQDSIFATRPLTMGTEYSSRGYLTIAVEPQGEQW  131

Query  280  AKMRRVLHSRVLSPASLRFTIK  215
             KMRRV+ S V    S R+T++
Sbjct  132  KKMRRVVASHVTCQKSFRWTLE  153


 Score = 49.3 bits (116),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 5/54 (9%)
 Frame = -1

Query  221  DKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            ++R EEA+NLV+YI   C      G   ++ R V RQY GNV  KM+F  R FG
Sbjct  153  EQRTEEADNLVRYINKLCK-----GSEGIDVRHVVRQYSGNVARKMLFGVRHFG  201



>gb|AHY21793.1| cytochrome P450 79D15, partial [Trifolium nigrescens subsp. meneghinianum]
Length=505

 Score = 92.8 bits (229),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM++VL + +LSP
Sbjct  123  KKMKKVLVNNLLSP  136


 Score = 53.5 bits (127),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K++ N R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNG---LVNIRTAAQHYGGNVFRKLILNTRYFGKGM  197



>ref|XP_004165284.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cucumis sativus]
Length=469

 Score = 99.4 bits (246),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLG-GTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            EIACIRLG  T++IPV SPEL+ EFL   DSVF SR + M+A+++SNGYLS++  P G+Q
Sbjct  23   EIACIRLGSNTHIIPVASPELSLEFLNTHDSVFGSRSISMTAEIVSNGYLSTVLSPMGEQ  82

Query  283  WAKMRRVLHSRVLSPASLR  227
            W KMR++L S+VL+ ++L 
Sbjct  83   WKKMRKILASQVLNSSTLH  101


 Score = 47.0 bits (110),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R +EA+ L++YI+       T     +N R++ R YCG VI +M+F++R++G
Sbjct  106  QRTDEADILLRYIFGL-----TKNGEAINIRSIVRHYCGTVIRRMIFSRRYYG  153



>ref|XP_010106336.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
 gb|EXC10050.1| Isoleucine N-monooxygenase 2 [Morus notabilis]
Length=303

 Score = 93.6 bits (231),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  460  EIACIRL-GGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            +IAC RL G ++VI VTSPE+AREFLKK D+VF+ RP  M+  ++S GYL++   P G+Q
Sbjct  55   DIACFRLVGNSHVIGVTSPEIAREFLKKHDAVFALRPDTMATCIVSKGYLTTALCPGGEQ  114

Query  283  WAKMRRVLHSRVLSPASLRFTI  218
            W KMRR+L S+VLS +++R+ +
Sbjct  115  WKKMRRILASQVLSLSTMRWLL  136


 Score = 53.1 bits (126),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGN  57
            L D R +E++NLV+Y+Y+QC+ +  G   VVN RT  + Y  N + +M+F +R+FG 
Sbjct  135  LLDMRNQESDNLVRYLYNQCSKNLKGD--VVNVRTAAQHYPANAMRRMMFGRRYFGK  189



>ref|XP_004146467.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cucumis sativus]
Length=466

 Score = 99.0 bits (245),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -2

Query  460  EIACIRLG-GTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQ  284
            EIACIRLG  T++IPV SPEL+ EFL   DSVF SR + M+A+++SNGYLS++  P G+Q
Sbjct  49   EIACIRLGSNTHIIPVASPELSLEFLNTHDSVFGSRSISMTAEIVSNGYLSTVLSPMGEQ  108

Query  283  WAKMRRVLHSRVLSPASLR  227
            W KMR++L S+VL+ ++L 
Sbjct  109  WKKMRKILASQVLNSSTLH  127


 Score = 47.4 bits (111),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFG  60
            +R +EA+ L++YI+       T     +N R++ R YCG VI +M+F++R++G
Sbjct  132  QRTDEADILLRYIFGL-----TKNGEAINIRSIVRHYCGTVIRRMIFSRRYYG  179



>emb|CBI35228.3| unnamed protein product [Vitis vinifera]
Length=247

 Score = 99.8 bits (247),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EI CI+LG  +VIPVTSPE++REFLKK D+V +SRP+ M  +  S G+L++  +P G+QW
Sbjct  98   EIECIQLGDVHVIPVTSPEISREFLKKHDTVLASRPITMVTEYSSGGFLTTAVVPWGEQW  157

Query  280  AKMRRVLHSRVLSPASLRF  224
             KMRRVL S+V++P++ R+
Sbjct  158  KKMRRVLASKVINPSTFRW  176


 Score = 46.6 bits (109),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 8/43 (19%)
 Frame = -1

Query  227  LHDKRVEEANNLVKYIYDQCNISGT--------GGMHVVNART  123
            LHDKRVEEA+NLV+Y+Y+QC IS +        GGM     RT
Sbjct  177  LHDKRVEEADNLVRYVYNQCKISTSNNCLGSNIGGMAKRRLRT  219



>gb|ACB15190.1| cytochrome P450 [Trifolium nigrescens subsp. petrisavii]
Length=506

 Score = 94.4 bits (233),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  460  EIACIRLGGTYVIPVTSPELAREFLKKQDSVFSSRPVCMSADLISNGYLSSIFLPTGDQW  281
            EIACIRLG + VIPVT P +A EFLKK D+ F+SRP  MSAD+ S G+ +++  P G+QW
Sbjct  63   EIACIRLGNSIVIPVTCPTIACEFLKKHDASFASRPKIMSADIASYGFTTTVLTPYGEQW  122

Query  280  AKMRRVLHSRVLSP  239
             KM+RVL + +LSP
Sbjct  123  KKMKRVLINNLLSP  136


 Score = 52.0 bits (123),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = -1

Query  218  KRVEEANNLVKYIYDQCNISGTGGMHVVNARTVTRQYCGNVISKMVFNKRFFGNVM  51
            KR EEA+NLV YIY++C     G   +VN RT  + Y GNV  K+V   R+FG  M
Sbjct  145  KRNEEADNLVFYIYNKCCKDVNG---LVNIRTAAQHYGGNVFRKLVLGTRYFGKGM  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519083570308