BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21362_g1_i1 len=1245 path=[1:0-381 383:382-403 405:404-435
3374:436-620 625:621-651 656:652-1244]

Length=1245
                                                                      Score     E

ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    266   2e-76   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    265   5e-76   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    264   7e-76   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...    253   6e-72   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...    222   9e-61   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...    217   4e-59   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...    211   3e-57   
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...    211   4e-57   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...    211   4e-57   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...    209   3e-56   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    207   7e-56   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...    206   5e-55   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...    206   6e-55   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...    202   7e-54   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...    202   9e-54   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...    201   5e-53   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...    197   3e-52   
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...    197   4e-52   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...    197   5e-52   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...    194   3e-51   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...    194   9e-51   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...    192   3e-50   
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...    182   1e-49   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...    189   2e-49   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...    188   5e-49   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...    188   6e-49   
emb|CDP10671.1|  unnamed protein product                                186   1e-48   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...    187   2e-48   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...    185   8e-48   
emb|CDP05499.1|  unnamed protein product                                184   8e-48   
emb|CDP00687.1|  unnamed protein product                                178   1e-47   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...    184   1e-47   
gb|AET22504.1|  hypothetical protein                                    184   1e-47   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    184   2e-47   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    183   3e-47   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...    182   4e-47   
emb|CDP05558.1|  unnamed protein product                                182   5e-47   
emb|CDP00736.1|  unnamed protein product                                181   1e-46   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    181   3e-46   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...    179   6e-46   
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...    177   3e-45   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    176   3e-45   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    178   3e-45   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    177   4e-45   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...    172   4e-45   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...    172   4e-45   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg                176   9e-45   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...    176   1e-44   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...    175   2e-44   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...    175   2e-44   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...    175   2e-44   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...    175   2e-44   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    175   3e-44   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg                174   4e-44   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...    174   4e-44   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    174   6e-44   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...    173   6e-44   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...    173   9e-44   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...    173   1e-43   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1                171   2e-43   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1                171   2e-43   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1                171   2e-43   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    172   2e-43   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1                171   2e-43   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1                171   2e-43   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    172   3e-43   
emb|CDP00737.1|  unnamed protein product                                172   3e-43   
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...    171   4e-43   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1                170   5e-43   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...    171   5e-43   
emb|CDP10323.1|  unnamed protein product                                169   6e-43   
emb|CDP00692.1|  unnamed protein product                                171   1e-42   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg                171   1e-42   
ref|XP_006355211.1|  PREDICTED: putative late blight resistance p...    167   1e-42   
ref|XP_009601833.1|  PREDICTED: putative late blight resistance p...    167   4e-42   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...    169   5e-42   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...    168   6e-42   
emb|CDP00690.1|  unnamed protein product                                166   8e-42   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                167   1e-41   Capsicum chacoense
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...    167   1e-41   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...    167   2e-41   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...    167   2e-41   
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...    166   3e-41   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...    166   3e-41   
ref|XP_009764457.1|  PREDICTED: putative late blight resistance p...    162   4e-41   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    166   5e-41   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    166   6e-41   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    166   6e-41   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    166   6e-41   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    166   6e-41   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    166   7e-41   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    166   7e-41   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    166   7e-41   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    166   7e-41   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    166   8e-41   
ref|XP_011087137.1|  PREDICTED: putative late blight resistance p...    165   8e-41   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...    165   8e-41   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...    165   9e-41   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    164   1e-40   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    164   1e-40   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...    164   2e-40   
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    166   2e-40   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    164   2e-40   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                162   1e-39   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...    159   1e-39   
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...    160   1e-39   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...    161   2e-39   
emb|CDP00592.1|  unnamed protein product                                161   2e-39   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...    161   2e-39   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                161   2e-39   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    160   2e-39   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...    159   3e-39   
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...    157   5e-39   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...    159   7e-39   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...    157   3e-38   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...    157   3e-38   
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...    156   4e-38   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg                157   4e-38   
emb|CDP00691.1|  unnamed protein product                                155   5e-38   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    157   5e-38   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    158   6e-38   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...    156   9e-38   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    156   1e-37   
ref|XP_009601897.1|  PREDICTED: putative late blight resistance p...    154   1e-37   
gb|EYU17693.1|  hypothetical protein MIMGU_mgv1a001245mg                155   1e-37   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...    156   1e-37   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...    154   2e-37   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg                155   2e-37   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...    154   2e-37   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    155   2e-37   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...    154   2e-37   
emb|CDP16255.1|  unnamed protein product                                155   2e-37   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...    155   3e-37   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...    151   3e-37   
emb|CDP05514.1|  unnamed protein product                                154   4e-37   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    154   4e-37   
emb|CDP05521.1|  unnamed protein product                                155   4e-37   
ref|XP_011087136.1|  PREDICTED: putative late blight resistance p...    154   5e-37   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...    155   5e-37   
emb|CDP16510.1|  unnamed protein product                                155   6e-37   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...    154   7e-37   
emb|CDP19728.1|  unnamed protein product                                154   1e-36   
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...    153   1e-36   
emb|CDP04753.1|  unnamed protein product                                154   1e-36   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...    152   1e-36   
emb|CDP08032.1|  unnamed protein product                                148   2e-36   
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...    145   7e-36   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...    150   8e-36   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg                150   9e-36   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...    150   1e-35   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg                149   1e-35   
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...    148   1e-35   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...    149   1e-35   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...    149   1e-35   
emb|CDP11186.1|  unnamed protein product                                150   2e-35   
emb|CDP19132.1|  unnamed protein product                                150   2e-35   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    149   2e-35   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...    149   2e-35   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg                149   2e-35   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg                149   2e-35   
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...    145   3e-35   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg                148   3e-35   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...    149   3e-35   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...    150   4e-35   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...    148   4e-35   
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...    148   4e-35   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...    148   4e-35   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...    148   5e-35   
emb|CDP19994.1|  unnamed protein product                                148   5e-35   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...    148   5e-35   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...    147   7e-35   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    147   8e-35   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...    146   1e-34   
gb|EYU24408.1|  hypothetical protein MIMGU_mgv1a022062mg                146   1e-34   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...    147   1e-34   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...    147   1e-34   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...    147   2e-34   
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg                144   2e-34   
emb|CDP12800.1|  unnamed protein product                                146   3e-34   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...    145   3e-34   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...    145   3e-34   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...    145   3e-34   
emb|CDP19634.1|  unnamed protein product                                146   4e-34   
gb|ABJ99598.1|  NBS-LRR type resistance protein                         145   4e-34   Beta vulgaris [beet]
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...    145   4e-34   
ref|XP_010677242.1|  PREDICTED: putative late blight resistance p...    145   5e-34   
emb|CDP00590.1|  unnamed protein product                                145   6e-34   
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...    140   6e-34   
ref|XP_010319427.1|  PREDICTED: putative late blight resistance p...    139   7e-34   
emb|CDP12770.1|  unnamed protein product                                144   7e-34   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg                144   7e-34   
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...    144   8e-34   
gb|EYU22216.1|  hypothetical protein MIMGU_mgv1a019937mg                144   8e-34   
emb|CDP19489.1|  unnamed protein product                                145   1e-33   
emb|CDP18675.1|  unnamed protein product                                144   1e-33   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg                144   1e-33   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg                144   1e-33   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...    144   1e-33   
emb|CDP17260.1|  unnamed protein product                                144   2e-33   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...    143   2e-33   
emb|CDP20519.1|  unnamed protein product                                144   2e-33   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg                142   2e-33   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...    144   2e-33   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...    144   2e-33   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg                142   3e-33   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...    144   3e-33   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg                142   3e-33   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...    142   3e-33   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg                142   3e-33   
emb|CDP20153.1|  unnamed protein product                                143   4e-33   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...    143   4e-33   
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...    137   4e-33   
ref|XP_010319426.1|  PREDICTED: putative late blight resistance p...    136   5e-33   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...    142   5e-33   
ref|XP_011072138.1|  PREDICTED: putative late blight resistance p...    138   6e-33   
emb|CDP08033.1|  unnamed protein product                                142   6e-33   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    143   7e-33   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...    142   9e-33   
emb|CDP12798.1|  unnamed protein product                                142   1e-32   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...    141   1e-32   
emb|CDP08019.1|  unnamed protein product                                142   1e-32   
gb|EYU38159.1|  hypothetical protein MIMGU_mgv1a025995mg                140   1e-32   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    141   1e-32   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...    140   2e-32   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg                140   2e-32   
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...    140   2e-32   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...    140   3e-32   
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...    137   3e-32   
emb|CDP21622.1|  unnamed protein product                                140   4e-32   
emb|CDP16256.1|  unnamed protein product                                139   4e-32   
emb|CDP11831.1|  unnamed protein product                                139   4e-32   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...    139   4e-32   
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg                134   4e-32   
gb|EYU24400.1|  hypothetical protein MIMGU_mgv1a026464mg                139   4e-32   
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...    136   4e-32   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...    140   4e-32   
emb|CDP11642.1|  unnamed protein product                                140   4e-32   
gb|EYU17708.1|  hypothetical protein MIMGU_mgv1a001149mg                139   4e-32   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg                139   5e-32   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...    139   5e-32   
emb|CDP15705.1|  unnamed protein product                                140   6e-32   
gb|EYU24406.1|  hypothetical protein MIMGU_mgv1a002161mg                138   6e-32   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg                134   6e-32   
emb|CDP18040.1|  unnamed protein product                                139   7e-32   
ref|XP_010677240.1|  PREDICTED: putative late blight resistance p...    139   7e-32   
emb|CDP18682.1|  unnamed protein product                                139   7e-32   
emb|CDP20211.1|  unnamed protein product                                137   7e-32   
gb|AAV31175.1|  Putative disease resistance protein, identical          138   7e-32   Solanum tuberosum [potatoes]
emb|CDP18959.1|  unnamed protein product                                139   7e-32   
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg                139   8e-32   
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...    138   9e-32   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg                138   9e-32   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    137   9e-32   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
emb|CDP08020.1|  unnamed protein product                                139   1e-31   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
ref|XP_011072559.1|  PREDICTED: putative late blight resistance p...    133   1e-31   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
gb|EYU40383.1|  hypothetical protein MIMGU_mgv1a001106mg                138   1e-31   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg                137   1e-31   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...    138   1e-31   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    137   1e-31   
gb|EYU25706.1|  hypothetical protein MIMGU_mgv1a023806mg                137   2e-31   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...    137   2e-31   
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg                132   2e-31   
emb|CDP04880.1|  unnamed protein product                                137   2e-31   
emb|CDP18680.1|  unnamed protein product                                137   3e-31   
gb|EYU17714.1|  hypothetical protein MIMGU_mgv1a006864mg                133   3e-31   
ref|XP_011087139.1|  PREDICTED: putative late blight resistance p...    137   3e-31   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...    136   4e-31   
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...    136   4e-31   
emb|CDP08038.1|  unnamed protein product                                137   4e-31   
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg                135   4e-31   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg                135   4e-31   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...    136   5e-31   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...    136   5e-31   
emb|CDP08024.1|  unnamed protein product                                135   5e-31   
ref|XP_011072171.1|  PREDICTED: putative late blight resistance p...    136   5e-31   
emb|CDP11160.1|  unnamed protein product                                137   5e-31   
gb|EYU17711.1|  hypothetical protein MIMGU_mgv1a001090mg                136   5e-31   
emb|CDP15268.1|  unnamed protein product                                136   7e-31   
emb|CDP21314.1|  unnamed protein product                                129   7e-31   
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...    132   8e-31   
emb|CDP12799.1|  unnamed protein product                                136   9e-31   
emb|CDP17920.1|  unnamed protein product                                136   9e-31   
gb|EYU17692.1|  hypothetical protein MIMGU_mgv1a019705mg                134   9e-31   
ref|XP_006365690.1|  PREDICTED: putative late blight resistance p...    133   9e-31   
emb|CDP15990.1|  unnamed protein product                                134   1e-30   
gb|AAT39951.2|  Disease resistance protein, putative                    136   1e-30   
emb|CDP20463.1|  unnamed protein product                                135   1e-30   
gb|EYU17684.1|  hypothetical protein MIMGU_mgv1a023183mg                135   1e-30   
gb|EYU22169.1|  hypothetical protein MIMGU_mgv1a001998mg                134   1e-30   
ref|XP_011072172.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg                134   1e-30   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...    134   1e-30   
gb|EYU17704.1|  hypothetical protein MIMGU_mgv1a025955mg                134   1e-30   
gb|EYU24353.1|  hypothetical protein MIMGU_mgv1a022376mg                134   1e-30   
ref|XP_011072180.1|  PREDICTED: putative late blight resistance p...    134   2e-30   
ref|XP_009600479.1|  PREDICTED: putative late blight resistance p...    134   2e-30   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...    135   2e-30   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...    135   2e-30   
ref|NP_001234202.1|  NRC1                                               134   2e-30   
gb|EYU17706.1|  hypothetical protein MIMGU_mgv11b023458mg               133   2e-30   
emb|CDP13440.1|  unnamed protein product                                133   2e-30   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...    133   2e-30   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg                134   3e-30   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg                134   3e-30   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...    135   3e-30   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...    135   3e-30   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    134   3e-30   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...    134   3e-30   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...    134   3e-30   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...    134   3e-30   
emb|CDP04878.1|  unnamed protein product                                134   4e-30   
gb|EYU17759.1|  hypothetical protein MIMGU_mgv1a001467mg                133   4e-30   
emb|CDP17919.1|  unnamed protein product                                134   5e-30   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...    133   6e-30   
emb|CDP13141.1|  unnamed protein product                                132   6e-30   
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...    133   6e-30   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...    132   6e-30   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...    132   6e-30   
emb|CDP11611.1|  unnamed protein product                                133   7e-30   
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...    132   8e-30   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    132   9e-30   
gb|AAF76312.1|AF220603_4  Prf                                           133   1e-29   
ref|XP_011071970.1|  PREDICTED: putative late blight resistance p...    132   1e-29   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg                131   1e-29   
gb|AAT40487.1|  putative disease resistance protein                     133   1e-29   
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...    132   1e-29   
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...    132   2e-29   
gb|AAC49408.1|  PRF                                                     132   2e-29   
gb|AAF76308.1|  Prf                                                     132   2e-29   
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...    131   2e-29   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...    132   2e-29   
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...    131   2e-29   
emb|CDP10338.1|  unnamed protein product                                131   2e-29   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...    132   2e-29   
gb|EYU23615.1|  hypothetical protein MIMGU_mgv1a019724mg                130   2e-29   
emb|CDP04755.1|  unnamed protein product                                130   2e-29   
emb|CDP04885.1|  unnamed protein product                                131   3e-29   
emb|CDP12797.1|  unnamed protein product                                131   3e-29   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                130   3e-29   
gb|EYU43578.1|  hypothetical protein MIMGU_mgv1a025232mg                130   4e-29   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...    130   4e-29   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg                130   5e-29   
emb|CDP10267.1|  unnamed protein product                                130   5e-29   
gb|EYU24185.1|  hypothetical protein MIMGU_mgv1a024774mg                130   6e-29   
ref|XP_004243045.1|  PREDICTED: putative late blight resistance p...    127   6e-29   
emb|CDP11830.1|  unnamed protein product                                129   7e-29   
emb|CDP11161.1|  unnamed protein product                                129   7e-29   
emb|CDP05441.1|  unnamed protein product                                129   8e-29   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...    129   8e-29   
ref|XP_004236955.1|  PREDICTED: putative late blight resistance p...    130   8e-29   
emb|CDP11548.1|  unnamed protein product                                129   9e-29   
gb|EYU23536.1|  hypothetical protein MIMGU_mgv1a001875mg                129   9e-29   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...    129   9e-29   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...    130   9e-29   
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg               129   1e-28   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...    129   1e-28   
emb|CDP08040.1|  unnamed protein product                                127   1e-28   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg                129   1e-28   
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...    123   1e-28   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...    129   1e-28   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...    129   1e-28   
emb|CDP21300.1|  unnamed protein product                                129   1e-28   
gb|EYU23519.1|  hypothetical protein MIMGU_mgv1a022028mg                129   1e-28   
emb|CDP11649.1|  unnamed protein product                                129   1e-28   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...    129   2e-28   
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg                128   2e-28   
emb|CDP11163.1|  unnamed protein product                                129   2e-28   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg                128   2e-28   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg                128   2e-28   
ref|XP_004236958.1|  PREDICTED: putative late blight resistance p...    128   2e-28   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...    128   2e-28   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...    128   2e-28   
emb|CDP08023.1|  unnamed protein product                                129   2e-28   
gb|EYU23544.1|  hypothetical protein MIMGU_mgv1a019656mg                128   2e-28   
gb|EYU23566.1|  hypothetical protein MIMGU_mgv1a020047mg                128   2e-28   
emb|CDP04754.1|  unnamed protein product                                128   3e-28   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...    127   3e-28   
emb|CDP16841.1|  unnamed protein product                                127   3e-28   
ref|XP_009800168.1|  PREDICTED: putative late blight resistance p...    126   3e-28   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...    127   3e-28   
gb|EYU17690.1|  hypothetical protein MIMGU_mgv1a023002mg                127   4e-28   
emb|CDP08021.1|  unnamed protein product                                127   4e-28   
emb|CDP16512.1|  unnamed protein product                                127   4e-28   
gb|AEW48197.1|  disease resistance protein RGH3                         127   5e-28   
ref|XP_009800164.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
gb|EYU23535.1|  hypothetical protein MIMGU_mgv1a024600mg                127   5e-28   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...    127   5e-28   
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg                126   6e-28   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg                127   6e-28   
ref|XP_009602411.1|  PREDICTED: putative late blight resistance p...    127   6e-28   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...    126   7e-28   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...    126   7e-28   
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg                126   7e-28   
emb|CDP10797.1|  unnamed protein product                                126   7e-28   
dbj|BAD15107.1|  hypothetical protein                                   122   7e-28   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg                126   8e-28   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...    126   8e-28   
ref|XP_009799406.1|  PREDICTED: putative late blight resistance p...    125   8e-28   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...    126   8e-28   
gb|EYU17703.1|  hypothetical protein MIMGU_mgv1a001093mg                126   8e-28   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...    119   9e-28   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg                126   9e-28   
emb|CDP17263.1|  unnamed protein product                                127   9e-28   
gb|AEW48205.1|  disease resistance protein RGH2                         126   1e-27   
ref|XP_009778434.1|  PREDICTED: putative late blight resistance p...    126   1e-27   
emb|CDP15849.1|  unnamed protein product                                126   1e-27   
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...    126   1e-27   
ref|XP_009762295.1|  PREDICTED: putative late blight resistance p...    117   1e-27   
ref|XP_009799404.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...    125   1e-27   
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...    126   2e-27   
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
gb|EYU24178.1|  hypothetical protein MIMGU_mgv1a024402mg                125   2e-27   
gb|EYU23555.1|  hypothetical protein MIMGU_mgv1a020380mg                125   2e-27   
gb|EYU23524.1|  hypothetical protein MIMGU_mgv1a025003mg                125   2e-27   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363    126   2e-27   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...    125   2e-27   
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...    124   2e-27   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg                124   2e-27   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...    125   3e-27   
gb|EYU40390.1|  hypothetical protein MIMGU_mgv1a018316mg                125   3e-27   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...    118   3e-27   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...    124   3e-27   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg                124   3e-27   
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...    125   3e-27   
emb|CDP21316.1|  unnamed protein product                                116   3e-27   
gb|EYU23532.1|  hypothetical protein MIMGU_mgv1a001026mg                124   3e-27   
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...    124   3e-27   
emb|CDP07957.1|  unnamed protein product                                125   4e-27   
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...    124   4e-27   
gb|EYU17780.1|  hypothetical protein MIMGU_mgv11b023716mg               122   4e-27   
emb|CDP04756.1|  unnamed protein product                                125   4e-27   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...    124   4e-27   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...    124   4e-27   
gb|EYU17739.1|  hypothetical protein MIMGU_mgv1a023631mg                124   4e-27   
emb|CDP11157.1|  unnamed protein product                                124   5e-27   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...    124   5e-27   
ref|XP_011072132.1|  PREDICTED: putative late blight resistance p...    122   5e-27   
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg                124   5e-27   
emb|CDP11974.1|  unnamed protein product                                124   6e-27   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...    124   6e-27   
gb|EYU17710.1|  hypothetical protein MIMGU_mgv1a021341mg                124   6e-27   
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg                124   6e-27   
ref|XP_009792813.1|  PREDICTED: putative late blight resistance p...    120   7e-27   
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...    123   7e-27   
emb|CDP16500.1|  unnamed protein product                                122   7e-27   
gb|EYU22116.1|  hypothetical protein MIMGU_mgv1a009581mg                119   7e-27   
ref|XP_011072123.1|  PREDICTED: putative late blight resistance p...    123   8e-27   
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg                123   8e-27   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg                123   8e-27   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg                123   9e-27   
emb|CDP11825.1|  unnamed protein product                                124   9e-27   
emb|CDP20159.1|  unnamed protein product                                124   9e-27   
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...    122   9e-27   
emb|CDP16515.1|  unnamed protein product                                123   1e-26   
emb|CDP00758.1|  unnamed protein product                                123   1e-26   
gb|EYU19311.1|  hypothetical protein MIMGU_mgv1a022681mg                123   1e-26   
ref|XP_009779607.1|  PREDICTED: putative late blight resistance p...    123   1e-26   
emb|CDP16498.1|  unnamed protein product                                123   1e-26   
ref|XP_009625968.1|  PREDICTED: putative late blight resistance p...    119   1e-26   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg                122   1e-26   
emb|CDP10810.1|  unnamed protein product                                123   1e-26   
gb|EYU17742.1|  hypothetical protein MIMGU_mgv1a023281mg                122   1e-26   
emb|CDP05594.1|  unnamed protein product                                123   1e-26   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...    122   2e-26   
emb|CDP20685.1|  unnamed protein product                                123   2e-26   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...    122   2e-26   
ref|XP_004239469.1|  PREDICTED: putative late blight resistance p...    122   2e-26   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...    122   2e-26   
ref|XP_009774297.1|  PREDICTED: putative late blight resistance p...    122   2e-26   
ref|XP_006360433.1|  PREDICTED: putative late blight resistance p...    118   2e-26   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg                122   2e-26   
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...    122   3e-26   
ref|XP_009757879.1|  PREDICTED: putative late blight resistance p...    122   3e-26   
gb|AAV88066.1|  NBS-LRR protein                                         121   3e-26   
ref|XP_009604446.1|  PREDICTED: putative late blight resistance p...    120   3e-26   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg                121   3e-26   
gb|EYU22214.1|  hypothetical protein MIMGU_mgv1a001216mg                121   3e-26   
gb|EYU23527.1|  hypothetical protein MIMGU_mgv1a026455mg                121   4e-26   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...    121   4e-26   
gb|EYU22052.1|  hypothetical protein MIMGU_mgv1a023195mg                121   4e-26   
ref|XP_009596917.1|  PREDICTED: disease resistance protein RPP13-...    121   4e-26   
emb|CDP18676.1|  unnamed protein product                                121   5e-26   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...    115   5e-26   
gb|EYU23504.1|  hypothetical protein MIMGU_mgv1a021434mg                120   6e-26   



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 215/350 (61%), Gaps = 16/350 (5%)
 Frame = -3

Query  1183  PSICSFIAFGR------------VQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLA  1040
             P   SF+ FGR                  F+ L VLDI FQ F   P EI  L  L+YLA
Sbjct  519   PCASSFLCFGRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHLPCEIWKLSTLKYLA  578

Query  1039  IGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGT--R  866
             +  F+ LPPS   L  LQTLIR+ + A + LP E W++K LRH+YF+K  +FP+  +  +
Sbjct  579   LASFSVLPPSVCNLRYLQTLIRYSHQASICLPAEIWEIKNLRHLYFRKCCYFPIVQSIQK  638

Query  865   MTWYGERHWDLP--KLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYL  692
              +    RH +L   KL+T+SY++FGS  R +L ++  LKKLG+RE E E L  EQ+   L
Sbjct  639   DSLGSSRHSNLALTKLRTISYITFGSIKRRVLKRMHKLKKLGIRESEEECLTAEQMSGNL  698

Query  691   NNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVK  512
               L +L  LE  K FF K       D FPP+LK+L+LRGCQ PW +M++L  LP LEV+K
Sbjct  699   KKLVLLEHLETFKGFFIKPWLPKQCDVFPPTLKKLTLRGCQLPWDQMTILCKLPKLEVLK  758

Query  511   LKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPI  332
             LK YAF+GS+WE  +E F QLK +L+D  DL  W+ASSI FPKL++LVLK C  L EIP 
Sbjct  759   LKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPD  818

Query  331   GFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
                E+ TL  IEL+ C+SS  DS +RIREEQ   GND   VRIH+  N E
Sbjct  819   DVAEIPTLLFIELYHCSSSADDSANRIREEQISMGNDDLVVRIHKFPNSE  868



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score =   265 bits (676),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 215/350 (61%), Gaps = 16/350 (5%)
 Frame = -3

Query  1183  PSICSFIAFGR------------VQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLA  1040
             P   SF+ FGR                  F+ L VLDI FQ F   P EI  L  L+YLA
Sbjct  519   PCASSFLCFGRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHLPCEIWKLSTLKYLA  578

Query  1039  IGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGT--R  866
             +  F+ LPPS   L  LQTLIR+ + A + LP E W++K LRH+YF+K  +FP+  +  +
Sbjct  579   LASFSVLPPSVCNLRYLQTLIRYSHQASICLPAEIWEIKNLRHLYFRKCCYFPIVQSIQK  638

Query  865   MTWYGERHWDLP--KLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYL  692
              +    RH +L   KL+T+SY++FGS  R +L ++  LKKLG+RE E E L  EQ+   L
Sbjct  639   DSLGSSRHSNLALTKLRTISYITFGSIKRRVLKRMHKLKKLGIRESEEECLTAEQMSGNL  698

Query  691   NNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVK  512
               L +L  LE  K FF K       D FPP+LK+L+LRGCQ PW +M++L  LP LEV+K
Sbjct  699   KKLVLLEHLETFKGFFIKPWLPKQCDVFPPTLKKLTLRGCQLPWDQMTILCKLPKLEVLK  758

Query  511   LKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPI  332
             LK YAF+GS+WE  +E F QLK +L+D  DL  W+ASSI FPKL++LVLK C  L EIP 
Sbjct  759   LKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPD  818

Query  331   GFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
                E+ TL  IEL+ C+SS  DS +RIREEQ   GND   VRIH+  N E
Sbjct  819   DVAEIPTLLFIELYHCSSSADDSANRIREEQISMGNDDLVVRIHKFPNCE  868



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score =   264 bits (674),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 214/348 (61%), Gaps = 16/348 (5%)
 Frame = -3

Query  1183  PSICSFIAFGR------------VQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLA  1040
             P   SF+ FGR                  F+ L VLDI FQ F   P EI  L  L+YLA
Sbjct  519   PCASSFLCFGRDGTPRCCSQVDSFVTFTNFKWLTVLDICFQPFDHLPCEIWKLSTLKYLA  578

Query  1039  IGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGT--R  866
             +  F+ LPPS   L  LQTLIR+ + A + LP E W++K LRH+YF+K  +FP+  +  +
Sbjct  579   LASFSVLPPSVCNLRYLQTLIRYSHQASICLPAEIWEIKNLRHLYFRKCCYFPIVQSIQK  638

Query  865   MTWYGERHWDLP--KLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYL  692
              +    RH +L   KL+T+SY++FGS  R +L ++  LKKLG+RE E E L  EQ+   L
Sbjct  639   DSLGSSRHSNLALTKLRTISYITFGSIKRRVLKRMHKLKKLGIRESEEECLTAEQMSGNL  698

Query  691   NNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVK  512
               L +L  LE  K FF K       D FPP+LK+L+LRGCQ PW +M++L  LP LEV+K
Sbjct  699   KKLVLLEHLETFKGFFIKPWLPKQCDVFPPTLKKLTLRGCQLPWDQMTILCKLPKLEVLK  758

Query  511   LKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPI  332
             LK YAF+GS+WE  +E F QLK +L+D  DL  W+ASSI FPKL++LVLK C  L EIP 
Sbjct  759   LKHYAFQGSEWESTDERFQQLKFLLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPD  818

Query  331   GFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHN  188
                E+ TL  IEL+ C+SS  DS +RIREEQ   GND   VRIH+  N
Sbjct  819   DVAEIPTLLFIELYHCSSSADDSANRIREEQISMGNDDLVVRIHKFPN  866



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score =   253 bits (647),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 211/370 (57%), Gaps = 36/370 (10%)
 Frame = -3

Query  1183  PSICSFIAFGR------------VQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLA  1040
             P   SF+ FGR                  F  L VLDISFQ F   P EI  L  LRYLA
Sbjct  519   PHASSFLCFGRDGTPGSCSQVDSFITFTNFTWLTVLDISFQPFDHLPCEIWQLFSLRYLA  578

Query  1039  IGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHF--------  884
             +  F  LPPS   L  LQTLIR+ + A + LP E W+++ LRH+YF+K  +F        
Sbjct  579   LASFTMLPPSICNLRYLQTLIRYSHQASICLPAEIWEIEPLRHLYFRKCCYFRYVQSEQK  638

Query  883   ----------------PVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkk  752
                             P      + +   +  L KLQTLSY++FGS  R I   +P LKK
Sbjct  639   DHQGTSSRSNLGLTRWPTFSYHPSEFSRSNLGLTKLQTLSYITFGSIKRRIFKGMPKLKK  698

Query  751   lglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGC  572
             LG+RE E E+L  +++   L  L +L  LE LKCFF K   L   D FPP+LK+L+LRGC
Sbjct  699   LGIRESEEEHLTAKKMSRKLKKLVLLEKLETLKCFFIKPWILKERDVFPPTLKKLTLRGC  758

Query  571   QRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSIN  392
             Q PW +M++L  LP LEV+KLKDYAF+GS+WE  +E F QLK +L+D  DL  W   SI 
Sbjct  759   QLPWNQMTILCMLPELEVLKLKDYAFQGSEWESTDERFQQLKFLLLDGTDLIHWIVDSIQ  818

Query  391   FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFT  212
             FPKL+SLVLK C  L EIP    E+ TLQ IEL+ C+SS   S +RI+EEQ   GND   
Sbjct  819   FPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVSANRIQEEQHSMGNDDLV  878

Query  211   VRIHRGHNDE  182
             VRIH+  N E
Sbjct  879   VRIHKFCNPE  888



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score =   222 bits (565),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 154/341 (45%), Positives = 195/341 (57%), Gaps = 17/341 (5%)
 Frame = -3

Query  1210  WNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL  1031
             +N  K  P+PS        ++  L  F++LRVL I   +F  FP EI  L  LRYL    
Sbjct  555   FNGLKHAPRPS-------KQIPFLARFKLLRVLAILHYTFQDFPLEITKLVHLRYLEFNC  607

Query  1030  FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYG  851
              +DL  S SEL  LQ LI    G    LP E WKMK LRH+  KK S FPVP +  T   
Sbjct  608   RDDLHCSVSELYNLQNLI---FGRYSDLPVEIWKMKLLRHLEVKKISSFPVPSSMYTTGS  664

Query  850   ERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLH  671
                  L  L+ LS LS   C+ E+ T+ PNLK+L L     E  RD      LN+L  L 
Sbjct  665   SS--KLQNLEVLSDLSISCCSNEMFTRTPNLKRLKLHGAWEECRRDTISQ-MLNSLYCLP  721

Query  670   CLEKLKCFFTKQ---RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
              LE LK   +++    PLPS    P SL +L+LR    PW++M+ +  LPNL+V+K+KD 
Sbjct  722   QLEILKIICSRKLYPHPLPSTYVLPTSLVRLTLRCTYLPWEDMANIVMLPNLQVLKIKDN  781

Query  499   AFKGSQWELIEE-VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFG  323
              F G  W L +E +F QLK +LID  +++ W+A S+NFPKLQ LVLK C +L EIP   G
Sbjct  782   GFDGDAWRLSDEQIFNQLKYLLIDRTNVKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIG  841

Query  322   EVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             EVYTL+SIEL  C +S   SV  I+EEQE  GND  +VRIH
Sbjct  842   EVYTLESIELLNCRTSAAKSVKEIQEEQESMGNDCLSVRIH  882



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score =   217 bits (553),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 187/318 (59%), Gaps = 10/318 (3%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP EI  L  LRYL     +DL  S SEL  LQ LI   + 
Sbjct  571   LARFKLLRVLAILHYTFQDFPLEITKLVHLRYLEFNCHDDLQCSVSELYNLQNLIFRRHS  630

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                 LP E WKMK LRH+  KK S FPVP +  T        L  L+ LS LS   C+ E
Sbjct  631   D---LPVEIWKMKLLRHLEVKKISSFPVPSSTYTTGSSS--KLQNLEVLSDLSISCCSNE  685

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPSPDA  611
             + T+ PNLK+L L     E  RD      LN+L  L  LE LK   +++    PLPS   
Sbjct  686   MFTRTPNLKRLKLHGAWEECRRDTISQT-LNSLYCLTELEILKIKCSRKLYPHPLPSKYV  744

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQLKVMLI  434
              P SL +L+LR    PW++M+ +  LPNL+V+K+KD  F G  W L  EE+F QLK +LI
Sbjct  745   LPNSLMRLTLRCTYLPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLKFLLI  804

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  +L++W+A S+NFPKLQ LVLK C +L EIP   GE+YTL+SIEL  C +S   SV  
Sbjct  805   DRTNLKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKSVKE  864

Query  253   IREEQEDSGNDGFTVRIH  200
             I+EEQE  GND  +VRIH
Sbjct  865   IQEEQESMGNDCLSVRIH  882



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 186/318 (58%), Gaps = 12/318 (4%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP E+  L  LRYL    ++DL  S SEL  LQ L+    G
Sbjct  570   LARFKLLRVLAILQYTFREFPLELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLVF---G  626

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                 LP + WKMK LRH++ +K S F VP ++        + L  L+ LS +S   C + 
Sbjct  627   GHSNLPVDIWKMKLLRHLHVRKISSFRVPSSKEG----SGFKLQNLEGLSDISISCCTKG  682

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPSPDA  611
             + T  PNLK+L +     E  RD      LNNL  L+ LE LK   +++    PLPS  A
Sbjct  683   LFTGFPNLKRLKIHGAWAECRRDMIFQT-LNNLSCLNKLEILKIICSRKLYPHPLPSKYA  741

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQLKVMLI  434
              P SLK+L+LR    PW++M+ +  LPNL+V+K+KD  F G  W L  +E F QLK +LI
Sbjct  742   LPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLI  801

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  +L+ W+A S+NFPKL+ LVLK C +L EIP   GE+ TL+SIEL  C SS   SV  
Sbjct  802   DRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKE  861

Query  253   IREEQEDSGNDGFTVRIH  200
             I+EEQE   ND  +VRIH
Sbjct  862   IQEEQESMANDILSVRIH  879



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score =   211 bits (538),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 186/318 (58%), Gaps = 12/318 (4%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP E+  L  LRYL    ++DL  S SEL  LQ L+    G
Sbjct  570   LARFKLLRVLAILQYTFREFPLELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLVF---G  626

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                 LP + WKMK LRH++ +K S F VP ++        + L  L+ LS +S   C + 
Sbjct  627   GHSNLPVDIWKMKLLRHLHVRKISSFRVPSSKEG----SGFKLQNLEGLSDISISCCTKG  682

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPSPDA  611
             + T  PNLK+L +     E  RD      LNNL  L+ LE LK   +++    PLPS  A
Sbjct  683   LFTGFPNLKRLKIHGAWAECRRDMIFQT-LNNLSCLNKLEILKIICSRKLYPHPLPSKYA  741

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQLKVMLI  434
              P SLK+L+LR    PW++M+ +  LPNL+V+K+KD  F G  W L  +E F QLK +LI
Sbjct  742   LPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLI  801

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  +L+ W+A S+NFPKL+ LVLK C +L EIP   GE+ TL+SIEL  C SS   SV  
Sbjct  802   DRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKE  861

Query  253   IREEQEDSGNDGFTVRIH  200
             I+EEQE   ND  +VRIH
Sbjct  862   IQEEQESMANDILSVRIH  879



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score =   211 bits (538),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 186/318 (58%), Gaps = 12/318 (4%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP E+  L  LRYL    ++DL  S SEL  LQ L+    G
Sbjct  554   LARFKLLRVLAILQYTFREFPLELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLVF---G  610

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                 LP + WKMK LRH++ +K S F VP ++        + L  L+ LS +S   C + 
Sbjct  611   GHSNLPVDIWKMKLLRHLHVRKISSFRVPSSKEG----SGFKLQNLEGLSDISISCCTKG  666

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPSPDA  611
             + T  PNLK+L +     E  RD      LNNL  L+ LE LK   +++    PLPS  A
Sbjct  667   LFTGFPNLKRLKIHGAWAECRRDMIFQT-LNNLSCLNKLEILKIICSRKLYPHPLPSKYA  725

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQLKVMLI  434
              P SLK+L+LR    PW++M+ +  LPNL+V+K+KD  F G  W L  +E F QLK +LI
Sbjct  726   LPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLKFLLI  785

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  +L+ W+A S+NFPKL+ LVLK C +L EIP   GE+ TL+SIEL  C SS   SV  
Sbjct  786   DRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSVKE  845

Query  253   IREEQEDSGNDGFTVRIH  200
             I+EEQE   ND  +VRIH
Sbjct  846   IQEEQESMANDILSVRIH  863



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 180/319 (56%), Gaps = 18/319 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI--RWCNG  962
             G+ +LRVLD+    F  FP+EI  L  LRYLA      LPPS +EL  LQTL+   W  G
Sbjct  643   GYRLLRVLDLIIVRFFHFPAEITKLVHLRYLAFTYNEALPPSIAELWNLQTLVYHNWTFG  702

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP-GTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
              C + P E W M +LRH+        PVP   RM   G        LQTLS +    C+ 
Sbjct  703   KCPVFPVEIWMMPKLRHLCIT-PCRLPVPQNVRMLVLG-------NLQTLSEVRNLRCSV  754

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF-----TKQRPLPS  620
             +I  ++PNLK+LG+  E        +    L  L  LH LE LK  F       +   P 
Sbjct  755   DIFKRIPNLKELGISYEVSPSENWSKY--QLEALVNLHQLETLKLLFKYSSHASEIVNPP  812

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
               AFP  LK+L L GC  PW  M+++ ALPNLEV+KL+  A +G +WE +EE FCQLK +
Sbjct  813   KLAFPEKLKRLILAGCGIPWSSMTIVGALPNLEVLKLRKNACQGIEWEPVEEQFCQLKHL  872

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             L++  DL QW A+  +FP+LQ LV++ C  L+EIP G GE+ TL+ IEL +C+ S   S 
Sbjct  873   LLEEVDLVQWVANETHFPRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSA  932

Query  259   DRIREEQEDSGNDGFTVRI  203
             ++I+EEQE  GN+   V I
Sbjct  933   EKIQEEQEGLGNEELKVHI  951



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   207 bits (526),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 179/319 (56%), Gaps = 18/319 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI--RWCNG  962
             G+ +LRVLD+    F  FP+EI  L  LRYLA      LPPS +EL  LQTL+   W  G
Sbjct  414   GYRLLRVLDLIIVRFFHFPAEITKLVHLRYLAFTYNEALPPSIAELWNLQTLVYHNWTFG  473

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP-GTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
              C + P E W M +LRH+        PVP   RM   G        LQTLS +    C+ 
Sbjct  474   KCPVFPVEIWMMPKLRHLCIT-PCRLPVPQNVRMLVLG-------NLQTLSEVRNLRCSV  525

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF-----TKQRPLPS  620
             +I  ++PNLK+LG+  E        +    L  L  LH LE LK  F       +   P 
Sbjct  526   DIFKRIPNLKELGISYEVSPSENWSKY--QLEALVNLHQLETLKLLFKYSSHASEIVNPP  583

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
               AFP  LK+L L GC  PW  M+++ ALPNLEV+KL+  A +G +WE +EE FCQLK +
Sbjct  584   KLAFPEKLKRLILAGCGIPWSSMTIVGALPNLEVLKLRKNACQGVEWEPVEEQFCQLKHL  643

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             L++  DL QW A+  +FP LQ LV++ C  L+EIP G GE+ TL+ IEL +C+ S   S 
Sbjct  644   LLEEVDLVQWVANETHFPCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSA  703

Query  259   DRIREEQEDSGNDGFTVRI  203
             ++I+EEQE  GN+   V I
Sbjct  704   EKIQEEQEGLGNEELKVHI  722



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score =   206 bits (524),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 187/343 (55%), Gaps = 33/343 (10%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLDI+FQ F +FPSEI+ L  LRYLA+   ++ PP  S+   LQTLI        
Sbjct  633   FKLLRVLDITFQHFPQFPSEIMQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHLYSRSS  692

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILT  773
              LP E W M  LRH++ K S     P T++       W L  LQTL  ++   C +++ +
Sbjct  693   TLPWEIWTMPNLRHLHVKPSICLQSP-TKVECNRYSSWVLNNLQTLVNITLADCTKDVFS  751

Query  772   QVPNlkklglree------------------------egeylrdeqLVCYLNNLKVLHCL  665
               P LKKLG+ E                           + + D    C+  NL +L  L
Sbjct  752   STPKLKKLGICESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCF-RNLALLPQL  810

Query  664   EKLKCFFTKQRPLPSP------DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKD  503
             E LK F  K  P+  P      DA P +LK+L+L     PW+ M+ L  LPNLEV+KLK+
Sbjct  811   EALKIFGLKP-PVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKN  869

Query  502   YAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFG  323
             YAF G +WE +EE FC LK++LI+++DLEQW AS+ +FP L+ LVLK C HL  IP   G
Sbjct  870   YAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLG  929

Query  322   EVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRG  194
              + TLQ IEL   + S   S   I+EEQ+  GND   VRI R 
Sbjct  930   FIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVRIERN  972



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score =   206 bits (523),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 187/343 (55%), Gaps = 33/343 (10%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLDI+FQ F +FPSEI+ L  LRYLA+   ++ PP  S+   LQTLI        
Sbjct  618   FKLLRVLDITFQHFPQFPSEIMQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHLYSRSS  677

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILT  773
              LP E W M  LRH++ K S     P T++       W L  LQTL  ++   C +++ +
Sbjct  678   TLPWEIWTMPNLRHLHVKPSICLQSP-TKVECNRYSSWVLNNLQTLVNITLADCTKDVFS  736

Query  772   QVPNlkklglree------------------------egeylrdeqLVCYLNNLKVLHCL  665
               P LKKLG+ E                           + + D    C+  NL +L  L
Sbjct  737   STPKLKKLGICESIDYTYPVQIPWSDFLYTSEKLWPYSSDTMSDLWSDCF-RNLALLPQL  795

Query  664   EKLKCFFTKQRPLPSP------DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKD  503
             E LK F  K  P+  P      DA P +LK+L+L     PW+ M+ L  LPNLEV+KLK+
Sbjct  796   EALKIFGLKP-PVQEPKLARHLDALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKLKN  854

Query  502   YAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFG  323
             YAF G +WE +EE FC LK++LI+++DLEQW AS+ +FP L+ LVLK C HL  IP   G
Sbjct  855   YAFTGPKWEQVEEGFCSLKLLLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLG  914

Query  322   EVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRG  194
              + TLQ IEL   + S   S   I+EEQ+  GND   VRI R 
Sbjct  915   FIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVRIERN  957



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score =   202 bits (514),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 184/345 (53%), Gaps = 37/345 (11%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLDI+FQ F +FPSEIL L  LRYLA+   ++ PP  S+   LQTLI        
Sbjct  582   FKLLRVLDITFQHFPQFPSEILQLVNLRYLAVATGSEFPPLVSQFWSLQTLILHLYSRSS  641

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILT  773
              LP E W M  LRH++ K S   P P T++         L  LQTL  ++   C +++ +
Sbjct  642   TLPWEIWTMPNLRHLHVKPSICLPSP-TKVECNRYSSLVLNNLQTLVNITLADCTKDVFS  700

Query  772   QVPNlkklglreeegeylrdeq------------------------LVCYLNNLKVLHCL  665
               P LKKLG+ E        +                           C+  NL +L  L
Sbjct  701   STPKLKKLGICESIEYTYPVQIPWSDFLYTSEKLWPYGSETISDLWSDCF-RNLALLPQL  759

Query  664   EKLKCFFTK--------QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKL  509
             E LK F  K         R L   DA P +LK+L+L     PW+ M+ L  LPNLEV+KL
Sbjct  760   EALKIFGLKPPVQELKLARHL---DALPENLKKLTLSFTYLPWESMTSLCRLPNLEVLKL  816

Query  508   KDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIG  329
             K+YAF G +WE +EE FC LK++LI+++DLE W AS+ +FP L+ LVLK C HL  IP  
Sbjct  817   KNYAFTGPKWEQVEEGFCSLKLLLIEMSDLEHWSASNDHFPCLEHLVLKGCLHLDSIPHE  876

Query  328   FGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRG  194
              G++ TLQ IEL   + S   S   I+EEQ+  GND   VRI R 
Sbjct  877   LGDIPTLQIIELENSSQSALLSAKEIQEEQQSYGNDALEVRIERN  921



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score =   202 bits (513),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 190/327 (58%), Gaps = 7/327 (2%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLDI       FP EI+ L  LRYLA+ +  +LP S  +L  LQTLI        
Sbjct  563   FKLLRVLDIELLQSNHFPIEIVELIHLRYLALAINCELPRSIFKLQNLQTLIIDHIWEGQ  622

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG-SCAREIL  776
              LP E W M +LRH+  K+  +FP+P +R     +  + L  LQT+S L+   SC++E+ 
Sbjct  623   YLPREIWMMPQLRHIRLKRGCYFPLPYSRGI-KEKSQFVLQNLQTISTLTGPFSCSKEVF  681

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT---KQRPLPSPDAFP  605
               +P LKKL +   E     ++    Y +NL  L+ LE LKC F    ++  LPS D FP
Sbjct  682   ACLPALKKLEIFATESNSKAEQTSE-YFSNLASLNLLETLKCSFLYRPRKHRLPSGDHFP  740

Query  604   PSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIA  425
              +LK+L+L G   PW++M+ L+ LP LEV+KL+ +AF+G  W  +E  F QLK++L++ +
Sbjct  741   ANLKKLTLSGSFLPWEDMAKLAVLPKLEVLKLRSFAFEGQIWGAVEGGFFQLKLLLVENS  800

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
             D   W+A + +FP LQ LVL+ C  L EIP G G++ TLQ IE+ +C+     S  +I +
Sbjct  801   DPMSWDADASHFPSLQQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRSARKIHQ  860

Query  244   EQEDSGNDGFTVRIHRGHNDE*HSNLP  164
             +Q+  GND   +RI     D  HS  P
Sbjct  861   QQQILGNDELGIRIITTSGDN-HSASP  886



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score =   201 bits (512),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 180/318 (57%), Gaps = 12/318 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR--WCNG  962
             GF  LRVLDI    F  FPS+I+ L  LRYL       LPPS S+L  LQT++   W  G
Sbjct  763   GFRFLRVLDIIVIHFSEFPSDIIRLFHLRYLGFTYKGPLPPSISKLRNLQTVVHHNWTFG  822

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP-GTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
                +LP E W M  LRH+YF  S   P P G ++         L  LQ L  +    C++
Sbjct  823   KYPLLPIEIWTMPNLRHLYFMPSC-LPDPLGGQV--LANNFVVLENLQALLDIRNFRCSK  879

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC------FFTKQRPLP  623
             +IL ++PNLKKLG+  +       +     L +L  LH LE LK       + T +   P
Sbjct  880   DILKRIPNLKKLGISYDVSSQAYVDWSQFELESLVNLHQLETLKIVIKNDPYRTSKFVNP  939

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                AFP  LK+L+L GC  PW+ M+++ +LPNLEV+KLK  A +G +WE +EE FC+LK 
Sbjct  940   PQLAFPQKLKRLTLSGCGLPWETMTIVGSLPNLEVLKLKKDACRGQEWEPVEEQFCRLKY  999

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             +L++  DL QW  +  +FP LQSL+++ C  LREIP   G++ TLQ IEL +C+ S   S
Sbjct  1000  LLLEELDLVQWRTNEAHFPCLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTS  1059

Query  262   VDRIREEQEDSGNDGFTV  209
               +I+EEQE   N+   V
Sbjct  1060  AKQIQEEQESMANEDLKV  1077



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score =   197 bits (502),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 194/330 (59%), Gaps = 21/330 (6%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFN---DLPPSFSEL  998
             F        L  F++LRVL I   +F  FP  I  L  LRYL I  FN    +  S SEL
Sbjct  582   FYGLNNDSLLGQFKLLRVLAILDCTFHYFPLVIKKLVHLRYLHI--FNCHEYIHSSVSEL  639

Query  997   CRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQT  818
               LQTLI    G    LP E WKMK LRH+  K+ S+F VP ++        + L  L+ 
Sbjct  640   YNLQTLIF---GQYSGLPVEIWKMKILRHLEVKRISYFCVPSSKEG----SSFKLQNLEQ  692

Query  817   LSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLK--CFF  644
             LSYL+   C  ++ + +PNLK+L +  ++G    ++     LN+L  L+ LE LK  C+ 
Sbjct  693   LSYLNISCCTEKLFSGIPNLKRLKIYGDKGNMTSEK-----LNSLSCLNKLETLKITCYR  747

Query  643   TK-QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE  467
                +RP  S  A P SLK+L+L     PW++M+ +  LPNL+V+K+KD  F   +W L +
Sbjct  748   GYYERPPQSKFALPTSLKRLTLESTYLPWEDMANIVMLPNLQVLKIKDNGFVDGRWRLND  807

Query  466   E-VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
             E +F QLK +LI   DLEQW+A S+NFP+LQ LVLK C  L++IP   GE+YTL+SIEL 
Sbjct  808   EMIFNQLKFLLIHKTDLEQWKAGSVNFPELQCLVLKECISLKKIPQDIGEIYTLESIELH  867

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
              C++S  +SV +I++EQ+  GND  TV ++
Sbjct  868   NCSTSAENSVKKIQKEQKSMGNDCLTVLVN  897



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 183/320 (57%), Gaps = 20/320 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F RFP EI  L  LRYL    ++ +  S SEL  LQT I     
Sbjct  565   LVSFKLLRVLAILKVTFQRFPLEITKLVQLRYLQFTCYDHIHWSVSELYNLQTFILGYEV  624

Query  961   ACLI---LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSC  791
             A L+   +P E W+M+ LRH++      FP+P  +          L  LQ LS L+  SC
Sbjct  625   AGLLPPTIPVEIWQMRNLRHLHIGDFFSFPIPSNK----------LQNLQELSCLALTSC  674

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP--LPSP  617
               E+ + +PNLKKL +       ++ E    +LN+L  L  LE LK      +P  +PS 
Sbjct  675   TSELFSAIPNLKKLQIVGNYLMEMKRE----HLNSLSCLKELEILKYRDDGIQPSRIPSM  730

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVM  440
              A P SLK+L+L     PW++M+ +  LPNLEV+K+KD  F G  W+L  EE+F QLK +
Sbjct  731   YALPTSLKRLTLCFTSLPWEDMANIVKLPNLEVLKIKDNGFLGDVWKLNDEEIFNQLKFL  790

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             LI    L+ WEASS+NFPKLQ L LK C +L EIP  FGE+ TL+SIEL +C+ S   S 
Sbjct  791   LISWTGLKHWEASSVNFPKLQRLFLKRCMNLEEIPQDFGEICTLESIELHDCSISAAKSG  850

Query  259   DRIREEQEDSGNDGFTVRIH  200
               I+EEQE  GN+   V I+
Sbjct  851   KDIKEEQESMGNECLCVLIY  870



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score =   197 bits (500),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 191/350 (55%), Gaps = 22/350 (6%)
 Frame = -3

Query  1228  FYSDVDWNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
              Y D D  +       ++  F        L  F++LRVL I   +F  FP  I  L  LR
Sbjct  556   IYDDDDLRESSSSNTRTLHFFYGLNNDSLLGRFKLLRVLAILDCTFHYFPLVIKKLVHLR  615

Query  1048  YLAIGLFN---DLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPV  878
             YL I  FN   D+  S SEL  LQTLI    G    L  E WKMK LRHV  K  S F V
Sbjct  616   YLHI--FNCHEDIHSSVSELYNLQTLIF---GQYSGLSVEIWKMKLLRHVEIKGISDFCV  670

Query  877   PGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVC  698
             P ++        + L  L+ LSYL    C  ++ + +PNLK L +   +G+   +     
Sbjct  671   PSSKEG----SSFKLQNLEHLSYLKISCCTEKLFSDIPNLKTLKIYGAKGDITSE-----  721

Query  697   YLNNLKVLHCLEKLKCFFTK---QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPN  527
              LN+L  L+ LE LK    +   +RP  S  A P SLK+L+L     PW++M+ +  LPN
Sbjct  722   -LNSLSCLNKLETLKIACNRRYYERPPQSKFALPTSLKRLTLESTYLPWEDMANIVMLPN  780

Query  526   LEVVKLKDYAFKGSQWELIEE-VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSH  350
             L+V+K+KD  F G  W L +E +F QLK +LI   +L+QW+A S+NFP+LQ LVLK C  
Sbjct  781   LQVLKIKDNGFDGDVWRLNDEMIFNQLKFLLIYETNLKQWKAGSVNFPELQCLVLKECRS  840

Query  349   LREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L+ IP   GE+YTL+SIEL  C++S   SV  I++EQ+  GND  TV I+
Sbjct  841   LKTIPQDIGEIYTLESIELHNCSTSAEKSVKNIQKEQKSMGNDCLTVLIN  890



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score =   194 bits (492),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 191/346 (55%), Gaps = 32/346 (9%)
 Frame = -3

Query  1201  YKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND  1022
             Y+    P  CSF        L  F ML++LD+   + + F  E+  L  LRYLA+    +
Sbjct  427   YRSPTHPEYCSF--------LGNFRMLKILDMVNSARVPFSPEVFELFHLRYLAVDYSIE  478

Query  1021  LPPSFSELCRLQTLI-------RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRM  863
             +P + S L  LQTLI       +      + LP + W + +LRH+        P P   +
Sbjct  479   IPATISNLQNLQTLIVHRGKIFKSYEPMMIFLPPKIWMIPQLRHLVSFVFGRLPDPERAI  538

Query  862   TWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNL  683
             +        L  LQTLS +    C  + L  +PNLKKL +    G+  ++ Q    LNNL
Sbjct  539   S-------PLENLQTLSEVRDFRCTEKFLKMIPNLKKLSISYFRGKNDQEYQ----LNNL  587

Query  682   KVLHCLEKLKC----FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVV  515
                H LEKLK      F  +R L    AFPPSLK+L+L G QRPW++M ++S LPNLEV+
Sbjct  588   LHFHQLEKLKVKIFPTFLFRRKLNL--AFPPSLKKLTLSGWQRPWEDMGIVSLLPNLEVL  645

Query  514   KLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIP  335
             KL+DYAF+G +WE  EE F  LK +L+D +DL+ W   S +FP L+ LVL  C  L+EIP
Sbjct  646   KLRDYAFRGYKWETSEEEFRCLKFLLLDKSDLQHWITESSHFPNLKCLVLYRCWCLKEIP  705

Query  334   IGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              GFGE+ TL+ I++ + N S  DS  +I+E Q+  GND F VR+ R
Sbjct  706   DGFGEIPTLELIKVDDGNISLVDSARQIQEVQQGWGNDAFQVRVGR  751



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score =   194 bits (492),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 189/361 (52%), Gaps = 37/361 (10%)
 Frame = -3

Query  1189  PKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             P+  I SF+ F  ++      +L +LDI+FQ F +FPSEI+ L  LRYLA+   ++ PP+
Sbjct  572   PQSPIFSFMDFKLLR------VLDILDINFQHFPQFPSEIMQLVNLRYLALATSSEFPPT  625

Query  1009  FSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLP  830
              S+   LQTLI         LP E WKM  LRH++ K S   P   T     G     L 
Sbjct  626   VSQFWSLQTLILHVYSRNSTLPREIWKMPNLRHLHIKPSICLP-SQTNEERNGYNSLVLN  684

Query  829   KLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrde---qLVCY------------  695
              LQTL+ ++   C  ++ +  P LKKLG+ E        +       Y            
Sbjct  685   NLQTLTNITLADCTTDVFSSTPKLKKLGICETVEYTYPVQIPWSDFLYTSENLWPYCSDT  744

Query  694   --------LNNLKVLHCLEKLKCFFTKQRPLPSP------DAFPPSLKQLSLRGCQRPWK  557
                     L NL +L  LE LK    +  P+  P      DA P +LK+L+L     PW+
Sbjct  745   ISDLWSDCLRNLALLPQLEALKIVGLRA-PVQVPKLAFHLDALPENLKKLTLSFTYLPWE  803

Query  556   EMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQ  377
              M+ L  LPNLEV+KLK YAF G++WE +EE FC LK++ I++ DLE W AS+ +FP L+
Sbjct  804   SMTSLCRLPNLEVLKLKPYAFTGTKWEQVEEGFCSLKLLQIEMFDLEHWSASNDHFPVLE  863

Query  376   SLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              LVLK C HL  IP   G++ TLQ IEL   + S   S   I+EEQ++ GN+   V++ R
Sbjct  864   HLVLKCCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQNIGNETLEVQLER  923

Query  196   G  194
              
Sbjct  924   N  924



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score =   192 bits (489),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 174/317 (55%), Gaps = 11/317 (3%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR--WCNG  962
             GF +LRVLDI    F  FPS+I+ L  LRYL       LPPS S+L  LQT++   W  G
Sbjct  665   GFRLLRVLDIILIHFSEFPSDIIRLFHLRYLGFTYNGPLPPSISKLRNLQTVVHHNWTFG  724

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                +LP E W M  LRH+Y   S   P P   +         L  LQTL  +    C++ 
Sbjct  725   KYHLLPIEIWTMPNLRHLYCMPSC-LPDPVGEI--LANNFVVLENLQTLLDVRNFRCSKN  781

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC------FFTKQRPLPS  620
             IL ++PNLKKLG+  +       ++    L +L  LH LE LK       + T +   P 
Sbjct  782   ILKRIPNLKKLGISYDVSSQAYVDRWQFNLESLANLHQLETLKIIIKNDPYRTSKFVNPP  841

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
               +FP  L +L+L GC  PW+ M+++  LP LEV+KLK  A +G +WE +EE FC+LK +
Sbjct  842   KLSFPRKLNRLTLSGCGLPWERMTIVGLLPCLEVLKLKKDACRGQEWETVEEQFCRLKYL  901

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             L++  DL QW      FP+LQSL+++ C  LREIP   G++ TLQ IEL +C+ S     
Sbjct  902   LLEELDLVQWRTKEAPFPRLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTWA  961

Query  259   DRIREEQEDSGNDGFTV  209
              +I+EEQE   N+   V
Sbjct  962   KQIQEEQESMANEDLKV  978



>ref|XP_009784309.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=330

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 174/325 (54%), Gaps = 16/325 (5%)
 Frame = -3

Query  1150  VQQLNGFEMLRVLDISFQS--FMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI  977
              Q  + F +LRVL +  +S     FP  I  L  LRYLA+  + DLP S SEL  LQ LI
Sbjct  8     AQVFSCFNLLRVLALFHESNEINLFPLMITKLFHLRYLAVKCYVDLPASISELQNLQILI  67

Query  976   ----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY  809
                 R  N +   LP + W MK LR ++    S+ P P  R      +H  +P L+ L  
Sbjct  68    QEKFRAKNTS---LPRKIWAMKNLRLMHLGTISYLPNP--RRNSIRNKHMGMPNLEELFG  122

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP  629
             L   SC  ++ + +PNLK+L + +      R +    Y  ++  L   E LKCF      
Sbjct  123   LCSTSCTNKVFSGIPNLKRLIIHQTPVSTERRDN---YFIDMSSLTKFEALKCFNYNLPC  179

Query  628   LPSPDAFPPSLKQLSLRGC-QRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFC  455
                   FP SLK+LS  GC   PW ++S L  LPNLE +KLKDYA KG  W L +E  F 
Sbjct  180   TIERFVFPTSLKRLSFDGCFSFPWADISTLVMLPNLEELKLKDYAVKGEVWRLRDEDKFE  239

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSS  275
              LK+++     LE+WEASS +FP L+ LVLK C  L+EIPI FGE+ TL+SIEL  C+ +
Sbjct  240   SLKLLVFSGLYLERWEASSDSFPNLKRLVLKKCFLLKEIPIDFGEICTLESIELHNCSIA  299

Query  274   TYDSVDRIREEQEDSGNDGFTVRIH  200
               DS   I +EQ D GN+   V I 
Sbjct  300   AEDSATIIEQEQADMGNNSLKVSIQ  324



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 188/363 (52%), Gaps = 41/363 (11%)
 Frame = -3

Query  1195  DLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLP  1016
             D+ + SI S+I          F++LRVLDI+ Q F +FPSEI  L  LRYLA+   ++ P
Sbjct  566   DISQSSIFSYI---------DFKLLRVLDITSQHFPQFPSEITQLVNLRYLALA-SSEFP  615

Query  1015  PSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD  836
             P+ S+   LQTLI         LP E WKM  LRH++ K S   P   T     G     
Sbjct  616   PAVSQFWSLQTLILHVYSRDSTLPREIWKMPNLRHLHIKPSICLP-SQTNEERSGHNSLV  674

Query  835   LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrde---qLVCY----------  695
             L  LQTL+ ++   C  ++ +  P LKKLG+ E        +       Y          
Sbjct  675   LNNLQTLTNITLADCTTDVFSSTPKLKKLGICETVEYTYPVQIPWSDFLYTSENLWPYCS  734

Query  694   ----------LNNLKVLHCLEKLKCFFTKQRPLPSP------DAFPPSLKQLSLRGCQRP  563
                       L NL +L  L+ LK       P+  P      DA P +LK+L+L     P
Sbjct  735   DTISDLWSDCLRNLALLPQLKALKIVGLTP-PVQVPKLALHLDALPENLKKLTLSFTYLP  793

Query  562   WKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPK  383
             W+ M+ L  LPNLEV+KLK+YAF G +WE +EE F  LK++LI+I+D++ W AS+ +FP 
Sbjct  794   WESMASLCRLPNLEVLKLKNYAFTGPKWEQVEEGFGSLKLLLIEISDIKHWSASNDHFPV  853

Query  382   LQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             L+ LVLK C HL  IP   G++ TLQ IEL   + S   S   I+EEQ+  GN+   VR+
Sbjct  854   LEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQSMGNETLEVRM  913

Query  202   HRG  194
              R 
Sbjct  914   ERN  916



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score =   188 bits (478),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 132/324 (41%), Positives = 183/324 (56%), Gaps = 20/324 (6%)
 Frame = -3

Query  1153  RVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR  974
             +V  L  F++LRVL I   +F  FP EI  L  LRYL    ++++  S S+L  LQT I 
Sbjct  557   QVPLLVSFKLLRVLAILNDTFPTFPLEITKLVQLRYLQFTCYDNIHWSVSKLYNLQTFIL  616

Query  973   WCNGACLI---LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLS  803
                 A L+   +PE  W+M+ LRH++      FP+P  +          L  LQ LS L+
Sbjct  617   GYGVAGLLPPTIPEGIWQMRNLRHLHIGDFFSFPIPSNK----------LQNLQELSRLA  666

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP--  629
               SC  E+ + +PNLKKL +       ++ E+    LN+L  L  LE LK      +P  
Sbjct  667   LSSCTCELFSAIPNLKKLKIIGNYLMEMKRER----LNSLSCLEKLEILKYRDDGIQPSQ  722

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQ  452
             +PS    P SLK+L+L     PW++M+ +  LPNLEV+K+KD  F G  W L  EE+F Q
Sbjct  723   IPSKYVLPASLKRLTLSCTSLPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFKQ  782

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             LK +LI    L+ W+A S+NFPKLQ L LK C +L EIP  FG++ TL+SIEL +C+ S 
Sbjct  783   LKFLLISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSISA  842

Query  271   YDSVDRIREEQEDSGNDGFTVRIH  200
               S   I+EEQE  GN+  +V I+
Sbjct  843   ATSGKNIQEEQESIGNECLSVLIY  866



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score =   188 bits (477),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 135/367 (37%), Positives = 190/367 (52%), Gaps = 26/367 (7%)
 Frame = -3

Query  1228  FYSDVDWNDYKDLPKPSICSFIAFGR----------VQQLNGFEMLRVLDISFQSFMRFP  1079
             F S++  ND  +L      S   +G+          +     F+ +RVL I    F  FP
Sbjct  513   FLSNISLNDSSELSSHVTRSMFFWGKLLISAPPHRQISLFASFKHIRVLAIFSHMFPAFP  572

Query  1078  SEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-----RWCNGACLILPEETWKMKELR  914
             +EI  L  LRYL I     LP S S L  LQTL+      +     L+LP + W M +LR
Sbjct  573   AEITQLTHLRYLWIQSNGGLPASVSHLYNLQTLVFQQPELYYMHKTLVLPRDIWNMTQLR  632

Query  913   HVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglree  734
              +     ++   P    T   +    L  L+ LS+L F SC  E+ + +PN++KL + + 
Sbjct  633   RLRLLSGNYLSKPKRSTT--TDDVLGLSNLEELSHLCFSSCTEEVFSCLPNIRKLSILDA  690

Query  733   egeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD--AFPPSLKQLSLRGCQRPW  560
               +   +     YL NL  L  LE LKC    Q+ L   +  A   S+K+L L GC    
Sbjct  691   ASDDASE-----YLKNLVHLEKLETLKCICYGQKRLTLSNWCASLTSVKRLVLSGCLLLS  745

Query  559   KEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQLKVMLIDIADLEQWEASSINFPK  383
             ++M+ L+ALPNLEV+KL+D  F+G  W L +E  F QLK +L+    L  WEA S+NFP 
Sbjct  746   EDMASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLSEPRLVNWEAGSVNFPN  805

Query  382   LQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             LQ LVL+ C  L EIP+  GE+ TL+ IEL  C+SS  +S + IREEQE  GN    +R+
Sbjct  806   LQKLVLRKCIRLEEIPLDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRV  865

Query  202   HRGHNDE  182
             +   +DE
Sbjct  866   Y-ADDDE  871



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/289 (43%), Positives = 168/289 (58%), Gaps = 18/289 (6%)
 Frame = -3

Query  1045  LAIGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVP-GT  869
             L+    + LP + S L  LQTL+      C  LP + W +++LRH++F   S  P P G 
Sbjct  492   LSTTHIDSLPSTISHLWNLQTLVLNIYSGCTTLPWKLWTIQQLRHLHFNFCSFLPNPAGA  551

Query  868   RMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLN  689
              +   G+    L  LQTLS LSF SC  +++  +PNLKKLGL E    +        Y++
Sbjct  552   EINGQGD--LVLRNLQTLSKLSFSSCTMQVIASLPNLKKLGLYETAEAHSNCW---SYIS  606

Query  688   NLKVLHCLEKLKC-----FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNL  524
             N+  LH LE LK      F  ++R +P  D FPP+LK+L+L     PWK+M+VLS LPNL
Sbjct  607   NVAQLHQLEILKLNFINLFAEERRWVPCVDEFPPNLKKLTLSSSYLPWKDMNVLSMLPNL  666

Query  523   EVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLR  344
             EV+KLK+ AF GS WE  EE F +LK +LID  DL  W A+S  FP L+ L L  C  LR
Sbjct  667   EVLKLKNNAFVGSDWEQYEEGFSRLKYLLIDKTDLVHWRATSTQFPSLKHLRLFRCRCLR  726

Query  343   EIPIGFGEVYTLQSIELWECNSSTYD---SVDRIREEQEDSGNDGFTVR  206
             E+P+ F E+  LQ I+++     +YD   SV +I++EQE  GND   VR
Sbjct  727   EVPLDFAEIPYLQIIDVY----GSYDAVRSVMQIKQEQESVGNDDLLVR  771



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score =   187 bits (476),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/313 (42%), Positives = 176/313 (56%), Gaps = 20/313 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP EI  L  LRYL    ++D+  S S+L  LQT I     
Sbjct  559   LVSFKLLRVLAILNVTFQTFPLEITKLVQLRYLQFTCYDDIHWSVSKLHNLQTFILGYGV  618

Query  961   ACLI---LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSC  791
             A L+   +P   W+M  LRH++      FP+P  +          L  LQ LS L+  SC
Sbjct  619   AGLLPPTIPAGIWQMSNLRHLHIGDFFSFPIPSNK----------LQNLQELSRLALTSC  668

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP--LPSP  617
               E+ + +PNLKKL +       ++ E+    LN+L  L  LE LK      +P  +PS 
Sbjct  669   TSELFSAIPNLKKLKIIGNYLMEMKRER----LNSLSCLKKLEILKYRDDGIQPSQIPSK  724

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVM  440
                P SLK+L+L     PWK+M+ +  LPNLEV+K+KD  F G +W L  EE+F QLK +
Sbjct  725   YVLPASLKRLTLSCTSLPWKDMANVITLPNLEVLKIKDNGFLGDEWMLNDEEIFKQLKFL  784

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             LI    L+ W+A S+NFPKLQ L LK C +L +IP  FGE+ TL+SIEL +C+ S   S 
Sbjct  785   LISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEKIPQDFGEICTLESIELHKCSISAAKSG  844

Query  259   DRIREEQEDSGND  221
               I+EEQE  GN+
Sbjct  845   KDIQEEQESMGNE  857



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score =   185 bits (470),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 178/345 (52%), Gaps = 36/345 (10%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPP-----------------  1013
             L GF++LR+LD+    F  FP+++L +  LR+L +    +LP                  
Sbjct  569   LMGFKLLRILDMISYYFNHFPTQVLKMIHLRFLGLSTSGELPAASSKLRRGSGKWYLPFS  628

Query  1012  -------SFSELCRLQTLI---RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRM  863
                    S S L  LQ LI    W    CL  P +   M +LRH+  K +  +       
Sbjct  629   KRSELPVSISNLVNLQILIVNWGWRENHCL--PFDIQTMTQLRHIRLKGAVVYFDDLFLA  686

Query  862   TWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNL  683
                      L  LQTL  +S  + +++I++ +PNLKKLG+   +           +LN L
Sbjct  687   ETSRANPLVLSNLQTLLTVSSTNFSKKIVSIIPNLKKLGILVSKKNDEHP---TNFLNYL  743

Query  682   KVLHCLEKLKCFFTKQRPLPSP----DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVV  515
               LHCLE L   F+ Q    S     +AFPP+L+ L+L G   PW+EM  +  +PNLEV+
Sbjct  744   SSLHCLETLNLSFSLQNEKSSTISQWNAFPPNLRALTLSGSHLPWEEMVTVGKIPNLEVL  803

Query  514   KLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIP  335
             KLKD AF G  WE I+  F  LK +L++  +LE W+A+S ++P LQ LVL+ C  L EIP
Sbjct  804   KLKDRAFSGQVWEPIDGGFLALKFLLLENNELEIWKATSTHYPSLQHLVLRLCDALIEIP  863

Query  334   IGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
              G GE+ TLQ IEL+ C  S   S  RI EEQ+  GND   VRI+
Sbjct  864   CGIGEIPTLQIIELYSCGHSAVRSAKRIHEEQQSIGNDDLEVRIN  908



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score =   184 bits (468),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 120/327 (37%), Positives = 176/327 (54%), Gaps = 20/327 (6%)
 Frame = -3

Query  1150  VQQLNG--FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFN-DLPPSFSELCRLQTL  980
             +QQ N   +++LRVLD+ +     FP  IL L  L YLA+ ++N  + P  S+L  L+TL
Sbjct  544   LQQKNSLVYKLLRVLDLGYIILDHFPVNILELVHLNYLALRIYNLRMLPPLSKLWNLETL  603

Query  979   IRWC-NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLS  803
             I     G  + LPE+ W+M +LRH+++     F       +      + L  LQT+S + 
Sbjct  604   ILVTEKGQIVTLPEDIWQMVKLRHLHYSGELEF----ESASLSSSTPFVLYNLQTISQVR  659

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLE------KLKCFFT  641
               S  +E+L ++PN                      L+ L++L  L        +  FF 
Sbjct  660   PSSSIQEVLARMPN-LVNLGCHLTLSDAMKHAQFPDLSRLRMLETLTFDYQTLNMAKFF-  717

Query  640   KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
                 LP P  FPP+LK+L+L G    WKEMS++  LPNLEV+K+KD  F   +WE+++E 
Sbjct  718   ----LPQPSKFPPNLKKLTLVGSYVDWKEMSIIGMLPNLEVLKIKDNFFNAPRWEVMDEA  773

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F  LK + +   DL+QW ASS +FP LQ LVL  C +L+EIP  F  + TL++IEL+  +
Sbjct  774   FSHLKFLKLSNTDLQQWSASSSSFPCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSS  833

Query  280   SSTYDSVDRIREEQEDSGNDGFTVRIH  200
              S  DS  +I++ Q   GNDG  V IH
Sbjct  834   QSVADSARQIQDSQRYMGNDGLKVLIH  860



>emb|CDP00687.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 189/354 (53%), Gaps = 23/354 (6%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPK-PSICSFIAFGRVQQLN--------GFEMLRVLDISFQSFMR  1085
             RL F+ D  ++D    P  P + SF+ F     +         GF++LRVLDI F  F  
Sbjct  21    RLSFHLD-PYSDVSAAPAIPHVSSFLCFTLGANIVPDILFFQLGFKLLRVLDIFFLHFDY  79

Query  1084  FPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RWC---NGACLILPEETWKMK  923
             FP +IL L  LRYLA+ +  +LP S S+L  LQTL+    W    +G    L  E W M 
Sbjct  80    FPDQILKLIHLRYLALNVTYELPASVSQLRNLQTLVIHGPWLCRESGGSPTLLLEYWSMP  139

Query  922   ELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklgl  743
              LRHV+   + H   P T       R +    LQTL  + F  C +E  + +P+LKKLG+
Sbjct  140   SLRHVHITAACHLKNPFTVQDNL-PRPFASEHLQTLYTIQFSCCTKEFFSVMPHLKKLGI  198

Query  742   reeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ----RPLPSPDAFPPSLKQLSLRG  575
              E + +Y  D      LNNL  L  LE L+C F  Q    R      A P +LK LSL  
Sbjct  199   CETKEDYSTDSLSQV-LNNLVCLQELETLECSFHTQNREVRKNLGLAALPVTLKHLSLSW  257

Query  574   CQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSI  395
                PW++M+ ++ LPNLEV+KLK+YAF+G +WE  EE F  LK +LI+  DL  WEA  +
Sbjct  258   SYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPTEEGFHSLKHLLIENTDLIHWEAIIV  317

Query  394   -NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
              +FP LQ LVLK C  L EIP G  E+ TLQ +E   C+    +S   I+E+ E
Sbjct  318   RHFPCLQHLVLKSCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQIE  371



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/361 (37%), Positives = 187/361 (52%), Gaps = 25/361 (7%)
 Frame = -3

Query  1228  FYSDVDWNDYKDLPKPSICSFIAFG----------RVQQLNGFEMLRVLDISFQSFMRFP  1079
             F S++  ND  +L      S   +G          ++     F+ +RVL I    F  FP
Sbjct  509   FLSNISLNDSSELSSHVTRSMFFWGELSISSPPHRQISLFASFKHIRVLAIISHMFPAFP  568

Query  1078  SEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-----RWCNGACLILPEETWKMKELR  914
             +EI  L  LRYL I     LP S S L  LQTL+      +     L+LP + W M +LR
Sbjct  569   AEITQLTHLRYLWIRSNGGLPASVSHLYNLQTLVFQQPELYYMHKTLVLPRDIWNMTQLR  628

Query  913   HVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglree  734
              +     ++   P    T   +    L  L+ LS+L F SC  E+ + +P+++K+ + + 
Sbjct  629   RLRLLSGNYLSKPKRSTT--TDDVLGLSNLEELSHLCFASCTEEVFSCLPSIRKVSILDA  686

Query  733   egeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD--AFPPSLKQLSLRGCQRPW  560
               +   +     YL NL  L  LE LKC    Q+ L   +  A   S+K+L L GC    
Sbjct  687   ASDDASE-----YLQNLVHLEKLETLKCVCYGQKRLTLSNWCASLTSVKRLILSGCLLLS  741

Query  559   KEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQLKVMLIDIADLEQWEASSINFPK  383
             ++M+ L+ALPNLEV+KL+D  F+G  W L +E  F QLK +L+    L  WEA S+NFP 
Sbjct  742   QDMASLAALPNLEVLKLRDNEFEGCAWTLSDEDEFSQLKFLLLAEPRLLNWEAGSVNFPN  801

Query  382   LQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             LQ LVL+ C  L EIPI  GE+ TL+ IEL  C+SS  +S + IREEQE  GN    +R+
Sbjct  802   LQKLVLRKCICLEEIPIDIGEICTLEMIELICCSSSAQNSANEIREEQESMGNSCLDIRV  861

Query  202   H  200
             +
Sbjct  862   Y  862



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 197/368 (54%), Gaps = 24/368 (7%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLN-------GFEMLRVLDISFQSFMRFP  1079
             RL F+SD+          P + SF++      L        GF++LRVLD+   SF  FP
Sbjct  518   RLHFHSDIFAYSSYTYSNPYVRSFLSSKACSVLEDSYFGCMGFKLLRVLDVVNYSFYGFP  577

Query  1078  SEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYF  902
               ++ L  LRYLA+ + ++LP S S+L  LQTLI  W      ILP E WKM  LRH++ 
Sbjct  578   IHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIYWGTKEMRILPLELWKMPILRHIHV  637

Query  901   KKSSH-FPVPGTRMTWYGERHWD-LPKLQTLSYLSFGSC--AREILTQVPNlkklglree  734
             K     F  P      + +R++  L  LQTL  ++  +   +  ++  +PNLK L     
Sbjct  638   KGDVLLFGSPID--DHHSKRNFRVLENLQTLCTITISTINFSHRLIATLPNLKTLASNLV  695

Query  733   egeylrdeqLVCYLNNLKVLHCLEKLKCFFT--KQRPLPSP-----DAFPPSLKQLSLRG  575
              G     + L   LNNL  ++ LE LK  F    + PLP       +AFPP+LK L+L  
Sbjct  696   TGGNHDVDWLGSCLNNLHQMYSLETLKLLFNLPMKNPLPHNSIQRWNAFPPNLKNLTLSC  755

Query  574   CQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSI  395
                 W++  VL  LPNLEV+KLK ++F+G +WE  EE F +LK +L++  DL  W+ +S 
Sbjct  756   SLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVIWKQAST  815

Query  394   N---FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGN  224
             +   FP LQ LV ++C+ L+EIP   G++ +LQ IEL+ C+         I+++Q DSGN
Sbjct  816   DSYPFPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSGN  875

Query  223   DGFTVRIH  200
                 V IH
Sbjct  876   SCLEVFIH  883



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 197/368 (54%), Gaps = 24/368 (7%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLN-------GFEMLRVLDISFQSFMRFP  1079
             RL F+SD+          P + SF++      L        GF++LRVLD+   SF  FP
Sbjct  520   RLHFHSDIFAYSSYTYSNPYVRSFLSSKACSVLEDSYFGCIGFKLLRVLDVVNYSFYGFP  579

Query  1078  SEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYF  902
               ++ L  LRYLA+ + ++LP S S+L  LQTLI  W      ILP E WKM  LRH++ 
Sbjct  580   IHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIYWGTKEMRILPLELWKMPILRHIHV  639

Query  901   KKSSH-FPVPGTRMTWYGERHWD-LPKLQTLSYLSFGSC--AREILTQVPNlkklglree  734
             K     F  P      + +R++  L  LQTL  ++  +   +  ++  +PNLK L     
Sbjct  640   KGDVLLFGSPID--DHHSKRNFRVLENLQTLCTITISTINFSHRLIATLPNLKTLASNLV  697

Query  733   egeylrdeqLVCYLNNLKVLHCLEKLKCFFT--KQRPLPSP-----DAFPPSLKQLSLRG  575
              G     + L   LNNL  ++ LE LK  F    + PLP       +AFPP+LK L+L  
Sbjct  698   TGGNHDVDWLGSCLNNLHQMYSLETLKLLFNLPMKNPLPRNSIQRWNAFPPNLKNLTLSC  757

Query  574   CQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSI  395
                 W++  VL  LPNLEV+KLK ++F+G +WE  EE F +LK +L++  DL  W+ +S 
Sbjct  758   SLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQAST  817

Query  394   N---FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGN  224
             +   FP LQ LV ++C+ L+EIP   G++ +LQ IEL+ C+         I+++Q DSGN
Sbjct  818   DSYPFPALQHLVFRFCNKLKEIPYEIGDIPSLQVIELYSCSPYATRLARMIQQDQIDSGN  877

Query  223   DGFTVRIH  200
                 V IH
Sbjct  878   SCLEVFIH  885



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 137/371 (37%), Positives = 197/371 (53%), Gaps = 28/371 (8%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLN-------GFEMLRVLDISFQSFMRFP  1079
             RL F+SD+          P + SF++      L        GF++LRVLD+   SF  FP
Sbjct  506   RLHFHSDIFAYSSYTYSNPYVRSFLSSKACSVLEDSYFGCMGFKLLRVLDVVNYSFYGFP  565

Query  1078  SEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYF  902
               ++ L  LRYLA+ + ++LP S S+L  LQTLI  W      ILP E WKM  LRH++ 
Sbjct  566   IHVIKLVHLRYLALSINSELPRSISKLKNLQTLIIYWGTKEMRILPLEIWKMPILRHIHV  625

Query  901   KKSSHFPVPGTRMTWYGERHWD-LPKLQTLSYLSFG--SCAREILTQVPNlkklglreee  731
             K      + G+ +  + +R++  L  LQTL  ++    S +  ++  +PNLK L      
Sbjct  626   K--GDVLLFGSPIADHSKRNFQVLGNLQTLCTITISTISFSHGLVATLPNLKTLASNLVT  683

Query  730   geylrdeqL----VCYLNNLKVLHCLEKLKCFFTKQRPLPSP-------DAFPPSLKQLS  584
             G       +     C LNNL+ ++ LE LK  F      P P       +AFPP+LK L+
Sbjct  684   GGNHDAFDVDWLGSC-LNNLEQMYSLETLKLLFNLPMNNPRPRNSIQRWNAFPPNLKNLT  742

Query  583   LRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEA  404
             L      W++  VL  LPNLEV+KLKD++F+G +WE  EE F +LK +L++  DL  W+ 
Sbjct  743   LSCSFLLWEDARVLGNLPNLEVLKLKDFSFQGPEWETDEEGFHRLKYLLVESRDLVVWKQ  802

Query  403   SSIN---FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQED  233
             +S +   FP LQ LVL++C  L+EIP   G++ +LQ I+L  C+         I +EQ D
Sbjct  803   ASTDSYPFPVLQHLVLRFCYKLKEIPYEIGDIPSLQVIKLHSCSPYATRLARMIEKEQID  862

Query  232   SGNDGFTVRIH  200
             SGN    V IH
Sbjct  863   SGNSCLEVFIH  873



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score =   182 bits (461),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 191/351 (54%), Gaps = 18/351 (5%)
 Frame = -3

Query  1153  RVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR  974
             +V     F++LRVL I    F  FP E+  L  LRYL     +D+    SEL  LQTLI 
Sbjct  236   QVPHFERFKLLRVLVIFGFIFQDFPLEVTKLVHLRYLEFYCKDDIHWLVSELHNLQTLIF  295

Query  973   WCNG-ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHW---DLPKLQTLSYL  806
                G     +P   WKMK LRH++   +  F  P + +  +G   +    L  L+ LS L
Sbjct  296   GHRGYKSPTIPASIWKMKHLRHLHV--NGFFSFPQSIIDSFGFFSFLQNKLQNLEVLSCL  353

Query  805   SFGSCAREILTQVPNlkklglreeegeylrdeqLVC-YLNNLKVLHCLEKLKCFFTKQ--  635
             +  SC  E+ + +PNLK+L +  EE     +   +  +L+N   L  LE LK    +Q  
Sbjct  354   ALSSCTSELFSAIPNLKRLTVHHEEELTEFERVEISQHLSNFSRLKELEILKFRGNRQYF  413

Query  634   RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE-EVF  458
             R +P   + P SL  L+L     PW++++ +  LPNLEV+K+K + F G+ W L + E+F
Sbjct  414   RRMPGKYSLPTSLNSLTLTDTYLPWEDIANIVMLPNLEVLKIKYHGFYGAFWRLNDNEIF  473

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
              QLK++LI+   L+ W+A S+NFPKLQ LVLK C  L EIP  FGE+ TL+SIEL +C +
Sbjct  474   NQLKLLLINETYLKHWDAGSVNFPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKCKT  533

Query  277   STYDSVDRIREEQEDSGNDGFTVRIHRGHNDE*HSNLPGSVYLLPFLPVGV  125
             S   S   I+EEQE  GND  +V I    ND    + P     +PF+  G+
Sbjct  534   SAAASAKNIQEEQESMGNDCLSVLI----ND----SGPAQAQAVPFVIPGL  576



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   182 bits (463),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 176/315 (56%), Gaps = 18/315 (6%)
 Frame = -3

Query  1204  DYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLF  1028
             D +D+P+    SF+          F ++R+LD+    F RFP+EI+ L  LR+L++ G F
Sbjct  545   DERDVPREH-TSFVH-------EAFNLVRILDLKSIIFSRFPNEIVQLVHLRFLSLSGHF  596

Query  1027  NDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGE  848
               LPP+ S L  LQTL+       L +  + WKM + RH++    S    P        E
Sbjct  597   KVLPPAISNLWNLQTLVVVTTSRNLDIQADLWKMLQFRHLHTSGLSCLHGPRAETRKDSE  656

Query  847   RHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHC  668
               +    +QT+  +    C   IL++ PNLKKLG+R +    +++   +   +NL  L  
Sbjct  657   DPFVRRNIQTICTIVPECCTENILSRTPNLKKLGIRGKLVMLVQERGGMSLFDNLAKLDH  716

Query  667   LEKLKCF--------FTKQRP-LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVV  515
             LE LK          F    P LP    FPP+LK+L+L      W EMS L  LPNLEV+
Sbjct  717   LETLKLLNDTFPLDPFKCHIPGLPQSYKFPPNLKKLTLSDTLLDWSEMSTLGMLPNLEVL  776

Query  514   KLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIP  335
             KLKDYAFKGS+WE ++  F  L+V+ +  +DL  W ASS +FP+L+ +VLK+C+HL EIP
Sbjct  777   KLKDYAFKGSRWEPLDGGFRLLRVLQLGRSDLVHWHASSHHFPRLERVVLKHCTHLEEIP  836

Query  334   IGFGEVYTLQSIELW  290
              GFGEV  LQ++EL+
Sbjct  837   CGFGEVSALQNMELY  851



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/354 (40%), Positives = 198/354 (56%), Gaps = 26/354 (7%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPK-PSICSFIAFGR---------VQQLNGFEMLRVLDISFQSFM  1088
             R+ F+S+    D + +P  P + SF+ F           + QL GF++LRVLDI F    
Sbjct  465   RISFHSEF-CGDLRSVPAIPHVRSFLMFSLGLGFPADIFLLQL-GFKLLRVLDIIFLRSE  522

Query  1087  RFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RWC---NGACLILPEETWKM  926
              FP++IL L  LRYLA+    +LP S S+LC LQTLI    W    NG    +  E W M
Sbjct  523   HFPTQILKLVHLRYLALTATYELPASISKLCNLQTLIIHGPWILSENGESPTIFFEYWNM  582

Query  925   KELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklg  746
               LRH+ F  +    +P      Y   +   P LQTLS +   SC RE+   +P L++L 
Sbjct  583   PWLRHLGFTVTCSLCIPPIPEINYP--YPLAPILQTLSTIRLTSCTREVFRSMPYLRRLA  640

Query  745   lreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ----RPLPSPDAFPPSLKQLSLR  578
             + E + ++  +E    YL+NL  L  LE LKC F +     R LP  DAFP +L++L+L 
Sbjct  641   ICETKEDHNTNETSK-YLSNLVHLPLLEALKCSFYRDAKPWRTLPW-DAFPSNLRKLTLS  698

Query  577   GCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASS  398
                 PW++M+ +S LP LEV+KL++ AF G +WE  E+ F  LK +LI+ +DL QW+AS+
Sbjct  699   WSYLPWEDMTNISRLPKLEVLKLRNCAFLGPEWEPPEDEFLHLKQLLIENSDLVQWKAST  758

Query  397   INFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
             I+FP L  LVL  C  L EIP+  GE+ TL+ +EL  C+ S   S   I E+ E
Sbjct  759   IHFPSLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIGEQVE  812



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score =   181 bits (458),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 185/342 (54%), Gaps = 25/342 (7%)
 Frame = -3

Query  1162  AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI----GLFNDLPPSFSELC  995
              F    +L  F ++R+LD+S      FP +ILCL  LRYL +    G+FN +PP  S L 
Sbjct  577   TFTLKSELTHFNLIRILDLSCIKINIFPPQILCLIWLRYLVLHSRRGVFN-IPPEISRLW  635

Query  994   RLQTLIRWCNGACL---ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKL  824
              LQT I    G  L   ILPE+ W + +LRH+    S H P P   ++   E+  D   L
Sbjct  636   NLQTFI--VGGYHLTSTILPEQIWGLMQLRHLELS-SFHLPNPPI-VSVEEEKCLDFSNL  691

Query  823   QTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYL-NNLKVLHCLEKL---  656
              T+S LS   C +E+++ + N++KL +   +          C L +N   LH LE L   
Sbjct  692   HTISGLSLSCCTKEVISGIRNVRKLRINRGDEYESFQ---ACRLFDNFVHLHQLETLSLE  748

Query  655   ---KCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFK  491
                +    +  P  +PS  +FPP LK+L L G    W++++++  LPNLE++KLK YA +
Sbjct  749   LEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLRWEDLNIIGELPNLEILKLKRYACR  808

Query  490   GSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYT  311
             G +W   E+ F QLK++LI+  DL+ W + + NFP L+ LV++ CS L +IPI F  + +
Sbjct  809   GEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDS  868

Query  310   LQSIELWECNSSTYDSVDRIREEQEDS-GNDGFTVRIHRGHN  188
             LQ IEL +C      S  RI+ EQE++ G     V I  G N
Sbjct  869   LQQIELTDCTPELEASAARIQHEQEENLGKKPVDVLISSGQN  910



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   179 bits (455),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 179/321 (56%), Gaps = 26/321 (8%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRW----  971
             GF  LRVLD+    F +FP  IL L +LRYLA+     DLP   S+LC LQ LI      
Sbjct  549   GFTFLRVLDVLTIRFYKFPDGILELVLLRYLALTCKAGDLPAKVSKLCNLQFLIVRRHMS  608

Query  970   --CNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                +G    LP E W MK+LRH+ F      P P             LP L +LS +S  
Sbjct  609   IKSSGDPSYLPFEIWNMKQLRHIQFM-GGDLPDPCGA---------SLPYLLSLSNVSGH  658

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ----RP  629
             SC++++    PNL KLG+R E  E       +  L++L +L  LE  KC         + 
Sbjct  659   SCSKQVFKATPNLMKLGIRIELAEDTATPLCL--LDHLTLLSQLESFKCVIVNPTREFQV  716

Query  628   LPSPDA---FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVF  458
             +  PD+   FP +LK+++L GC  PW++M +L+ LPNLE +KL  YAF+G +WEL EE F
Sbjct  717   VARPDSVSIFPSTLKKITLSGCGFPWEDMKILAQLPNLEALKLGCYAFQGPEWELDEEDF  776

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
              +LK +L++  D+  W A+     +L+ LV+++C +L+EIP G   + TLQ +E+ +C+ 
Sbjct  777   IRLKFLLLEDMDIANWRANGQILHRLERLVVRHCYNLQEIPYGIDYITTLQLVEVVDCSP  836

Query  277   STYDSVDRIREEQEDSGNDGF  215
             S  DS  RI+E QED  ND F
Sbjct  837   SVVDSAMRIKEMQEDLSNDDF  857



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score =   177 bits (450),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 177/322 (55%), Gaps = 5/322 (2%)
 Frame = -3

Query  1150  VQQLNGFEMLRVLDI--SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI  977
             +   + F++LRVL +   +  F  FP  I  L  LRYL I   ++ P S +EL  LQTL+
Sbjct  549   IDDFSHFKLLRVLAVFNEYNCFRSFPLVITKLFHLRYLQIRCDDNPPASIAELQNLQTLV  608

Query  976   RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                      LPE+ W MK+LR ++ +++ + P PG +          +P ++ L  LS  
Sbjct  609   YGRERGYTTLPEKIWMMKKLRCIHIREAFYLPSPGRKSILNKHLAIGMPNVEELYNLSIT  668

Query  796   SCAREILTQVPNlkklglreeegeyl-rdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPS  620
             SC  ++ + +PN+K+L ++             +   ++L  L  L+ +K      R L S
Sbjct  669   SCTNKVFSNIPNVKRLIIQNNALLRTGDRASSLVDTSSLTKLEALKFVKKLSWSARTLIS  728

Query  619   PDAFPPSLKQLSLRGCQR-PWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLK  446
               + P SLK+L+L G     W ++S L  LPNLE +KLK+YA  G  W L  E+ F  L+
Sbjct  729   IRSLPISLKRLTLAGWHSFRWTDISALVMLPNLEELKLKNYAANGYVWRLNDEDKFQSLE  788

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             ++L    ++E WEASS NFP L+ LVLK C  L+EIPI FGE+ +L+SIEL  C++   +
Sbjct  789   LLLFCNINVEHWEASSDNFPNLKRLVLKECRKLKEIPIDFGEICSLESIELHNCSTLAEE  848

Query  265   SVDRIREEQEDSGNDGFTVRIH  200
             S  +I +EQED GN+   V I+
Sbjct  849   SARKIEQEQEDMGNNCLKVYIN  870



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 198/364 (54%), Gaps = 34/364 (9%)
 Frame = -3

Query  1228  FYSDVDWNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
             F   V+  + +D+ + ++   +     + L+ F +LR+LD+ F S +     I  L  LR
Sbjct  399   FVKKVNHKNLEDVAEENLRELVD----RSLSSFRLLRILDVCFTSRLYRSMSITELVHLR  454

Query  1048  YLAIGLFNDLPPSFSELCRLQTLI------RWCNGACLILPEETWKMKELRHVYFKKSSH  887
             YLA   FN L  S  +L  +Q L+               LP E   M +LRH++ KK S 
Sbjct  455   YLACPSFNGLVQSLCKLRNIQNLVIQDLRSSGLRRRTQFLPWEVVNMPKLRHIHTKKFSL  514

Query  886   FPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeq  707
             F +P T +    E H     LQTL+ L   SC  E+  ++PNLKKLG+   +      + 
Sbjct  515   F-IPPTSLIAERENH-----LQTLTGLMPSSCNEEVFLRIPNLKKLGILIVDDSDTIQK-  567

Query  706   LVCY-LNNLKVLHCLEKLKCFFTKQ----RP-------LPSPDAFPPSLKQLSLRGCQRP  563
               CY L+NL  L  LEKLK    +     RP       +P  D FPP+LK+L+L      
Sbjct  568   --CYCLDNLVHLTQLEKLKVEVRESWLIFRPTIKGWVDIPHCDNFPPNLKKLTLCTTHLE  625

Query  562   WKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE---VFCQLKVMLIDIADLEQWEASSIN  392
             W++M++LS LPNLEV+KLKD+AF+G  W+L +E    F +LK +L++   LEQWEA+S +
Sbjct  626   WEDMNILSKLPNLEVLKLKDHAFRGHIWKLSDEDADGFLKLKFLLLEHMHLEQWEATSYH  685

Query  391   FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFT  212
             FP L+ LVL +C  L +IP  F E+ TLQ IEL  C  S   S ++I+EEQ+  GND   
Sbjct  686   FPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQIQEEQQSFGNDDLI  745

Query  211   VRIH  200
             +R++
Sbjct  746   IRVN  749



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 193/363 (53%), Gaps = 30/363 (8%)
 Frame = -3

Query  1216  VDWNDYKDLPKP-SICSFI----AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKIL  1052
              D +D   L +  SI SF      F    +L  F ++R+LD+S      FP +ILCL  L
Sbjct  554   TDDDDNNSLKRTRSIFSFCRDSSTFTLKSELTHFNLIRILDLSCIKINIFPPQILCLIWL  613

Query  1051  RYLAI----GLFNDLPPSFSELCRLQTLIRWCNGACL---ILPEETWKMKELRHVYFKKS  893
             RYL +    G+FN +PP  S L  LQT I    G  L   ILPE+ W + +LRH+    S
Sbjct  614   RYLVLHSRRGVFN-IPPEISRLWNLQTFI--VGGYHLTSTILPEQIWGLMQLRHLELS-S  669

Query  892   SHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrd  713
              H P P   ++   E+  D   L T+S LS   C +E+++ + N++KL +   +      
Sbjct  670   FHLPNPPI-VSVEEEKCLDFSNLHTISGLSLSCCTKEVISGIRNVRKLRINRGDEYESFQ  728

Query  712   eqLVCYL-NNLKVLHCLEKL------KCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPW  560
                 C L +N   LH LE L      +    +  P  +PS  +FPP LK+L L G    W
Sbjct  729   ---ACRLFDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLRW  785

Query  559   KEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKL  380
             ++++++  LPNLE++KLK YA +G +W   E+ F QLK++LI+  DL+ W + + NFP L
Sbjct  786   EDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVL  845

Query  379   QSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDS-GNDGFTVRI  203
             + LV++ CS L +IPI F  + +LQ IEL +C      S  RI+ EQE++ G     V I
Sbjct  846   ERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPVDVLI  905

Query  202   HRG  194
               G
Sbjct  906   SSG  908



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   177 bits (450),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 128/350 (37%), Positives = 189/350 (54%), Gaps = 29/350 (8%)
 Frame = -3

Query  1216  VDWNDYKDLPKP-SICSFI----AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKIL  1052
              D +D   L +  SI SF      F    +L  F ++R+LD+S      FP +ILCL  L
Sbjct  554   TDDDDNNSLKRTRSIFSFCRDSSTFTLKSELTHFNLIRILDLSCIKINIFPPQILCLIWL  613

Query  1051  RYLAI----GLFNDLPPSFSELCRLQTLIRWCNGACL---ILPEETWKMKELRHVYFKKS  893
             RYL +    G+FN +PP  S L  LQT I    G  L   ILPE+ W + +LRH+    S
Sbjct  614   RYLVLHSRRGVFN-IPPEISRLWNLQTFI--VGGYHLTSTILPEQIWGLMQLRHLELS-S  669

Query  892   SHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrd  713
              H P P   ++   E+  D   L T+S LS   C +E+++ + N++KL +   +      
Sbjct  670   FHLPNPPI-VSVEEEKCLDFSNLHTISGLSLSCCTKEVISGIRNVRKLRINRGDEYESFQ  728

Query  712   eqLVCYL-NNLKVLHCLEKL------KCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPW  560
                 C L +N   LH LE L      +    +  P  +PS  +FPP LK+L L G    W
Sbjct  729   ---ACRLFDNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLRW  785

Query  559   KEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKL  380
             ++++++  LPNLE++KLK YA +G +W   E+ F QLK++LI+  DL+ W + + NFP L
Sbjct  786   EDLNIIGELPNLEILKLKRYACRGEEWHPTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVL  845

Query  379   QSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDS  230
             + LV++ CS L +IPI F  + +LQ IEL +C      S  RI+ EQE++
Sbjct  846   ERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEEN  895



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 180/317 (57%), Gaps = 18/317 (6%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG-ACL  953
             ++LRVL I +  F  FP EI  L  LRYL     +D+    S+L  L T I    G    
Sbjct  102   KLLRVLVIPYYEFQDFPLEITKLVHLRYLQFWCNDDIHQLVSKLYNLHTFIFRHEGLKPP  161

Query  952   ILPEETWKMKELRHVYFKK---SSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
              +PE  WKMK LRH++  K   S   P+            + L  L+ LS L+  +C  E
Sbjct  162   TIPETIWKMKHLRHLHVVKRVFSLAIPIKSG---------FKLENLEGLSCLNLSNCTYE  212

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ--RPLPSPDAF  608
             + + +PNLK+L +     E  R++    +L++L  L  LE LK  +  +  R LP   + 
Sbjct  213   LFSAIPNLKRLKIYGNWRECKREKISQ-HLDSLSCLKELEILKFRYQGRYRRRLPRKLSL  271

Query  607   PPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVMLID  431
             P SLK+L+L+      ++++ +  LPNLEV+K+KD  F   +W L  +E+F QLK +LI 
Sbjct  272   PTSLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD-VFYNDEWILNDDEIFSQLKFLLIS  330

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
             +  L  W+A S+NFPKLQ LVL+ C  L EIP  FGE+Y+L+SIEL++C+ ST  SV+ +
Sbjct  331   VTSLRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEEL  390

Query  250   REEQEDSGNDGFTVRIH  200
             REEQE  GND  +V I+
Sbjct  391   REEQESMGNDCLSVVIN  407



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 180/317 (57%), Gaps = 18/317 (6%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG-ACL  953
             ++LRVL I +  F  FP EI  L  LRYL     +D+    S+L  L T I    G    
Sbjct  102   KLLRVLVIPYYEFQDFPLEITKLVHLRYLQFWCNDDIHQLVSKLYNLHTFIFRHEGLKPP  161

Query  952   ILPEETWKMKELRHVYFKK---SSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
              +PE  WKMK LRH++  K   S   P+            + L  L+ LS L+  +C  E
Sbjct  162   TIPETIWKMKHLRHLHVVKRVFSLAIPIKSG---------FKLENLEGLSCLNLSNCTYE  212

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ--RPLPSPDAF  608
             + + +PNLK+L +     E  R++    +L++L  L  LE LK  +  +  R LP   + 
Sbjct  213   LFSAIPNLKRLKIYGNWRECKREKISQ-HLDSLSCLKELEILKFRYQGRYRRRLPRKLSL  271

Query  607   PPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVMLID  431
             P SLK+L+L+      ++++ +  LPNLEV+K+KD  F   +W L  +E+F QLK +LI 
Sbjct  272   PTSLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKD-VFYNDEWILNDDEIFSQLKFLLIS  330

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
             +  L  W+A S+NFPKLQ LVL+ C  L EIP  FGE+Y+L+SIEL++C+ ST  SV+ +
Sbjct  331   VTSLRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEEL  390

Query  250   REEQEDSGNDGFTVRIH  200
             REEQE  GND  +V I+
Sbjct  391   REEQESMGNDCLSVVIN  407



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score =   176 bits (445),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 185/347 (53%), Gaps = 27/347 (8%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLK  1058
             R +F++  D N         IC F   G    +  F+ LR+LD+      +F        
Sbjct  480   RRIFFNQYDLNVDHRTIHTMIC-FRVIGLRFHIQYFKSLRILDLLLAQVFKFFH------  532

Query  1057  ILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACLI-LPEETWKMKELRH-VYFKKSSHF  884
              LRY+A     D+PPS S L  LQTLI   +    I LP E W+M +LRH V ++K    
Sbjct  533   -LRYIAFDFRMDIPPSISNLQNLQTLI--IHPVSFISLPPEIWRMADLRHLVCYRKFGQL  589

Query  883   PVP--GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrde  710
             P P  G   +  G     L KLQTL  ++   C R IL  +PN+K+L +   +     + 
Sbjct  590   PNPEEGASTSSRG-----LVKLQTLWEVTDLICTRTILKMIPNVKELAIFYTKEHQEEEY  644

Query  709   qLVCYLNNLKVLHCLEKLKC----FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVL  542
                 +L++L  L  LE+LK     F++  R      AFP +LK L++RG +RPW EM+V+
Sbjct  645   ----HLDDLVHLKQLERLKLTVPYFWSSSRWEKITPAFPKTLKWLTIRGGRRPWSEMTVV  700

Query  541   SALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLK  362
              +LPNL+V+K++++ F G  WE  E  F +LK ++I+ + L+ W   S +FPKL+ ++L 
Sbjct  701   GSLPNLQVLKIRNHGFDGETWETSEGGFIELKHLMIEYSKLKYWVTESNHFPKLERVLLH  760

Query  361   YCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGND  221
              CS+L EI  G GE+ TL+ IE+  C  S      R+REEQ+D  ND
Sbjct  761   DCSYLIEISDGVGEIPTLELIEVKFCTESIAGWAKRMREEQQDYRND  807



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 181/315 (57%), Gaps = 15/315 (5%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACL  953
             ++LRVL I +  F  FP EI  L  LRYL     +D+    S+L  LQT I R       
Sbjct  547   KLLRVLVIPYYEFRDFPLEITELVHLRYLQFWCNDDIYQLVSKLYNLQTFIFRHEALKPP  606

Query  952   ILPEETWKMKELRHV-YFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
              +PE  W+MK LRH+   K+     +P +         + L  L+ LS L+  SC  E+ 
Sbjct  607   TIPETIWEMKHLRHLQVVKRVFSLAIPKS--------GFKLENLEGLSCLNLSSCTYEMF  658

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--QRPLPSPDAFPP  602
             + +PNLK+L +     E  R++    +L++L  L  LE LK  +    +R LP   + P 
Sbjct  659   SAIPNLKRLKIHGNWRECKREKIS-QHLDSLSCLKELEILKFRYQGAYRRQLPRKFSLPT  717

Query  601   SLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVMLIDIA  425
             SLK+L+L     P ++M+ ++ LPNLEV+K+KD  F   +W L  EE+F QLK +LI + 
Sbjct  718   SLKRLTLTNTLFPPEDMTNITMLPNLEVLKMKD-VFDSDEWRLNDEEIFSQLKFLLISVT  776

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
              L  WEA S+NFPKLQ +VL+ C  L EIP  FGE+Y+L+SIEL++C+ S   SV+ ++E
Sbjct  777   FLRHWEAGSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQE  836

Query  244   EQEDSGNDGFTVRIH  200
             EQE  GND  +V I+
Sbjct  837   EQESMGNDCLSVVIN  851



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 180/315 (57%), Gaps = 15/315 (5%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACL  953
             ++LRVL I +  F  FP EI  L  LRYL     +D+    S+L  LQT I R       
Sbjct  546   KLLRVLVIPYYEFQDFPLEITKLVHLRYLQFWCSDDIHLLVSKLYNLQTFIFRHEALKPP  605

Query  952   ILPEETWKMKELRHV-YFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
              +PE  W+MK  RH+   K+     +P +         + L  L+ LS L+  SC  E+ 
Sbjct  606   TIPETIWEMKHFRHLQVVKRVFSLAIPKS--------GFKLENLEGLSCLNLSSCTYEMF  657

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ--RPLPSPDAFPP  602
             + +PNLK+L +     E  RD+    +L++L  L  LE LK  +  +  R LP   + P 
Sbjct  658   SAIPNLKRLKIHGNWSECKRDKIYQ-HLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPT  716

Query  601   SLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVMLIDIA  425
             SLK+L+L     P ++M+ +  LPNLEV+K+KD  F+  +W L  EE+F QLK +LI + 
Sbjct  717   SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKD-VFENDEWRLNDEEIFSQLKFLLISVT  775

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
              L  WEA S+NFPKLQ LVL+ C  L EIP  FGE+Y+L+SIEL++C+ S   SV+ ++E
Sbjct  776   FLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQE  835

Query  244   EQEDSGNDGFTVRIH  200
             EQ+  GND  TV I+
Sbjct  836   EQKSMGNDCLTVVIN  850



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 180/327 (55%), Gaps = 15/327 (5%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRL  989
             F    R   L  F++LRVL I    F  FP  I  L  LRYL +   +++    SEL  L
Sbjct  558   FHGLSRFPLLERFKLLRVLAIHNCCFQDFPVVITNLVHLRYLELYCEDNIHRLVSELYNL  617

Query  988   QTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQ  821
             QTLI    R        +PE  W+++ LRH++      FP+  +R    G   + L  L+
Sbjct  618   QTLIFHHQRLYTSR---VPETIWQIEHLRHLHVTDFFSFPIT-SREVKPG---FKLQNLE  670

Query  820   TLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT  641
              LS L   SC  E+ + +PNLK+L +  +  E    +    YLN+L  L  LE LK    
Sbjct  671   RLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQ-YLNSLSCLKELEMLKFNGD  729

Query  640   K-QRP-LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-I  470
               Q P +PS  A P  LK+L+L     PW++M+ +  LPNL+ +K+K   F G  W+L  
Sbjct  730   GLQLPRIPSKFALPVCLKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLND  789

Query  469   EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
             EEVF QLK +LI   +L+ WEASS+NFP+L+ LVLK C +L EIP   GE+ TL SIEL 
Sbjct  790   EEVFNQLKFLLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTV  209
             EC+ S   SV+ I+EEQE  GND  +V
Sbjct  850   ECSISAAKSVNEIQEEQESMGNDCLSV  876



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 180/315 (57%), Gaps = 15/315 (5%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGACL  953
             ++LRVL I +  F  FP EI  L  LRYL     +D+    S+L  LQT I R       
Sbjct  546   KLLRVLVIPYYEFQDFPLEITKLVHLRYLQFWCSDDIHLLVSKLYNLQTFIFRHEALKPP  605

Query  952   ILPEETWKMKELRHV-YFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
              +PE  W+MK  RH+   K+     +P +         + L  L+ LS L+  SC  E+ 
Sbjct  606   TIPETIWEMKHFRHLQVVKRVFSLAIPKS--------GFKLENLEGLSCLNLSSCTYEMF  657

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ--RPLPSPDAFPP  602
             + +PNLK+L +     E  RD+    +L++L  L  LE LK  +  +  R LP   + P 
Sbjct  658   SAIPNLKRLKIHGNWSECKRDKIYQ-HLDSLSCLKELEILKFKYQGRYRRQLPRKFSLPT  716

Query  601   SLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLKVMLIDIA  425
             SLK+L+L     P ++M+ +  LPNLEV+K+KD  F+  +W L  EE+F QLK +LI + 
Sbjct  717   SLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKD-VFENDEWRLNDEEIFSQLKFLLISVT  775

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
              L  WEA S+NFPKLQ LVL+ C  L EIP  FGE+Y+L+SIEL++C+ S   SV+ ++E
Sbjct  776   FLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKSVEELQE  835

Query  244   EQEDSGNDGFTVRIH  200
             EQ+  GND  TV I+
Sbjct  836   EQKSMGNDCLTVVIN  850



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 180/327 (55%), Gaps = 15/327 (5%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRL  989
             F    R   L  F++LRVL I    F  FP  I  L  LRYL +   +++    SEL  L
Sbjct  558   FHGLSRFPLLERFKLLRVLAIHNCCFQDFPVVITNLVHLRYLELYCEDNIHRLVSELYNL  617

Query  988   QTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQ  821
             QTLI    R        +PE  W+++ LRH++      FP+  +R    G   + L  L+
Sbjct  618   QTLIFHHQRLYTSR---VPETIWQIEHLRHLHVTDFFSFPIT-SREVKPG---FKLQNLE  670

Query  820   TLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT  641
              LS L   SC  E+ + +PNLK+L +  +  E    +    YLN+L  L  LE LK    
Sbjct  671   RLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQ-YLNSLSCLKELEMLKFNGD  729

Query  640   K-QRP-LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-I  470
               Q P +PS  A P  LK+L+L     PW++M+ +  LPNL+ +K+K   F G  W+L  
Sbjct  730   GLQLPRIPSKFALPVCLKRLTLSYTSLPWEDMANIVMLPNLQELKIKYNGFDGDVWKLND  789

Query  469   EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
             EEVF QLK +LI   +L+ WEASS+NFP+L+ LVLK C +L EIP   GE+ TL SIEL 
Sbjct  790   EEVFNQLKFLLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELH  849

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTV  209
             EC+ S   SV+ I+EEQE  GND  +V
Sbjct  850   ECSISAAKSVNEIQEEQESMGNDCLSV  876



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/352 (36%), Positives = 189/352 (54%), Gaps = 19/352 (5%)
 Frame = -3

Query  1219  DVDWNDYKDLPKPSI------CSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLK  1058
             DVD N+Y      SI      C    F    ++  F++LR LD+S      FPS+ILCL 
Sbjct  574   DVDDNNYFLKRTRSIISLSNYCPLPNFTLESEIIHFKLLRTLDLSPIEVESFPSQILCLI  633

Query  1057  ILRYLAI-GLFNDLPPSFSELCRLQT-LIRWCNGACLILPEETWKMKELRHVYFKKSSHF  884
              LRYLA+ G   D+PP    L  LQT +++  +  C+I PE+ W++ +LRH+    + + 
Sbjct  634   WLRYLALSGGLIDIPPEVCRLWNLQTCIVKGSSSRCIIFPEQIWELMQLRHLKLN-AFYL  692

Query  883   PVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqL  704
             P P +        +  L  +QT+  LS  SC +E+++ + N+KKLG+  ++ +       
Sbjct  693   PNPPSVSAEEESSYLVLSNVQTIYGLSARSCTKEVISGIRNVKKLGIYGDKDDCEDSR--  750

Query  703   VCYLNNLKVLHCLEKLKCFFTK-----QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLS  539
                 +NL  LH LEKL+             +PS  +FP  LK+L L G    W++M+++S
Sbjct  751   --LFDNLVHLHQLEKLRFGLLTPWKFGDATIPSAKSFPAMLKKLELNGTCLRWEDMNIIS  808

Query  538   ALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKY  359
              LPNLEV+K+       ++W  +   F QLK++LID   L  W+A+  NFP L+ LVL+ 
Sbjct  809   ELPNLEVLKVLS-VIHDNEWYPVAGGFTQLKLLLIDSTSLNYWKATDDNFPALECLVLRS  867

Query  358   CSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             C  L E+PI F  + +LQ IEL+ C      S  +I++EQED GN    +RI
Sbjct  868   CYFLAEMPIEFAYINSLQLIELYNCMPKLEASAAQIQQEQEDIGNKPLDIRI  919



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/325 (38%), Positives = 176/325 (54%), Gaps = 24/325 (7%)
 Frame = -3

Query  1132  FEMLRVLDIS----FQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI----  977
             F +LRVLD+     +  F+  P+++  L  LRYLA+     +P + + L  L+TL+    
Sbjct  594   FRLLRVLDVDNSYIYSEFVPLPNQLFELFHLRYLALDYPTKIPTTITNLKNLETLVIRPR  653

Query  976   -RWCNGACLI--LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYL  806
                   +  I  LP + W+M +LRH++       P P       G     L  LQTLS L
Sbjct  654   KTLSRRSYYITNLPLDIWRMPKLRHIFCFYIGQLPDPE------GSATCGLENLQTLSSL  707

Query  805   SFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPL  626
             +   C   I+  +PNLKKLGL     +   ++     L NL  LH LEKLK  F  +   
Sbjct  708   TNFVCVERIIKMIPNLKKLGLAFCTSDKPYEDIEHYCLENLVYLHQLEKLK--FVVESDF  765

Query  625   PSP-----DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
             PSP       FP  L++L+L G + PWK+M+++ +LPNL+V+KL++ A  G  WE IE  
Sbjct  766   PSPVKLHFPVFPMKLRKLTLSGWRLPWKDMTIVGSLPNLQVLKLRESACVGDTWETIEGE  825

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F +L  ++I+ +DL  W   S +FP L+ LV++ C +LREIP G GE+ TL+ IE+   N
Sbjct  826   FLELNFLMIEESDLRNWITESSHFPNLKWLVIRRCRYLREIPDGIGEIATLELIEVEMRN  885

Query  280   SSTYDSVDRIREEQEDSGNDGFTVR  206
                 +S  RI+EEQE  GND   VR
Sbjct  886   KYLVESAKRIQEEQESLGNDALQVR  910



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score =   174 bits (440),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 178/315 (57%), Gaps = 12/315 (4%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR----WCN  965
             F +LRVLD    +F  FP E+L L  LR+LA+    +LP   S+L  L+ LI     W  
Sbjct  494   FGLLRVLDALSVTFFWFPIEVLELVNLRHLALTFDGELPRMVSDLQNLEILIVHQVFW--  551

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
             G    LP E W+M  LRH+ FK+      PGT   +YG+  + L  LQTL  +       
Sbjct  552   GPLSYLPLEIWRMPRLRHLEFKEVFFPNYPGT--LYYGKNTFSLENLQTLVGIRDFRVTE  609

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF---TKQRPLPSPD  614
             ++   +PN+KKL +  ++     +  L C L+NL  LH LE LKC F    +Q+P     
Sbjct  610   DVYKSIPNVKKLEIVYDKNSNTTEWSLYC-LDNLVHLHQLESLKCHFLDAHRQKPDLPDL  668

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP  LK+LSL G + P K M+ + +L NLE++KL+  + +  +WEL E  F +LK++++
Sbjct  669   TFPSKLKELSLLGWEIPSKYMTTIGSLHNLEILKLRFCSLRDDEWELSEGEFYRLKILVL  728

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             +  ++ QW A + +FP L+ L++K+C  L EIP GFG++ TLQ I++ E + S   S  +
Sbjct  729   EGMNIVQWRAEADHFPSLEQLIIKHCRKLEEIPPGFGDIPTLQLIKVVEGSRSCESSAMQ  788

Query  253   IREEQEDSGNDGFTV  209
             I E+Q+  GN G  V
Sbjct  789   ILEDQQSLGNYGLKV  803



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   174 bits (441),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/312 (38%), Positives = 169/312 (54%), Gaps = 10/312 (3%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCNGA  959
              F ++RVLD+ + +F RFP+EI+ L  LRY+A+ G F  LP S S+L  L+TLI      
Sbjct  560   AFRLVRVLDLKYINFPRFPTEIVQLVHLRYIALSGNFRVLPASISKLWNLETLIVGTKSR  619

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREI  779
              L +  + WKM + +H+Y    S    P  +        +    +QT+S +    C   I
Sbjct  620   ELDIQVDIWKMSQFKHLYTSGLSCLRGPPAKTRKDNADPFVRRNIQTISTVLPDCCKENI  679

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--------QRP-L  626
             L + P L+KLG+R +    +         +NL  L  LE LK             Q P L
Sbjct  680   LARTPGLRKLGIRGKLATLVATNGDSSLFDNLAKLDNLETLKLLNDTFPLPPSQCQIPGL  739

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P    FPP+LK+L+L      W  +S L  LPNLEV+KLKDYAFKG+QWE ++  F  L+
Sbjct  740   PQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLLR  799

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I   +LE W AS  +FP+LQ + LK+CS L EIP G  EV +LQ+IEL+    +   
Sbjct  800   VLHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAA  859

Query  265   SVDRIREEQEDS  230
             S   I++E+++ 
Sbjct  860   SARIIQQEKQEG  871



>ref|XP_009777218.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777219.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777220.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009777221.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=791

 Score =   173 bits (438),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 175/322 (54%), Gaps = 19/322 (6%)
 Frame = -3

Query  1132  FEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGAC  956
             F++L+VL I     F  FP EI  L  LRYLA+    D P S S+L +LQTLI       
Sbjct  475   FKLLKVLAIFRHDMFSSFPIEITNLVNLRYLAVASHGDPPESISKLRKLQTLIFTNLVGF  534

Query  955   LILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
               LP + WK+ +LRH+   + S+   P T     G     +  L+  S L F SC  EI 
Sbjct  535   ANLPVKIWKLTDLRHIRVNRCSYLCSPST----AGLHKTKMSNLEEFSTLCFSSCTNEIF  590

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNN------LKVLHCLEKLKCFF-TKQRPLPSP  617
             + +PNLK+L +R+   E L+     C L N      + +L  L+  KCFF    R     
Sbjct  591   SAIPNLKRLSIRQTYSESLK-----CALRNTDHFLDMSILRKLQASKCFFYVHYRCSLRR  645

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE-EVFCQLKVM  440
               FP  LK+L+L+G   PW+E+S L  LPNLEV+KLK+       W L + E F ++K++
Sbjct  646   YIFPTCLKRLTLKGSYLPWEELSSLVVLPNLEVLKLKNCKRDDQVWSLKDDEEFARIKLL  705

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             LI    L++WEA S  FP LQSLVLK C+ L  IP  F     L+SIEL++C++S  DS 
Sbjct  706   LIGNTKLKRWEACSDCFPMLQSLVLKDCTELENIPEDFVNSCLLESIELYDCSTSAADSA  765

Query  259   DRI-REEQEDSGNDGFTVRIHR  197
               I +E+QE  GND   V +++
Sbjct  766   RSIAQEKQEMEGNDSLKVHVNK  787



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score =   173 bits (439),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 178/315 (57%), Gaps = 12/315 (4%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR----WCN  965
             F +LRVLD    +F  FP E+L L  LR+LA+    +LP   S+L  L+ LI     W  
Sbjct  566   FGLLRVLDALSVTFFWFPIEVLELVNLRHLALTFDGELPRMVSDLQNLEILIVHQVFW--  623

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
             G    LP E W+M  LRH+ FK+      PGT   +YG+  + L  LQTL  +       
Sbjct  624   GPLSYLPLEIWRMPRLRHLEFKEVFFPNYPGT--LYYGKNTFSLENLQTLVGIRDFRVTE  681

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF---TKQRPLPSPD  614
             ++   +PN+KKL +  ++     +  L C L+NL  LH LE LKC F    +Q+P     
Sbjct  682   DVYKSIPNVKKLEIVYDKNSNTTEWSLYC-LDNLVHLHQLESLKCHFLDAHRQKPDLPDL  740

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP  LK+LSL G + P K M+ + +L NLE++KL+  + +  +WEL E  F +LK++++
Sbjct  741   TFPSKLKELSLLGWEIPSKYMTTIGSLHNLEILKLRFCSLRDDEWELSEGEFYRLKILVL  800

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             +  ++ QW A + +FP L+ L++K+C  L EIP GFG++ TLQ I++ E + S   S  +
Sbjct  801   EGMNIVQWRAEADHFPSLEQLIIKHCRKLEEIPPGFGDIPTLQLIKVVEGSRSCESSAMQ  860

Query  253   IREEQEDSGNDGFTV  209
             I E+Q+  GN G  V
Sbjct  861   ILEDQQSLGNYGLKV  875



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/362 (35%), Positives = 188/362 (52%), Gaps = 26/362 (7%)
 Frame = -3

Query  1216  VDWNDYKDLPKP-SICSFI----AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKIL  1052
              D +D   L +  SI SF      F    +L  F ++R+LD+S      FP +ILCL  L
Sbjct  511   TDDDDNNSLKRTRSIFSFCRDSSTFTLESELTHFNLIRILDLSCIKIHTFPPQILCLIWL  570

Query  1051  RYLAI----GLFNDLPPSFSELCRLQTLIRWCNG---ACLILPEETWKMKELRHVYFKKS  893
             RYL +    G F D+PP  S L  LQT I    G      I PE+ W++ +LRH+    S
Sbjct  571   RYLVLRSRRGSF-DIPPEISRLWSLQTFI--VGGYRLTSTIFPEQIWELMQLRHLELS-S  626

Query  892   SHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrd  713
              H P P   ++   E+  D P L T+S LS   C +E+++ + N++KL +   E +    
Sbjct  627   FHLPNPPI-VSVEEEKCLDFPNLHTISGLSLSCCTKEVISGIRNVRKLRINRGEDDEYES  685

Query  712   eqLVCYLNNLKVLHCLEKLKC--------FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWK  557
               +    +N   LH LE L          +      +PS  +FPP LK+L L G    W+
Sbjct  686   FHVCRLFDNFVHLHQLETLSLELDFRGVLYEISPATIPSVKSFPPMLKKLKLYGTGLRWE  745

Query  556   EMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQ  377
             +++++  L NLE++KLK YA +G +W   E  F +LK++LI+  DL+ W + + +FP L+
Sbjct  746   DLNIIGELRNLEILKLKRYACRGEEWHPSENGFTRLKLLLIEYNDLKYWSSPNDSFPVLE  805

Query  376   SLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
              LV+++CS L +IPI F  + +LQ IEL +C      S  RI+ EQ E+ G     V I 
Sbjct  806   RLVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQKENLGKKPVDVLIS  865

Query  199   RG  194
              G
Sbjct  866   SG  867



>gb|AGX27495.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27497.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27498.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  379   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  437

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  438   ISRLWNLQILIVQAIRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  487

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  488   REHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  539

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  540   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  599

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  600   EFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  659

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  660   IPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AGX27496.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  379   SFLSIGDASQEVLSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  437

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  438   ISRLWNLQILIVQAIRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  487

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  488   REHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  539

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  540   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  599

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  600   EFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  659

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  660   IPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AGX27493.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  379   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  437

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  438   ISRLWNLQILIVQAIRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  487

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  488   REHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  539

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  540   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  599

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  600   EFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  659

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  660   IPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 176/331 (53%), Gaps = 22/331 (7%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFM-RFPSEILCLKILRYLAIGLFNDL-PPSFSELCRLQTLI---RWC  968
             F++LRVLDI+  +    FP +ILCL  LRYLA      L  P    L  L+T +   R C
Sbjct  542   FKLLRVLDIATDTLRGNFPKDILCLFHLRYLAFTFAGSLDSPLDMSLWNLETFVFDYRVC  601

Query  967   NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA  788
                C+   EE W+M++LRH+ F  +     P        E+   L  LQT S L+  +C 
Sbjct  602   --GCIYFAEEIWRMEQLRHLKFSLNC-LTQPSQ------EKCLVLENLQTFSGLNPLNCT  652

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP-----LP  623
             +E+  ++PN+KKL +     +Y   E   C+ N+L  L  LE L              LP
Sbjct  653   KEVFKRIPNVKKLMILGHMVQYGESEMPDCF-NDLASLGKLESLGFHIQTNINHLNLCLP  711

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
              P  FP +LK+L+      PWK M ++  LPNLEV+KL+  A  G +WE  E  F QLK 
Sbjct  712   PPGNFPQNLKKLTFIFTYMPWKNMDIVGMLPNLEVLKLRSSACIGEEWEPSENGFHQLKF  771

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             +L+  +D   W+A+S +FP L+ LVL+ C HL+EIP+ F +  TLQSIE+  C  S   S
Sbjct  772   LLLHCSDPNYWKATSDHFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTS  831

Query  262   VDRIREEQEDSGNDGFTVRI--HRGHNDE*H  176
              ++I+EEQ + G D   VR    RG  DE H
Sbjct  832   AEQIQEEQRNLGVDDLIVRACRIRGCEDEDH  862



>gb|AGW28124.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  379   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  437

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  438   ISRLWNLQILIVQAIRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  487

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  488   REHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  539

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  540   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  599

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  600   EFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  659

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  660   IPTLQVIEVHECRRSVLDSARMIQEEQESWGNEYLEVR  697



>gb|AGX27492.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=700

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  378   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  436

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  437   ISRLWNLQILIVQAIRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  486

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  487   REHFVVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  538

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  539   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  598

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  599   EFENREWEPIEGDFCELKRLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  658

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  659   IPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  696



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/311 (38%), Positives = 168/311 (54%), Gaps = 12/311 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCNGA  959
              F ++RVLD+ + +F RFP+EI+ L  LRY+A+ G F  LP S S+L  L+TLI      
Sbjct  560   AFRLVRVLDLKYINFPRFPNEIVQLVHLRYIALSGNFRVLPASISKLWNLETLIVRTKSR  619

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREI  779
              L +  + WKM + +H+Y    S    P  +     E  +    +QT+S +    C   I
Sbjct  620   ELDIQVDIWKMSQFKHLYTSGLSCLRGPPAKTRKDNEDPFVRRNIQTISTVLPDCCKENI  679

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD-----  614
             L + P L+KLG+R +    +         +NL  L  LE LK       PLP        
Sbjct  680   LARTPGLRKLGIRGKVATLVATNGDSSLFDNLAKLDNLETLK-LLNDTFPLPPSQCQISG  738

Query  613   -----AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
                   FPP+LK+L+L      W  +S L  LPNLEV+KLKDYAFKG+QWE ++  F  L
Sbjct  739   LPQSYKFPPNLKKLTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWEPLDGGFRLL  798

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             +V+ I   +LE W AS  +FP+LQ + LK+CS L EIP G  EV +LQ++EL+    +  
Sbjct  799   RVLHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAA  858

Query  268   DSVDRIREEQE  236
              S   I++E++
Sbjct  859   ASARFIQQEKQ  869



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   172 bits (437),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 168/316 (53%), Gaps = 19/316 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RW  971
             ++ F++LRVLDI F S   FP EIL L  LRYLA+    +LP S S+L  LQTL+    W
Sbjct  690   ISSFKLLRVLDIIFLSSKYFPLEILDLVHLRYLALTATYELPASISKLRSLQTLVIHGPW  749

Query  970   CN---GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPK-LQTLSYLS  803
              N   G    L  E W M  LRH++     +   P     +   R    P+ LQTLS + 
Sbjct  750   INRNQGESPTLLFEYWIMPWLRHLHISMPCYLSNP-----FDPSRCPLAPRYLQTLSTIR  804

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP--  629
             F SC  ++   +P   +     E  E    +    +L NL  L  LE LKC F KQ    
Sbjct  805   FASCTSDVFLVMP-YLRKLGICETKEDFITDMSCRWLKNLANLQYLEALKCSFYKQNAEA  863

Query  628   ----LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
                  PS   FP +L++L+L     PWK+++ ++ LPNLEV+KLK+YAF+G  WE  EE 
Sbjct  864   PRILRPSVLHFPLTLRKLTLSWSYLPWKDIACIAMLPNLEVLKLKNYAFQGPDWEPTEEA  923

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F +LK  LID  +LE WEASS NFP L+ LVL+ C  L+ IP G  E+ TLQ  EL  C+
Sbjct  924   FRRLKHFLIDSTNLENWEASSDNFPCLEHLVLRGCKFLKGIPDGIEEINTLQRFELHYCS  983

Query  280   SSTYDSVDRIREEQED  233
              S   S   I  E  D
Sbjct  984   ESAEISAKGIEVEGLD  999



>ref|XP_011087335.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=794

 Score =   171 bits (432),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 176/321 (55%), Gaps = 27/321 (8%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RW  971
             ++ F +LRVLDI      +FP +IL L  LRYLA+   + LP S S LC LQ LI    W
Sbjct  485   ISAFRLLRVLDILSIKLDQFPRKILQLVNLRYLALST-SKLPSSISRLCNLQFLIFQAIW  543

Query  970   CNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD----LPKLQTLSYLS  803
              +    ++  E   M +LRH+ FK             WY +++ +      +LQ+LS + 
Sbjct  544   FSSNPHVVTPEILDMPQLRHIKFKGI---------YVWYDDKYREHFVVQDQLQSLSTIL  594

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--QRP  629
                    +L  +PNL KLG+  +E              +L +LH L  L C  +K     
Sbjct  595   ASGLNDRVLQTIPNLGKLGIFCDEELDRVI--------DLSLLHNLHTLNCTSSKYLTDN  646

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             L S   FP SLK+L+L GC   + + + +  LPNL+++KL+D  F+   W + E  FCQL
Sbjct  647   LLSNLIFPYSLKELTLDGCGICFGDRTRIGYLPNLQILKLRDCKFELELWVVSEAEFCQL  706

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             K ++++  +LE W A++I FP+L+ LV+++CSHL  IP G G + TL+ IE++ECN S  
Sbjct  707   KCLIMEKLNLEYWAANNICFPRLEHLVIRHCSHLDRIPHGIGGIPTLKLIEVYECNPSLV  766

Query  268   DSVDRIREEQEDSGNDGFTVR  206
             DS   I++EQE  GNDG  VR
Sbjct  767   DSARMIQKEQESYGNDGLEVR  787



>gb|AGX27494.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score =   170 bits (430),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 186/338 (55%), Gaps = 35/338 (10%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LRYLA+   ++LP S
Sbjct  379   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRYLALST-SELPSS  437

Query  1009  FSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
              S L  LQ LI    R+ +   ++ PE    M +LRH+ FK             WY +++
Sbjct  438   ISRLWNLQILIVQATRFSSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKY  487

Query  841   WD----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
              +      +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  L
Sbjct  488   REHFVVQDQLQSLSTILAPGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRL  539

Query  673   HCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
             H L  L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+  
Sbjct  540   HNLHTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGC  599

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
              F+  +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G+
Sbjct  600   EFENREWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGD  659

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             + TLQ IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  660   IPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  697



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   171 bits (433),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 182/325 (56%), Gaps = 29/325 (9%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCN----  965
             F++LRVLD     F+ FP E++ L  LRYL++     +P S S+L  LQ LI   +    
Sbjct  559   FDLLRVLDALTLYFIEFPKEVVALIHLRYLSLTYNGKIPSSISKLRNLQVLIVRQHPKII  618

Query  964   --GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSC  791
               GA  ILP E W M +LRH+ F +S+   +PG  +         L  LQ+LS +    C
Sbjct  619   FLGAS-ILPVEIWNMPQLRHLLFTESNLPSLPGLEID--ANDSVLLKNLQSLSDVHAACC  675

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF-FTKQRPLPSPD  614
              + +L  VPNL KLG   EE   +     +C       L+ LEKL+ F F    P+P+P+
Sbjct  676   IKNVLRHVPNLTKLGTWVEEPSDVH----LC-------LNQLEKLESFKFIVLNPIPNPE  724

Query  613   -------AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
                     FP +L +L+L GC   W++M+++  LPNLEV+KL+++AF+G +W+L E  F 
Sbjct  725   NNFLPKLVFPKTLTKLTLSGCGLHWEDMAIIEELPNLEVLKLREFAFQGPKWDLEEMFFP  784

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSS  275
             +LK +L++   L+ W AS  NFP L+ L++++C  L +IP    E+  L+ I+L +C+ +
Sbjct  785   ELKFLLLEALQLQIWTASDDNFPSLERLIIRHCYELEKIPPEIAEIGPLRLIQLVDCSPT  844

Query  274   TYDSVDRIREEQEDSGNDGFTVRIH  200
                S   I+++++ +  D   VRIH
Sbjct  845   AVASAQEIKKDKQRTKKD-LEVRIH  868



>emb|CDP10323.1| unnamed protein product [Coffea canephora]
Length=686

 Score =   169 bits (429),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 173/311 (56%), Gaps = 14/311 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F+ LRVLD+ F  F  FP++I+ L+ L YLA+ +   LP + + L  LQTL+   NG   
Sbjct  372   FQSLRVLDMFFLQFDSFPAQIVNLEYLTYLALNVTYKLPTALARLKNLQTLV--INGPWP  429

Query  952   I-----LPE---ETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
             I     LP      W M  LRH++    +         +    +   L  L+TLS + F 
Sbjct  430   IRDDADLPTLIVRYWSMPNLRHLHTTMVAFLSYITDAASNIYRKPLPLGYLKTLSTVQFL  489

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF---TKQRPL  626
              C R+    +P L +LGL E + +Y RD    C L +L  LH LE L C F    ++   
Sbjct  490   CCRRDAFANMPYLAELGLCETKEDYYRDRSCEC-LKDLAYLHKLEALNCSFYREIREART  548

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
              S DAFP +L++L+L     PW++M+ ++ LPNLEV+KLK+YAF+GS W+L +EVF  LK
Sbjct  549   ISWDAFPSNLRKLTLSASNLPWEDMTNVAKLPNLEVLKLKNYAFRGSTWKLTDEVFRCLK  608

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
              +LI+  D+ QWEA   +FP LQ L+L+ C  L E+P   GE+ TL+ IEL  CN S   
Sbjct  609   QLLIEKTDIVQWEAEDDHFPCLQFLILRSCEFLAELPYVLGEIPTLERIELHYCNESAEL  668

Query  265   SVDRIREEQED  233
             S    ++  ED
Sbjct  669   SAQEFKDLIED  679



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 189/359 (53%), Gaps = 34/359 (9%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPK-PSICSFIAFGRVQQLN--------GFEMLRVLDISFQSFMR  1085
             RL F+ D  ++D    P  P + SF+ F     +         GF++LRVLDI F  F  
Sbjct  762   RLSFHLD-PYSDVAAAPGIPHVSSFMCFTLGTNIVPNILFFQLGFKVLRVLDIFFLHFDY  820

Query  1084  FPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWC------NGACLILPEETWKMK  923
             FP+ IL L  LRYLA+    +LP S S+L  LQTL+         +G+   L  E W M 
Sbjct  821   FPARILKLIHLRYLALSATYELPASVSQLRNLQTLVIHGPWHCRESGSSPTLLLEYWSMP  880

Query  922   ELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKL------QTLSYLSFGSCAREILTQVPN  761
              LRH+    + +   P    +       +LP+L      QTLS +    C +E+ + +P+
Sbjct  881   SLRHLQCSVTIYLKNPPGANS-------ELPQLFVPKNVQTLSTIKISCCTKEVFSVMPH  933

Query  760   lkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR----PLPSPDAFPPSLK  593
             LKKL + E E +    E  V  L NL+ L  LE L+C F KQR     +    A P SL+
Sbjct  934   LKKLEICETEEDCGICEPSV-LLGNLQYLKELETLECCFYKQRVEARQISFFSALPCSLR  992

Query  592   QLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQ  413
             QLSL     PW++ S++  LP LEV+KLK +AF G +WE   + FC+L  +LI+  DL  
Sbjct  993   QLSLSWSYLPWEDTSLIGMLPRLEVLKLKHFAFHGPKWEPKTKGFCRLTHLLIENTDLVH  1052

Query  412   WEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
             WEA+  +FP+LQ LVLK C  L EIP    E+ TLQ IEL  CN +T      I+E+ E
Sbjct  1053  WEATVHHFPRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILAREIQEQVE  1111



>gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
 gb|EYU17762.1| hypothetical protein MIMGU_mgv1a000811mg [Erythranthe guttata]
Length=977

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/324 (35%), Positives = 181/324 (56%), Gaps = 30/324 (9%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD     F+ FP+EIL L  LR+L+      LP + S L +LQ L+   +   +
Sbjct  667   FDLLRVLDAFTVYFIEFPNEILKLIHLRFLSFTYNGKLPSALSNLDKLQVLMVRRHPKII  726

Query  952   -----ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA  788
                  ILP+E W +K LRH+ F +S    +P  R T           LQTL+ +S  SC 
Sbjct  727   FLGTSILPDEIWGLKHLRHLLFTESDLPKIPAVRNTLL------FANLQTLTNVSAASCT  780

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF-FTKQRPLPSPDA  611
             +E+L  +PNL KL +  EE   +       YLN +      EKL+ F FT   P+P    
Sbjct  781   QEVLQNMPNLTKLAMWTEEPATIG-----LYLNEV------EKLESFKFTVLNPIPKKKV  829

Query  610   -------FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQ  452
                    FP +L++L L GC  PW++MS+++ LP LEV+KL++ AF+G +W   ++ F +
Sbjct  830   DFQPRLYFPRTLRKLRLSGCSLPWEDMSIIAKLPLLEVLKLREIAFEGDEWIPEKKEFRE  889

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             LK +L++  DL+ W+A   ++PKLQ L+L++C  L +IP  F  +  L+ IEL +C+   
Sbjct  890   LKFLLLEYLDLKGWDADHTHYPKLQRLILRHCYELVDIPEKFDLLGCLELIELVDCSPDA  949

Query  271   YDSVDRIREEQEDSGNDGFTVRIH  200
              ++ + ++++ + SGN    ++ +
Sbjct  950   VEAAEEMKKKLKKSGNTLLKIQTY  973



>ref|XP_006355211.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=498

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 129/323 (40%), Positives = 179/323 (55%), Gaps = 8/323 (2%)
 Frame = -3

Query  1150  VQQLNGFEMLRVLDI--SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI  977
             ++  + F++LRVL I   +  F  FP  I  L  LRYL +   ++ P S  EL  LQTLI
Sbjct  177   LEAFSHFKLLRVLAIFHGYACFRSFPLVITKLFHLRYLQMQCNDNPPASIVELQNLQTLI  236

Query  976   RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                      LPE+ W MK LR ++ +K+   P PG +          +P ++ LS LSF 
Sbjct  237   YGREYGYTTLPEKIWMMKNLRCIHIRKACSLPNPGGKSILNKHLVIGMPNVEELSNLSFT  296

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--QRPLP  623
             SC  EI + +PN+K+L ++        D      L ++  L  LE LKC       + L 
Sbjct  297   SCTNEIFSNIPNVKRLIIQNTPLLRTGDWANP--LIDMSSLTKLEALKCVKLSWYVQTLI  354

Query  622   SPDAFPPSLKQLSLRGCQR-PWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQL  449
             S  +FP SLK+L+L G     WK+MS L  LPNLE +KLKD+A   + W L +E  F  L
Sbjct  355   SIRSFPTSLKRLTLAGWHNFTWKDMSTLVMLPNLEELKLKDHAAILNVWRLNDEDKFQSL  414

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             + +L    +LE WEASS NFP L+ LVLK C  L+EIPI FGE+ +L+SIEL  C++   
Sbjct  415   EFLLFCDINLEHWEASSDNFPNLKRLVLKKCKKLKEIPIDFGEICSLESIELHNCSTLAE  474

Query  268   DSVDRIREEQEDSGNDGFTVRIH  200
             +S  +I +EQED GN+   V I+
Sbjct  475   ESARKIEQEQEDMGNNFLKVYIN  497



>ref|XP_009601833.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=662

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 173/332 (52%), Gaps = 24/332 (7%)
 Frame = -3

Query  1153  RVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-  977
             ++     F+++RVL I    F  FP EI  L  LRYL I    +LP S S+L  LQTL+ 
Sbjct  334   QISLFTSFKLIRVLAIFSHLFSSFPVEITQLIHLRYLWIRSNGNLPASVSQLYNLQTLVF  393

Query  976   ----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY  809
                  +     LILP E W M +LR +     ++   P        +    L  L+ LS+
Sbjct  394   QQPELYYMYKTLILPREIWNMTQLRRLRLLSGNYLSKPKRTDEGATDTVLGLRNLEELSH  453

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP  629
             L F SC  E+ + +PN++KLG+ +   +   +     YL NL +L  LE LKC    Q+ 
Sbjct  454   LCFASCTAEVFSCLPNIRKLGILDAASDDASE-----YLKNLVLLGKLETLKCVCYGQKR  508

Query  628   LPSPD--AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VF  458
             L   +  A   S+K+L L GC    ++M+ L+ LPNLEV+KL+D  F+G  W L +E  F
Sbjct  509   LSLSNWCASLTSVKRLILSGCLLLSEDMANLATLPNLEVLKLRDNEFEGQAWTLSDEDEF  568

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
              QLK +L+    L  WEA S+NFP LQ LVL+ C  L E+P    E+ TL+ IEL  C+ 
Sbjct  569   NQLKFLLLAEPRLVNWEAGSVNFPTLQKLVLRKCIRLEEVPNDIVEICTLEVIELICCS-  627

Query  277   STYDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
                     IREEQE  GN    VR +   NDE
Sbjct  628   --------IREEQESMGNSCLDVRAY--ANDE  649



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score =   169 bits (427),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 180/330 (55%), Gaps = 21/330 (6%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRL  989
             F    R   L  F++LRVL I    F  FP  I  L  LRYL +   +++    SEL  L
Sbjct  558   FHGLSRFPLLERFKLLRVLAIHNCCFQDFPVVITNLVHLRYLELYCEDNIHRLVSELYNL  617

Query  988   QTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQ  821
             QTLI    R        +PE  W+++ LRH++      FP+  +R    G   + L  L+
Sbjct  618   QTLIFHHQRLYTSR---VPETIWQIEHLRHLHVTGFFSFPIT-SREVKPG---FKLQNLE  670

Query  820   TLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT  641
              LS L   SC  E+ + +PNLK+L +  +  E    +    YLN+L    CL++L+ F  
Sbjct  671   RLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQ-YLNSLS---CLKELEMFKL  726

Query  640   K----QRP-LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
                  Q P +PS  A P  LK+L+L     PW++M+ +  LPNL+ +K+K   F G  W+
Sbjct  727   NGDGLQLPRIPSIFALPICLKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWK  786

Query  475   LI-EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             L  EE F QLK +LI   +L+ WEASS+NFP+L+ LVLK C +L EIP   GE+ TL SI
Sbjct  787   LNDEEAFNQLKFLLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASI  846

Query  298   ELWECNSSTYDSVDRIREEQEDSGNDGFTV  209
             EL EC+ S   SV+ I+EEQ   GN+  +V
Sbjct  847   ELHECSISAAKSVNEIQEEQASMGNNCLSV  876



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score =   168 bits (426),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 180/330 (55%), Gaps = 21/330 (6%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRL  989
             F    R   L  F++LRVL I    F  FP  I  L  LRYL +   +++    SEL  L
Sbjct  558   FHGLSRFPLLERFKLLRVLAIHNCCFQDFPVVITNLVHLRYLELYCEDNIHRLVSELYNL  617

Query  988   QTLI----RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQ  821
             QTLI    R        +PE  W+++ LRH++      FP+  +R    G   + L  L+
Sbjct  618   QTLIFHHQRLYTSR---VPETIWQIEHLRHLHVTGFFSFPIT-SREVKPG---FKLQNLE  670

Query  820   TLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT  641
              LS L   SC  E+ + +PNLK+L +  +  E    +    YLN+L    CL++L+ F  
Sbjct  671   RLSCLCLSSCTSELFSAIPNLKRLKVHGDWEECEGRKMSQ-YLNSLS---CLKELEMFKL  726

Query  640   K----QRP-LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
                  Q P +PS  A P  LK+L+L     PW++M+ +  LPNL+ +K+K   F G  W+
Sbjct  727   NGDGLQLPRIPSIFALPICLKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWK  786

Query  475   LI-EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             L  EE F QLK +LI   +L+ WEASS+NFP+L+ LVLK C +L EIP   GE+ TL SI
Sbjct  787   LNDEEAFNQLKFLLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASI  846

Query  298   ELWECNSSTYDSVDRIREEQEDSGNDGFTV  209
             EL EC+ S   SV+ I+EEQ   GN+  +V
Sbjct  847   ELHECSISAAKSVNEIQEEQASMGNNCLSV  876



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   166 bits (419),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 169/308 (55%), Gaps = 13/308 (4%)
 Frame = -3

Query  1126  MLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RWC---N  965
             +L +LDI F  F  FP +IL L  LRYLA+ +  +LP S S+L  LQTL+    W    +
Sbjct  234   VLSLLDIFFLHFDYFPDQILKLIHLRYLALNVTYELPASVSQLRNLQTLVIHGPWLCRES  293

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
             G    L  E W M  LRHV+   + H   P T       R +    LQTL  + F  C +
Sbjct  294   GGSPTLLLEYWSMPSLRHVHITAACHLKNPFTVQDNL-PRPFASEHLQTLYTIQFSCCTK  352

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ----RPLPSP  617
             E  + +P+LKKLG+ E + +Y  D      LNNL  L  LE L+C F  Q    R     
Sbjct  353   EFFSVMPHLKKLGICETKEDYSTDSLSQ-VLNNLVCLQELETLECSFHTQNREVRKNLGL  411

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
              A P +LK LSL     PW++M+ ++ LPNLEV+KLK+YAF+G +WE  EE F  LK +L
Sbjct  412   AALPVTLKHLSLSWSYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPTEEGFHSLKHLL  471

Query  436   IDIADLEQWEASSI-NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             I+  DL  WEA  + +FP LQ LVLK C  L EIP G  E+ TLQ +E   C+    +S 
Sbjct  472   IENTDLIHWEAIIVRHFPCLQHLVLKSCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSA  531

Query  259   DRIREEQE  236
               I+E+ E
Sbjct  532   KEIQEQIE  539



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 178/318 (56%), Gaps = 12/318 (4%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFN--DLPPSFSELCRLQT-LIRWCNG  962
             F++L+VL++  +    FP EIL L  LRYL++  +   D+PP    L  LQT +++    
Sbjct  578   FKLLKVLELRHRQIDGFPREILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIVQRFRS  637

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGE-RHWDLPKLQTLSYLSFGSCAR  785
               +I  EE W++ +LRH+   K   F +P        + RH D   LQT+SYLS   C +
Sbjct  638   DIIIFAEEIWELMQLRHL---KLPRFYLPDCPSGSVDKGRHLDFSNLQTISYLSPRCCTK  694

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP----SP  617
             E++  + N+KKLG+   + +Y          NNL  L  LE L         LP    S 
Sbjct  695   EVIMGIQNVKKLGISGNKDDYKSFRDS-GLPNNLVYLQQLEILSLISVDYSLLPVIISSA  753

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
              AFP +LK+L L      W  + +++ LPNLEV+KL D A  G +W  I   F +LK++L
Sbjct  754   KAFPATLKKLKLERTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLLL  813

Query  436   IDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD  257
             I  + L+ W+A++ NFP L+ L+++ C +L+EIPI F +++TLQ IEL EC     +S  
Sbjct  814   IKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGESAA  873

Query  256   RIREEQEDSGNDGFTVRI  203
             RI++EQED GN+   VRI
Sbjct  874   RIQKEQEDLGNNPVDVRI  891



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 170/315 (54%), Gaps = 11/315 (3%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F+RFP+EI  L  LRYLA+     +P S S L  LQTLI       L
Sbjct  506   FQLLRVLDVLLIYFLRFPTEITQLVHLRYLALATSTSVPASISNLWNLQTLIVHSVANEL  565

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA-REIL  776
               P E WK+  L H Y  K  + P P     + G     L  L+ LS  +  S   +EI 
Sbjct  566   SWPLEIWKISSLIHFYPGKM-YVPAPPKAPNFLG-----LENLEELSLSTATSSDLKEIF  619

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--QRPLPSP-DAFP  605
               +P++K L +   +  +      + YL +L+ L  L +L  F  +  QRP   P D FP
Sbjct  620   MAIPHVKVLDVELNQDGWDNVIDNLIYLADLQNLRILLRLP-FDAQLFQRPSARPFDVFP  678

Query  604   PSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIA  425
              +LK L L      W EM++LS LPNLE +KL+ +AF+GS W L E  F +LK++ I   
Sbjct  679   ANLKSLILAETHLLWTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQT  738

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
             +L  W A+S + P L+ L+L++C  L+EIP   G++ TL+ +EL  C+ S   S + I E
Sbjct  739   ELVHWHATSDSLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILE  798

Query  244   EQEDSGNDGFTVRIH  200
             EQ+  GN+   VR +
Sbjct  799   EQQCLGNEILAVRAY  813



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score =   167 bits (423),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 174/336 (52%), Gaps = 26/336 (8%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLP-PSFSELCRLQTLIRWCN  965
             +  F +L+VLDI        PS I  L +L+++A+ + ND    SF  L  LQ LI  C 
Sbjct  574   MKNFMLLKVLDIMNIHLSIVPSVIADLILLKFMALTIVNDFSMDSFITLRGLQILIIDCE  633

Query  964   -GACLILPEETWKMKELRHVYFKKS--SHFPVPGTRMTWYGE--------RHWDLPKLQT  818
                CL      W M ELRH   K+S  S+ P+  T+              R   L  LQT
Sbjct  634   WDGCL--ARILWDMLELRHFRLKRSCLSNSPIYYTKSASTSVLSLQDAEVRLRVLKNLQT  691

Query  817   LSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT-  641
             LS +   SC +E+   VPNL+KLG+ + E +Y        +   L  L  LE LK  F+ 
Sbjct  692   LSTIRPISCTQEVFLSVPNLRKLGIYQTEEDYRFRG----WFEQLVHLQELETLKYAFSN  747

Query  640   -------KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQ  482
                    K   LPS  +FPP L +L+L G   PW++M  LS LP LEV+KL++YAF GS 
Sbjct  748   PFVSSALKPDRLPSWRSFPPKLVKLTLSGTSLPWEDMVELSMLPKLEVLKLRNYAFSGSV  807

Query  481   WELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQS  302
             W+  E  F +LK +LI   +LE W+A   +FP LQ LVL++C  L+EIP G  E   L+ 
Sbjct  808   WKSREGGFPRLKFLLIGSTNLEIWDADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLLEK  867

Query  301   IELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRG  194
             IEL  C  S   S   ++EEQ+  GNDG  + I  G
Sbjct  868   IELHCCKDSAVISARHLQEEQQSLGNDGLKIHISEG  903



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 170/315 (54%), Gaps = 11/315 (3%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F+RFP+EI  L  LRYLA+     +P S S L  LQTLI       L
Sbjct  564   FQLLRVLDVLLIYFLRFPTEITQLVHLRYLALATSTSVPASISNLWNLQTLIVHSVANEL  623

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA-REIL  776
               P E WK+  L H Y  K  + P P     + G     L  L+ LS  +  S   +EI 
Sbjct  624   SWPLEIWKISSLIHFYPGKM-YVPAPPKAPNFLG-----LENLEELSLSTATSSDLKEIF  677

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK--QRPLPSP-DAFP  605
               +P++K L +   +  +      + YL +L+ L  L +L  F  +  QRP   P D FP
Sbjct  678   MAIPHVKVLDVELNQDGWDNVIDNLIYLADLQNLRILLRLP-FDAQLFQRPSARPFDVFP  736

Query  604   PSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIA  425
              +LK L L      W EM++LS LPNLE +KL+ +AF+GS W L E  F +LK++ I   
Sbjct  737   ANLKSLILAETHLLWTEMTMLSNLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQT  796

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
             +L  W A+S + P L+ L+L++C  L+EIP   G++ TL+ +EL  C+ S   S + I E
Sbjct  797   ELVHWHATSDSLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILE  856

Query  244   EQEDSGNDGFTVRIH  200
             EQ+  GN+   VR +
Sbjct  857   EQQCLGNEILAVRAY  871



>ref|XP_009782925.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=795

 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 132/360 (37%), Positives = 180/360 (50%), Gaps = 41/360 (11%)
 Frame = -3

Query  1210  WNDYKDLP--KPSICSFIAFGRVQQLNGFEMLRVLDISFQS--FMRFPSEILCLKILRYL  1043
             +N  K LP    SI  F     ++  + F +LRVL I  +   F  FP  I  L  LRYL
Sbjct  448   YNYSKVLPHVSRSIYLFSGLTGLEVFSRFNLLRVLHIFHEDERFDSFPLAITKLFHLRYL  507

Query  1042  AIGLFNDLPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTR  866
             A+     +P S SEL  LQT+I        + LP + W M  LR ++   +S+FP P  +
Sbjct  508   AVRFDGSVPGSISELQNLQTIIIHGKEYRNITLPGKIWTMTNLRLMHLGSNSYFPRPRKK  567

Query  865   MTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLN-  689
                      ++P L+ L  L   SC+ E+ + +PNLKKL               +CY + 
Sbjct  568   GISNKHNVVEMPNLEELFGLCSTSCSNEVFSSIPNLKKLI--------------ICYASC  613

Query  688   ----------NLKVLHCLEKLKCFFTKQRPLPSPDA-----FPPSLKQLSL-RGCQRPWK  557
                       ++  L  LE LKC     R   SPD+     FP SLK+L+L R    PW+
Sbjct  614   RTNDSAKRFIDMSSLTKLEALKCL----RGDYSPDSIKSFGFPTSLKRLTLTRWFGFPWE  669

Query  556   EMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQLKVMLIDIADLEQWEASSINFPKL  380
             ++S L  LP LE +KLK +      W L  E+ F +L  +L    D   WEASS +FP L
Sbjct  670   DISTLVMLPYLEELKLKRWVVGDEVWRLSNEDKFERLNFLLFCQLDFRCWEASSDSFPNL  729

Query  379   QSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             + LVL +C +L EIP  FGE+ TL+SIEL  C++S  DS   I +EQED GN+   V IH
Sbjct  730   KRLVLNHCPYLEEIPTDFGEICTLESIELHNCSTSAEDSARNIEQEQEDMGNNCLKVYIH  789



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 171/307 (56%), Gaps = 13/307 (4%)
 Frame = -3

Query  1174  CSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSEL  998
             C    F    ++  F++LR LD+S      FPS+ILCL  LRYLA+ G F D+PP    L
Sbjct  595   CPLPNFTLESEIIRFKLLRTLDLSPIELESFPSQILCLIWLRYLALSGRFIDIPPEICRL  654

Query  997   CRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQ  821
               L TLI    +  C++ PE+ W++ +LRH+    + + P P +        H  L  +Q
Sbjct  655   WNLHTLIFEGSSSECIVFPEQIWELMQLRHLKLN-AFYLPNPPSVSAEEEGTHLALSNVQ  713

Query  820   TLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT  641
             T+  LS  SC +E+++ + N+KKLG+  +  ++          +NL  LH LE L+ +F 
Sbjct  714   TIYLLSAFSCTKEVISGIENVKKLGIYGDRDDFEDSR----LFDNLVYLHQLENLRFYFH  769

Query  640   K-----QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
                   +  +PS +AFP +LK+L L G    W++++++S LPNLEV+K+     K ++W 
Sbjct  770   STWKFGEATIPSAEAFPATLKKLELNGTCLRWEDINIISELPNLEVLKVLS-VMKDNEWY  828

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
              +   F QLK++LID   L  W+A+  NFP L+ LVL+ C +L EIPI F ++  L+   
Sbjct  829   TVAGGFTQLKLLLIDWTRLNYWKATDDNFPALECLVLRSCFNLEEIPIEFADISLLRKPN  888

Query  295   LWECNSS  275
             ++  N S
Sbjct  889   VYSVNKS  895



>ref|XP_009764457.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=487

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 121/321 (38%), Positives = 165/321 (51%), Gaps = 37/321 (12%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             L  F++LRVL I   +F  FP E+  L  LRYL    ++DL  S SEL  LQ L+    G
Sbjct  149   LARFKLLRVLAILQYTFREFPLELTKLVHLRYLEFNCYDDLHRSVSELYNLQNLV--FGG  206

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                +   + WKMK LRH+  +K S F VP ++        + L  L+ LS +S   C +E
Sbjct  207   HSNLPVSDIWKMKLLRHLQVRKISSFRVPSSKEG----SGYKLQNLEGLSDISISCCTKE  262

Query  781   ILTQVPNlkklglree--------egeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPL  626
             + T  PNLK+L +             + L +   +  L  LK++ C  KL         L
Sbjct  263   LFTGFPNLKRLKIHGAWAECRRDMIFQTLNNLSCLNNLEILKII-CSRKLYPHL-----L  316

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             PS  A P SLK+L+LR    PW++M+ +  LPNLE +K+KD  F                
Sbjct  317   PSKYALPTSLKRLTLRCTYLPWEDMANIVTLPNLEELKIKDNGFN---------------  361

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
               L    +L+ W+A S+NFP L+ LVLK C +L EIP   GE+ TL+SIEL  C SS   
Sbjct  362   --LTATTNLKHWDAGSVNFPMLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAK  419

Query  265   SVDRIREEQEDSGNDGFTVRI  203
             SV  I+EEQE   ND  +VR+
Sbjct  420   SVKEIQEEQESMANDNLSVRV  440



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score =   166 bits (421),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score =   166 bits (420),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score =   166 bits (420),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score =   166 bits (420),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score =   166 bits (420),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score =   166 bits (419),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 185/332 (56%), Gaps = 16/332 (5%)
 Frame = -3

Query  1171  SFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             S + F    +L  F +LR+LD+S      FP++ILCL  LRYLA+  + D+PP F  L  
Sbjct  625   SALYFTLTSKLFHFSLLRILDLSPIELPIFPAQILCLIWLRYLALSGYFDIPPEFCRLWN  684

Query  991   LQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             LQT I     +   LPE+ WK+ ELRH+  + S   P P + ++   ER+     +QT+S
Sbjct  685   LQTFIASFFTS---LPEQIWKLTELRHLELE-SLDLPNPPS-VSVDEERYLGFSNIQTIS  739

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              LS  SC  E+++ + N+KKL +  E+ EY   ++   + +NL  LH LE L   F    
Sbjct  740   GLSPSSCTEEVISGIRNVKKLRIFGEKDEYQICQESRLF-DNLVHLHQLETLS--FEINV  796

Query  631   P--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWE  476
             P        + S   FP +LK+L+L      W++++++  LPNLE +KL + A KG  W 
Sbjct  797   PWNEVFSMTISSAKVFPATLKKLTLLRTNLRWEDLNIIGELPNLEGLKLHEDACKGEIWC  856

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
                  F +LK++ I    ++ W+A++ +FP L+ L ++YC +L EIPI F E+Y+LQ + 
Sbjct  857   PSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVV  916

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L +C      S  RI++EQED GN    VR +
Sbjct  917   LKDCKPKLKASAARIQQEQEDLGNKPVDVRFY  948



>ref|XP_011087137.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=870

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 121/328 (37%), Positives = 170/328 (52%), Gaps = 31/328 (9%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGAC  956
             GF +LRVLD     F  FP EI+ L  LRYLA      LP S S+L  L+ LI     + 
Sbjct  546   GFRLLRVLDALTVRFYGFPIEIVKLVQLRYLAFTYNGRLPASISKLQNLRHLIVHQYLSI  605

Query  955   L-------ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
             +        LP E W M+EL+H+     S  P P +   +       LP L TL  +S  
Sbjct  606   ISSRARRSYLPMEIWNMRELKHLQVM-GSDLPNPDSEGAF-------LPNLSTLLGISAH  657

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP----  629
             SC  EIL ++PNLKKLG + E      +   V     LK       LKC      P    
Sbjct  658   SCTEEILGRIPNLKKLGFQVELPLDAVEPLHVANSRGLK------SLKCAIVNPNPSFDQ  711

Query  628   -----LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE  464
                  L     FP +LK+L+L G   PW++MS+++ + NLEV+KL+ YAF+GS W+  ++
Sbjct  712   VVVPALQGVSIFPSTLKKLTLSGLSLPWEDMSIIACIWNLEVLKLRCYAFRGSVWQTCQK  771

Query  463   VFCQLKVMLIDIADLEQWEASSIN-FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWE  287
              F  L+ +LI+  DLE W  + I+ FP LQ L + +C  L+EIP  F EV TLQ +E+ +
Sbjct  772   GFKNLRFLLIEDMDLEYWTGNRISFFPDLQRLTVGHCYKLKEIPCQFEEVLTLQMMEVVD  831

Query  286   CNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             C  S   S ++I ++Q+  GN    +R+
Sbjct  832   CAPSLVASAEKIVKQQKGCGNHVLQLRV  859



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score =   165 bits (418),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (53%), Gaps = 16/351 (5%)
 Frame = -3

Query  1216  VDWNDYKDLPKP----SICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
              D +DY  L +     S C    F    +L  F +LR+LD+     + FP  +LCL  LR
Sbjct  588   TDDDDYTLLKRTRSIFSFCLNSTFTINPELIHFSLLRILDLGTTKLISFPPHVLCLIWLR  647

Query  1048  YLAI-GLFND--LPPSFSELCRLQTLI--RWCNGACLILPEETWKMKELRHVYFKKSSHF  884
             YLA+ G   D  +PP    L  LQTLI  +      +   E+ W++ +LR +   K    
Sbjct  648   YLALSGTGEDFYVPPEICRLWNLQTLIIVKLNFPGDVTFTEKIWELMQLRQLRLHKFYLS  707

Query  883   PVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqL  704
               P  R +   E +     + T+S LS  SC +E+++ + N+KKL +     +Y   ++ 
Sbjct  708   NPP--RESDDEESYLAFSNIHTISGLSPSSCTKEVISGIRNVKKLVICGYANDYEIFQRS  765

Query  703   VCYLNNLKVLHCLEKLKCFFTKQ----RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSA  536
               + NNL  LH LE L     ++      +PS  AFP +LK+L L      W++++++  
Sbjct  766   GLF-NNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  824

Query  535   LPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYC  356
             LPNLEV+KL   A  G +W  IE  F +LK++LI   DL+ W+A+  NFP L+ L+++ C
Sbjct  825   LPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKATDDNFPVLERLLIRDC  884

Query  355   SHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
               L EIPI F ++Y+LQ IEL +C +    S  RI++EQED G     VRI
Sbjct  885   HRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLGIKPVDVRI  935



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score =   165 bits (417),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (53%), Gaps = 16/351 (5%)
 Frame = -3

Query  1216  VDWNDYKDLPKP----SICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
              D +DY  L +     S C    F    +L  F +LR+LD+     + FP  +LCL  LR
Sbjct  545   TDDDDYTLLKRTRSIFSFCLNSTFTINPELIHFSLLRILDLGTTKLISFPPHVLCLIWLR  604

Query  1048  YLAI-GLFND--LPPSFSELCRLQTLI--RWCNGACLILPEETWKMKELRHVYFKKSSHF  884
             YLA+ G   D  +PP    L  LQTLI  +      +   E+ W++ +LR +   K    
Sbjct  605   YLALSGTGEDFYVPPEICRLWNLQTLIIVKLNFPGDVTFTEKIWELMQLRQLRLHKFYLS  664

Query  883   PVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqL  704
               P  R +   E +     + T+S LS  SC +E+++ + N+KKL +     +Y   ++ 
Sbjct  665   NPP--RESDDEESYLAFSNIHTISGLSPSSCTKEVISGIRNVKKLVICGYANDYEIFQRS  722

Query  703   VCYLNNLKVLHCLEKLKCFFTKQ----RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSA  536
               + NNL  LH LE L     ++      +PS  AFP +LK+L L      W++++++  
Sbjct  723   GLF-NNLAHLHQLETLSVELVRKWDSPATIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  781

Query  535   LPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYC  356
             LPNLEV+KL   A  G +W  IE  F +LK++LI   DL+ W+A+  NFP L+ L+++ C
Sbjct  782   LPNLEVLKLMRNACIGKEWYPIEGGFTRLKLLLIVHCDLKYWKATDDNFPVLERLLIRDC  841

Query  355   SHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
               L EIPI F ++Y+LQ IEL +C +    S  RI++EQED G     VRI
Sbjct  842   HRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLGIKPVDVRI  892



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score =   164 bits (416),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 167/305 (55%), Gaps = 13/305 (4%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCN  965
             L+ F ++RVLD+   SF RFP+EI+ L  LR++A+ G F  LP + S L  LQT+I    
Sbjct  559   LDAFGLVRVLDLRSISFSRFPNEIVQLVHLRFIALFGNFKILPATISNLWNLQTIIVRTT  618

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
                L +  + WKM +LRH++    S    P ++     E  +    + T+S +S  SC  
Sbjct  619   CRELNILADIWKMLQLRHLHTSGISFLNGPPSQTRKNYEDPFVRRNILTISTISPDSCTE  678

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPL-------  626
              IL + PNL+KLG+R +    + ++      + L  L  LE LK       PL       
Sbjct  679   NILARTPNLRKLGIRGKLITLVEEKGGSTMFDILAKLDRLESLK-LLNDAFPLDPSRCII  737

Query  625   ---PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
                P    FPP+LK+++L      W  MS L  LPNLEV+KLKDYAFKGS+WE ++  F 
Sbjct  738   PGLPPSYKFPPNLKKITLSDTLLDWDHMSTLGMLPNLEVLKLKDYAFKGSRWEPLDGGFR  797

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIEL-WECNS  278
              L+V+ I   DL  W+AS  +FP+LQ +V ++CS L  IP G  EV  LQ++EL W   +
Sbjct  798   LLRVLKIGRTDLIWWDASGHHFPRLQCVVFRHCSSLEAIPSGLAEVSALQNMELHWPKPT  857

Query  277   STYDS  263
             + Y +
Sbjct  858   AAYSA  862



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/333 (36%), Positives = 179/333 (54%), Gaps = 19/333 (6%)
 Frame = -3

Query  1162  AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFN----DLPPSFSELC  995
              F     L  ++ L +LD+S      FP EILCL  LRYL +  +     D+PP   +L 
Sbjct  548   TFTLRSNLRHYKTLTILDLSLIQLSSFPPEILCLICLRYLVLSRYGWWGFDIPPEIFKLV  607

Query  994   RLQTLIRWCNGAC-LILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQT  818
              LQT I    G+  +I P+  W++  +RH+   K + F +P        ER+     +QT
Sbjct  608   NLQTFIVEGYGSIDVIFPQHIWELTGIRHL---KLNLFYLPNPPNV--SERYLVFSNVQT  662

Query  817   LSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF--  644
             +S LS  SC +E+++ + N+KKLG+  + G+Y   ++   + +NL  LH LE LK  F  
Sbjct  663   ISGLSPCSCTKEVISSIQNVKKLGIVGDGGDYRTFQKSA-FFDNLVHLHQLETLKFQFRY  721

Query  643   ------TKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQ  482
                        +PS  AFP +LK L L G    W++++++  LPNLEV+KL   A  G +
Sbjct  722   VWMSEQISPATIPSAKAFPATLKNLKLVGTGLRWEDLNIIGELPNLEVLKLILDACCGQE  781

Query  481   WELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQS  302
             W  IE  F +LK++LI + +++ W A+  +FP L+ LV+  CS L EIP  F ++ +LQ 
Sbjct  782   WHPIEGGFTRLKLLLIQMCNIKCWNATCDSFPVLERLVIISCSDLEEIPFEFADIQSLQL  841

Query  301   IELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             IEL  C      S  RI++EQE+ GN    V I
Sbjct  842   IELDSCTPELMASAVRIQQEQEEIGNKPVDVSI  874



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 183/345 (53%), Gaps = 28/345 (8%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQ----LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI--GLFND  1022
             P I + + F   Q     L  F +LRVLD+     M FP+++L L  LRYLA   G   D
Sbjct  561   PIIRTILCFQNCQSFPSSLKSFRLLRVLDVLKLIVMEFPAQVLELFHLRYLAFSYGYKGD  620

Query  1021  L--PPSFSELCRLQTLI---RWCNG---ACLI-LPEETWKMKELRHVYFKKSSHFPVPGT  869
             L  P S S+L  LQTL     W N    +C I  P E W+M +LRH+        P P +
Sbjct  621   LYVPASISKLQNLQTLFIFPYWRNNEDCSCRIHFPAEIWRMAQLRHLVSFILDPLPSPCS  680

Query  868   RMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLN  689
             +        + L  LQTL+ ++   CA+ I    P+LKKLGL             V  L+
Sbjct  681   K-------SFSLENLQTLALVANFKCAKRIGQIFPSLKKLGLIYNRDRIFLQ---VYQLH  730

Query  688   NLKVLHCLEKLK-CFFT--KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEV  518
             NL  L  LEKLK C  +   + PL    AFP +L++L+L GC    ++M+ + +LPNL V
Sbjct  731   NLIHLRQLEKLKICIGSYWDRHPLWEKLAFPTTLQKLTLSGCVLSQQDMATVGSLPNLHV  790

Query  517   VKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREI  338
             +KL+  +F+  +WE  E  F +LK + I+  +L+ W   S +FP L+ LVL  C  L EI
Sbjct  791   LKLRRCSFRRGKWETTEGEFPRLKFLQIESENLKHWVTDSSHFPNLERLVLHDCGELGEI  850

Query  337   PIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             P G GE+ TL+ IE+     S  DS  RI+EEQ++SGND   VR+
Sbjct  851   PDGIGEIPTLELIEVPHWPKSLVDSAMRIKEEQQESGNDFLQVRV  895



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score =   166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 173/322 (54%), Gaps = 12/322 (4%)
 Frame = -3

Query  1138  NGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSF-SELCRLQTLIRWCN  965
             + F++++VLD+ SF     FPSE+  L  LRY A+  + +  PSF ++L  L+T +    
Sbjct  1359  DSFKLVKVLDLESFNIGGTFPSEVESLIHLRYFAVQTYANSIPSFIAKLRNLETFVVRGL  1418

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
             G  +I+P    KM +LRH+  K  + F + G     +     D  +  +   LS+G  A 
Sbjct  1419  GGEVIIPSSILKMVKLRHLLVKNRASFSLQGNMGESFSNSQLDYLETFSTPRLSYGQDAE  1478

Query  784   EILTQVPNlkklg--lreeegeylrdeqLVCYLNNLKVLHCLEKLK----CFFTKQRPLP  623
              ILT++PNL+KL     E      + +        L+ L  LE LK    C+ +K   LP
Sbjct  1479  MILTKMPNLRKLNCIFLETFSYLEKLKGRCVRFPTLEFLSHLESLKLVSNCYPSK---LP  1535

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                 FP  L++L+L   + PW E+S++  LPNLE+++L   AF+G++WE+ +  F  LK 
Sbjct  1536  HVFNFPSKLRELTLSKFRLPWYEISIVGELPNLEILRLLSRAFEGNEWEVNDSEFRVLKY  1595

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             + +D  ++ QW  S+  FPKL+ LVL  C  L EIP  FG+  TL+SIE+  C  S  +S
Sbjct  1596  LNLDNINISQWSLSNDAFPKLEHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNS  1655

Query  262   VDRIREEQ-EDSGNDGFTVRIH  200
                I+  Q ED  ND FTV I 
Sbjct  1656  ALEIQTAQHEDMANDAFTVTIQ  1677



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 177/336 (53%), Gaps = 21/336 (6%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQL----------NGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG  1034
             P + SF+ F   + +            F++LRVLD     F RFP+++  L  LRY+ + 
Sbjct  535   PRVRSFLCFSNEETILQAEHISSIPGAFKLLRVLDAKSIIFTRFPTDLTQLVHLRYIVLS  594

Query  1033  L-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTW  857
               F  LP +FS L  +QTL+   +   L +  + WKM +LRH+    S+  P P ++   
Sbjct  595   SNFKVLPVAFSSLWNIQTLVIVTSSRTLEIKADIWKMIQLRHLKTNASTALPGPLSKSRK  654

Query  856   YGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
               +    +  LQTLS +S  SC  ++  + PNLK LG+R +  + L ++      ++L  
Sbjct  655   SKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKLLENKSGSMLFDSLGK  714

Query  676   LHCLEKLKCFFT---------KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNL  524
             L  LE LK             K   LP    FPP LK+L+L      W +MS L  L NL
Sbjct  715   LSHLENLKLLNDVFPRPPSEGKLTNLPQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLENL  774

Query  523   EVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLR  344
             E++KLKD AFKG  W+  +  F  L+++ I  +DL  W AS+ +FP+L+ L +K+CS L 
Sbjct  775   EILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHFPRLKHLFIKHCSSLE  834

Query  343   EIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
              +P GF ++ +LQ +EL+ C + +  +  RI +E++
Sbjct  835   ALPSGFADISSLQLVELY-CTTRSAAASARIIQEKK  869



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/356 (35%), Positives = 183/356 (51%), Gaps = 29/356 (8%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQL----------NGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG  1034
             P + SF++F   + +            F++LRVLD     F RFP+++  L  LRY+ + 
Sbjct  535   PRVRSFLSFSSDETILPTEHNSTIPGAFKLLRVLDARSVIFTRFPTDLTKLVHLRYIVLS  594

Query  1033  L-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTW  857
               F  LP + S L  +QTL+   +   L +  + WKM +LRHV    S+  P P +R   
Sbjct  595   SNFKMLPEAISSLWNMQTLVVETSSRVLDIKADIWKMIQLRHVKTNASTVLPGPLSRSRK  654

Query  856   YGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
               +       LQTLS +S  SC  E+  + PNLK LG+R + G+ L  +      ++L  
Sbjct  655   SKDEVLMSGTLQTLSTVSPESCTEEVFARAPNLKVLGIRGQLGKLLEIKNGSMLFDSLGR  714

Query  676   LHCLEKLKCFFTK-QRP--------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNL  524
             L  LE LK       RP        LP P  FPP+L++L+L      WK+MS L  L NL
Sbjct  715   LSHLENLKLINDVFPRPPSEGSLSRLPHPYKFPPNLRKLTLSDTLLEWKDMSTLGMLENL  774

Query  523   EVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSIN-FPKLQSLVLKYCSHL  347
             EV+KLKD AFKG  W+  +  F  L+V+ I   +L  W  +S N FP+L+ L LK+C +L
Sbjct  775   EVLKLKDNAFKGEWWKTEDGGFRGLRVLHIGRTNLVTWNVASGNHFPRLRHLFLKHCGYL  834

Query  346   REIPIGFGEVYTLQSIELWECNSSTYDSVDRI-------REEQEDSGNDGFTVRIH  200
               +P+ FG+V  LQ ++++  N S   S  +I       + +Q   GN GF + ++
Sbjct  835   ASLPLVFGDVVCLQVVDIYCTNESVAASARKIEGRKMELQGKQSGRGN-GFKLSVY  889



>ref|XP_011084823.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=557

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 179/325 (55%), Gaps = 17/325 (5%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI----R  974
             L GF +LRVLD+     +  P EI  L  LR+LA+     +PPS S+L  LQTL+    R
Sbjct  237   LRGFRLLRVLDLLRTVLLFMPPEITQLFFLRFLALTGRLKVPPSISKLQNLQTLMIRMYR  296

Query  973   WCNG-ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
             W  G + L LP E W+M++LRH+   + S  P P       G R   L  LQTL   +F 
Sbjct  297   WETGDSILFLPIEIWEMRQLRHLIVFEGSMLPTPLAAAP-SGRRV--LENLQTLFVDNFK  353

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT----KQRP  629
               +  I   +PNLKKL +   +       +    L+NL  L  LE L   F     +  P
Sbjct  354   FTSNAI-EMMPNLKKLKVYYCDVFTAVWAKYC--LSNLVHLCLLETLSLMFRPVGLEVNP  410

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
              P+  A P +L++L+L  C  PW++M+V+ +LPNLEV+KL+D AF G +WE  E  F +L
Sbjct  411   FPANFALPSTLQKLTLTDCALPWQDMAVIHSLPNLEVLKLRDDAFMGEKWECSEGEFPRL  470

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE--LWECNSS  275
             K +L+++ +L+ W+  S +FP+L+ L++K C  L EIP   G++ TL+ IE  +     S
Sbjct  471   KFLLMELLNLKCWQVESSHFPRLERLIIKRCWRLDEIPCEIGDIPTLELIEVPIGLGRKS  530

Query  274   TYDSVDRIREEQEDSGNDGFTVRIH  200
               DS   I+EEQ   GND   VRIH
Sbjct  531   AADSAVLIQEEQRSLGNDLLQVRIH  555



>ref|XP_006346788.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=676

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 124/325 (38%), Positives = 178/325 (55%), Gaps = 17/325 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFM--RFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGA  959
             F +LRVL I  +  M   FP  I  L  LRYL +    ++P S SEL  LQTLI  C+G 
Sbjct  354   FNLLRVLVIFNKVLMLSSFPVVITKLFHLRYLQVPFHQNIPESISELQNLQTLI--CSGY  411

Query  958   CL---ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA  788
              L    LP E W M+ LR+++ + ++  P P             +P L+  S LS  SC 
Sbjct  412   SLESVSLPVEIWTMQYLRYIHLRAATSLPSPRRESILNKHLVTRMPNLEEFSGLSCTSCT  471

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD--  614
              E+ + +P+L++L ++               L ++ +L  LE  KC++ +   +      
Sbjct  472   NEVFSGIPDLRRLIIQAPLFFDDSLPNG---LMDMSILRKLETFKCYYWQHSWISCNSIK  528

Query  613   --AFPPSLKQLSLRGCQR-PWKEMS-VLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQL  449
                FP SLK+L+L  C   PW+++S  L  LPNLE  KLKD       W L +E  F  L
Sbjct  529   SFVFPTSLKRLTLTRCYLFPWEDISSTLIMLPNLEEFKLKDSKATDDIWRLSDEDKFKSL  588

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             K++L+D+ +L+ WE+SS NFP L+ LVLK C+ L+EIP  FGE+ TL+SIEL +C+++T 
Sbjct  589   KLLLLDVLNLKHWESSSDNFPNLKRLVLKNCTDLQEIPGDFGEIGTLESIELHDCSTTTE  648

Query  268   DSVDRIREEQEDSGNDGFTVRIHRG  194
             DS   I +EQED GN+   V IH  
Sbjct  649   DSAREIVQEQEDMGNNILKVYIHNN  673



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 125/333 (38%), Positives = 174/333 (52%), Gaps = 27/333 (8%)
 Frame = -3

Query  1159  FGRVQQLNGFEMLRVLDI--SFQSFMRFPSEILCLKILRYLAIGLFND-LPPSFSELCRL  989
             F  ++    F  LRVL +   + +   FP EI  L  LRYL    ++  LP S  +L  L
Sbjct  516   FANLKVFPHFHHLRVLAVFHEYGTSCSFPPEITKLCHLRYLQFRSYDHFLPASILKLRNL  575

Query  988   QTLIRWCNGACL-ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             QTLI         +LPE  W M+ LRH++ +K+    +P             +  L+ LS
Sbjct  576   QTLIFESQHEYTPVLPENIWMMRNLRHLHVRKACTLLLPSRN---------SILNLEELS  626

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC----FF  644
              L F  C  EI + +P+LK+L +             V  + ++  L  LE LKC    F+
Sbjct  627   NLCFSCCTNEIFSGIPDLKRLIVHHRYSSAFS----VNDITDMSSLTKLEALKCVSEYFW  682

Query  643   TKQRPLPSPDAF-PPSLKQLSLRG--CQRPWKEMS-VLSALPNLEVVKLKDYAFKGSQWE  476
                 P+    +F P SLK+L+L G  C  PW ++S +L  LPNLE +KLKD+A     W 
Sbjct  683   FSTPPISIKQSFFPKSLKRLTLDGGFC-FPWDDISTLLVMLPNLEELKLKDHAANDHVWR  741

Query  475   LIEEV-FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             L  E  F  LK +L    +L+ WEASS NFP L+ LVLK C+ L EIPI FGE+ TL+SI
Sbjct  742   LSAETKFESLKFLLFHGLNLKYWEASSDNFPNLRRLVLKKCTKLNEIPIDFGEICTLESI  801

Query  298   ELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             EL++C     +S  +I +EQED GN+   + IH
Sbjct  802   ELYQCGVGAEESARKIEQEQEDMGNNFLKIFIH  834


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -3

Query  421  LEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREE  242
            L  WEASS +FP L+ L LK C++L EIP  FGE+ T +SIEL++C+    +S  +I +E
Sbjct  847  LSIWEASSDSFPNLKRLALKKCNYLNEIPTDFGEICTFESIELYQCSIGAEESARKIEQE  906

Query  241  QEDSGND  221
            QED GN+
Sbjct  907  QEDMGNN  913



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 172/319 (54%), Gaps = 11/319 (3%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLF-NDLPPSFSELCRLQTLIRWCNGA  959
              F++LRVLD+    F RFP E++ L +LRY+A+      LP   S L  L+T+I   +  
Sbjct  606   AFKLLRVLDVRPIIFTRFPGELVYLVLLRYIALSSRCKILPEKMSNLQILRTVIFETSWP  665

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREI  779
              L +  + WKM +LRH+    S+  P+P  ++   GE       LQTLS +S  SC R++
Sbjct  666   TLEIKADIWKMPQLRHLITNTSACLPLPLAKI-HKGEPSIS-ANLQTLSSISPESCKRDV  723

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC----FFTKQRPLPSPDA  611
               +VP LKKLG+      +++        ++   L  LE LK     F +K   LP    
Sbjct  724   FERVPKLKKLGICGRLASFMQGNNESSLFDSFSKLEFLENLKLINADFNSKLHFLPHESK  783

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLID  431
             FP SL +L+L      WK MS+L  L NLEV+KLKD AF+G +W+  E  F +L+V+ I 
Sbjct  784   FPRSLTRLTLLNTMLDWKHMSILGKLENLEVLKLKDNAFEGERWQTEEGGFLRLQVLNIG  843

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
                L  W AS+ +FP+L+ LVL +CS L  IP G  ++ +LQ++E++  +++   S  +I
Sbjct  844   STSLVTWNASASDFPRLRCLVLMHCSKLEAIPHGLAQIASLQAVEVYCTSNAAVSSAKKI  903

Query  250   R----EEQEDSGNDGFTVR  206
             +    E Q    N G   R
Sbjct  904   QAVKLESQSQQPNTGTKSR  922



>ref|XP_009779606.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=906

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 192/357 (54%), Gaps = 22/357 (6%)
 Frame = -3

Query  1216  VDWNDYKDLPKP-SICSFI---AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
              D +DY  L +  SI SF+    F    +L  F +LR+LD+       FP +ILCL  LR
Sbjct  544   TDDDDYTLLKRTRSIFSFLFNSTFTLNSELIHFSLLRILDLVTTDLESFPPQILCLIWLR  603

Query  1048  YLAI-GLFND--LPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSSHFP  881
             YLA+ G+  D  +PP    L  LQTLI +  +   +   E+ W++ +LR +   K  ++ 
Sbjct  604   YLALSGIGEDFYVPPEIYRLWNLQTLIVKRDSPRYVTFTEKIWELMQLRQLRLHK--YYL  661

Query  880   VPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLV  701
                 R +   E +     + T+S LS  SC +E+++ + N+KKL +     +Y   ++  
Sbjct  662   SNPPRESDDEESYLAFSNIHTVSGLSPSSCRKEVISGIQNVKKLVIYGHVSDYKVFQESR  721

Query  700   CYLNNLKVLHCLEKLKCFFTKQ-----------RPLPSPDAFPPSLKQLSLRGCQRPWKE  554
              + NNL  LH LE L     ++             +PS  AFP +L++L L      W++
Sbjct  722   LF-NNLVHLHQLETLSLALVRKWDSSENWRISPATIPSAKAFPVTLRKLKLEETSVRWED  780

Query  553   MSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQS  374
             ++++  LP+LEV+KL   A  G +W  IE  F +LK++LI+  DL+ W+A+  NFP L+ 
Sbjct  781   LNIVGELPSLEVLKLMWNACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATDDNFPVLER  840

Query  373   LVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             L+++ C  L EIPI F ++Y+LQ IEL +C +    S  RI++EQE+ G     +RI
Sbjct  841   LLIRECHMLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQENLGIKPVDIRI  897



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 177/337 (53%), Gaps = 23/337 (7%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQL----------NGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG  1034
             P + SF+ F   + +            F++LRVLD     F RFP+++  L  LRY+ + 
Sbjct  535   PRVRSFLCFSNEETILQAEHISSIPGAFKLLRVLDAKSIIFTRFPTDLAQLVHLRYIVLS  594

Query  1033  L-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTW  857
               F  LP +FS L  +QTL+   +   L +  + WKM +LRH+    S+  P P ++   
Sbjct  595   SNFKVLPVAFSSLWNIQTLVIVTSSRTLEIKADIWKMIQLRHLKTNASTALPGPLSKSRK  654

Query  856   YGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
               +    +  LQTLS +S  SC  ++  + PNLK LG+R +  + L ++      ++L  
Sbjct  655   SKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKLLENKSGSMLFDSLGK  714

Query  676   LHCLEKLKCFFTKQRPLPSPDA----------FPPSLKQLSLRGCQRPWKEMSVLSALPN  527
             L  LE LK       P P  +           FPP LK+L+L      W +MS L  L N
Sbjct  715   LSHLENLK-LLNDVFPRPPSEGKLTNPPQRYKFPPKLKKLTLSDTLLDWNDMSTLGMLEN  773

Query  526   LEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHL  347
             LE++KLKD AFKG  W+  +  F  L+++ I  +DL  W AS+ +FP+L+ L +K+CS L
Sbjct  774   LEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDLVSWNASARHFPRLKHLFIKHCSSL  833

Query  346   REIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
               +P GF ++ +LQ +EL+ C + +  +  RI +E++
Sbjct  834   EALPSGFADISSLQLVELY-CTTRSAAASARIIQEKK  869



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 131/373 (35%), Positives = 187/373 (50%), Gaps = 35/373 (9%)
 Frame = -3

Query  1237  RLVFYSDV-DWNDYKD------LPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFP  1079
             RL+ + D+ + ND  +      L +  +C+      V     F  LRVLD     F  FP
Sbjct  517   RLIMHLDIPEGNDITECMESMTLTRSVLCTGRVLSTVPFYQSFRFLRVLDFLETEFSEFP  576

Query  1078  SEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLI-------------RWCNGACLI-L  947
                L L  LRYLA     F  LP   S L +LQ LI              +    C +  
Sbjct  577   FAFLFLVNLRYLAFTFQSFPVLPSKISLLWKLQILIIKDQQNLLNREYFPYFQSYCEVDT  636

Query  946   PEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQV  767
             P E ++M +LRHV   +    P P  +     E    L  L+TL  ++   C  E+L + 
Sbjct  637   PSEVFQMAQLRHVQMTEI-FLPNPIDK-----ENPVVLKDLETLCTVANFRCTEEVLRKF  690

Query  766   PNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT---KQRPLPSPDAFPPSL  596
             PNLKKLG+                L NL  L  LE LKC F     +  LP+  +FP SL
Sbjct  691   PNLKKLGVYYYGAGIEDWSAY--DLKNLVRLSKLENLKCVFNWPPNETLLPNL-SFPQSL  747

Query  595   KQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLE  416
             K+L+L G    WK MS++ +LP+LEV+KLK YAF G+ W+ +E  F +LK +LI+   L 
Sbjct  748   KKLTLDGSNLSWKGMSIIGSLPHLEVLKLKQYAFTGAVWKPVEREFSRLKFLLIEKMRLV  807

Query  415   QWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
             +W A + +FP L+ L++  C  L+ IP G G++ TL+ I++ +C+SS   SV++I EEQ 
Sbjct  808   RWIAENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQILEEQR  867

Query  235   DSGNDGFTVRIHR  197
             D  N+   VR+ R
Sbjct  868   DMENNVLQVRVRR  880



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 113/308 (37%), Positives = 161/308 (52%), Gaps = 27/308 (9%)
 Frame = -3

Query  1093  FMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELR  914
             F +FP+E+L L  L YLA    +D P + S L  LQTLI   +   + LP E W+M ELR
Sbjct  438   FHQFPTELLGLVNLHYLAFSCNSDFPSAISRLWNLQTLIVQSSLFYMYLPSEIWEMPELR  497

Query  913   HVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR-EILTQVPNlkklglre  737
             H+ FKK+        R            KLQT+S  +        +L  +PN+K LG+  
Sbjct  498   HIKFKKTRICIDDAYRKKNVQR------KLQTISCTTLDQLIDCNLLGNIPNIKNLGIHS  551

Query  736   eegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK-QRPLPSPDAFPPSLKQLSLRGCQRPW  560
                          +  +L  LH LE LKC   K  R   S   FPPS+++L+L      W
Sbjct  552   ASP----------FHVDLSHLHRLEILKCSARKWSRTSISKLDFPPSIRKLTLSKLTIHW  601

Query  559   KEMSVLSALPNLEVVKLKDYAFKGSQ--------WELIEEVFCQLKVMLID-IADLEQWE  407
               M+ +  LPNLEV+K++   FKG +        W L E  FC L+ +L++ + +L  W+
Sbjct  602   GFMTTIGLLPNLEVLKIRKCTFKGQEMQPRDDEEWVLTEGEFCSLQFLLLEKLKNLVHWQ  661

Query  406   ASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSG  227
             A   + P+L+ L+++ CS L EIP G GE+ TL+ IEL EC+ S   S  +I+E+Q + G
Sbjct  662   ADETHLPRLRHLLIRGCSALEEIPSGIGEIPTLEIIELDECSPSVVASAKQIQEDQREYG  721

Query  226   NDGFTVRI  203
             NDG  VRI
Sbjct  722   NDGLEVRI  729



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 181/340 (53%), Gaps = 35/340 (10%)
 Frame = -3

Query  1138  NGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI--RWCN  965
             + F +LR+LD+ F S +     I  L  LRYLA   FN L  S  ++  +Q L+    C 
Sbjct  249   SSFRLLRILDVCFTSSLFCGQSISELVHLRYLACPSFNGLMQSLCKIRNIQNLVIHDLCP  308

Query  964   GACLI----LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                 +    LP E   M +LRH++ KK S F  P T +    E H     LQTL+ L   
Sbjct  309   SGLSMRTQFLPWEVVNMPQLRHIHTKKFSLFIPPPTSLIAKRENH-----LQTLTGLMPS  363

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCY-LNNLKVLHCLEKLKCFFTKQRPL--  626
             SC  E+  ++PNLKKLG+   +      +   CY L+NL  L  LEKLK  F +   L  
Sbjct  364   SCNEEVFLRIPNLKKLGILIVDDSDTIQK---CYCLDNLVHLSQLEKLKVQFRESYMLIF  420

Query  625   ---------------PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFK  491
                            P  D FPP+LK+L+L      W++M++L  LPNLEV+KLK +AF 
Sbjct  421   RWMSEDWMDLSSLHIPHCDNFPPNLKKLTLCRTHIQWEDMNILRKLPNLEVLKLKHHAFL  480

Query  490   GSQWELIEE---VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
             G  W+L +E    F +LK +L++  +L QWEA+S +FP L+ LVL  C  L ++P  F E
Sbjct  481   GLIWKLSDEDEDGFLKLKFLLLENMNLMQWEATSYHFPNLEHLVLTDCYLLEQMPFDFAE  540

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             + TLQ IEL +C  S   S ++I+EEQ+  GND   + ++
Sbjct  541   IQTLQLIELHKCKCSVLVSAEQIQEEQQSLGNDDLVIHVN  580



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score =   159 bits (403),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 187/360 (52%), Gaps = 36/360 (10%)
 Frame = -3

Query  1201  YKDLPKPSICSFIAFGRVQ----QLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG  1034
             ++++  P+I + + F   +     L GF +LRVLD    + M+FP+E+L L  LRYLA  
Sbjct  546   FQNIFTPTIRTALYFQHCRLFPSSLKGFRLLRVLDAQKVTVMKFPAEVLELFHLRYLAFT  605

Query  1033  L-FNDL--PPSFSELCRLQTLIRWCNG------ACLILPEETWKMKELRHVYFKKSSHFP  881
               ++DL  P S S+L  LQTL  +  G      + +    E W+M +LRH+ F      P
Sbjct  606   RGYDDLCIPASISKLENLQTLFIYPYGGDNAFYSAICFQAEIWRMAQLRHLVFFMLDPLP  665

Query  880   VPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLV  701
              P  R        + L  LQTL+ L    C+  I    P+LKKLGL   +   L  E   
Sbjct  666   SPCPR-------SFALENLQTLALLLNFRCSERIGQIFPSLKKLGLIYGKDRVLNWE--F  716

Query  700   CYLNNLKVLHCLEKLKCFF--------------TKQRPLPSPDAFPPSLKQLSLRGCQRP  563
               L+NL  LH LEKLK                   + PL    AFP  LK+L+L G    
Sbjct  717   YGLHNLVHLHQLEKLKISMPISSWESHSPTWIPESRVPLWEKLAFPRMLKKLTLGGFMLS  776

Query  562   WKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPK  383
              ++M+ + +LPNL V+KL+  +F+G +WE  E  F QLK + I+  +L+ W   S +FP 
Sbjct  777   QQDMATIGSLPNLHVLKLRRCSFRGGKWETTEGEFAQLKFLKIESTNLKHWVTDSSHFPT  836

Query  382   LQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             L+ L+L +C  L EIP   GE+ TL+ IE+   +    +S  RI++EQEDSGN+   VRI
Sbjct  837   LERLLLYHCPELYEIPNVIGEIPTLELIEVKSWDEFLGNSAKRIKQEQEDSGNECLRVRI  896



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/340 (35%), Positives = 181/340 (53%), Gaps = 32/340 (9%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF+ FG + Q      +    +LRVLDI    F  FP E+L L  LRYLA+ +   LP S
Sbjct  534   SFLLFGYMGQSLASAGVYELRLLRVLDILRIMFKEFPEEVLQLINLRYLALTIGRCLPSS  593

Query  1009  FSELCRLQTL--IRWCN----GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGE  848
              S L  LQT+  +R  +    GA +++P     M +LRH+  K         T + ++GE
Sbjct  594   ISRLRNLQTILVVRGGSLRIVGAIMVMPG-ILDMSQLRHIRLKGQR------TYIKYHGE  646

Query  847   RH---WDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
                    L KLQTLS ++        +  +P+L+KLG+  +E         V ++ ++  
Sbjct  647   DRNLFVVLDKLQTLSPIAVSDFTDRHIETLPHLEKLGIFWDEE--------VDHVRDVSH  698

Query  676   LHCLEKLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKD  503
             LH L  LKC  +K  +  + S    PPS+K+L+L+GC+    E++ +  LPNLE++KL+ 
Sbjct  699   LHKLHTLKCRSSKYNRYNILSNIILPPSIKKLTLKGCRIRDHELNEIGKLPNLEILKLQY  758

Query  502   YAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFG  323
               F+   WE  +  FC+L+ +L+    L  W A   +FP+L+ LV++YC  L+EIP+  G
Sbjct  759   CYFESGNWEGEDGEFCRLQFLLMKGLKLVNWTADDTHFPRLEELVIQYCFELKEIPLAIG  818

Query  322   EVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             ++ TL+ +E+  C  S   S   I E Q D+GND   VRI
Sbjct  819   DIPTLKVMEVLRCGDSAKASAREIMEAQVDNGNDELQVRI  858



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 164/319 (51%), Gaps = 16/319 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F RFP+EI  L  LRYLA     D+P S S L  LQTLI       L
Sbjct  560   FQLLRVLDVLMILFRRFPTEITQLVHLRYLAFLTGGDVPTSISNLWNLQTLIVEPTENQL  619

Query  952   ILPEETWKMKELRHVYFKKSS-HFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
               P E WKM  L+  YF+      PVP        +    L K + LS     S  +EI 
Sbjct  620   SWPVEIWKMSSLK--YFQSGGMSMPVPAPPK---AQHILGLEKFKKLSLNEASSNWKEIC  674

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC--------FFTKQRPLPS  620
               VPN+++L +      +        ++ +L  L  L+KL           F  +RP   
Sbjct  675   MAVPNVRELDVIINLDIHPNGWND--FIGSLICLVDLQKLSIQLEVSSHPLFFIRRPAQL  732

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
                FP +LK L+L      W +M +LS+LPNLEV+KL+ Y F+GS W L E  F +LK++
Sbjct  733   WYVFPENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLL  792

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
              I    L  W+A+S + P L+ LVL +CS L EIP   G++ TL+ I+L  C+ +   S 
Sbjct  793   HIHQTRLVHWQATSDSLPVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSA  852

Query  259   DRIREEQEDSGNDGFTVRI  203
             + I+EEQ+  GN+   V +
Sbjct  853   EEIQEEQKSIGNEVLVVTV  871



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score =   156 bits (395),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 132/217 (61%), Gaps = 7/217 (3%)
 Frame = -3

Query  835  LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKL  656
            L  LQTLS +    C++E+L  +PNLKKLG+                 NN   LH LE L
Sbjct  538  LENLQTLSEVKNFRCSKEVLEIMPNLKKLGILYVHDSSTEWS--TYEFNNFVHLHKLETL  595

Query  655  KCFFTKQ-----RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFK  491
            KC F+ +     +PLP   AFP  LK+L+L GC+  W++M+V+ +LPNL+V+KL+DYAF+
Sbjct  596  KCLFSAKDDLVRKPLPLNLAFPLDLKKLTLSGCRLSWEKMTVIGSLPNLQVLKLRDYAFE  655

Query  490  GSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYT  311
            GS WE  E  F +LK +LID   LE+W A   +FP+LQ L L +C  L  IP   G++ T
Sbjct  656  GSVWEPNEGEFTKLKYLLIDRNKLERWCADYTHFPQLQHLCLCHCFELEAIPTEVGDIGT  715

Query  310  LQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
            L+ +EL+ C SS   S   I+EEQ + GN+G  VR++
Sbjct  716  LEMLELFRCRSSVVASAMLIQEEQRNLGNEGLIVRVN  752



>gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Erythranthe guttata]
Length=859

 Score =   157 bits (397),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 125/350 (36%), Positives = 180/350 (51%), Gaps = 42/350 (12%)
 Frame = -3

Query  1180  SICSFIAFGRVQQLNGF----EMLRVLDISFQSFMRF------PSEILCLKILRYLAIGL  1031
             SI + I F R     GF     +LRVLD+   +F  F      PS++  L  LRYLA   
Sbjct  522   SIRTVICFQRNASSLGFVGNIRLLRVLDVVDANFSPFILYVSLPSKLFELFHLRYLAFSY  581

Query  1030  FNDLPPSFSELCRLQTLIRWCNGACLI-LPEETWKMKELRHVYFKKSSHFPVPGTRMTWY  854
                +P   S L  LQ+LI    G C + LP E W+M +LRH+  +     P P    T  
Sbjct  582   PTTIPSDISNLQNLQSLIVRSVGTCFVPLPREIWRMPQLRHLVCRSFGPLPCPDEGATLA  641

Query  853   GERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCY----LNN  686
                   L  LQTL+ ++   C+ +I   +PNL+KLG+     +        CY    L N
Sbjct  642   ------LENLQTLAVVTNFVCSEKITEMLPNLRKLGIVYSGDD--------CYQEFHLGN  687

Query  685   LKVLHCLEKLKC-------FFTKQRPLPSPDAFPPSLKQLSLRGCQR-PWKEMSVLSALP  530
             L +L  LE LK        F T+  P+     FP  LK+L+L G     WK+M+++ +L 
Sbjct  688   LVLLCKLESLKLEVIGRPHFRTRLNPV-----FPRLLKELTLSGFGIINWKDMTIVGSLL  742

Query  529   NLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSH  350
             NL+V+KL+D A +G +W   E  F +LK +LID +D +QW   S +FP L+ L+L  C +
Sbjct  743   NLQVLKLRDSACEGYEWITNEGEFLELKYLLIDNSDPQQWITESDHFPSLRFLLLHSCRN  802

Query  349   LREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L EIP   G++ +L+ IE+   N S  DS  +I EEQ+  GN+G  + +H
Sbjct  803   LSEIPNCVGDISSLELIEVKYGNKSLVDSAKQIEEEQQSYGNEGLQLHLH  852



>emb|CDP00691.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 135/359 (38%), Positives = 184/359 (51%), Gaps = 36/359 (10%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLN--------GFEMLRVLDISFQSFMRF  1082
             RL F+ D   +       P + SF+ F     +         GF++LRVLD+ F  F  F
Sbjct  331   RLSFHLDPYSHATTAPAIPHVSSFVCFTLGTDIVPDILFFQLGFKLLRVLDVFFLHFDYF  390

Query  1081  PSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RWC---NGACLILPEETWKMKE  920
             P +IL L  LRYLA+ +  +LP S S+L  LQTL+    W    +G    L  E W M  
Sbjct  391   PVQILKLIHLRYLALYVTYELPASVSQLRNLQTLVIHGPWLCQESGGRPTLLLEYWSMPS  450

Query  919   LRHVYFKKSSHFPVPGTRMTWYGERHWDLPK------LQTLSYLSFGSCAREILTQVPNl  758
             LRHV+   + H   P T          +LP+      LQTL  + F SC +E+ + +P+L
Sbjct  451   LRHVHVTVACHLKNPFTVQD-------NLPRPFASEHLQTLYTIQFSSCTKEVFSVMPHL  503

Query  757   kklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ----RPLPSPDAFPPSLKQ  590
             KKLG+ E + +Y  D      LNNL  L  LE L+C F  Q    R +      P +LK 
Sbjct  504   KKLGICETKEDYSIDSFSQV-LNNLVYLQELETLECSFHTQNREVRRILGLALLPVTLKH  562

Query  589   LSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQW  410
             LSL     PWK M+ ++ LPNLEV++LK+YAF+G +W   EE F  LK +LI+   L  W
Sbjct  563   LSLSWSYLPWKYMTSIAMLPNLEVLELKNYAFQGPKWGPTEEGFRSLKHLLIENMALIHW  622

Query  409   EASSI-NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
             EA+   +F  LQ LVLK C  L + P G   V  LQ +E+  C+    +S   I+EE E
Sbjct  623   EATIFRHFRCLQHLVLKSCKLLEKFPFG---VENLQRLEVHYCSGPIENSAKEIQEEIE  678



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   157 bits (396),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 189/345 (55%), Gaps = 22/345 (6%)
 Frame = -3

Query  1144  QLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND--LPPSFSELCRLQT-LIR  974
             +L    ++RVLD++  +F  FP +IL L +LRYL+    N   +P    +L  LQT ++R
Sbjct  574   ELGHLNLIRVLDLNSMNFSSFPLQILGLFLLRYLSFSTRNSFGIPRGLRKLLNLQTFIVR  633

Query  973   WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                 + +  PE  W+  ELRH+  + + + P P +  +  GER+     +Q++S L    
Sbjct  634   GPVSSFIKFPELIWETTELRHLKLR-NFYLPDPPSS-SIDGERNLFWSNIQSVSGLIPYC  691

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP-----  629
             C + IL++  N+KKL +R    +Y   E+ +  L +L  LH LE L     + +      
Sbjct  692   CTKNILSRFQNIKKLCIRGHVYDYRVHEEDM-DLRHLVDLHHLETLSIKVDRYQVSHWSS  750

Query  628   --------LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL  473
                     +PS   FP  LK+L L G +  W+E++++   PNLEV+KLK  A +G +W  
Sbjct  751   RFHKLPVYVPSAIHFPTKLKKLKLVGTRLSWEELNIVGQWPNLEVLKLKPNACRGLKWHP  810

Query  472   IEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIEL  293
             IE  F +LK +LI+  +L +W+A++ +FP L+ LV+K+C HL +IPI F ++Y+LQ IEL
Sbjct  811   IEGGFPRLKFLLIEGTNLTRWKATNDHFPALEHLVIKHCFHLVKIPIEFADIYSLQLIEL  870

Query  292   WECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHNDE*HSNLPGS  158
               C +    S  RI+EEQE  G+    V   R +ND     L GS
Sbjct  871   QNCKAKLMASTVRIQEEQEYLGSKPVDV---RSYNDLAECELNGS  912



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   158 bits (400),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 120/324 (37%), Positives = 181/324 (56%), Gaps = 14/324 (4%)
 Frame = -3

Query  1144  QLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND--LPPSFSELCRLQT-LIR  974
             +L    ++RVLD+S   F  FP +IL L +LRYL+    N   +P     L  LQT ++R
Sbjct  1546  ELGHLNLIRVLDLSSMFFSSFPLQILSLFLLRYLSFSTRNSFGIPGGLCRLLNLQTFIVR  1605

Query  973   WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                 + +  PE  W+  +LRH+  + + + P P +  +  GER+   P +Q++S L    
Sbjct  1606  GPVISFIKFPELIWETTQLRHLKLR-NFYLPDPPSS-SIDGERNLFWPNIQSVSGLIPYC  1663

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK-------Q  635
             C ++IL++  N+KKL +R    +Y   E+ V  L +L  LH LE L     +        
Sbjct  1664  CTKKILSRFQNIKKLCIRGHVYDYGVHEE-VMDLRHLVDLHQLETLSVKVDRYQVSHGSS  1722

Query  634   RPLPSPD-AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVF  458
             R   SP   FP  LK+L L G    W+E++++   PNLEV+KLK  A  G +W  IE  F
Sbjct  1723  RFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIGQWPNLEVLKLKPNACHGLEWRPIEGRF  1782

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
              QLK +LI+  +L+ W+A++ +FP L+ LV+++C HL EIPI F ++Y+LQ IEL  C++
Sbjct  1783  PQLKFLLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSA  1842

Query  277   STYDSVDRIREEQEDSGNDGFTVR  206
                 S  RI+EEQE  G+    VR
Sbjct  1843  KLVASAGRIQEEQESLGSKAVDVR  1866


 Score =   155 bits (392),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 185/340 (54%), Gaps = 17/340 (5%)
 Frame = -3

Query  1144  QLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND--LPPSFSELCRLQT-LIR  974
             +L    ++RVLD+S   F  FP +IL L +LRYL+    N   +P     L  LQT ++R
Sbjct  2353  ELGHLNLIRVLDLSSMFFSSFPLQILSLFLLRYLSFSTRNSFGIPGGLCRLLNLQTFIVR  2412

Query  973   WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                 + +  PE  W+  +LRH+  + + + P P +  +  GER+   P +Q++S L    
Sbjct  2413  GPVISFIKFPELIWETTQLRHLKLR-NFYLPDPPSS-SIDGERNLFWPNIQSVSGLIPYC  2470

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK-------Q  635
             C ++IL++  N+KKL +R    +Y   E+ V  L +L  LH LE L     +        
Sbjct  2471  CTKKILSRFQNIKKLCIRGHVYDYGVHEE-VMDLRHLVDLHQLETLSVKVDRYQVSHGSS  2529

Query  634   RPLPSPD-AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVF  458
             R   SP   FP  LK+L L G    W+E++++   PNLEV+KLK  A  G +W  IE  F
Sbjct  2530  RFHKSPVLHFPIKLKKLKLVGTCLSWEELNIIGQWPNLEVLKLKPNACHGLEWRPIEGRF  2589

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
              QLK +LI+  +L+ W+A++ +FP L+ LV+++C HL EIPI F ++Y+LQ IEL  C +
Sbjct  2590  PQLKFLLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCTA  2649

Query  277   STYDSVDRIREEQEDSGNDGFTVRIHRGHNDE*HSNLPGS  158
                 S   I+EEQE  G+    V   R +ND     L GS
Sbjct  2650  KLVASTVLIQEEQESLGSKAVDV---RSYNDPAECELNGS  2686


 Score =   149 bits (377),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 169/328 (52%), Gaps = 31/328 (9%)
 Frame = -3

Query  1162  AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQT  983
              F    +L  F +LR+LD+SF    RFP +ILCL  LRYL +    D+P     L  LQT
Sbjct  641   TFSLKSKLFHFSLLRILDLSFVLLERFPFQILCLVWLRYLELLGDFDIPTDICRLWNLQT  700

Query  982   -LIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGT-RMTWYGERHWDLPKLQTLSY  809
              ++    G   I P+E W++ +LRH+     + F +P +  ++  G+R+  LP + T+  
Sbjct  701   FIVDGSPGDFGIYPKEIWELTQLRHLEL---TSFLLPNSPTVSVDGQRYLGLPNIHTILG  757

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ--  635
             LS G C +E+++ + N++KL +  +  +Y   ++   + NNL  L  LE L         
Sbjct  758   LSHGCCTKEVISGIRNVRKLKVEGDNNDYEGFQESRLF-NNLVHLQHLETLSVTIYADLE  816

Query  634   ----RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE  467
                   +PS  AFP +LK+L L G    W +++++  LPNLEV+KL    F     E   
Sbjct  817   DSVPVTIPSAKAFPATLKKLKLYGTGLRWDDLNIVGELPNLEVLKL---IFDAVGEE---  870

Query  466   EVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWE  287
                C LK           W  ++ NFP L+ L++  C+ L EIPI F E  +L+ IEL +
Sbjct  871   ---CHLKY----------WNITNDNFPVLERLMIIDCTELEEIPIEFSETSSLKLIELKD  917

Query  286   CNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             C      S  RI++EQED GN+   VRI
Sbjct  918   CKPHLEASATRIQQEQEDIGNNPVDVRI  945



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score =   156 bits (394),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 189/374 (51%), Gaps = 35/374 (9%)
 Frame = -3

Query  1237  RLVFYSDV-DWNDYKD------LPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFP  1079
             RL+ + D+ + ND  +      L +  +C+      V     F  LRVLD     F  FP
Sbjct  517   RLIMHLDIPEGNDITECMESMTLTRSVLCTGRVLSTVPFYQSFRFLRVLDFLETEFSEFP  576

Query  1078  SEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLI-------------RWCNGACLI-L  947
                L L  LRYLA     F  LP   S L +LQ LI              +    C +  
Sbjct  577   FAFLFLVNLRYLAFTFQSFPVLPSKISLLWKLQILIIKDQQNLLNREYFPYFQSYCEVDT  636

Query  946   PEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQV  767
             P E ++M +LRHV   +    P P  +     E    L  L+TL  ++   C  E+L + 
Sbjct  637   PSEVFQMAQLRHVQMTEI-FLPNPIDK-----ENPVVLKDLETLCTVANFRCTEEVLRKF  690

Query  766   PNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT---KQRPLPSPDAFPPSL  596
             PNLKKLG+                L NL  L  LE LK  F     +  LP+  +FP SL
Sbjct  691   PNLKKLGVYYYGAGIEDWSSY--DLKNLVRLSKLENLKLVFNWPLNEVLLPNL-SFPQSL  747

Query  595   KQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLE  416
             K+L+L   +  W++MS++ +LP+LEV+KLK++AF G  WE +E  F +LK +L+D  +L 
Sbjct  748   KELTLNASKLSWEDMSIIGSLPHLEVLKLKEHAFTGGVWEPVEGEFSRLKFLLMDRMELV  807

Query  415   QWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
              W A + +FP L+ L+++ C +L+ IP G G++ TL+ I++ +C+SS   SV++I EEQ 
Sbjct  808   WWIAENTHFPCLEHLIIRSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQILEEQR  867

Query  235   DSGNDGFTVRIHRG  194
             D  N+   VR+ R 
Sbjct  868   DMENNVLQVRVCRN  881



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   156 bits (394),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 165/327 (50%), Gaps = 25/327 (8%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG--LFNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRV D+   +F RF  E   L  LRY+A        +P    EL  +QTLI     
Sbjct  564   GFPLLRVFDVESINFSRFSKEFFQLYHLRYIAFSSDTIKIIPKHIGELWNIQTLIINTQQ  623

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLP----KLQTLSYLSFGS  794
               L +    W M  LRH++   S+  PVP T       R   +P     LQTLS ++  S
Sbjct  624   RSLDIQANIWNMARLRHLHTNSSAKLPVPVT------PRSSKVPLVNQSLQTLSTIAPES  677

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP-----  629
             C  E+  + PNLKKLG+R +    L   + +  L N+K L  LE LK      +      
Sbjct  678   CTEEVFARTPNLKKLGIRGKIAVLLEPNKSL--LKNVKKLESLENLKLINDSSQTGKGLR  735

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP    FP  L++LSL      W +MS+L  + +LEV+KLK+  F G  WE +   FC L
Sbjct  736   LPPSYIFPTKLRKLSLVDTWLEWNDMSILGQMEHLEVLKLKENGFMGECWESVGG-FCSL  794

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
              V+ I+  DL  W+AS+ +FP+L+ LVL  C  L+EIPIG  ++ + Q +EL     +  
Sbjct  795   LVLWIERTDLVSWKASADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAA  854

Query  268   DSVDRIREE-----QEDSGNDGFTVRI  203
              S   IR++     QE + N+GF + I
Sbjct  855   ISAREIRDKKDKQTQEGTNNNGFKLSI  881



>ref|XP_009601897.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=636

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 119/324 (37%), Positives = 168/324 (52%), Gaps = 11/324 (3%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWCNGAC  956
             F +LRVL I  Q F  FP  I  L  LRYL +  +++LPPS SEL  LQTLI    +   
Sbjct  312   FSLLRVLAIFDQKFRSFPLVITKLFHLRYLQVQSYDNLPPSISELHNLQTLIYEGQDYKH  371

Query  955   LILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
               LP + W M  LRH++  ++ + P P             +P L+ LS L F SC  E  
Sbjct  372   TTLPGKIWMMNNLRHIHLSRACYLPSPRRESILNKYLVIGMPNLEELSNLCFTSCTNENF  431

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD----AF  608
             + +PNLK+L +        ++     +L ++  L  L+ LKC         S       F
Sbjct  432   SIIPNLKRLIVHHIGSSRRKNRAN--HLIDMSSLTKLKALKCVSNASWSWRSTSIKRFVF  489

Query  607   PPSLKQLSLRG--CQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQLKVML  437
             P SLK+L+L G  C   W+++S L  LPNLE +KLK  A     W L +E  F  LK++L
Sbjct  490   PTSLKRLTLAGGFC-FSWEDISTLVMLPNLEELKLKRNAVSDPIWRLSDEDKFESLKLLL  548

Query  436   IDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD  257
             +   +   WEASS +FP L+ LV++ C +L+EIP  FGE+ TL+SIEL  C++       
Sbjct  549   LSELEFGHWEASSESFPSLKRLVMRNCINLKEIPTDFGEICTLESIELHNCSTVVEGCAR  608

Query  256   RIREEQEDSGNDGFTVRIHRGHND  185
              I +E ED GN+   V I+    +
Sbjct  609   NIEQEHEDMGNNFLKVYIYNNRRN  632



>gb|EYU17693.1| hypothetical protein MIMGU_mgv1a001245mg [Erythranthe guttata]
Length=855

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/311 (38%), Positives = 173/311 (56%), Gaps = 24/311 (8%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCN---  965
             G  +LRVLD     F  FP E+L L  LRYL++    D+  S SEL  L+ LI   +   
Sbjct  534   GLMLLRVLDALSIRFYEFPLEVLKLIQLRYLSLTCDGDISNSMSELRNLRWLIVDIHQRI  593

Query  964   ---GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                GA   LP + W M+EL H+         + GT +    E    LPKL TL  +S  S
Sbjct  594   KSPGAPSYLPMDIWHMQELEHL--------QITGTDLPNPCEGSL-LPKLSTLLDVSARS  644

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPL----  626
             C + +L ++PNLKKLG+R E      D+Q +   +++  L  L  LKC       +    
Sbjct  645   CTKRVLERIPNLKKLGIRIELTSDNVDDQPLSCFDHISHLDKLRSLKCVVVNPGIMFDIV  704

Query  625   --PSP-DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
               P P   FP +L +L+L G   PW+E++ +S+LP L+V+KL+ YAF+G++WE+ +  F 
Sbjct  705   GPPFPLSIFPSNLAKLTLSGLGNPWEEITSISSLPYLKVLKLRCYAFRGTKWEVYDNGFP  764

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSS  275
              L+ +LI+ ADL QW   S +FPKL+SL +K+C  LRE+P+ F +  +L+ I+L ECN  
Sbjct  765   WLENLLIEDADLAQWSVGSGSFPKLKSLTMKHCYKLRELPVEFAK--SLRKIDLIECNPL  822

Query  274   TYDSVDRIREE  242
                   +I+E+
Sbjct  823   VLTCAKKIKED  833



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score =   156 bits (394),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 173/329 (53%), Gaps = 21/329 (6%)
 Frame = -3

Query  1168  FIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI--GLFNDLPPSFSELC  995
             F  F    +L  F++L++LD++      FP +IL L  LRYLA+      D+ P    L 
Sbjct  583   FSTFVLQSELIHFKLLKILDLTHIRIYSFPLQILSLIWLRYLALFCSEIFDVTPEICRLW  642

Query  994   RLQTLIRWCNG---ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKL  824
              LQT I    G   + L  PE+ W ++ LR++   K  H P   + ++    RH     +
Sbjct  643   NLQTFI--VEGYPPSYLTFPEQIWGLRRLRYLKLHKL-HLPNQPS-VSVDKARHMSFSNI  698

Query  823   QTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKL--KC  650
             Q++SYLS   C +E+L+ + N+KK+G++  +             NNL +L  LE L  + 
Sbjct  699   QSISYLSPLCCTKEVLSGIQNVKKIGIKGNQNISESG-----IFNNLVILQQLETLTVRK  753

Query  649   FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI  470
             F+       S    P +LK+L L      W  + +++ LPNLEV+KL   A  G +W   
Sbjct  754   FYNW-----SAVTIPTTLKKLKLYKTFLRWSYLDIIAELPNLEVLKLVLNACHGEEWNPN  808

Query  469   EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
               VF QLKV+LI    LE W+A++ NFP L+ LVL  CS+L+EIPI F ++ T Q IEL 
Sbjct  809   VRVFTQLKVLLIQANYLESWKATNDNFPVLERLVLGSCSYLKEIPIEFADINTSQLIELD  868

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
              C     +S  RI++EQED GND   V I
Sbjct  869   SCPPILAESAARIQQEQEDLGNDPIDVHI  897



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 164/322 (51%), Gaps = 14/322 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG--LFNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRVLD+   +F RF  E   L  LRY+AI       LP    EL  +QTLI     
Sbjct  378   GFPLLRVLDVESINFSRFSREFFQLYHLRYIAISSDTIKVLPKLIGELWNIQTLIINTQQ  437

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
              CL +    W M  LRH++   S+  PVP  R +   +       LQTLS ++  SC  E
Sbjct  438   RCLDIQANIWNMARLRHLHTNSSAKLPVPIARKS--SKVTLVNQSLQTLSTIAPESCTEE  495

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRPLPSP  617
             +  + PNLKKLG+R +    L        L N+K L  LE LK         K+  LP  
Sbjct  496   VFARAPNLKKLGIRGKIAVLLEPNTSTS-LKNVKKLEYLESLKLINDSIQTGKELHLPPA  554

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
               FP  L++L+L      W +MSVL  L +LEV+KLK+  F G  WE     F  L V+ 
Sbjct  555   YIFPTKLRKLTLLDTWLGWNDMSVLGQLEHLEVLKLKENGFIGECWEPKVGGFSSLLVLW  614

Query  436   IDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD  257
             I+  +L  W AS+  FP+L+ LVL  C  L+EIPIG  ++ +LQ++EL+    +   S  
Sbjct  615   IERTNLVSWNASADQFPRLKRLVLISCDRLKEIPIGLADIRSLQTVELYNSTKTAAISAR  674

Query  256   RI--REEQEDSGND--GFTVRI  203
              +  +++++  G +  GF + I
Sbjct  675   ELQYKKDKQPQGTEKTGFKLSI  696



>gb|EYU24187.1| hypothetical protein MIMGU_mgv1a001243mg [Erythranthe guttata]
Length=855

 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 130/362 (36%), Positives = 181/362 (50%), Gaps = 36/362 (10%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAF--GRVQQLNGFEMLRVLDISFQSFMRFPSEILC  1064
             RL  ++++ W+ +  L   SI + + F  G +  L  F++LRVLD S      +P E+  
Sbjct  505   RLSIFTNI-WSGFPILYGSSIHTILLFQNGTLNSLRSFQLLRVLDTSSVVLTSYPVEVGE  563

Query  1063  LKILRYLAI-------GLFNDLPPSFSELCRLQTLIRWCNGACLI-----LPEETWKMKE  920
             L  LRYLA        G F ++P S S L  LQTLI    G         LP   WKM +
Sbjct  564   LFHLRYLAFTFEYIGKGKF-EVPASLSSLQNLQTLIIRHVGLAATTHTSYLPFGIWKMPQ  622

Query  919   LRHVYFKKSSHFPVPGTRMTWYGERH---WDLPKLQTLSYLSFGSCAREILTQVPNlkkl  749
             LRH+           G       E       L  LQTL+ +    C++  L  +PNLKKL
Sbjct  623   LRHLIL-------FDGVLPDLSAETSCGILALEYLQTLTRVKSFRCSKRRLEAMPNLKKL  675

Query  748   glreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQ  569
             G+     E          L+NL  LH LEKL  +           +F  +LK+L+  GC 
Sbjct  676   GIFYSFSEIDETGWSKYGLSNLVHLHKLEKLNLY---------GKSFV-ALKKLTFSGCG  725

Query  568   RPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINF  389
               W EM+++ +LPNLEV+KLK +A  G +W+  E  FCQLK+++ID  DL  W     +F
Sbjct  726   LKWNEMTIVGSLPNLEVLKLKRHACDGFEWKTTEGGFCQLKLLVIDSTDLRVWITERCHF  785

Query  388   PKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTV  209
             PKL+ LVL  C  L +IP   GE+ TLQ+IE+   NSS  +S   I EEQ +S  +   +
Sbjct  786   PKLERLVLYDCYKLEKIPFDIGEIPTLQAIEVDLRNSSVVNSAKCIAEEQLESYGNELQI  845

Query  208   RI  203
             R+
Sbjct  846   RV  847



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 162/323 (50%), Gaps = 16/323 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F  FP+EI  L  LRYLA     D+P S S L  LQTLI       L
Sbjct  451   FQLLRVLDVLMILFQLFPTEITQLVHLRYLAFTTGGDVPTSISNLWNLQTLIVEPIENQL  510

Query  952   ILPEETWKMKELRHVYFKKSS-HFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
               P E WKM  L+  YF+      PVP        +    L K + LS     S   EI 
Sbjct  511   SWPVEIWKMSSLK--YFQSGGMSMPVPAPPK---AQHILGLEKFKKLSLNEASSNWEEIC  565

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC--------FFTKQRPLPS  620
               VPN+K+L +      +        ++ +L  L  L+KL           F  +RP   
Sbjct  566   MAVPNVKELDVIINLDIHPNGWND--FIGSLICLVDLQKLSIQLKVSSHPLFFIRRPAQL  623

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
                FP +LK L+L      W +M +LS+LPNLEV+KL+ Y F+GS W L E  F +LK++
Sbjct  624   WYVFPENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLL  683

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
              I    L  W+A+S + P L+ LVL +CS L EIP   G++ TL+ I+L  C+ +   S 
Sbjct  684   HIHQTRLVHWQAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSA  743

Query  259   DRIREEQEDSGNDGFTVRIHRGH  191
             + I EEQ+  GN+   V +   H
Sbjct  744   EEILEEQKSIGNEVLVVTVSPDH  766



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 159/321 (50%), Gaps = 19/321 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RFP E   L  LRY+A        +P +   L  +QTLI     
Sbjct  559   AFPLLRVLDAESIKFSRFPKEFFKLFHLRYIAFSTDSIMTIPTNIGNLWNVQTLIIETQQ  618

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + W M  LRHV    S+  P P    +  G  H+    LQTLS ++   C  E
Sbjct  619   GTLDIKADIWNMTRLRHVCTNASAILPSPKHPKSRKGVNHY----LQTLSTIAPECCTAE  674

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRPL  626
             I T+ PNLKKLG+R +        +        +N+  L CLE LK         KQ  L
Sbjct  675   IFTRTPNLKKLGVRGKIAALLEASKGGSGSGLFSNIGKLECLENLKLVNDTRQSDKQLHL  734

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P    FP  LK+L+L      WK+MS+L  L  LEV+KLK+ AF+G  WE  +  F +L+
Sbjct  735   PPAYIFPQKLKKLTLIDTWLKWKDMSILGLLEYLEVLKLKENAFRGQSWEPDDGGFPRLQ  794

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I   DL  W+ASS+NFP+L+ LVL  C  L E+P    +V +LQ +EL   + S   
Sbjct  795   VLWIQRTDLSSWKASSLNFPQLKRLVLISCDKLEELPAALADVQSLQLMELHYTSESAAK  854

Query  265   SV-----DRIREEQEDSGNDG  218
             S       R+R+E+  +   G
Sbjct  855   SARAILKKRLRKEEGSTNRCG  875



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 167/316 (53%), Gaps = 11/316 (3%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F+ FP+EI  L  LRYLA+     +P S S L  LQTLI       L
Sbjct  455   FQLLRVLDVLLIYFLHFPTEITQLVHLRYLALVTSTSVPASISNLWNLQTLIVHSVANEL  514

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILT  773
               P E WK+  L H Y  K  + P P     + G  + +   L T S     S  +EI  
Sbjct  515   SWPLEIWKISSLIHFYPGKM-YVPAPPKAPNFLGLENLEELSLSTAS----SSNLKEIFM  569

Query  772   QVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPSP-DAFP  605
              +P++K L +   +  +      + YL +L+ L  L +L   F  Q   RP   P D FP
Sbjct  570   AIPHVKVLDVDLNQDGWDNLIDNLIYLADLRNLRILLRLP--FDAQLFRRPSARPYDVFP  627

Query  604   PSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIA  425
              +LK L L      W +M++LS LPNLE +KL+ +AF+GS W L E  F +LK++ I   
Sbjct  628   ANLKSLILAETHLVWTKMTMLSYLPNLEGLKLELFAFQGSNWNLDEGGFKKLKLLDIVQP  687

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
             +L  W A+S + P L+ LVL++C  L+EIP   G++ TL+ IEL  C+ S   S + I +
Sbjct  688   ELVHWHATSESLPVLEYLVLRHCYKLKEIPTEIGDIPTLKLIELHYCSQSAVTSAEEILD  747

Query  244   EQEDSGNDGFTVRIHR  197
             EQ+  GN+   VR + 
Sbjct  748   EQQSLGNEVLAVRAYN  763



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/301 (37%), Positives = 156/301 (52%), Gaps = 9/301 (3%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND-LPPSFSELCRLQTLIRWCNGA  959
              F++LRVLD     F  FP ++  L +L+Y++I    D LPP+ S L  LQTLI      
Sbjct  563   AFKLLRVLDAKSLRFTLFPPDLCQLVLLKYISISCKLDILPPAMSTLWSLQTLIVDTTAR  622

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDL-PKLQTLSYLSFGSCARE  782
              L +  + WKM +LRH++   S+  P P T     G+    +   LQTLS +S  SC +E
Sbjct  623   TLQIKSDIWKMPQLRHLHTNASTSLPCPTTPK---GKEEASVNANLQTLSSISPKSCTKE  679

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF----FTKQRPLPSPD  614
             +  + P LKKL +       +          +L  L  LE LK       +    LP  +
Sbjct  680   LFERAPKLKKLAICGRLAILIEANGQSRLFESLCTLQFLENLKLLNEDVSSPLNRLPQEN  739

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP  L +L+L     PW +MSVL  L NLEV+KLKD AFKG++W      F  L+ + I
Sbjct  740   NFPRKLTKLTLSKTFLPWNQMSVLGKLENLEVLKLKDNAFKGNRWRTESGGFQSLQFLHI  799

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                DL  W+A+  + PKL+ LVLK+C+ L+ +P  F ++ TLQ I+L   N S   S  +
Sbjct  800   GSTDLVIWDAAENHLPKLKCLVLKHCTELQGVPHSFADISTLQIIDLHCTNHSVAASAMK  859

Query  253   I  251
             I
Sbjct  860   I  860



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score =   155 bits (391),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 182/356 (51%), Gaps = 21/356 (6%)
 Frame = -3

Query  1216  VDWNDYKDLPKP----SICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILR  1049
              D +DY  L +     S C    F    +L  F +LR+LD+       FP  +LCL  LR
Sbjct  544   TDDDDYTLLKRTRSIFSFCLNSTFTLNSELIHFSLLRILDLGTTKLRSFPPHVLCLIWLR  603

Query  1048  YLAIGLFND---LPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSSHFP  881
             +LA+  F +   +PP    L  LQTLI +W         E+ W++ +L  +   K     
Sbjct  604   FLALSGFGEDFYVPPEIYRLWNLQTLIVKWRCPRYETFTEKIWELMQLSQLRLHKFYLSN  663

Query  880   VPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLV  701
              P  R +   E +     + ++S LS  SC +E+++ + N+KKL +     +Y   ++  
Sbjct  664   PP--RESDNEESYLAFSNIHSISGLSPSSCTKEVISGIRNVKKLVIHGHANDYEIFQESR  721

Query  700   CYLNNLKVLHCLEKLKCFFTK----------QRPLPSPDAFPPSLKQLSLRGCQRPWKEM  551
              + +NL  LH LE L   F +             +PS  AFP +L++L L+     W+++
Sbjct  722   LF-DNLVHLHQLETLSFEFRRWGSSENWRISPATIPSAKAFPVTLRKLKLKSTYVRWEDL  780

Query  550   SVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSL  371
             +++  LPNLEV+KL   A  G +W  IE  F +LK++LI+  DL+ W+A+  NFP L+ L
Sbjct  781   NIVGELPNLEVLKLMWKACIGEEWYPIEGGFTRLKLLLIEHCDLKYWKATDDNFPVLERL  840

Query  370   VLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             + ++C  L EIPI F  + +LQ IEL  C +    S  RI+EEQE+ G     VRI
Sbjct  841   LFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEASAVRIQEEQEELGIKPVDVRI  896



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 161/315 (51%), Gaps = 17/315 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIG--LFNDLPPSFSELCRLQTLIRWCNGA  959
             F +LRVLD     F  F  E   L  LRY+A        LP    EL  +QTLI     +
Sbjct  168   FPLLRVLDAESIKFSCFCREFFQLYHLRYIAFSSDFIKILPKHIGELWNVQTLIVNTQQS  227

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVP----GTRMTWYGERHWDLPKLQTLSYLSFGSC  791
              L +  + W M  LRH++   S+  P P     +++T   +       LQTLS ++  SC
Sbjct  228   NLDIQADIWNMPRLRHLHTNTSAKLPTPVAPKSSKVTSVNQ------CLQTLSTIAPESC  281

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT----KQRPLP  623
               E+ ++ PNLKKLG+R +    L   +   + NN+K L CLE LK        KQ  LP
Sbjct  282   TEEVFSRAPNLKKLGIRGKIFMLLEPNKSELF-NNVKKLQCLENLKLINVGQSGKQLRLP  340

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                 FP +L++L+L      W +MSVL  L  LEV+KLKD AFKG  WE     F  L V
Sbjct  341   PTYIFPTNLRKLTLLDTWLEWDDMSVLGQLEYLEVLKLKDNAFKGEYWEPKVGGFRSLLV  400

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             + I+ +DL  W ASS +FP+L+ LVL  C  L E+PIG  ++  LQ +EL      T +S
Sbjct  401   LWIERSDLASWNASSDHFPRLKRLVLVSCDKLEEVPIGLADICGLQVMELRNSTKQTANS  460

Query  262   VDRIREEQEDSGNDG  218
                I+ +++    +G
Sbjct  461   ARDIQAKKDKQTQEG  475



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 171/327 (52%), Gaps = 28/327 (9%)
 Frame = -3

Query  1165  IAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSEL---C  995
             I+F +++ L   ++L VLD+       FP EIL +  L+YL++ +     PS  +L   C
Sbjct  550   ISFPKMESLVT-KLLIVLDLENIILQVFPLEILVMVHLKYLSLNI-----PSLRKLPLLC  603

Query  994   R---LQTLIRWC-NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPK  827
                 L+T I     GA + LP + WKM  LRH++      F     R      R + L  
Sbjct  604   NFWNLETFILITEKGATVTLPHDIWKMVNLRHLHISGELEFE----RACSSSSRPFMLDN  659

Query  826   LQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF  647
             LQT+S+L   SC ++IL ++PNL  LG         +D        +L +L  LE LK  
Sbjct  660   LQTISHLCPSSCIKDILAKMPNLVNLGCNLSFSNTAKDF----LFPDLSILKLLETLKFD  715

Query  646   FTKQRPL------PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGS  485
                   L      P P +FPPSLK+L+L G    WKEMS +  LPNLEV+K+K+  F G 
Sbjct  716   IQTWGTLQFCYSSPQPTSFPPSLKKLTLIG-SLDWKEMSTIGRLPNLEVLKVKNNFFNGQ  774

Query  484   QWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQ  305
             QWE  +E F  LK + +   +L++W ASS +FP L  LVL  C  L EIP   G++ TLQ
Sbjct  775   QWETSDEGFHHLKFLKLSHTNLQRWIASSSSFPCLGHLVLHRCLVLEEIPPSIGDIQTLQ  834

Query  304   SIELWECNSSTYDSVDRIREEQEDSGN  224
              IE+   + +  DSV +I+E Q+  GN
Sbjct  835   MIEVSHSSLAAADSVWQIQESQKSMGN  861



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 165/319 (52%), Gaps = 21/319 (7%)
 Frame = -3

Query  1138  NGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNG  962
               F+MLRVL++    F + PS+I  L  LRYL I      LP +FS+L  +QTL+     
Sbjct  565   TAFKMLRVLEVQPIKFTKIPSDIYQLIHLRYLTISFSLAVLPAAFSKLWNMQTLVVETTS  624

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + WKM +LRH+    SS  P PG + +  GE      KL+TL  +S  SC  E
Sbjct  625   RTLEIKADIWKMIQLRHLKTNASSTLPNPG-KSSKEGE------KLRTLGTISPQSCTDE  677

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT---------KQRP  629
             +  +  NLKKLG+R      +  +      ++L  L  +EKLK             + R 
Sbjct  678   VFERARNLKKLGIRGRLALLIDGKS--GSFDSLGKLENVEKLKLLNDVFPSPPSEGQLRG  735

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP P  FP  LK L+L      W  MS+L  L NLEV+KLKD +F G +WE  +  F  L
Sbjct  736   LPPPYKFPKKLKSLTLADTFLDWSNMSILGLLENLEVLKLKDNSFMGKRWEAADGGFRHL  795

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN--SS  275
             +V+ I   DL  W AS+ +FP+L+ L L+ C  L E+PIG  ++   Q ++L+     S+
Sbjct  796   EVLHIGRTDLVFWIASAHHFPQLRRLELQNCEELNEVPIGLADIENFQVLDLYHTKFASA  855

Query  274   TYDSVDRIREEQEDSGNDG  218
             +   +   +++QE +G  G
Sbjct  856   SAKKIVEAKKKQEQNGKAG  874



>emb|CDP05521.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   155 bits (391),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/323 (35%), Positives = 161/323 (50%), Gaps = 31/323 (10%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAI--GLFNDLPPSFSELCRLQTLIRWC-NG  962
             + ++RVLD+       FP  +  L  L+YLA+  G    LPP  S L  L+TLI     G
Sbjct  718   YNLVRVLDLRHIMEDNFPRRVHELIRLKYLALYLGALTCLPPVISRLRNLETLIVDVEKG  777

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               + LP++ WKM +LRH+       F  P     W                 S G     
Sbjct  778   RKVTLPDDIWKMFKLRHLQISPEFEFETP-----WPN---------------SAGPSRDI  817

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP----SPD  614
             +L ++PN++ LG                   +L  L+ LEKLK  +     +P    S D
Sbjct  818   LLARIPNVRNLGFHITLSSREDPFNFF----DLSGLNVLEKLKFEYQTYGMVPVTISSSD  873

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP SLK+L+L G    W+EMS++  LPNLEV+K+KD  F G +WE  E  F +L+ +  
Sbjct  874   KFPSSLKKLTLVGSHVNWEEMSIIGMLPNLEVLKVKDNFFNGPKWETCEGGFRRLRFLKF  933

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                DL++W A++ +FP L+ LVL  C  L EIP  FG+  TLQ IE++  + +  DS  +
Sbjct  934   SHMDLQEWIATADDFPSLEKLVLNGCLALTEIPSAFGDSCTLQVIEVYRSSDTVADSACQ  993

Query  253   IREEQEDSGNDGFTVRIHRGHND  185
             I+E Q + GND F V I+R   D
Sbjct  994   IQESQRNWGNDEFKVFIYRHFQD  1016



>ref|XP_011087136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score =   154 bits (389),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 175/330 (53%), Gaps = 26/330 (8%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRW------  971
             F +L+VL+     F  FP E++ L  L++LA      LP S S+L  LQ LI        
Sbjct  558   FGLLKVLNALTIRFYGFPIEVVKLVQLKFLAFTYNGKLPASISKLKSLQYLIVHQYLTIL  617

Query  970   -CNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                G  + LP E W M+EL+H+     S  P P             LP L TL  +S  S
Sbjct  618   PFGGTRMCLPMEMWTMQELKHLQVM-GSDLPNPSLEDAC-------LPNLLTLLGISAHS  669

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP-----  629
             C +E+L ++PNL +LG++      +     +C L++L+ L  LE LKC      P     
Sbjct  670   CTKEVLERIPNLTRLGIQIGLTLDVAKP--LCCLDHLRYLRRLESLKCVILNPNPRLRVV  727

Query  628   LPSP--DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
             +P+P   AFP SLK+L+L G   PW+ MS ++ L NLEV+KL+ +AF+G  W   +  F 
Sbjct  728   VPTPPVTAFPSSLKKLTLSGLGFPWEYMSTIAKLRNLEVLKLRCHAFRGPVWNAYDCQFL  787

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSS  275
             QLK +L++  DLE W      FP L+ L+++ C  L+ IP+G  ++ +L+ IEL +CN S
Sbjct  788   QLKFLLLEDIDLEYWYRGL--FPWLERLIIRDCYKLKRIPLGIKKISSLEMIELVDCNPS  845

Query  274   TYDSVDRIREEQEDSGNDGFTVRIHRGHND  185
                S  RI EEQ+ +G+D   + I    +D
Sbjct  846   LVSSAKRIAEEQKSNGDDYLQICIKSSADD  875



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 172/321 (54%), Gaps = 12/321 (4%)
 Frame = -3

Query  1135  GFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNG  962
              F++++VLD+ SF     FPSEI  L  LRYLA+    N +P   ++L  L+T +    G
Sbjct  1406  SFKLVKVLDLESFNVGGTFPSEIQSLIHLRYLAVQTDANSIPSFIAKLQNLETFVVRGLG  1465

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY--LSFGSCA  788
               +ILP    +M +LRH+  K+ + F +              L  L+T S   LS+G  A
Sbjct  1466  GEVILPRSLLRMVKLRHILVKRRASFTLHENMDESLANSQ--LNDLETFSTPRLSYGKDA  1523

Query  787   REILTQVPNlkklg-lreeegeylrdeqLVCYL-NNLKVLHCLEKLKCFFTKQRP--LPS  620
               IL ++PNL+KL  +  E   Y    +  C L   L+ L  LE +K   +   P  LP 
Sbjct  1524  ETILAKMPNLRKLSCIFLETFSYSEKLKGRCVLFPRLEFLSHLESVK-LVSNSYPSKLPH  1582

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
                FP  LK+L+L   + PW E+S++  LPNLE++KL   AF+G +WE+ +  F +LK +
Sbjct  1583  EFNFPSKLKELTLSKFRLPWSEISIIGELPNLEILKLLFRAFEGDRWEVKDAEFPKLKYL  1642

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             ++D  +  QW  S   FP+L++L L  C  L EIP  FGE  +++SIE+  C SS  +S 
Sbjct  1643  ILDNINFSQWSISDDAFPELENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANSA  1702

Query  259   DRIREEQ-EDSGNDGFTVRIH  200
               I+  Q E+  ND FTV I 
Sbjct  1703  LEIQTTQHEEMANDAFTVTIQ  1723



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score =   155 bits (391),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 165/323 (51%), Gaps = 11/323 (3%)
 Frame = -3

Query  1141  LNGFEMLRVLDIS-FQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWC  968
             LN F++LRVLD+        FP  I  +  LRYLA+ G  + +P S SEL  L+ L+   
Sbjct  1102  LNNFKLLRVLDVECINMGHAFPRGIEVMVRLRYLALSGDIDSIPESISELLNLEILLVKG  1161

Query  967   NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS--YLSFGS  794
                 ++LP   W M +LRHV+    + F +      W       L  L + S  YLS G 
Sbjct  1162  LKGRVLLPRTIWSMAKLRHVHVINHAAFSLQDG--IWKSSSQ--LHNLVSFSSPYLSCGE  1217

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD  614
                 I+ ++P L+KL     E     ++        L  L  L  LK  ++ +  LP   
Sbjct  1218  RTENIMRRLPKLRKLRCTFSELSDDNEKCN--QFPKLNFLTELVSLKLLYSGRIALPCKF  1275

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP +L++L+L     PW  +S +  LPNLEV+KL   AF+G  WE+ E  F  LK + +
Sbjct  1276  DFPLNLRKLTLSKFHLPWSYISEIGKLPNLEVLKLLSKAFEGEVWEMKEGEFLNLKFLKL  1335

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  +L +W ASS + P+LQ L+L+ C  L+E+P GFGE+ TL+ IE+  C  S   SV R
Sbjct  1336  DSLNLAEWNASSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKSVRR  1395

Query  253   IREEQEDSGNDGFTVRIHRGHND  185
             ++ E  D GN+   V I R   D
Sbjct  1396  LQTESLDMGNE-LKVLIDRSEMD  1417



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score =   154 bits (388),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 173/326 (53%), Gaps = 26/326 (8%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTL----IRWCN  965
             F++LRVLD+    F  FP  IL L  LRYLA+          S+L  LQTL    + + +
Sbjct  551   FKLLRVLDMEENRFFDFPIAILDLVFLRYLALTFKRSGQLPISKLLNLQTLTVRPLSYIS  610

Query  964   GACLILPEETWKMKELRHVY---FKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                + LP E WK+ +LRH++       S   V G ++     ++  L  +QT+S L+   
Sbjct  611   DWSMSLPNEIWKLSQLRHLHCWCMYLESPQTVSGNKV-----KNLVLESIQTVSGLTPSC  665

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC--------FFTK  638
             C +E+   +  +KKL +  +  E+        + NNLK L  LE L          F + 
Sbjct  666   CTKEVFEGIKKVKKLEIAGKAEEFHST---TGWENNLKYLKELETLNVAVWHRLVMFRSN  722

Query  637   QRPL---PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE  467
               P    PSP +FPP+LK+L+L G   PW  M++ S LPNLEV++LKD+AF G +WE+ E
Sbjct  723   AVPRSINPSPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTE  782

Query  466   EVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWE  287
               F +LK +L++   L  W A+   F  L+ + ++ C +L+EIP GF +  TLQ IEL +
Sbjct  783   MGFPKLKFLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHK  842

Query  286   CNSSTYDSVDRIREEQEDSGNDGFTV  209
             C  S     ++I+E  E+ GN+   V
Sbjct  843   CCLSLVIFAEQIQETHEELGNNLLKV  868



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score =   154 bits (388),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 175/321 (55%), Gaps = 13/321 (4%)
 Frame = -3

Query  1135  GFEMLRVLDIS-FQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCNG  962
              F++LRVLD+        FP+ +L L  LRYLA+ G  + +P S + L  L+TL+     
Sbjct  785   NFKLLRVLDLECINMGYSFPTGVLVLVGLRYLALCGDIDSIPASITHLQNLETLLVKGLK  844

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS--YLSFGSCA  788
               ++LP   W M++LRH++ K  +   +     T + E    +  L +LS  YL +G   
Sbjct  845   GRILLPYAIWNMEKLRHLHVKNYATITLQDGESTIFPE----VLNLVSLSSPYLLYGIGI  900

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAF  608
               I+ ++  L+KL     E      +     + N   L  LE L   ++ +  LP    F
Sbjct  901   ENIMRRLVKLRKLRCLFSELRDDTGKCNQFPIMNF--LTELESLNVLYSGRVGLPCKFDF  958

Query  607   PPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDI  428
             P +L++L+L   + PW  +S +  LPNLEV+KL   AF G  WE+ E  F +LK + +D 
Sbjct  959   PLNLRKLTLSKFRLPWDCISDIGRLPNLEVLKLLSKAFDGKVWEMKEGEFLKLKFLKLDS  1018

Query  427   ADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIR  248
              +L +W ASS + P+LQ L+L+ C  L+E+P GFG+ +TL+ IE+  C SS  +SV R+ 
Sbjct  1019  LNLSEWNASSDHLPQLQHLILQSCWQLKEVPPGFGDSFTLEIIEVQMCTSSLEESVKRLE  1078

Query  247   EEQEDSGNDGFTVRIHRGHND  185
             EEQ++ GN+   +++   H+D
Sbjct  1079  EEQQEMGNE---LKVLVDHSD  1096



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 174/331 (53%), Gaps = 30/331 (9%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRW-----  971
              F +L+VLD     F++       L  LRYLAI     LP S S+L  LQ LI       
Sbjct  590   SFGLLKVLDALTVRFLK-------LVRLRYLAITYNRKLPASISKLQSLQYLIVRQYLSI  642

Query  970   --CNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                  + L LP E W M+ LRH+     S  P P ++             L TL  +S  
Sbjct  643   LPLGPSRLYLPMEIWTMQGLRHLQVM-GSDLPNPSSKDALLP-------NLLTLLDVSGR  694

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTK---QRPL  626
             SC R+++ ++PNLKKLG+R E G    +    C+ +NL     L+ LKC       QR +
Sbjct  695   SCTRKVIKRIPNLKKLGIRIETGPDDVEPLY-CF-DNLDFFRELQSLKCSVMNPIFQRVV  752

Query  625   PS---PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
             P+      FP SLK+L+L G + PW  MS ++ L NLEV+KL+ YAF+G  WE  E  F 
Sbjct  753   PAISYNSIFPTSLKKLTLSGLRFPWGHMSDIAELRNLEVLKLRCYAFQGRAWETYEGEFF  812

Query  454   QLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSS  275
             +LK +LI+  DLE W     +FP L+ L+L++C  L+E+P   GE+  L+ +EL +C+ S
Sbjct  813   RLKFLLIEDTDLEYWYVDYESFPSLERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPS  872

Query  274   TYDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
                S  RI EEQ+ +GND   V I    +D+
Sbjct  873   LVASAKRIAEEQQSAGNDVLQVSIKSSADDQ  903



>emb|CDP04753.1| unnamed protein product [Coffea canephora]
Length=1258

 Score =   154 bits (388),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 165/331 (50%), Gaps = 47/331 (14%)
 Frame = -3

Query  1129  EMLRVLDISFQSF-MRFPSEILCLKILRYLA--IGLFNDLPPSFSELCRLQTLIRWCNGA  959
             ++LRVLD+    F   FP  ++ L  LRYLA  I   N +PP  S L RLQT +      
Sbjct  948   QLLRVLDLRNLKFDAHFPMVVVLLVHLRYLALYITGINSIPPEISNLSRLQTFLVRGYSR  1007

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG-----S  794
               +LP+  W +K LRH+Y+  +  F  P   +          P L  L  L+        
Sbjct  1008  YFLLPKTIWNIKTLRHLYYTTNGGFAFPVENLEVS-------PCLDHLDTLNLAIDPSSQ  1060

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV--------LHCLEKLKC----  650
               ++ILT++P++++L                C +  +++          CL +L+     
Sbjct  1061  SLQKILTKLPSIRRLK---------------CSITGVRIGNGGGILEFDCLSQLESLNLS  1105

Query  649   FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI  470
             +FT          FP +LK+L+L   ++PW E+S +  LPNL+V+KLK  AF G +W   
Sbjct  1106  YFTGY-----GFKFPRNLKKLTLSDNKQPWSEISTIGKLPNLQVLKLKHEAFAGEEWVKE  1160

Query  469   EEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
             E  F  L+V+ +   D  +W A+S NFP+L+ LVL  C  L E+P   GE  TL++IE+ 
Sbjct  1161  EGEFPSLRVLKLARLDFRRWTAASDNFPRLEQLVLYNCRELEEVPSCLGECPTLEAIEVG  1220

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              C  S   SV++I+EEQ D GN+   + I +
Sbjct  1221  RCGESVVSSVEKIQEEQMDMGNEDLKIAIEK  1251



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 160/319 (50%), Gaps = 16/319 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             F++LRVLD+    F  FP+EI  L  LRYLA     D+P S S L  LQTLI       L
Sbjct  560   FQLLRVLDVLMILFQLFPTEITQLVHLRYLAFTTGGDVPTSISNLWNLQTLIVEPTENQL  619

Query  952   ILPEETWKMKELRHVYFKKSS-HFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREIL  776
               P E WKM  L+  YF+      PVP        +    L K + LS     S   EI 
Sbjct  620   SWPVEIWKMSSLK--YFQSGGMSMPVPAPPK---AQHILGLEKFKKLSLNEASSNWEEIC  674

Query  775   TQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC--------FFTKQRPLPS  620
               VPN+K+L +      +        ++ +L  L  L+KL           F  +RP   
Sbjct  675   MAVPNVKELDVIINLDIHPNGWND--FIGSLICLVDLQKLSIQLKVSSHPLFFIRRPAQL  732

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
                FP +LK L+L      W +M +LS+LPNLEV+KL+ Y F+GS W L E  F +LK++
Sbjct  733   WYVFPENLKSLTLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNLDEGGFKKLKLL  792

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
              I    L  W+A+S + P L+ LVL +CS L EIP   G++ TL+ I+L  C+ +   S 
Sbjct  793   HIHQTRLVHWQAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSA  852

Query  259   DRIREEQEDSGNDGFTVRI  203
               I EEQ+  GN+   V +
Sbjct  853   GEILEEQKSIGNEVLVVTV  871



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 120/356 (34%), Positives = 174/356 (49%), Gaps = 27/356 (8%)
 Frame = -3

Query  1240  SRLVFYSDVDWNDY--KDLPKPSICSFIAFGRVQ-----------QLNGFEMLRVLDISF  1100
             +R +F ++  ++ Y  K  P     SF++FGR +               F++LRVLDI  
Sbjct  47    ARRLFCNNSQFSQYVRKKQPAEKARSFLSFGRDEIKLDPNLSPDDVFKHFKLLRVLDILS  106

Query  1099  QSFM--RFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWK  929
                +    P ++  L +L+++AI      LP   S L  LQTLI       L +  + W 
Sbjct  107   VKLLTVHLPKKLSNLVLLKFIAINCEVEILPKIMSSLLNLQTLIVHTVSPTLDIQADIWA  166

Query  928   MKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkkl  749
             M +LRH+    S   P          E+      LQTLS +S  S   E+L +  NLKKL
Sbjct  167   MTKLRHLITNSSMSLP-------RCEEQSTICENLQTLSVVSPESLTDEVLKRATNLKKL  219

Query  748   glreeegeylrdeqLVCYLNNLKVLHCLEKLKC----FFTKQRPLPSPDAFPPSLKQLSL  581
             G+    G  ++ +      ++L  L+ LE+LK       +K   LP P  FP  L +LSL
Sbjct  220   GISGNLGTLMKAKGESNLFDHLCELNFLERLKLCSNDVNSKLLALPQPHKFPKRLTKLSL  279

Query  580   RGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEAS  401
             +     W +MS+L  L  LEV+KLKDYAF G  W+  E  F  LKV+ I   DL+ WEA 
Sbjct  280   QNTSLGWDQMSILGKLQYLEVLKLKDYAFTGDDWQTEEGGFRSLKVLFIGATDLKCWEAQ  339

Query  400   SINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQED  233
             + +FP+L+ L+L+ C  L+ IP  F ++  L+ I L     S   S  RIR+ Q D
Sbjct  340   ATDFPELRRLILRQCKQLQRIPPDFVDMKKLEDIHLEHTTGSVISSARRIRQLQID  395



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 160/321 (50%), Gaps = 12/321 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RF  E   L  LRY+A        +P +   L  +QTLI     
Sbjct  12    AFPLLRVLDAESIKFSRFSKEFFKLFHLRYIAFSTDTIMTIPTNVGNLWNVQTLIIETQQ  71

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + W M  LRHV    S+  P P  +     + +     LQTLS  +   C  E
Sbjct  72    GTLDIKADIWNMTRLRHVCTNASATLPSP--KRPKSSKDNLVNRCLQTLSTKAPECCTAE  129

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRPL  626
             + T+ PNLKKLG+R +        +D       +N+  L CLEKLK        +KQ  L
Sbjct  130   VFTRTPNLKKLGVRGKLNALLETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSSKQLHL  189

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P    FP  LK+L+L      WK+MS+L  L  LEV+KLK+ AF G  WE  E  F +L+
Sbjct  190   PPAYIFPQKLKKLTLIDTWFEWKDMSILGLLDYLEVLKLKENAFTGQSWEPEEGGFPRLQ  249

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I+  DL  W++S  NFP+L+ LVL  C +L+E+P    +V  LQ +EL   + S   
Sbjct  250   VLWIERTDLSSWKSSCGNFPRLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAK  309

Query  265   SVDRIREEQEDSGNDGFTVRI  203
             S   I +++++    GF + +
Sbjct  310   SARAILKKKQEKEGSGFKLSV  330



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score =   150 bits (379),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 172/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTL----IRWC  968
              F++LRVLD+    F  FP  IL L  LRYLA+          S+L  LQTL    + + 
Sbjct  550   NFKLLRVLDMEENRFFDFPIAILDLVFLRYLALTFKRSGQLPISKLLNLQTLTVRPLSYI  609

Query  967   NGACLILPEETWKMKELRHVY---FKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
             +   + LP + WK+ +LRH++       S   V G ++     ++  L  +QT+S L+  
Sbjct  610   SDWSVSLPNDIWKLSQLRHLHCWCMYLESPQTVSGNKL-----KNLVLENIQTVSGLTPS  664

Query  796   SCAREI---LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCL--EKLKCFFTKQR  632
              C +E+   + +V  L+  G  EE       E  + YL  L+ L+     +L  F +   
Sbjct  665   CCTKEVFEGIKKVKKLEIAGKAEEFHSKKGWETNLKYLKELEALNVAVWHRLAMFSSNAM  724

Query  631   PL---PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
             P    P P +FPP+LK+L+L G   PW  M++ S LPNLEV++LKD+AF G +WE+ E  
Sbjct  725   PRSINPCPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMG  784

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F +LK +L++   L  W A+   F  L+ + ++ C +L+EIP GF +  TLQ IEL +C 
Sbjct  785   FPKLKFLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCC  844

Query  280   SSTYDSVDRIREEQEDSGNDGFTV  209
              S     ++I+E  E+ GN+   V
Sbjct  845   LSLVIFAEQIQEMHEELGNNLLKV  868



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score =   150 bits (379),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 164/294 (56%), Gaps = 21/294 (7%)
 Frame = -3

Query  1054  LRYLAIGLFNDLP-----PSFSELC-RLQTLIRWCNGA-CLILPEETWKMKELRHVYFKK  896
             LR++AI   +D+P     PS   L   LQTLI   NG   ++ P E W M +L+HV+F +
Sbjct  565   LRFIAIR--SDVPKNSGFPSLVNLLWNLQTLI--VNGIFGVVAPCEIWNMTQLKHVHFFQ  620

Query  895   SSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylr  716
                  +P   +   G   + L  LQTL+++    C  E++ ++PN+ KL +   E     
Sbjct  621   ---LKLPDPPIGGKGNE-FVLENLQTLTHIRNFKCGEEVVKRIPNINKLQISYFEEPQGF  676

Query  715   deqLVCYLNNLKVLHCLEKLK-CFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSV-L  542
                    L+NL  LH LE L+   +++ + L      P SLK+L+L G    W++M   +
Sbjct  677   LSYS---LDNLGQLHKLESLRLSIYSENKHLLQNFILPNSLKKLTLMGTCLKWEDMKTKI  733

Query  541   SALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI-DIADLEQWEASSINFPKLQSLVL  365
               LPNL+V+KLK+Y+F G++WE +E  FC L+ +LI    DLE W   S +FP+L+ L L
Sbjct  734   CLLPNLQVLKLKEYSFVGTEWETVEGQFCNLRYLLIRSCRDLEWWTTDSSHFPRLEHLHL  793

Query  364   KYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             +Y   L+EIP   GE+ TLQSIEL  C+     S  +I +EQED GN+ F V++
Sbjct  794   RYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGNEDFRVQV  847



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 172/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTL----IRWC  968
              F++LRVLD+    F  FP  IL L  LRYLA+          S+L  LQTL    + + 
Sbjct  561   NFKLLRVLDMEENRFFDFPIAILDLVFLRYLALTFKRSGQLPISKLLNLQTLTVRPLSYI  620

Query  967   NGACLILPEETWKMKELRHVY---FKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
             +   + LP + WK+ +LRH++       S   V G ++     ++  L  +QT+S L+  
Sbjct  621   SDWSVSLPNDIWKLSQLRHLHCWCMYLESPQTVSGNKL-----KNLVLENIQTVSGLTPS  675

Query  796   SCAREI---LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCL--EKLKCFFTKQR  632
              C +E+   + +V  L+  G  EE       E  + YL  L+ L+     +L  F +   
Sbjct  676   CCTKEVFEGIKKVKKLEIAGKAEEFHSKKGWETNLKYLKELEALNVAVWHRLAMFSSNAM  735

Query  631   PL---PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
             P    P P +FPP+LK+L+L G   PW  M++ S LPNLEV++LKD+AF G +WE+ E  
Sbjct  736   PRSINPCPGSFPPNLKKLTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVTEMG  795

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F +LK +L++   L  W A+   F  L+ + ++ C +L+EIP GF +  TLQ IEL +C 
Sbjct  796   FPKLKFLLLEHLFLSYWTATDDYFQCLERVYIRDCVYLQEIPEGFADSVTLQLIELHKCC  855

Query  280   SSTYDSVDRIREEQEDSGNDGFTV  209
              S     ++I+E  E+ GN+   V
Sbjct  856   LSLVIFAEQIQEMHEELGNNLLKV  879



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 169/340 (50%), Gaps = 48/340 (14%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPP-------------------  1013
             GF++LR+LD+    F  FP ++L L  LRYLA+    +LP                    
Sbjct  384   GFKLLRILDLISYYFSDFPIQVLKLFHLRYLALSTSGELPTKASKLGRDFGKWCNIPFSK  443

Query  1012  -------SFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSS-HFPVPGTRMT  860
                    S S L  L+ LI  W       LP +   M +LRH++ K +  +F       T
Sbjct  444   RTTNPPISISNLVNLEILIVHWGMRESHNLPLDIQMMTQLRHIHLKGAVVYFDDLFLMET  503

Query  859   WYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLK  680
                    +L  L T+S  +F       +  VPNLKKLG+   +  +        +LN+L 
Sbjct  504   KNPLVLSNLQTLLTVSSANFSQKKMFPMAIVPNLKKLGIIVSDKNHDF------FLNDLS  557

Query  679   VLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDY  500
              LH              L   DAFPP L+ L+L G   PW++M  +  +P LEV+K+KD 
Sbjct  558   SLH--------------LSRWDAFPPKLRALTLCGGHLPWEDMVNIGKIPELEVLKVKDR  603

Query  499   AFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
             AF G  WE  +E F  LK +L++ +++E WEA+S +FP+LQ LVL+ C  L EIP G G 
Sbjct  604   AFAGRIWETADEGFLGLKFLLLEKSEIEIWEATSDHFPRLQHLVLRLCGCLEEIPFGVGG  663

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             + TLQ IE++ C  S   S  RI+EEQ+  GND   VRI+
Sbjct  664   IPTLQMIEIYSCAHSVVSSAKRIQEEQQSYGNDDLEVRIN  703



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 115/320 (36%), Positives = 172/320 (54%), Gaps = 26/320 (8%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F +LRVLDI     ++FP EI+ L  LRYLA+   + +P S S L  LQ LI     
Sbjct  394   ISAFRLLRVLDILSIRRIQFPGEIIQLVNLRYLALRT-SKVPSSISRLWNLQFLIVKAIA  452

Query  961   ACL---ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD----LPKLQTLSYLS  803
                   ++  E   M +LRH+ FK    F V      WY +++ +      +LQ+LS ++
Sbjct  453   NSFNRHVVTPEILDMTQLRHIKFKG---FCV------WYDDQYREHIVVQDQLQSLSTIA  503

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP  623
                    +L  +PNLKKLG+  +E           ++ +L  LH L  LKC   +   L 
Sbjct  504   DSGLTDRVLRTIPNLKKLGIFCDEKFD--------HVRDLSRLHKLHSLKCSSWRDADL-  554

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
             S   FP SLK+L+L  C      MS +  LPNL+++KL+    K  +W++ E  FCQLK 
Sbjct  555   SNLIFPDSLKELALHNCVIHDPHMSRIGNLPNLQILKLRCCGIKNRKWKVNEGEFCQLKY  614

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             +++    L+ W A  I FP+L+ L+++ CS L EIP G G++ TL+ IE+ E      DS
Sbjct  615   LMMASLHLDFWAADDICFPRLEHLIIRRCSGLPEIPYGIGDIPTLKVIEVREYLPPLLDS  674

Query  262   VDRIREEQEDSGNDGFTVRI  203
             V  I+++QE +GNDG  VR+
Sbjct  675   VRMIQKKQEKNGNDGLEVRL  694



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score =   149 bits (377),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 121/328 (37%), Positives = 166/328 (51%), Gaps = 27/328 (8%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND--LPPSFSELCRLQTLIRWC  968
             L  F +LRVLD+   +        L L  LRYLA     +  +P S  +L  LQTL    
Sbjct  561   LQSFRLLRVLDVVVAA----XXXXLKLFHLRYLAFTFLGNFHIPASILKLQNLQTLFMCP  616

Query  967   NGACLI-------LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY  809
               + LI        P E W+M +LRH+    S  FP P           + L  LQTL+ 
Sbjct  617   YASFLIHQRSRVRFPLEIWRMAQLRHLVLSMSDPFPKPSAGT-------FVLKNLQTLAI  669

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF--TKQ  635
             +    C +EI+  +PNLKKLG+          E    +L+NL  LH LE LK +     +
Sbjct  670   VRNFKCTKEIVQMIPNLKKLGILYGVYGIKWREY---HLHNLVDLHQLENLKVWVEDISR  726

Query  634   RPLP--SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
              P P     AFP  LK+L+L GC   W++M+ + +L NLEV+KL   +F+G +WE IE  
Sbjct  727   EPFPLWEKLAFPVMLKKLTLSGCLFCWEDMTTVGSLQNLEVMKLTRCSFEGCKWETIEGE  786

Query  460   FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
             F +LK + I   +L+ W   S +FP L+ L L  C  L EIP   GE+ TL+ IE+   +
Sbjct  787   FPRLKFLKIRWTNLQHWVTDSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSD  846

Query  280   SSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              S   S  +I+EEQ+  GND   VRI R
Sbjct  847   RSLVKSAKQIKEEQQSFGNDYLEVRIVR  874



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score =   149 bits (377),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 174/323 (54%), Gaps = 28/323 (9%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F +LRVLDI     + FP EI+ L  LRYLA+   + +P S S L  LQ LI     
Sbjct  510   ISAFRLLRVLDILSIGCILFPGEIIQLVNLRYLALRT-SKVPSSISRLWNLQVLIVEAIA  568

Query  961   ACL---ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDL----PKLQTLSYLS  803
                   ++  E  +M +LRH+ FK    F V      WY +++ +      +LQ+LS ++
Sbjct  569   DSFNRHVVTPEILEMTQLRHIKFKG---FCV------WYDDQYREHIVVQDQLQSLSTIA  619

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC---FFTKQR  632
                    +L  +PNLKKLG+  +E           ++ +L  LH L  LKC    +    
Sbjct  620   VSGLTDRVLRTIPNLKKLGIFCDEKFD--------HVRDLSRLHKLHSLKCSSGLYVHHH  671

Query  631   PLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQ  452
                S   FP SLK+L+L+ C      MS +  LPNL+++KL +   K  +W++ E  FCQ
Sbjct  672   SDLSNLIFPDSLKKLALQHCVIHDPHMSRIGNLPNLQILKLSNCGIKNRKWKVNEGEFCQ  731

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             LK ++++   ++ W A  I FP+L+ L++++C+ L EIP G G++ TL+ IE+ +     
Sbjct  732   LKYLIMEHLHMDFWAADDICFPRLEHLIIRHCAWLPEIPYGIGDIPTLKVIEVRQYLPPL  791

Query  271   YDSVDRIREEQEDSGNDGFTVRI  203
              DSV  I+++QE +GNDG  VR+
Sbjct  792   LDSVRMIQKKQEKNGNDGLEVRL  814



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score =   150 bits (380),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 159/301 (53%), Gaps = 6/301 (2%)
 Frame = -3

Query  1132  FEMLRVLDIS-FQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCNGA  959
             F++++VLD+        FP+E+  L  LRYLAI G    +P S S L +L+TLI      
Sbjct  1159  FKLVKVLDLECINIGHSFPAEMEFLVQLRYLAISGDVGSIPRSISNLWKLETLIVKGLSG  1218

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREI  779
              ++LP+  W M  LR ++ KK + F + G  ++ Y  +  +L    +LS LSFG    +I
Sbjct  1219  MVLLPDSLWCMTRLRRIHVKKQAAFSM-GDDISGYSFQLENLVTFSSLS-LSFGMDTEKI  1276

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPS  599
             L ++PNL+       +               L  L  LE LK F+  +   P   + P +
Sbjct  1277  LRKLPNLRSFSCIFLDARDSSQS--CNQFPRLDFLPQLESLKIFYAGRTRKPGEFSLPLN  1334

Query  598   LKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADL  419
             LK+L+L     PW  +S +  LPNL+V+KL   AF G  W++ E+ F +L+ + +D  +L
Sbjct  1335  LKKLTLSSFGLPWDHISTIGRLPNLQVLKLASEAFDGESWDMREDEFPELRFLQLDSLNL  1394

Query  418   EQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQ  239
              QW AS  + PKL  LVL+ C  L+E+P  F ++ TL+ I++ +C  S  +SV  I E  
Sbjct  1395  VQWNASYDHLPKLAQLVLRNCKRLQEVPYDFADIPTLELIQVQQCGKSLEESVRSIGEAT  1454

Query  238   E  236
             E
Sbjct  1455  E  1455



>emb|CDP19132.1| unnamed protein product [Coffea canephora]
Length=1249

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 157/307 (51%), Gaps = 13/307 (4%)
 Frame = -3

Query  1138  NGFEMLRVLDIS-FQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCN  965
             N F+ L+VLD+        FP ++  L +LRYLA+ G    +P S + L  L+TLI    
Sbjct  936   NNFKHLKVLDLGRINVGDSFPGQVEKLVLLRYLALRGRIKSIPSSIANLWNLETLIVKGL  995

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
                + LP+   +M  LRH++      F +  +      +   +L    TLS LS G CA 
Sbjct  996   KGEVTLPDTILEMASLRHLHINNRVVFSLDDSEPGDTSQS--NLETCSTLS-LSHGICAE  1052

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCL---EKLKCFFTKQRPLPSPD  614
              I+ ++ N++KL     E         +   N   VLHCL   E LK  +      P   
Sbjct  1053  MIIRRLVNIRKLKSIFFESWND-----LANCNRFPVLHCLSRLESLKLLYHGSIMFPCEM  1107

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
             + P SL++L+L   + PW EMS +  LPNLEV+KL   AF+G QW + +  F +LK + +
Sbjct  1108  SLPLSLRKLTLSKFRLPWDEMSTILKLPNLEVLKLLHRAFEGEQWNMGDAEFLKLKFLKL  1167

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D   L QW ASS NFP L+ LVL+ C  L EIP  FG++ TL+ IE+  C+ S   S   
Sbjct  1168  DTLKLVQWNASSDNFPCLEQLVLQKCKQLEEIPSSFGDIATLEKIEVQWCSISASKSATD  1227

Query  253   IREEQED  233
             I  E+ D
Sbjct  1228  IEAEEPD  1234



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   149 bits (377),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 176/330 (53%), Gaps = 25/330 (8%)
 Frame = -3

Query  1123  LRVLDISFQSFMRFPSEILCLKILRYLAI----GLFNDLPPSFSELCRLQTL----IRWC  968
             L++LD+S  +   FP  ILCL  LRYL +    G F D+PP   E+CRL +L    +   
Sbjct  525   LKILDLSPITLDIFPPPILCLSFLRYLVLSTRGGRF-DIPP---EICRLWSLRTFIVEGY  580

Query  967   NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA  788
                 +  PE+ W++ +LRH+   +      P   +    ER  +   + T+S L   SC 
Sbjct  581   RPTYVHFPEQIWELWQLRHLGVYQFDLLNPPSISVD--EERCLEFSNIHTVSGLCVSSCT  638

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT-------KQRP  629
              E+++ + N+KKLG+  +E E+        + +NL  LH LE L    +        + P
Sbjct  639   EEVISGIRNVKKLGIYADEYEFKTFHGSKLF-DNLANLHQLETLSLKISVPLQTKINKVP  697

Query  628   L--PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFC  455
             L  PS  AFP +LK+L L      W++M ++  LP+LEV+KL   A  G +W  I   F 
Sbjct  698   LTIPSAKAFPATLKKLKLDNTCLRWEDMDIIGELPDLEVLKLMLNACCGQEWHPIAGGFT  757

Query  454   QLKVMLIDIA-DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNS  278
             +LK++LI     L+ W+A++ NFP L+ LV+ YC+ L E+PI F ++ +LQ IEL  C +
Sbjct  758   RLKLLLIKHNYHLKYWKATNDNFPVLERLVITYCTELEEMPIEFADMDSLQLIELSYCTA  817

Query  277   STYDSVDRIREEQEDSGNDGFTVRIHRGHN  188
                 S  RI++EQED GN    VRI   +N
Sbjct  818   QLEASAARIQQEQEDLGNKPVDVRISDTYN  847



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score =   149 bits (377),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 164/311 (53%), Gaps = 32/311 (10%)
 Frame = -3

Query  1093  FMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELR  914
             F +FP+EIL L  LRYLA    +++P + S L  LQTLI         LP E W+M ELR
Sbjct  563   FHQFPTEILELVNLRYLAFYCNSEIPSAISRLWNLQTLIVGSILRSFELPSEIWEMPELR  622

Query  913   HVYFKKSSHFPVPGTRMTWYGERHWDLP----KLQTLSYLSFGS-CAREILTQVPNlkkl  749
             H+ F+ S        R++ Y    + +P    KLQT+S +S        IL  VPN+K L
Sbjct  623   HIKFRNS--------RISIYSV--YQIPFVHEKLQTISAMSANVLIDSNILGSVPNIKNL  672

Query  748   glreeegeylrdeqLVCYLNNLKVLHCLEKLKC--FFTKQRPLPSPDAFPPSLKQLSLRG  575
             G+                  +L +L  LE LK   F        S   FPPS+ +L+LR 
Sbjct  673   GIYSWIPPRTVV--------DLSLLPKLETLKFSDFCLIDHGHLSEVIFPPSVIKLALRS  724

Query  574   CQRPWKEMSVLSALPNLEVVKLKDYAFK-------GSQWELIEEVFCQLKVMLIDIADLE  416
             C   W+ +  + +LPNL+V+K++   FK         +WE  E  F  L+ +L++   L 
Sbjct  725   CTITWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSDEEWEPTEGEFSSLQFLLLEKLKLV  784

Query  415   QWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQE  236
             +W+A   +FP+L+ LV++ CS L EIP   G++ TL+ IEL EC+ S   S  +I+E+Q 
Sbjct  785   RWKADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVASARQIQEDQS  844

Query  235   DSGNDGFTVRI  203
             ++GNDG  VRI
Sbjct  845   ENGNDGLEVRI  855



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 169/330 (51%), Gaps = 28/330 (8%)
 Frame = -3

Query  1141  LNGFEMLRVLDISF----------QSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCR  992
             L  F  LRVLD+ F          +     P ++  L  LRYLA     ++P + S L  
Sbjct  538   LRHFRFLRVLDLVFAYNHRRMFDSEEVASLPPQVFELFHLRYLAFSYAVEIPRAVSNLQN  597

Query  991   LQTLIRWCNG------ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLP  830
             LQTLI +         + + LP E W+M +LRH+        P P        E    L 
Sbjct  598   LQTLIIYLGTKFRYRPSTVRLPSEIWRMPQLRHLICFNFDQLPDPHQE----SEITRALL  653

Query  829   KLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC  650
              LQTLS +    C   I+  +PN+KKLG+   E +Y ++     +L NL  L  L  LK 
Sbjct  654   NLQTLSRVRNLKCTETIMKMIPNVKKLGIFYSEDKYKQEY----HLENLVHLQNLVNLKL  709

Query  649   FFTKQRPLPSPD-AFPPSLKQLSLRGCQRPWKE-MSVLSALPNLEVVKLKDYAFKGSQWE  476
                     P+    FP +LK+LSL G   PW+  M  + +LPNL+V+KL++Y   G  W+
Sbjct  710   TVRANLSFPNKSLNFPQTLKKLSLSGESLPWQSTMMSIGSLPNLQVLKLRNYC--GYAWK  767

Query  475   LIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIE  296
               +  F +L+ +LI+ +DL  W   S +FP L+ L+L++C HLREIP   GE+ TLQ IE
Sbjct  768   TSDGGFPELEFLLIESSDLRHWITESDHFPSLKWLLLRHCEHLREIPDAIGEIPTLQLIE  827

Query  295   LWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             +   ++S ++S   I+EEQ+  GN+   VR
Sbjct  828   VKGGSASLFESAKGIQEEQQSWGNEALQVR  857



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score =   149 bits (377),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 175/336 (52%), Gaps = 28/336 (8%)
 Frame = -3

Query  1147  QQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI--GLFN--DLPPSFSELCRLQTL  980
             +++ GF +LRVLD+    F  FP E+L L  LRY+A   G      LPPS  +L  LQTL
Sbjct  592   ERVTGFSLLRVLDVLEVVFESFPVELLELFHLRYIAFSTGFIRHCTLPPSLPKLRNLQTL  651

Query  979   IRWCNGACLI--------LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKL  824
             I   +    I        LP   W+M +LRH+ F   +  P P      +      L  L
Sbjct  652   IVGSSVTFGITDRMVAAKLP--IWEMPQLRHLVFLNITLSPFPCETDKEFAV----LKNL  705

Query  823   QTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF  644
             QTLS +      RE +  +PNLKKL L      ++     V  L NL     LE L   F
Sbjct  706   QTLSRVRNFRFTREAVEMIPNLKKLKLVYMGRSHVHMS--VYELENLVHFQKLETLNLKF  763

Query  643   TK-----QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQW  479
                    + P+P     P +LK+L+L GC    ++M+++ +L NLEV+KL + +  G+ W
Sbjct  764   QTSSDWWRNPVPVRFGLPLNLKKLTLSGCGLSLEDMTMIGSLANLEVLKLLNMSLVGALW  823

Query  478   ELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             E++EE +  L+ ++++  D++ W A S  FP L+ LV+++CS L  IP G G++ TL+ I
Sbjct  824   EVVEEEYSCLRFLMMEWLDIKTWLAESGCFPSLERLVIRHCSALENIPSGIGDIPTLRVI  883

Query  298   ELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGH  191
             E+ +   +  DS + I EEQ+D GND   VR   GH
Sbjct  884   EVDDSEMAE-DSAEEILEEQQDLGNDVLQVRF--GH  916



>ref|XP_009609967.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=468

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 113/309 (37%), Positives = 158/309 (51%), Gaps = 56/309 (18%)
 Frame = -3

Query  1132  FEMLRVLDI--SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGA  959
             F++LRVL I    + F  FP EI  L  LRYL +    D+P S SEL  LQTLI      
Sbjct  206   FKLLRVLAIFNKVERFRTFPLEITKLFHLRYLQVFFSGDIPESISELQNLQTLIN-----  260

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREI  779
                                               +G +   +P L+ LS L   SC  E+
Sbjct  261   ----------------------------------HGGK--GMPNLEELSGLCSLSCTTEV  284

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDA----  611
              +++PNLK+L + E           +  ++NL  L     LKC+   +  +P P +    
Sbjct  285   FSRIPNLKRLVVYEISSRREGMANRLIDMSNLTKL---VTLKCW---EYDVPKPISIKMF  338

Query  610   -FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQLKVML  437
              FP SLK+L+L   + PWK++S L+ LPNLE +KLK  A KG  W L +E  F  LK++L
Sbjct  339   VFPTSLKRLTLYEFRFPWKDISTLAMLPNLEELKLKYNAVKGGVWRLSDEDKFESLKLLL  398

Query  436   IDIADL-EQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             I        WEASS NFP L+ LVL  C +L++IP  FGE+ +L+SIEL  CN++  DS 
Sbjct  399   IATTTFFHHWEASSDNFPNLKRLVLNNCHYLKQIPTDFGEICSLESIELHYCNTTAEDSA  458

Query  259   DRIREEQED  233
              +I++EQ+D
Sbjct  459   RKIKQEQQD  467



>gb|EYU19036.1| hypothetical protein MIMGU_mgv1a021264mg, partial [Erythranthe 
guttata]
Length=768

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 151/307 (49%), Gaps = 19/307 (6%)
 Frame = -3

Query  1054  LRYLAIGLFN-----DLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSS  890
             LRYL +  F        PPS   L  LQTLI       ++ P E WKM +LRHV F    
Sbjct  454   LRYLVVENFGYENPCRFPPSMYLLWNLQTLIVKSISGFVVAPSEIWKMTQLRHVQFFGGL  513

Query  889   HFPVP--GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylr  716
               P P  G +     +  + L  LQTLS +    C  E++ + PN+ KL +  E  E   
Sbjct  514   KMPDPPLGGQ-----DGEFVLGNLQTLSLIINFKCGEEVVKRTPNITKLQICYEGEEIEG  568

Query  715   deqLVCYLNNLKVLHCLEKLKCFFT-----KQRPLPSPDAFPPSLKQLSLRGCQRPWKEM  551
                    LNNL  L  LE   C+F       +  +      P SLK+L+L      W++M
Sbjct  569   YLSSYYCLNNLGRLGKLESFDCYFDSLNKPNRNDMLQNSIIPNSLKKLTLGWTYLKWEDM  628

Query  550   SV-LSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDI-ADLEQWEASSINFPKLQ  377
                +  LPNLEV+ L   +  G++WE +E  FC L+ + I + +DLE W   S +FP L+
Sbjct  629   KTKIGWLPNLEVLNLNCKSVVGAEWETVEGQFCNLRFLQIYMCSDLEWWTTDSNHFPSLE  688

Query  376   SLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              LVL+Y   L+EIP   GE+ TL SIEL  C+ S   S   I +EQED GN G  VR+  
Sbjct  689   QLVLEYMDKLKEIPSCIGEIPTLGSIELNYCSKSAVISAKEILDEQEDLGNVGLRVRVRV  748

Query  196   GHNDE*H  176
                D+ H
Sbjct  749   FPKDKQH  755



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score =   149 bits (375),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 164/326 (50%), Gaps = 17/326 (5%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RF  E   L  LRY+A+       +P  F  L  +QTLI     
Sbjct  561   AFPLLRVLDAESIKFNRFSREFFKLFHLRYIALSTDKIKTIPVDFGNLWNVQTLIVETQE  620

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
             A L +  + W M  LRHV    S+   +P T+     + +     LQTLS ++   C  E
Sbjct  621   ATLDIKADIWNMTRLRHVCTNASA--TLPSTKRPKSSKGNLVNRCLQTLSTIAPECCTAE  678

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPS  620
             + T+ PNLKKLG+R +        +D       +N+  L CLE LK     +   +PL  
Sbjct  679   VFTRTPNLKKLGVRGKIDALLETSKDGSGSVLFSNIGKLACLEYLKLVNDTRISSKPLHL  738

Query  619   PDA--FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P A  FP  LK+LSL      WK+MS+L  LP+LEV+KLK+ AFKG  WE  +  F +L+
Sbjct  739   PPAYIFPQKLKKLSLVDTWFEWKDMSILGLLPDLEVLKLKENAFKGQSWEQEDGGFPRLQ  798

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I+  DL  W+ASS NFP+L+ L L  C  L E+P    +V  LQ IEL   + S   
Sbjct  799   VLWIERTDLTSWKASSGNFPRLKHLALISCDKLEELPAELADVKNLQLIELQSSSESAAR  858

Query  265   SVDRI-----REEQEDSGNDGFTVRI  203
             S   I      +EQE     GF + I
Sbjct  859   SARAILKRNQEKEQEGDKGTGFKLSI  884



>ref|XP_009762970.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=1777

 Score =   150 bits (378),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 116/335 (35%), Positives = 174/335 (52%), Gaps = 16/335 (5%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND-LPPSF  1007
             PS+ + ++F      + F+ LRVLD+ F +   FP+E   L  LRYLA+  F + +P S 
Sbjct  1452  PSVDNQVSFA----FHSFKCLRVLDLEFVTVDSFPTE---LSQLRYLALRTFEESIPSSI  1504

Query  1006  SELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPK  827
             + L  L+TL+    G+ L LP    KM ++RH++    + F +   ++  + E   +L  
Sbjct  1505  ANLRNLETLMVKGLGSELSLPHSLCKMVKIRHLHLNDRASFNLQNIKV--FLEDPSELGN  1562

Query  826   LQTLSYLSF--GSCAREILTQVPNlkklglreeeg--eylrdeqLVCYLNNLKVLHCLEK  659
             L+T S  +F  G    ++L++ PN++KL              ++       L+ L  LE 
Sbjct  1563  LETFSTPAFSSGEDVEKVLSKTPNIRKLRCIFSGSWGYSEEQQKDCNQFPRLQHLTKLES  1622

Query  658   LKCF-FTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQ  482
             LK F F K    P    FP  LK+L+L G   PW E+S +S LPNL ++KL+  AF G +
Sbjct  1623  LKVFCFHKPERSPCVFNFPSDLKKLTLCGFGFPWSEISAISTLPNLVILKLQSDAFCGEE  1682

Query  481   WELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQS  302
             WE+ +E F QLKV+ ++      W  S   F  L+ LVL  C  L EIP  FG    LQS
Sbjct  1683  WEVSDEQFSQLKVLKLENISFACWSVSEDAFSNLEQLVLHSCDCLVEIPTEFGYFTCLQS  1742

Query  301   IELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
             IE+  C  S  +S   + E Q E+  N+GFT+ I+
Sbjct  1743  IEVKSCQESVANSARNVEEIQVEEMQNNGFTLFIY  1777



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 170/326 (52%), Gaps = 26/326 (8%)
 Frame = -3

Query  1171  SFIAFGRV--QQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSEL  998
             S++ FG V  + L+   +LRVLDI + S + FP EIL L  LRYLA      LP S S L
Sbjct  534   SWLDFGPVNWKILSESRLLRVLDILWISLLEFPEEILQLINLRYLAFSSAKGLPSSISRL  593

Query  997   CRLQTLI-------RWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHW  839
               LQTLI       RW      I P   + M +LRH+ FK++    +    +  +  +  
Sbjct  594   LNLQTLIAQRSTNSRWPRD---IAPGILY-MTQLRHIKFKRTHVRFLDKDNLASFVLQ--  647

Query  838   DLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEK  659
                KLQTLS ++        L ++PNL+KLG+  +E +            +L  LH L  
Sbjct  648   --DKLQTLSTIALSEINHWFLDKIPNLQKLGVICDEIQDTE--------KDLSRLHKLHT  697

Query  658   LKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQW  479
             LK   T+ +       FPP LK+L+L+ C      ++ +  L NLE++KL++  FK  +W
Sbjct  698   LKLSSTRFQ-FTFNVIFPPYLKKLTLKRCTVLDHHLNAIGKLLNLEILKLQECKFKSLRW  756

Query  478   ELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             E  E  FCQL+ + +D+ DL  W     NFP+L  LV++ C HL EIP+  G++ TL+ I
Sbjct  757   EPNEGEFCQLQFLRMDLVDLVNWVVDDTNFPRLDHLVIRGCRHLEEIPLAIGDIPTLKVI  816

Query  298   ELWECNSSTYDSVDRIREEQEDSGND  221
             E+   + S   S   I++ Q DSGND
Sbjct  817   EVDNSSPSVLASAREIQQAQLDSGND  842



>ref|XP_006346790.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=890

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 174/330 (53%), Gaps = 29/330 (9%)
 Frame = -3

Query  1132  FEMLRVLDISFQS---FMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             F +LRVL I F +   F  FP  I  L  LRYL       +P S S+L  LQTLI  C+G
Sbjct  571   FNLLRVLAI-FNTDVWFESFPLVITTLFHLRYLQFPFHVKIPGSISKLNNLQTLI--CSG  627

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L  P E W MK LR++  +  SH P P       G     +  L+ LS + + SC +E
Sbjct  628   HTL--PREIWMMKNLRYICLEVPSHLPSPRIGSLVTG-----MSNLEELSGVCYFSCTKE  680

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD-AFP  605
             + + +PNLK L +             +    +L  L  LE  K +       P     FP
Sbjct  681   VFSGIPNLKVLIIHLPHISKGIPHHQL----DLSGLTKLEVFKLYGAPYLRDPIKRFGFP  736

Query  604   PSLKQLSL-RGCQRPWKEMSVLSA-LPNLEVVKLKDYAFKGSQWELIEE-------VFCQ  452
              SL++LSL + C   W ++S  +  LPNLEV+KL  Y    ++  L +E       VF  
Sbjct  737   TSLRRLSLSQCCYFDWADLSSTAMMLPNLEVLKLIHYEPLSNECRLSDEWRMSDKDVFKS  796

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             LK++L+   +L+ WEASS NFP L+ LVLK C HL+EIP  FGE+ TL+S+EL +C+++ 
Sbjct  797   LKLLLLSGTNLKHWEASSDNFPILKRLVLKKCRHLQEIPADFGEICTLESVELHDCSATA  856

Query  271   YDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
              DS   I  EQED GN+   ++++  HN++
Sbjct  857   EDSAKNIEREQEDMGNN--ILKVYIIHNND  884



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 120/319 (38%), Positives = 162/319 (51%), Gaps = 15/319 (5%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RF  E   L  LRY+A+       +P  F  L  +QTLI     
Sbjct  561   AFPLLRVLDAESIKFSRFSREFFKLFHLRYIALSTDKIKTIPADFGNLWNIQTLIVETQQ  620

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
             A L +  + W M  LRHV    S+   +P T+     + +     LQTLS ++   C  E
Sbjct  621   ATLDIKADIWNMTRLRHVCTNASA--TLPSTKRPKSSKDNLVNRCLQTLSTIAPECCTAE  678

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCFFTKQ---RPLPS  620
             + T+ PNLKKLG+R +        +D       +N+  L CLE LK     +   +PL  
Sbjct  679   VFTRTPNLKKLGVRGKIDALLESSKDGSGSGLFSNIGKLGCLEYLKLVNDTRLSSKPLHL  738

Query  619   PDA--FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P A  FP  LK+LSL      WK+MS+L  LP LEV+KLK+ AFKG  WE  +  F +L+
Sbjct  739   PPAYIFPQKLKKLSLVDTWFEWKDMSILGLLPELEVLKLKENAFKGQSWEQEDGGFPRLQ  798

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I+  DL  W+ASS NFP+L+ L L  C  L E+P    +V  LQ IEL   + S   
Sbjct  799   VLWIERTDLTSWKASSGNFPRLKHLALISCDKLEELPAELADVKNLQLIELQSSSESAAR  858

Query  265   SVDRI---REEQEDSGNDG  218
             S   I    +E+E  G+ G
Sbjct  859   SARAILKRNQEKEQDGDKG  877



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score =   148 bits (374),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 121/328 (37%), Positives = 183/328 (56%), Gaps = 24/328 (7%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFN---DLPPSFSELCRLQTLIRW  971
             LN F++LRVLD+    F  FPSEIL L  LRYLA+ ++    D+P   S L  LQTL+  
Sbjct  550   LNHFKLLRVLDLEAVEFSYFPSEILHLVGLRYLALAIYKIPEDVP--ISNLWNLQTLVVS  607

Query  970   CN--GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
              +     + LP   W + +LRH++   +S +     +++     H  L KL ++S LS  
Sbjct  608   QSELDGRISLPIGIWGLSQLRHLHC--TSMYVHSPRKVSVNEVNHPILEKLLSVSGLSLS  665

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC------FFTKQ  635
              C +E+   +  +KKLG+     E++   +  C L+NL  LH LE LK            
Sbjct  666   CCTKEMFEGIKKVKKLGIFGTGNEFIDVPE--C-LDNLIHLHELETLKIAGFNMDLLDFD  722

Query  634   RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAF----KGSQWELIE  467
               LP   +FPP+LK+L+L     PW++M+++S LP LEV++LK+ AF       +WE+ E
Sbjct  723   FRLPRLVSFPPNLKKLTLSKTYLPWEDMTIISKLPKLEVLQLKNSAFVEAWSAERWEVTE  782

Query  466   EVFCQLKVMLIDIADLEQWEASSI--NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIEL  293
               F +LK +L++  DL+ W A+ I  NFP L+ +V++ CS+L++IP  F +  TLQ IEL
Sbjct  783   MGFPELKFVLLEKLDLKYWRAADIDDNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIEL  842

Query  292   WECNSSTYDSVDRIREEQEDSGNDGFTV  209
             W C+ S      +I+E  ED GN+   V
Sbjct  843   WGCSPSLVTFAKKIQENHEDLGNNMLKV  870



>emb|CDP19994.1| unnamed protein product [Coffea canephora]
Length=991

 Score =   148 bits (374),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/323 (35%), Positives = 168/323 (52%), Gaps = 28/323 (9%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNGA  959
             ++LRVLD+    F   FP E+  L  LRYLA+     N +P + + L RLQT +   N  
Sbjct  685   QLLRVLDLGELVFHAYFPVEVFLLAHLRYLALRTRGVNFIPAAIANLSRLQTFLLRGNAK  744

Query  958   CLILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYLSFG---  797
               +LP+  W +K LRH++   SS    FPV    +          P L  L  LS     
Sbjct  745   DCLLPKTIWDIKTLRHLWTTYSSAGFIFPVENLEVP---------PGLFHLDTLSLAIDP  795

Query  796   --SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP  623
                  ++ILT++P++++L  RE E          C  + +    CL +L+   T +  + 
Sbjct  796   SSQSLQKILTKLPSIRRLRCRETESTEK------CTGDGILGFDCLSRLESL-TLRSLVG  848

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                 FP +LK+L+L    +PW E+S +  LP LEV+KL  Y+F G +WE+ E  F +L+V
Sbjct  849   YGFKFPLNLKKLTLEVTDQPWSEISTIGKLPKLEVLKLLFYSFLGEEWEVKEGEFPKLRV  908

Query  442   M-LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             + L ++ D   W ASS NFP+L+ LV++ C  L E+P   GE  TL+ IE+  C  S   
Sbjct  909   LKLSNLWDFRSWTASSDNFPRLEKLVVERCLKLEEVPSCLGECPTLEMIEVRGCRESVAS  968

Query  265   SVDRIREEQEDSGNDGFTVRIHR  197
             SV +I++EQ D GN+   + I  
Sbjct  969   SVKQIQQEQRDMGNEALKISIEH  991



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score =   148 bits (373),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 163/328 (50%), Gaps = 26/328 (8%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIG--LFNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRV D+   +F RF  E   L  LRY+A        +P    EL  +QTLI     
Sbjct  565   GFPLLRVFDVESINFSRFSKEFFQLYHLRYIAFSSDTIKIIPKHIGELWNIQTLIINTQQ  624

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLP----KLQTLSYLSFGS  794
               L +    W M  LRH++   S+  PVP T       R   +P     LQTLS ++  S
Sbjct  625   RSLDIQANIWNMARLRHLHTNSSAKLPVPVT------PRSSKVPLVNQSLQTLSTIAPES  678

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRP  629
             C  E+  + PNLKKLG+R +    L   + +  L N+K L  LE LK         K   
Sbjct  679   CTEEVFARTPNLKKLGIRGKIAVLLEPNKSL--LKNVKKLEYLENLKLINDSSQTGKGLR  736

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP    FP  L++LSL      W +MS+L  L +LEV+KL +  F G  WE +   FC L
Sbjct  737   LPPSYIFPTKLRKLSLVDTWLEWNDMSILGQLEHLEVLKLIENGFMGECWESVGG-FCSL  795

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
              V+ I+  DL  W+AS+ +FP+L+ LVL  C  L+EIPIG  ++ + Q +EL     +  
Sbjct  796   LVLWIERTDLVSWKASADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAA  855

Query  268   DSVDRIREEQED------SGNDGFTVRI  203
              S   IR +++       + N+GF + I
Sbjct  856   ISARDIRAKKDKQTQKGTNNNNGFKLSI  883



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score =   147 bits (372),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 165/316 (52%), Gaps = 20/316 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F++L+VLD     F  F   I  L  LRY+     ND P S ++L  LQT+I +   
Sbjct  557   ISDFKLLKVLDAHAIGF-DFSRIIPQLVHLRYVD-ARVND-PSSLAKLFNLQTIIIYSQK  613

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               + LP E W M E++HV        P P       GE+   L  L TL+  S  +   +
Sbjct  614   KNVQLPTEIWTMSEIKHVDITDVD-MPNPP-----LGEQPLFLNNLHTLAVKS-SAVVLK  666

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP---SPDA  611
             IL   PNL KL + +             +L+ L VL  L  L          P   S D 
Sbjct  667   ILRSFPNLNKLKINDVRSTEWN-----AFLDCLLVLEGLVTLNIQAAASLNSPFFLSKDI  721

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVMLI  434
             F P+L +LSL     PW++M+VL+ LPNLEV+K  D AF G+ W+L E+V F +LK + +
Sbjct  722   FLPNLAKLSLNSTFFPWEDMAVLAKLPNLEVLK-ADNAFWGTDWKLDEDVVFPELKYLGV  780

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                +LE WEA+S NFP L+ L L +   L EIP   GE+ TL+SIE+ +CNS+   S ++
Sbjct  781   HHGNLEIWEATSDNFPMLEELNLSWLHFLEEIPESIGEIMTLRSIEIKDCNSAVITSAEQ  840

Query  253   IREEQEDSGNDGFTVR  206
             IRE QE  GN  F VR
Sbjct  841   IRENQEIYGNYEFQVR  856



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score =   147 bits (372),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 114/321 (36%), Positives = 160/321 (50%), Gaps = 12/321 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RF  E   L  LRY+A        +P +   L  +QTLI     
Sbjct  559   AFPLLRVLDAESIKFSRFSREFFKLFHLRYIAFSTDSIMTIPTNIGNLWNVQTLIIETQQ  618

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + W M  LRHV    S+  P P  +     + +     LQTLS ++   C  E
Sbjct  619   GTLDIKADIWNMTRLRHVCTNASATLPSP--KRPKSSKENLVNRCLQTLSTIAPECCTAE  676

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCFFT-----KQRPL  626
             + T+ PNLKKLG+R +        +D       +N+  L CLEKLK         KQ  L
Sbjct  677   VFTRTPNLKKLGVRGKIDALLETSKDGSSSGLFSNIGKLDCLEKLKLVNDTRQSRKQLHL  736

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P    FP  LK L+L      WK+MS+L  L  LEV+KLK+ AF+G  WE  +  F +L+
Sbjct  737   PPAYIFPQKLKTLTLIDTWFEWKDMSILGLLEYLEVLKLKENAFRGQSWETKDGGFPRLQ  796

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I+  DL  W+ASS NFP+L+ LVL  C +L E+P    +V  LQ +EL   + S   
Sbjct  797   VLWIERTDLSSWKASSGNFPRLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAAR  856

Query  265   SVDRIREEQEDSGNDGFTVRI  203
             S   I +++++    GF + +
Sbjct  857   SARAILKKKQEKVGSGFKLSL  877



>ref|XP_011087329.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=789

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 170/334 (51%), Gaps = 55/334 (16%)
 Frame = -3

Query  1171  SFIAFGRVQQ------LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             SF++ G   Q      ++ F +LRVLDI      +FP EIL L  LR+            
Sbjct  495   SFLSIGDASQEILSPLISTFRLLRVLDILGIKLDQFPGEILQLVNLRF------------  542

Query  1009  FSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD--  836
                           +   ++ PE    M +LRH+ FK             WY +++ +  
Sbjct  543   -------------SSNPHVVTPE-ILDMPQLRHIKFKGI---------YVWYDDKYREHF  579

Query  835   --LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLE  662
                 +LQ+LS +        +L  +PNL KLG+  +E         + ++ +L  LH L 
Sbjct  580   VVQDQLQSLSTILASGLNDRVLQTIPNLGKLGIFCDEK--------LDHVIDLSRLHNLH  631

Query  661   KLKCFFTK--QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKG  488
              L C  +K  +  L S   FP SLK+L L  C   +++MS++ +LPNL+++KL+   F+ 
Sbjct  632   TLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICYRDMSIIGSLPNLQILKLRGCEFEN  691

Query  487   SQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTL  308
              +WE IE  FC+LK ++++  +L  W A  I FP+L+ LV+++C+HL EIP G G++ TL
Sbjct  692   REWEPIEGDFCELKCLIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTL  751

Query  307   QSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             Q IE+ EC  S  DS   I+EEQE  GN+   VR
Sbjct  752   QVIEVHECKRSVLDSARMIQEEQESWGNEYLEVR  785



>gb|EYU24408.1| hypothetical protein MIMGU_mgv1a022062mg [Erythranthe guttata]
Length=740

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 172/337 (51%), Gaps = 37/337 (11%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR----  974
             L+  ++LR+LD     F  FP ++L L  LRYL++    +LP S S+L  L+ LI     
Sbjct  420   LDHSKLLRILDALTVHFYLFPIDVLKLVELRYLSLSYNQNLPSSISKLLNLECLIVSRPL  479

Query  973   --WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSF  800
                     L LP E W MK+L+HV F  S+  P P             LP L TLS +S 
Sbjct  480   SIISVEKPLCLPIEIWDMKKLKHVQFMGSNQLPNPSEGSY--------LPNLLTLSDMSA  531

Query  799   GSCAREILTQVPNlkklglreeegeylrdeq--LVCYLNNLKVLHCLEKLKCF-----FT  641
              SC + +L  +PNLKKLG++ E        Q    C+ +++  L  LE LKC      F 
Sbjct  532   RSCTKSVLESIPNLKKLGIQIELSPEAATNQEPSSCF-DHISHLEKLESLKCVVVNPSFN  590

Query  640   KQR----PLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL  473
               R    P P    FP  LK+LSL G   PW+EMS ++ LPNLEV+KL+  AF+G +W++
Sbjct  591   TTRIAVCPPPPLSVFPSGLKKLSLSGLGYPWEEMSKIALLPNLEVLKLRSCAFRGPKWDV  650

Query  472   IEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIEL  293
              +  F +L+ +LI+ +DL  W A + +FP L  L +K+C  L+ +P  F   + L  I++
Sbjct  651   EDNRFLRLEFILIEDSDLVHWTAGNRSFPYLDCLSIKHCYKLQVVPRQFS--FDLGKIQV  708

Query  292   WECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHNDE  182
              +C     +   ++ +           VR+H   +D+
Sbjct  709   VDCTPLVVNWAKKLTK---------IDVRVHSSWDDK  736



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score =   147 bits (371),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 164/317 (52%), Gaps = 19/317 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRVLD+   +F RF  E   L  LRY+A        LP    EL  +QT+I     
Sbjct  563   GFPLLRVLDVESINFSRFSKEFYQLYHLRYVAFSSDSIKILPKLMGELWNIQTIIINTQQ  622

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP----GTRMTWYGERHWDLPKLQTLSYLSFGS  794
               L +    W M+ LRH++   S+  PVP     +++T   +       LQTLS ++  S
Sbjct  623   RTLDIQANIWNMERLRHLHTNSSAKLPVPVAPKNSKVTLVNQ------SLQTLSTIAPES  676

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLK-----CFFTKQRP  629
             C  E+  + PNLKKLG+R +    L ++  V  L N+K L  LE LK        T +  
Sbjct  677   CTEEVFARTPNLKKLGIRGKIAVLLDNKSAVS-LKNVKRLEYLENLKLINDSSIQTGKLR  735

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP    FP  L++L+L      WK+MS+L  L +LEV+K+K+  F G  WE     FC L
Sbjct  736   LPPAYIFPTKLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKENGFTGESWESTGG-FCSL  794

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
              V+ I+  +L  W+AS+ +FP+L+ LVL  C +L+E+PI   ++ + Q + L     +  
Sbjct  795   LVLWIERTNLVTWKASADDFPRLKHLVLICCDYLKEVPIALADIRSFQVMMLQNSTKTAA  854

Query  268   DSVDRIREEQEDSGNDG  218
              S  +I+ ++++    G
Sbjct  855   ISARQIQAKKDNQTQQG  871



>ref|XP_009764269.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=903

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 189/373 (51%), Gaps = 25/373 (7%)
 Frame = -3

Query  1243  VSRLVFYSDVDWNDYKDLPKPSICSFI---AFGRVQQLNGFEMLRVLDIS-----FQSFM  1088
             V R   ++      + DL +     +I     G   +  GF+ LRVL +S     F+   
Sbjct  529   VPRFSLHAHFSLEKFSDLSQGVRSLYIFKQLLGPTGRTAGFKALRVL-VSIPRPIFKYRH  587

Query  1087  RFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI----RWCNGACLILPEETWKMKE  920
             R  S+      LRYL I   ND   S   L  LQT I    +    A + LP+  W MK+
Sbjct  588   RLTSDS---AFLRYLEIHRGNDFTESLPYLYNLQTFIFKHDKLKCDAVITLPDYIWNMKQ  644

Query  919   LRHVYFKKSSHFPVP---GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkkl  749
             LR+++ +   H P P    +      +    L  LQ  S L F SC +E+L+ + NLKKL
Sbjct  645   LRYIHIQHCIHLPNPQSISSANVVDSKSDLGLQHLQEFSRLCFASCTKEVLSCLTNLKKL  704

Query  748   glreeegeylrdeqLVCYLNNLKVLHCLEKL--KC-FFTKQRPLPSPDAFPPSLKQLSLR  578
              +   + +    E     L NL  L  LE L   C  +    PL    +FP SLK+L++ 
Sbjct  705   RIANIQEDINGLEGTPGSLFNLVYLKKLESLYLSCEMWELSSPLADSCSFPISLKRLTIF  764

Query  577   GCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLK-VMLIDIADLEQWEA  404
               +   ++M+VL+ LPNLEV+KL+   F+ S W+L  E+ F QLK ++L+D   ++QWEA
Sbjct  765   SARLSCEDMTVLAKLPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLLLVDNTYIKQWEA  824

Query  403   SSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQED-SG  227
             SS+NFP L+ LVL    +L+ IP+ F E+ TL+SIEL+ C  +   S   I+EE    +G
Sbjct  825   SSVNFPNLRRLVLHQIRNLKRIPLAFAEICTLESIELYMCPWNLEKSAKEIQEEVSSIAG  884

Query  226   NDGFTVRIHRGHN  188
             ND   + I+  ++
Sbjct  885   NDCLHIGIYNDYH  897



>ref|XP_009763530.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763531.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1734

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 114/321 (36%), Positives = 168/321 (52%), Gaps = 10/321 (3%)
 Frame = -3

Query  1138  NGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCN  965
             N F++++VL++ SF     FPSEI  L  LRY A     N +P S S+L  L+T +    
Sbjct  1406  NSFKLVKVLNLESFNIGGTFPSEIQSLIHLRYFAAQTDGNSIPSSISKLWNLETFVVKGL  1465

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS--YLSFGSC  791
             G  +ILP    KM +LRH++ K  + F +         +   D   L+T S  +L +G  
Sbjct  1466  GVEVILPSSLLKMVKLRHIHVKDRASFSLYENMGESLADSQLD--NLETFSTPHLFYGED  1523

Query  790   AREILTQVPNlkklg-lreeegeylrdeqLVCYL-NNLKVLHCLEKLKCFFTK-QRPLPS  620
                IL ++P L+KL  +      Y +     C L   L+ L  LE LK         LP 
Sbjct  1524  TEMILRKMPKLRKLSCIFSGTFGYSKIVTGKCVLFPRLEFLSHLESLKLVSNSCPAKLPH  1583

Query  619   PDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM  440
               +FP  L++L+L   + PW ++S ++ LPNLE++KL   AF+G +WE+ +  F +LK +
Sbjct  1584  VFSFPSRLRELTLSKFRLPWNQISTIAELPNLEILKLFLRAFEGDEWEVKDSEFPELKYL  1643

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
              +D  ++ QW  S   FP L+  VLK C  L+EIP  F    +L+ IE+  C+ S  +S 
Sbjct  1644  ELDDLNITQWSVSEDAFPMLEHFVLKKCKQLKEIPSQFDYAISLRRIEVNWCSWSVANSA  1703

Query  259   DRI-REEQEDSGNDGFTVRIH  200
               I R +QED  ND FTV IH
Sbjct  1704  MEIQRTQQEDLSNDAFTVTIH  1724



>gb|EYU22232.1| hypothetical protein MIMGU_mgv1a002671mg [Erythranthe guttata]
Length=648

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/362 (33%), Positives = 179/362 (49%), Gaps = 33/362 (9%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQL----------NGFEMLRVLDISFQSFM  1088
             RL  +SDV     +    P + SF+ F + +              F++LRVLD+    F 
Sbjct  282   RLCIHSDVLKFLSRKPFGPRVRSFVCFSKEEVTLPTDSSSAIPAAFKLLRVLDVKPIKFT  341

Query  1087  RFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRH  911
             +  S++  L  LRY+ +    + LP +FS+L  +QTL+       L +  + WKM +LRH
Sbjct  342   KIHSDMYQLVHLRYVTLSFNLSILPAAFSKLWNIQTLVVDTTSRTLEIKADIWKMIQLRH  401

Query  910   VYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreee  731
             +    S+  P  G + +  GE      KLQTL  +S  SC  E+  +  NLK+LG+R   
Sbjct  402   LKTNASAVLPKTG-KSSKEGE------KLQTLGTISPQSCTEEVFDRARNLKRLGIRGRL  454

Query  730   geylrdeqLVCYLNNLKVLHCLEKLKCFF---------TKQRPLPSPDAFPPSLKQLSLR  578
                +  +  V   ++L  L  LEKLK             + R LP P  FPP L+ L+L 
Sbjct  455   ASLIEGK--VGSFDSLGKLGNLEKLKLLNDVFPNPPSEGQLRGLPQPYKFPPKLRSLTLA  512

Query  577   GCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASS  398
                  W  MS++  L NLEV+KLK+ AF G  W   +  F  L+V+ I   DL  W AS 
Sbjct  513   DTFLDWCHMSIIGLLENLEVLKLKEKAFVGKSWVAADGGFRCLEVLHIGRTDLVVWVASG  572

Query  397   INFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD----RIREEQEDS  230
              +FP+L+ L L YC  L+E+PIG  ++ TLQ ++L+    +   +      R R++ E++
Sbjct  573   HHFPRLRRLELHYCEELQEVPIGLADIPTLQLLDLYRSKFAAAPAKKIQEARSRKQAEET  632

Query  229   GN  224
              N
Sbjct  633   SN  634



>emb|CDP12800.1| unnamed protein product [Coffea canephora]
Length=1162

 Score =   146 bits (369),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 169/322 (52%), Gaps = 26/322 (8%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMR--FPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQT-LIRWCN  965
             F++LRVLD+    F+   FP E+  L  LRYLAI G  N +P +   L RL+T L+R C 
Sbjct  855   FKLLRVLDLGEPFFVATCFPKEVTWLVHLRYLAIHGHINYIPSAIGNLSRLETFLVRGCI  914

Query  964   GACLILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYL---S  803
              A ++LP   W +K LRH+Y  +S     FP+         E   DL  L TL+     S
Sbjct  915   -ADVLLPNTIWNIKTLRHLYITRSEKGFSFPIDSKL-----EDRLDLKNLATLALAIDPS  968

Query  802   FGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP  623
             F  C ++ILT++P+++K+                   N + VL  L +L+    +   + 
Sbjct  969   F-QCLQKILTKLPSIRKIRCTPLGSRESTGNH-----NGILVLDYLSQLESLNVRGF-VG  1021

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                 FP +LK+L+L    +PW E+SV+  LPNLEV+KL+  +F G +WE+ E  FC+L+ 
Sbjct  1022  YEFEFPLNLKKLTLSSNHQPWSEISVIGKLPNLEVLKLESSSFVGEKWEMKEGEFCRLRF  1081

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             + + + D+  W ASS NF  L+ L+L  C HL E+P   GE+ TL+ IE   C  S    
Sbjct  1082  LKLLLLDIRIWTASSDNFSCLEKLILHICPHLEEVPSCLGEIPTLEMIEAKSCPESALSY  1141

Query  262   VDRIREEQEDSGNDGFTVRIHR  197
             V +I+ E    GN+   +   R
Sbjct  1142  VKQIQMEM---GNEDLKIVTER  1160



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 116/321 (36%), Positives = 155/321 (48%), Gaps = 19/321 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRVLD     F RFP E   L  LRY+A        +P +   L  +QTLI     
Sbjct  559   AFPLLRVLDAESIKFSRFPKEFFKLFHLRYMAFSTDSIMTIPSNIGNLWNVQTLIIETQQ  618

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + W M  LRHV    S+  P P    +     H+    LQTLS ++   C  E
Sbjct  619   GTLDIKADIWNMTTLRHVCTNASAILPSPKHSKSRKEVNHY----LQTLSTIAPECCTAE  674

Query  781   ILTQVPNlkklglreeege---ylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRPL  626
             I T+ PNLKKLG+R +        +D        N+  L CLE LK         KQ  L
Sbjct  675   IFTRTPNLKKLGVRGKIAALLETSKDGSGSGLFGNIGKLDCLENLKLVNDTRQSGKQLHL  734

Query  625   PSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLK  446
             P    FP  LK+L+L      WK+MS+L  L  LEV+KLK  AF+G  WE  +  F  L+
Sbjct  735   PPAYIFPQKLKKLTLIDTWFEWKDMSILGLLEYLEVLKLKQNAFRGQSWEPEDGGFPCLQ  794

Query  445   VMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             V+ I+  DL  W+ASS NFP+L+ LVL  C  L E+P    +  +LQ +EL   + S   
Sbjct  795   VLWIERTDLSSWKASSGNFPQLKRLVLISCDKLEELPAALADAQSLQLMELHYTSESAAK  854

Query  265   SV-----DRIREEQEDSGNDG  218
             S       R+R+E+  +   G
Sbjct  855   SARVILKRRLRKEEGSTNRCG  875



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/317 (34%), Positives = 163/317 (51%), Gaps = 19/317 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRVLD+   +F RF  E   L  LRY+A        LP    EL  +QT+I     
Sbjct  562   GFPLLRVLDVESINFSRFSREFYQLYHLRYVAFSSDSIKILPKLMGELWNIQTIIINTQQ  621

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP----GTRMTWYGERHWDLPKLQTLSYLSFGS  794
               L +    W M+ LRH++   S+  PVP     +++T   +       LQTLS ++  S
Sbjct  622   RTLDIQANIWNMERLRHLHTNSSAKLPVPVAPKNSKVTLVNQ------SLQTLSTIAPES  675

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLK-----CFFTKQRP  629
             C  E+  + PNLKKLG+R +    L ++     L N+K L  LE LK        T +  
Sbjct  676   CTEEVFARTPNLKKLGIRGKISVLLDNKS-AASLKNVKRLEYLENLKLINDSSIQTSKLR  734

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP    FP  L++L+L      WK+MS+L  L +LEV+K+K+  F G  WE     FC L
Sbjct  735   LPPAYIFPTKLRKLTLLDTWLEWKDMSILGQLEHLEVLKMKENGFSGESWESTGG-FCSL  793

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
              V+ I+  +L  W+AS+ +FP+L+ LVL  C +L+E+PI   ++ + Q + L     +  
Sbjct  794   LVLWIERTNLVSWKASADDFPRLKHLVLICCDNLKEVPIALADIRSFQVMMLQNSTKTAA  853

Query  268   DSVDRIREEQEDSGNDG  218
              S  +I+ ++++    G
Sbjct  854   ISARQIQAKKDNQTQQG  870



>ref|XP_011101277.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101278.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101279.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101280.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101281.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 113/328 (34%), Positives = 164/328 (50%), Gaps = 27/328 (8%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRW------  971
             F +LRVLD     F  FP E++ L  LRYLA     +LP S S+L  LQ LI        
Sbjct  552   FSLLRVLDALTIRFHEFPIEVVKLVQLRYLAFTYNKELPTSISKLLNLQYLIVHQFLSII  611

Query  970   CNGACL-ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
               GA    LP E W M+ELRH+   +S   P+P +    +       P L TLS +S  S
Sbjct  612   SPGAHRSYLPMEIWNMRELRHLEVMRSD-LPIPSSEDALF-------PNLSTLSGISTRS  663

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLN---NLKVLHCLEKLKCF-FTKQRPL  626
             C +E+L ++PNLKKL ++ EE     +   +C L+    +K       +K   F    P+
Sbjct  664   CTKEVLKRIPNLKKLRIQIEEAPGAAES--LCSLDVDQGIKWFGFQRGIKSLGFVIINPV  721

Query  625   PSPD------AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE  464
             P P       + P  L++LSL G   PWK+  V+  L +LEV+KLK+YAF+G +W     
Sbjct  722   PKPQIAAPIKSLPSGLRKLSLSGLGCPWKDARVIGKLWHLEVLKLKNYAFQGPEWITDSF  781

Query  463   VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWEC  284
              F  LKV L++  DL  W     +F  ++ L++++C  L EIP+  G    L+ +EL + 
Sbjct  782   QFKSLKVFLLEDTDLRHWRKGEGSFISIRHLIIRHCYKLEEIPLEIGIYPALERVELVDV  841

Query  283   NSSTYDSVDRIREEQEDSGNDGFTVRIH  200
               S   S D+I + +  +      V IH
Sbjct  842   KPSVVASADKILQLRTQNNMGNIQVSIH  869



>emb|CDP19634.1| unnamed protein product [Coffea canephora]
Length=1229

 Score =   146 bits (368),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 118/339 (35%), Positives = 173/339 (51%), Gaps = 25/339 (7%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLNGF---EMLRVLDISFQSF-MRFPSEILCLKILRYLAIGL--FND  1022
             P++ S + F   ++  GF   ++LRVLD+    F   FP E+L L  LRYLAI     + 
Sbjct  889   PNVRSLLLFK--EEDLGFWFPKLLRVLDLGELEFGAYFPEEVLLLAHLRYLAIRTTEVSF  946

Query  1021  LPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERH  842
             +P + + L RLQTL+   N    +LP+  W +K LRH++       P PG    +  E  
Sbjct  947   IPAAIANLSRLQTLLLRGNTCDCLLPKTIWNIKTLRHLWITD----PYPG--FIFPVENL  1000

Query  841   WDLPKLQTLSYLSFG-----SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
                P L  L  L+          ++ILT++PN+++L     E            L     
Sbjct  1001  EVSPGLDHLDSLNLAIDPSSQSLQKILTKLPNIRRLRCNMREPREEPARIGDRILG-FDC  1059

Query  676   LHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYA  497
             L  LE L   F           FP +LK+L+L    +PW E+S +  LP LEV+KL  Y+
Sbjct  1060  LSKLESLALLFFDGYGF----KFPLNLKKLTLEENAQPWSEISTIGKLPKLEVLKLFCYS  1115

Query  496   FKGSQWELIEEVFCQLKVM-LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGE  320
             F G +WE+ E  F +L+V+ L ++ DL  W ASS NFP+L+ LV+  C HL E+P   G+
Sbjct  1116  FVGDEWEMKEGEFPKLRVLKLSNLMDLRSWTASSDNFPRLEKLVVHGCVHLEEVPSCLGD  1175

Query  319   VYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
               TL+ IE+  C  S   SV +I++EQ D GN+   + I
Sbjct  1176  CPTLEMIEVRGCRESVASSVKQIQQEQIDMGNEVLKILI  1214



>gb|ABJ99598.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=895

 Score =   145 bits (366),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 171/322 (53%), Gaps = 15/322 (5%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTL-IRWCNG  962
              F++LR+LD++   F RFP E+L L  LRY+++ + F  LPP  S+L  +Q L I+  +G
Sbjct  566   AFQLLRILDVTSIIFERFPKELLRLVQLRYISMAITFTVLPPDMSKLWNMQILMIKAISG  625

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               L +  + WKM +LRH++   S++F +  +  T   + H     ++TL+ +S  SC  +
Sbjct  626   NSLDIRADIWKMFQLRHLHTNVSANFVMRPSSKT-KKQNHQGPSHIKTLTSISADSCTSK  684

Query  781   ILTQVPNlkklglreeegeylr--deqLVCYLNNLKVLHCLEKLKCFF-------TKQRP  629
             +L ++P + KLG   +  E +       V     L  +  LE LK +        +K   
Sbjct  685   LLARIPTVTKLGHSRKLEELIMPPQGGGVSTFEALANMKYLETLKFYGDVSSNARSKISH  744

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
              P  + FPP+L+ L++      W+   +L  LPNL ++KLK+ AF G  W+  ++ F  L
Sbjct  745   FPGHNKFPPNLRNLTITDTMLSWEHTDILGMLPNLVMLKLKENAFMGEYWKPKDDGFRTL  804

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             +V  +   +L++WEAS+ +FP L+ L+LK+C  L  +     ++ TLQ I++   N    
Sbjct  805   EVFYLGRTNLQKWEASNYHFPSLKKLILKFCDRLEGLSSSLADISTLQLIDIHMANPVVA  864

Query  268   DSVDRIREEQEDSGNDGFTVRI  203
                   R+ Q+++   G +V++
Sbjct  865   ACA---RQIQKNNNGIGRSVQV  883



>ref|XP_011102162.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=997

 Score =   145 bits (367),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 153/304 (50%), Gaps = 23/304 (8%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI-RWC---  968
             GF +LRVLD     F  FP E++ L  LRYLA      LP S S L  LQ LI R C   
Sbjct  677   GFSLLRVLDALTVRFYEFPIEVVKLIKLRYLAFTYNGKLPASISNLRYLQYLIVRQCLRI  736

Query  967   ---NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
                      LP E W MKELRH+        P P +   +       L  L TL  +S  
Sbjct  737   LSSEARQSYLPMEIWDMKELRHLQVM-GRDLPDPTSNDAF-------LLNLSTLLGVSAH  788

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR-----  632
             SC  ++  ++PNL KLG++ E    + +   +C    L  LH LE LK            
Sbjct  789   SCTYKVFERIPNLIKLGVQMELAPDVDEP--LCCFELLASLHKLESLKWSVVNPNLQLLV  846

Query  631   PLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQ  452
             P  S   FPP LK+L+L G   PW+ MS ++ L NLEV+KL+ YAF+G  W     +F +
Sbjct  847   PAASVPIFPPGLKKLTLSGLGFPWEYMSTIARLENLEVLKLQCYAFQGQVWNTKLSIFSK  906

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             L+ +LI+  DLE W   S  FP L+ L+L++C  L+EI    G++  L+ IEL +CN S 
Sbjct  907   LRFLLIEDTDLEDWYVKSW-FPSLERLILRHCYKLKEISKEIGDIVCLEMIELDDCNPSL  965

Query  271   YDSV  260
               S 
Sbjct  966   VAST  969



>ref|XP_010677242.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010677243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score =   145 bits (367),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 114/327 (35%), Positives = 174/327 (53%), Gaps = 18/327 (6%)
 Frame = -3

Query  1162  AFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQ  986
              F R    NG ++L VLD+   S M  P+ I  L +L+YLA+ G F  +P S   L  L+
Sbjct  837   GFDRSYIYNGLKLLNVLDLESISIMFVPNNINGLILLKYLAVRGEFESIPLSIGSLWNLE  896

Query  985   TLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYL  806
             TLI      CL  PE    M +L+H+  K         T  + Y  +  +L  +QTL  +
Sbjct  897   TLIVKAPLTCL--PEAILGMMKLKHLLIKSKK-----ATLASLYNHQALNLETVQTLGTV  949

Query  805   SFGSCA-REILTQVPNlkklglreeegeylrde--qLVCYLNNLKVLHCLEKLKCFFTKQ  635
                S   +E LT   N++++     E +   +     + +LN+L++LH     +  +  +
Sbjct  950   YINSPEDKEALTNFQNVREMKCFFSEIKIGSEYCFHALDFLNHLEILHL--SYRKSWRDR  1007

Query  634   RPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLS-ALPNLEVVKLKDYAFKGSQWEL-IEEV  461
             +   +  +FPPSLKQL+L     PWK+MSVL+ ++P LEV+KL + AF+G Q ++  +EV
Sbjct  1008  KNKAATLSFPPSLKQLTLSEFCLPWKQMSVLAKSMPKLEVLKLVNIAFEGEQCDMDTDEV  1067

Query  460   -FCQLKVMLIDIADLEQW--EASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELW  290
              F +LK   +   ++  W    S+  FPKL+ LV+KYC  LR+IP  F +   L+ I L 
Sbjct  1068  EFSELKFFKLKGINIHNWIISCSADAFPKLECLVIKYCDKLRKIPSSFVDNKKLRLILLE  1127

Query  289   ECNSSTYDSVDRIREEQEDSGNDGFTV  209
              C SS   S ++I+EEQ+D GN  F V
Sbjct  1128  GCKSSVEKSANQIKEEQQDYGNKNFEV  1154



>emb|CDP00590.1| unnamed protein product [Coffea canephora]
Length=899

 Score =   145 bits (365),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 159/320 (50%), Gaps = 18/320 (6%)
 Frame = -3

Query  1204  DYKDLPKPS---ICSFIAFGRVQQL----------NGFEMLRVLDISFQSFMRFPSEILC  1064
             DY   P PS   + SF+ F + +              F++LRVL++   +F RFP ++  
Sbjct  533   DYISRPTPSGKCVRSFLTFAKEETTVEPKHVSAIPKTFKLLRVLEVQSLTFTRFPPDLCH  592

Query  1063  LKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSH  887
             L +L+Y+A     + LPP+ S +C +QTLI       L +  + W+M +LRH++   S+ 
Sbjct  593   LVLLKYVAFSCNISVLPPAMSTMCNMQTLIVNTTSRILEIKADIWRMPQLRHLHTNASTL  652

Query  886   FPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeq  707
              P P  +     E       L TL  +S  SC  E+  +   LKKLG+R +  +      
Sbjct  653   LPCPDNKNQRSKEEALIGENLLTLHTVSPESCKEEVFERTTRLKKLGIRGKLAKLFEITG  712

Query  706   LVCYLNNLKVLHCLEKLKCF----FTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLS  539
                    L+ L  LE LK       ++   LPS  +FP  L +L+L      W EMS L 
Sbjct  713   ESSLFGYLRKLDSLENLKLLNDDISSRLFGLPSHKSFPRELTKLTLLNTLLDWSEMSTLG  772

Query  538   ALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKY  359
              L NLEV+KLKD AFKG  W+  +  F +LK + I   DL  WEAS   FPKL+SLVL+ 
Sbjct  773   KLENLEVLKLKDNAFKGRLWQTEKGGFLRLKFLHIGRTDLVVWEASVDQFPKLKSLVLRN  832

Query  358   CSHLREIPIGFGEVYTLQSI  299
             C  LR  P    ++ +LQ +
Sbjct  833   CDKLRAFPHDLADIPSLQMV  852



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 119/304 (39%), Positives = 161/304 (53%), Gaps = 30/304 (10%)
 Frame = -3

Query  1054  LRYLAIGLFNDLPPSFSELCRLQTLIRWCNG--ACLILPE----ETWKMKELRHVYFKKS  893
             LRYLA   F  L  S  +L  LQ L+       A LI  +    E   M +LRH++ K  
Sbjct  103   LRYLACPSFGGLVQSICKLRNLQNLVIHDVSLFASLITTQSLAWEVLNMPQLRHIHTKNF  162

Query  892   SHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrd  713
             S F    T +    E H     L T++ L   SC  E+  ++PNLKKLG+  +   Y   
Sbjct  163   SLFIPRPTSLIAERENH-----LLTITGLIPSSCNDEVFLRIPNLKKLGILIDVASYPIR  217

Query  712   eqLVCYLNNLKVLHCLEKLKC-----FFTKQRPL-------PSPDAFPPSLKQLSLRGCQ  569
                   L+NL  L  LEKLK      F     P+       P  D FPP+LK+L+L    
Sbjct  218   NC----LDNLVHLTQLEKLKVVVREPFLLIFTPIIEGWMDIPHCDNFPPNLKKLTLCRTN  273

Query  568   RPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI---EEVFCQLKVMLIDIADLEQWEASS  398
               W++M++L  LPNLEV+KLKDYAF+G  W+L    E+ F +LK +L++   L QWEA+S
Sbjct  274   LQWEDMNILRKLPNLEVLKLKDYAFRGLTWKLSDVDEDGFLKLKFLLLESLHLMQWEATS  333

Query  397   INFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDG  218
              +FP L+  VL  C +L +IP  F E+ TLQ IEL EC  S   S ++I+EEQ+  GND 
Sbjct  334   YHFPSLEHFVLTNCRYLEKIPFDFAEIQTLQLIELHECMRSVLVSAEQIQEEQQSFGNDD  393

Query  217   FTVR  206
               +R
Sbjct  394   LIIR  397



>ref|XP_010319427.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 110/309 (36%), Positives = 163/309 (53%), Gaps = 12/309 (4%)
 Frame = -3

Query  1093  FMRFPSEILCLKILRYLAIG-LFNDLPPSFSELCRLQTLIRWCNGAC-LILPEETWKMKE  920
             F  FP  I  L  LRYL +  L  ++P S SEL  LQTLI  C+    + LP++ W MK 
Sbjct  4     FDSFPLVITKLFHLRYLHVERLSMNIPESISELLNLQTLISSCSPLFRMTLPKKIWLMKN  63

Query  919   LRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglr  740
             L+++   ++++ P P             +P L+    L + SC  E+ + +PNLK L + 
Sbjct  64    LKYISLGRNTYLPSPRINKNLVTV----MPNLEKFFGLCYSSCTNEVFSSIPNLKILTIH  119

Query  739   eeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD-AFPPSLKQLSLRGCQR-  566
                              ++  L  LE  K F+ K    P     FP SL++L+L  C + 
Sbjct  120   VPLTFKEEIIPY--RFLDMSSLIKLEAFKLFWDKNWENPIKTFVFPTSLRRLTLTFCSKF  177

Query  565   PWKEMS-VLSALPNLEVVKLKDYAFKGSQWELIE-EVFCQLKVMLIDIADLEQWEASSIN  392
              W+E+S     LPNLE +KLK        W + + ++F  LK++L+   +L++WEASS N
Sbjct  178   IWEEISSTFIMLPNLEKLKLKYCGADDDAWIMSDKDIFKSLKLLLLSHLNLKRWEASSDN  237

Query  391   FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFT  212
             FP L+ LVLK C  L+EIP  FGE+ TL+SIEL +C++++  S   I +EQED  N+   
Sbjct  238   FPNLKRLVLKKCPDLQEIPTDFGEICTLESIELHDCSATSEVSARNIEQEQEDMENNILK  297

Query  211   VRIHRGHND  185
             V IH  H +
Sbjct  298   VYIHNSHRN  306



>emb|CDP12770.1| unnamed protein product [Coffea canephora]
Length=811

 Score =   144 bits (364),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 112/327 (34%), Positives = 170/327 (52%), Gaps = 40/327 (12%)
 Frame = -3

Query  1129  EMLRVLDIS---FQSFMRFPSEILCLKILRYLAI--GLFNDLPPSFSELCRLQTLIRWCN  965
             ++LRVLD+    F+++  FP  +L L  LRYLA+   L + +P + + L RLQT +   N
Sbjct  501   KLLRVLDLGELVFRAY--FPMGVLLLVHLRYLALRLHLIDSIPAAIANLSRLQTFLLRGN  558

Query  964   GACLILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYLSFG-  797
                 +LP+  W +K LRH++   S+    FPV    ++         P L  L  LS   
Sbjct  559   DIDCLLPKTIWNIKTLRHLWTTNSAIGFIFPVENLEVS---------PGLIHLDTLSLAI  609

Query  796   ----SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKC----FFT  641
                    ++ILT++PN++ L  +  E             N + V  CL +L+     FF 
Sbjct  610   DPSSQSLQKILTKLPNIRMLRCKMTESREEHTG------NGILVFDCLSQLESLTLLFFD  663

Query  640   KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
                       FP +LK+L+L   ++PW E+S +  LP LEV+KL D  F G +WE+ E  
Sbjct  664   GY-----GFKFPLNLKKLTLVYNKQPWSEISTIGKLPKLEVLKLLDGFFVGEEWEMKEGE  718

Query  460   FCQLKVM-LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWEC  284
             F  L+V+ L ++     W ASS NFP+LQ LV+  C +L E+P   GE  TL+ IE+  C
Sbjct  719   FPSLRVLQLSNLWKFRSWTASSDNFPRLQKLVVHNCENLEEVPSCLGECPTLEMIEVKWC  778

Query  283   NSSTYDSVDRIREEQEDSGNDGFTVRI  203
              +S  +SV +I++EQ D GN+   + I
Sbjct  779   RTSVANSVKQIQQEQIDMGNEVLKISI  805



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score =   144 bits (364),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 157/322 (49%), Gaps = 50/322 (16%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL-FND------LPPSFSELCRLQTLI  977
              F +LRV+D        +P +I  L  LRYLA    + D      +P SFS+L  L+TLI
Sbjct  538   SFSLLRVVDALSVILDFYPDDIFELFHLRYLAFTFDYTDKRHHYEIPKSFSKLENLRTLI  597

Query  976   -RWCNG-----ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTL  815
              R  NG         +P E W+M +LRH+        P P +           L  LQTL
Sbjct  598   IRQFNGFYGFRTTCCMPFEIWRMTQLRHLILL-DGFLPDPCSETCL---ETLALENLQTL  653

Query  814   SYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFT--  641
             S +                              +    C LNNL  LH LE+LK      
Sbjct  654   SNIQ----------------------------EEWSKYC-LNNLVHLHKLEELKFHAMPH  684

Query  640   --KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIE  467
                +  L     FP ++K+L+L GC  PW+ M+++ +LPNLEV+KLK  AF+G +WE  E
Sbjct  685   DYHRSDLSRNLVFPLTMKKLTLSGCNLPWESMTIVGSLPNLEVLKLKKGAFRGLKWETTE  744

Query  466   EVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWE  287
               FC+LKV+++D  D   W   S +FP L+ LVL+ C  L EIP    E+ TL+ I++  
Sbjct  745   GEFCRLKVLVMDRTDPRIWITESSHFPTLEVLVLRKCYTLSEIPYSICEIQTLEQIKVDC  804

Query  286   CNSSTYDSVDRIREEQEDSGND  221
             CNSS  +S  RI+EE +  GN+
Sbjct  805   CNSSIGESAKRIQEEVQSFGNE  826



>ref|XP_009589795.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=903

 Score =   144 bits (364),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 165/302 (55%), Gaps = 13/302 (4%)
 Frame = -3

Query  1054  LRYLAIGLFNDLPPSFSELCRLQTLI----RWCNGACLILPEETWKMKELRHVYFKKSSH  887
             LRYL I   NDL  S   L  LQT I    +    A L LP+  W MK+LR+++ +   H
Sbjct  596   LRYLEIRRGNDLTESLPYLYNLQTFIFKHDKLKCDAVLTLPDYIWNMKQLRYIHIQHCIH  655

Query  886   FPVPGTRMTWYGE---RHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylr  716
              P P +  +   E       L  LQ  S L F SC +E+L+ + NLKKL +   + +   
Sbjct  656   LPNPQSISSTNVEDSRSDLGLQHLQEFSRLCFASCTKEVLSCLTNLKKLRIANIQEDING  715

Query  715   deqLVCYLNNLKVLHCLEKL--KC-FFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSV  545
              E     L NL  L  LE L   C  +    PL    +FP SLK+L++   +   ++M+V
Sbjct  716   LEGTPGSLINLVYLKKLESLYLSCEMWELSSPLADSCSFPISLKRLTIFSGRLSCEDMTV  775

Query  544   LSALPNLEVVKLKDYAFKGSQWEL-IEEVFCQLK-VMLIDIADLEQWEASSINFPKLQSL  371
             L+ LPNLEV+KL+   F+ S W+L  E+ F QLK ++L+D   ++QWEASS+ FP L+ L
Sbjct  776   LAKLPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLLLVDNTYIKQWEASSVYFPNLRRL  835

Query  370   VLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQED-SGNDGFTVRIHRG  194
             VL    +L+ IP+ F E+ TL+SIEL+ C+ +   S   I+EE    +GND   + I+  
Sbjct  836   VLHQIRNLKRIPLAFAEICTLESIELYMCSRNLEKSAREIQEEVSSVAGNDCLHIGIYND  895

Query  193   HN  188
             ++
Sbjct  896   YH  897



>gb|EYU22216.1| hypothetical protein MIMGU_mgv1a019937mg [Erythranthe guttata]
Length=868

 Score =   144 bits (364),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 117/359 (33%), Positives = 180/359 (50%), Gaps = 38/359 (11%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLN-----GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDL  1019
             P   S + +G  QQ       GF +L+VLD     F  FP +++ L  LRYLAI  + ++
Sbjct  517   PCARSLLCYGPKQQYPVVSYFGFRLLKVLDAVSIRFYEFPHQVVELVHLRYLAITYYGEI  576

Query  1018  PPSFSELCRLQTLI-RWCNGAC------LILPEETWKMKELRHVYFKKSSHFPVPGTRMT  860
             P S S L  L+ LI  W +         + LP E WK+ +L+H+   +   F +P     
Sbjct  577   PSSVSRLSNLEVLIIHWHHRVIKSSNFPVYLPVEIWKLHKLKHL---ECMGFDLPDPSPA  633

Query  859   WYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylr----deqLVCYL  692
                +    L KL TLS +   SC   +L ++PNL KLG+R +     +     E   CY 
Sbjct  634   --NDDSLILEKLLTLSGVGAHSCTERVLIRIPNLIKLGIRIDSSLDEKFNFLGEFASCYD  691

Query  691   NNLKVLHCLEKLKCFFT-----KQRPLPSPD-AFPPSLKQLSLRGCQRPWKEMSVLSALP  530
                      +  KC        + R + SP   FP +++++SL GC   W+ M V+  LP
Sbjct  692   E-------FDSFKCIVVDDPGIRSRFVSSPVLNFPANIRKISLSGCGFQWRSMGVIGELP  744

Query  529   NLEVVKLKDYAFKGSQWELI---EEVFCQLKVMLIDIADLEQWEASS-INFPKLQSLVLK  362
             NLEV+KL+  AF G++WE+     E+F +LK +L++  D+E WE +S   F +L  LV++
Sbjct  745   NLEVLKLRWCAFSGAEWEIAGGEGELFPRLKFLLMEDLDVEVWETNSGGGFRRLSRLVIR  804

Query  361   YCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGHND  185
             +C  L+EIP G  +   L+ IE+ +C+SS  +S   I   + D  ND   +R+     D
Sbjct  805   HCYKLKEIPRGIADSAALEVIEVDDCSSSLANSARGIYMAKHDWVNDHVKIRVRSSWED  863



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   145 bits (365),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 109/335 (33%), Positives = 169/335 (50%), Gaps = 18/335 (5%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLNGF-EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGL--FNDLP  1016
             P++ S + F +     G  E+LRVLD+    F+  FP E+  L  LRYLA+       +P
Sbjct  921   PNVRSLLLFKKDDLGFGLPELLRVLDLGELEFVAYFPMEVFLLVHLRYLALRTRGVKFIP  980

Query  1015  PSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVY-----FKKSSHFPVPGTRMTWYG  851
              + + L RLQT +   N    +LP   W +K LRH+      F     FPV    ++  G
Sbjct  981   AAIANLSRLQTFLLRGNDIDCLLPNTIWSIKTLRHLLTPNFGFISGFIFPVENLEVS-PG  1039

Query  850   ERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLH  671
               H D   L  +   S     ++ILT++P++++L  R             C  N +    
Sbjct  1040  LFHLDTLSL-AIDPSSPSQSLQKILTKLPSIRRLRCRVTASREK------CTGNGILGFD  1092

Query  670   CLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFK  491
             CL +L+    +   +     FP +LK+LSL   ++PW E+S +  LP LEV+KL   +  
Sbjct  1093  CLSRLESLALRS-FVGYGFKFPLNLKKLSLSCNKQPWVEISTIGKLPKLEVLKLLTDSVV  1151

Query  490   GSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYT  311
             G +WE+ E  F  L+++ +   D  +W ASS NFP+L+ LV+ +C  L E+P   GE   
Sbjct  1152  GKEWEMTEGEFPTLRILKLRDLDFRRWTASSDNFPRLEKLVVHWCRELEEVPFCLGECQA  1211

Query  310   LQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVR  206
             L+ IE+  C  S  +SV +I++EQ D GN+   +R
Sbjct  1212  LEMIEVRGCRESVANSVKQIQQEQRDMGNEALILR  1246



>emb|CDP18675.1| unnamed protein product [Coffea canephora]
Length=1241

 Score =   144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 167/321 (52%), Gaps = 26/321 (8%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNGA  959
             E+LRVLD+    F+  FP E+  L  LRYLA+     N +P + + L RLQT +   N +
Sbjct  929   ELLRVLDLGELEFVAYFPMEVFLLAHLRYLALRTRGVNFIPAAIASLSRLQTFLLRGNAS  988

Query  958   CLILPEETWKMKELRHV---YFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG---  797
               +LP+  W +K LRH+   Y      FPV    ++         P L  L  LS     
Sbjct  989   DCLLPKTIWNVKTLRHLWTTYCDSGFIFPVENLEVS---------PGLDHLDTLSLAIDP  1039

Query  796   --SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP  623
                  ++ILT++PN+++L  +         +     L       CL +L+   T +  + 
Sbjct  1040  SSQSLQKILTKLPNIRRLRCKMTAPREEPTKMDDGILG----FDCLSQLESL-TLRSFVG  1094

Query  622   SPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKV  443
                 FP +LK+L+L   ++PW E+S +  LP LEV+KL  Y+F G +WE+ E  F  L+V
Sbjct  1095  YGFKFPLNLKKLTLSCNKQPWSEISTIGKLPKLEVLKLLLYSFVGEEWEMKEGEFLNLQV  1154

Query  442   M-LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYD  266
             + L ++    +W ASS NFP+L+ LV+ +C +L E+P   GE  TL+ I++  C  S   
Sbjct  1155  LKLSNLLKFRRWTASSDNFPRLEKLVVDWCPNLEEVPSCLGECLTLEMIDVKWCGESVAS  1214

Query  265   SVDRIREEQEDSGNDGFTVRI  203
             SV +I+++Q D GN+   + I
Sbjct  1215  SVKQIQQDQIDMGNEVLKILI  1235



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 166/326 (51%), Gaps = 24/326 (7%)
 Frame = -3

Query  1156  GRVQQLNGFEMLRVL---DISFQSFMRFPSEILCLKILRYLAI----GLFNDLPPSFSEL  998
             G +  LN F +LRVL   D      +     +  L   R++AI        D P S + L
Sbjct  566   GVLPSLNYFRLLRVLNAVDKYLNDHVFSLEAVFQLVNSRFIAITSDRDQNADFPSSINLL  625

Query  997   CRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQT  818
               LQTLI     A    P E WKM +LRHV F +     +P   +   G+  + L  L+T
Sbjct  626   WNLQTLIVKERDA--FAPSEIWKMTQLRHVQFNQ---LEMPDPPLD--GKDEYVLGNLRT  678

Query  817   LSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF-T  641
             LS +    C  E++ ++PN+ KL +   E          C L+NL  LH LE   CFF T
Sbjct  679   LSRIRNFKCGEEVVKRIPNINKLQISYHEQFDGCSSY--C-LDNLVRLHKLESFGCFFFT  735

Query  640   KQRP----LPSPDAFPPSLKQLSLRGCQRPWKEMSV-LSALPNLEVVKLKDYAFKGSQWE  476
               RP    +      P SLK+L+L      W++M   +  LPNL+V+KLK  +F G++WE
Sbjct  736   WNRPNRDDVLRNFILPNSLKKLTLHRTNLYWEDMKTKIGLLPNLQVLKLKANSFVGTEWE  795

Query  475   LIEEVFCQLKVMLI-DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
              +E  FC LK + I D +DLE+W   S +FP+L+ L L++   L EIP   GE+ TLQSI
Sbjct  796   TVEGQFCNLKFLQICDCSDLERWTTESAHFPRLEQLDLRHLDRLEEIPSDIGEIPTLQSI  855

Query  298   ELWECNSSTYDSVDRIREEQEDSGND  221
              +  C+ +   S  RI +EQE+  N+
Sbjct  856   RVQYCSKTAVISARRILDEQEEFDNN  881



>gb|EYU21830.1| hypothetical protein MIMGU_mgv1a001060mg [Erythranthe guttata]
Length=899

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 168/341 (49%), Gaps = 50/341 (15%)
 Frame = -3

Query  1138  NGFEMLRVLDI----SFQSFMRFPS--EILCLKILRYLAIGL----FNDLPPSFSELCRL  989
             + + +LRVL +    S+  +    S   +L L   R+LAIG     F   P S   L  L
Sbjct  558   SNYRLLRVLKVVDKHSYSGYHASDSIEAVLQLVNSRFLAIGADWQNFR-FPSSVYLLWNL  616

Query  988   QTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY  809
             QTLI   +    + P E WKM +LRH+ F      P P       G+    L  LQTL  
Sbjct  617   QTLI-VKDMFYAVAPSEIWKMTQLRHIEFGLLD-LPDP----PLGGDDDSVLGNLQTLLK  670

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYL-----------NNLKVLHCLE  662
             +    C  E++ ++PN+KKL               +CYL           NNL  LH LE
Sbjct  671   IRNFKCGEEVVKRIPNVKKLQ--------------ICYLEEFEGCSSYSLNNLVRLHKLE  716

Query  661   KLKCFFTKQRPLPSPD-----AFPPSLKQLSLRGCQRPWKEMSV-LSALPNLEVVKLKDY  500
                CFF  Q+     D       P S+K+L+LRG    W +M   +  LPNL+V+KL+  
Sbjct  717   SFSCFFYSQKKPHRNDLLRNLILPNSIKKLALRGTNLYWDDMKTKIGLLPNLQVLKLQYN  776

Query  499   AFKGSQWELIEEVFCQLKVMLI-DIADLEQWEAS-SINFPKLQSLVLKYCSHLREIPIGF  326
             +F G +WE ++  FC L+ + I   +DLE W  + S +FP+L+ LVL     L E+P   
Sbjct  777   SFVGPEWETVDGQFCNLRFLQIYTCSDLEWWTMTDSSHFPRLEHLVLCNMDKLNEMPSCI  836

Query  325   GEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             GE+ TLQSIEL  C+ ST  S  RI EEQE+ GN G  VR+
Sbjct  837   GEIPTLQSIELKNCSDSTIISTRRILEEQEELGNVGLRVRV  877



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 156/311 (50%), Gaps = 18/311 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAI--GLFNDLPPSFSELCRLQTLIRWCNG  962
             GF +LRV D+   +F R   E   L  LRY+A        LP    EL  +QTLI     
Sbjct  557   GFPLLRVWDVESINFSRLSREFFQLYHLRYIAFSSNSIKVLPTRIGELWNIQTLIINTQQ  616

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVP----GTRMTWYGERHWDLPKLQTLSYLSFGS  794
               L +    W M  LRH++   S+   VP     +++T   +       LQTLS ++  S
Sbjct  617   RSLDIQANIWNMARLRHLHTNSSAKLSVPIARKSSKVTLVNQ------SLQTLSTIAPES  670

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF-----FTKQRP  629
             C  E+  + PNLKKLG+R +    L        L N+K +  LE LK         K+  
Sbjct  671   CTEEVFARAPNLKKLGIRGKISVLLEPNTSTS-LKNVKKVEYLESLKLINDGIQTGKELH  729

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP    FP  L++L+L   +  W +MSVL  L +LEV+KLK+  F G  WE     F  L
Sbjct  730   LPPAHIFPTKLRKLTLVDTRLGWNDMSVLGQLEHLEVLKLKENGFMGECWEPKVGGFSSL  789

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
              V+ I+  +L  W AS+  FP+L+ LVL  C  L+EIPIG  ++ +LQ++EL+    +  
Sbjct  790   LVLWIERTNLVSWNASADQFPRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAA  849

Query  268   DSVDRIREEQE  236
              S   ++++++
Sbjct  850   ISARELQDKKD  860



>emb|CDP17260.1| unnamed protein product [Coffea canephora]
Length=1080

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 164/324 (51%), Gaps = 17/324 (5%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             ++LRVLD+      + FP E++ L  LRYL +     +P +   L RL+TLI       +
Sbjct  750   KLLRVLDLGGLIIGKSFPMEVVLLVHLRYLVLSGIRSIPSAIDNLSRLKTLIVQGVDFVV  809

Query  952   ILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYL--SFGSCAREI  779
              LP+  W +K L ++       F  P   +    E   DL  L+TLS        C + I
Sbjct  810   KLPDTIWNIKTLSYLRTMLPHGFSFPDGNL----EVSPDLDHLETLSLAIDPSAQCLQRI  865

Query  778   LTQVPNlkklglreeegeylrdeqLVCYLNNLKVL--HCLEKLKCFFTKQRPLPSPDAFP  605
             L ++P+++ L      G         C  N  K+L  +CL+         R       FP
Sbjct  866   LKKLPSIRWLKCWRSSGLQ------ACARNRDKILVFNCLKLESLHLENFRNYRF--EFP  917

Query  604   PSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIA  425
              +LK+L L G ++PW E+S +  LP+LEV+KL D +F G +WE+ E  F  L+V+ +   
Sbjct  918   LNLKKLVLEGNRQPWSEISTIGKLPHLEVLKLLDDSFIGEEWEMKEGEFPSLRVLKLSDL  977

Query  424   DLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIRE  245
             D+ +W ASS NF  L+ LV+  C  L E+P   GE  TL++IE+ +C  S  +SV++IR+
Sbjct  978   DIRRWTASSGNFSHLEKLVVDNCDELEEVPSCLGECPTLETIEVTDCPESVVNSVNQIRQ  1037

Query  244   EQEDSGNDGFTVRIHRGHNDE*HS  173
             EQ D GN    + I     +E +S
Sbjct  1038  EQLDMGNAILKIVIENPSEEESNS  1061



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 160/305 (52%), Gaps = 42/305 (14%)
 Frame = -3

Query  1054  LRYLAIGLFNDL-------PPSFSELCRLQTLIRWCNGA---CLILPEETWKMKELRHVY  905
             LRY+ + L N +       P +   L  LQTL      A    ++LP+  W+M +LRH+ 
Sbjct  576   LRYVEMALVNTMDDVKFISPFAMPLLWDLQTLFFTLGDARHPTIVLPK-IWEMPQLRHII  634

Query  904   FKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeege  725
                 +  P P        +    L  LQTLS +    C RE+L ++PNLKK+        
Sbjct  635   MG-GAILPDPIDT-----QDSPILENLQTLSLIHDFKCTREVLHRIPNLKKMK-------  681

Query  724   ylrdeqLVCYLNNLK---------VLHCLEKLKCFFTKQRPLPSPD-AFPPSLKQLSLRG  575
                    + YLN ++         ++H L KL+  + + + L   +  FP SLK+L L  
Sbjct  682   -------IYYLNKVEDWSSYCLYNLVH-LHKLESLYVRAKDLSLKNMGFPTSLKKLELYE  733

Query  574   CQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSI  395
             C+ PW++M ++ +LPNLEV+ LK   FKGS+W  IE  F +LKV+ + +++LE W A ++
Sbjct  734   CKVPWEDMIIIGSLPNLEVLMLKGCGFKGSEWNPIEGQFPRLKVLELSMSNLECWRAENV  793

Query  394   NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGF  215
             +FP L+ L L+    L EIP G G + TL  IE++ C+ S  +S  +I EEQ  +GN+  
Sbjct  794   HFPNLEKLSLRLMDDLEEIPSGIGYIATLGLIEVYYCSDSIVNSAMQILEEQRSNGNEDL  853

Query  214   TVRIH  200
              V +H
Sbjct  854   HVYVH  858



>emb|CDP20519.1| unnamed protein product [Coffea canephora]
Length=1251

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 173/365 (47%), Gaps = 73/365 (20%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLNGF---EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGL--FND  1022
             P++ SF+ F   +   GF    +LRVLD+    F+  FP E+  L  LRYLA+     N 
Sbjct  917   PNVRSFLLFE--EDDLGFWLPRLLRVLDMGELEFVAYFPMEVFLLAHLRYLALRTRKVNF  974

Query  1021  LPPSFSELCRLQT-LIRWCNGACLILPEETWKMKELRHVYFKK-SSHFPVPGTRM-TWYG  851
             +P + + L RLQT L+R  N  CL LP   W +K LRH+   +  S F  P   +    G
Sbjct  975   IPAAIANLSRLQTFLLRRNNVDCL-LPNTIWSIKTLRHLRITEFYSGFIFPAENLEVCPG  1033

Query  850   ERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLH  671
               H D      L+        ++ILT++PN                              
Sbjct  1034  LFHLDT---LNLTIDPSSQSLQKILTKLPN------------------------------  1060

Query  670   CLEKLKCFFTKQRPLPSPDA--------------------------FPPSLKQLSLRGCQ  569
              + +L+C  T  R  P+  A                          FP +LK+L+L G  
Sbjct  1061  -IRRLRCTMTTSREEPTRIAGGILVFDYFSELQSLALHSFHGYGFKFPLNLKKLTLEGNF  1119

Query  568   RPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM-LIDIADLEQWEASSIN  392
             +PW E+S +  LP LEV+KL   +F G +WE+ E  F +L+V+ L  + D  +W ASS N
Sbjct  1120  QPWSEISTIGKLPKLEVLKLLYDSFVGEEWEMKEGEFPKLRVLKLSHLWDFRRWTASSDN  1179

Query  391   FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFT  212
             FP+L+ LV+++C HL E+P   GE  TL+ IE+  C  S   SV +I++EQ D GN+   
Sbjct  1180  FPRLEKLVVQWCRHLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQQEQRDGGNEVLR  1239

Query  211   VRIHR  197
             + I +
Sbjct  1240  ILIEK  1244



>gb|EYU31460.1| hypothetical protein MIMGU_mgv1a020657mg [Erythranthe guttata]
Length=720

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/301 (36%), Positives = 148/301 (49%), Gaps = 37/301 (12%)
 Frame = -3

Query  1054  LRYLAIGLFNDLPPSFSELCRLQTLI--RWCNGACLILPEETWKMKELRHVYFKKSSHFP  881
             +RYLA      +PP+ S L  LQ LI     N     LP + W MKELRH+   +    P
Sbjct  430   IRYLAFPYPTKIPPTISNLLNLQALIIHESLNECKQSLPTKIWTMKELRHLICYRFGELP  489

Query  880   VPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLV  701
              P       G   + L  LQTL  ++   C   IL  +PN+K+LG              +
Sbjct  490   NPPDEGASSG---YGLENLQTLWEVTNLICTENILEMIPNVKELG--------------I  532

Query  700   CY----------LNNLKVLHCLEKLKCFFTKQRPLPS------PDAFPPSLKQLSLRGCQ  569
             CY          L+NL  L  LE+ K   T   PL          AFP +LK LS  G  
Sbjct  533   CYTIDNREKEYELDNLVRLKQLERFK--LTLSYPLDVWKGKNITLAFPKTLKWLSFGGWS  590

Query  568   RPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINF  389
             RPW EM+++ +LPNL+V+K+K+   +G  WE +E  F +LK ++I  + LE+W   S +F
Sbjct  591   RPWSEMTIVGSLPNLQVLKIKENILRGETWETVEGEFLELKHLMIKGSKLERWVTESNHF  650

Query  388   PKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTV  209
             PKL+ L++  C  LR I    GE+ TL+ IE+     ST +  +RI+ EQ D   D   V
Sbjct  651   PKLERLLIHQCLELRNISNDIGEISTLELIEVKSGLKSTAEWAERIQREQRDYRYDVTEV  710

Query  208   R  206
             R
Sbjct  711   R  711



>ref|XP_009595789.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Nicotiana tomentosiformis]
Length=1776

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 172/335 (51%), Gaps = 16/335 (5%)
 Frame = -3

Query  1183  PSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND-LPPSF  1007
             PS+ + ++F      + F+ LRVLD+ F +   FP+E LC   LRYLA+  F + +P S 
Sbjct  1451  PSVDNQVSFA----FHSFKCLRVLDLEFVTVGSFPTE-LCQ--LRYLALRTFEESIPSSI  1503

Query  1006  SELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPK  827
               L  L+TL+    G+ L LP    KM ++RH++    + F +   ++  + E   +L  
Sbjct  1504  DNLRNLETLVVKGLGSELSLPHSLCKMVKMRHLHLNDRASFDLQNLKI--FLEDPSELDN  1561

Query  826   LQTLSYLSF--GSCAREILTQVPNlkklglreeeg--eylrdeqLVCYLNNLKVLHCLEK  659
             L+T S  +F  G     +L++ PNL+KL              ++       L+ L  LE 
Sbjct  1562  LETFSTPAFSSGEDVERVLSKTPNLRKLRCIFSGSWGYSEEQKKDCNQFPRLQHLTKLES  1621

Query  658   LKCF-FTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQ  482
             LK F F K    P    FP  LK+L+L G   PW E+S +S L NL ++KL+  AF G +
Sbjct  1622  LKVFCFHKPERSPCVFNFPSDLKKLTLCGFGLPWSEISAMSTLHNLVILKLQSDAFCGEE  1681

Query  481   WELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQS  302
             WE+ +E F QLKV+ ++     +W  S   F  L+ LVL  C  L EIP  FG    LQ+
Sbjct  1682  WEVSDEQFSQLKVLKLENISFARWSISEDAFSNLEKLVLHSCDCLVEIPSEFGYFTCLQT  1741

Query  301   IELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
             IE+  C  S  +S   + E Q E+  N+GF + I+
Sbjct  1742  IEVKSCQESVANSAKNVEEIQVEEMQNNGFKLFIY  1776



>ref|XP_009790398.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana sylvestris]
Length=1807

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 170/344 (49%), Gaps = 19/344 (6%)
 Frame = -3

Query  1204  DYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-  1031
             D  +L  P   SFI        + F++++VLD+ SF     FPSEI  L  +RY A    
Sbjct  1464  DLDNLLWPRDISFI-------FDSFKLVKVLDLESFNIGGTFPSEIQYLIQMRYFAAQTD  1516

Query  1030  FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYG  851
              N +P S ++L  L+T +    G  +ILP    KM +LRH++      F +         
Sbjct  1517  ANSIPSSIAKLGNLETFVVRGLGGEMILPCSLLKMVKLRHIHVNHRVSFGLHENMDESLS  1576

Query  850   ERHWDLPKLQTLSY--LSFGSCAREILTQVPNlkklg--lreeegeylrdeqLVCYLNNL  683
               H  L  L+T S   LS+G  A +IL ++P L+KL        G   +          L
Sbjct  1577  --HSQLANLETFSTPRLSYGEDAEKILRKMPKLRKLSCIFSGTFGYSRKVMGRCVRFPRL  1634

Query  682   KVLHCLEKLKCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKL  509
             + L  LE LK   +   P  LP    FP  L++L+L   + PW ++S ++ L NL ++KL
Sbjct  1635  EFLSHLESLK-LVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWNQISTIAELRNLVILKL  1693

Query  508   KDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIG  329
                AF+G  WE+ +  F +LK + +D   + QW  S   FPKL+ LVL  C HL +IP  
Sbjct  1694  SLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSH  1753

Query  328   FGEVYTLQSIELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
             F +  +L+SIE+  CN S  +S   I+  Q ED  ND FTV I 
Sbjct  1754  FDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVTIQ  1797



>gb|EYU31597.1| hypothetical protein MIMGU_mgv1a001843mg [Erythranthe guttata]
Length=751

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 141/266 (53%), Gaps = 37/266 (14%)
 Frame = -3

Query  946  PEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQV  767
            P E WKM +LRHV F +     +P   +   G+  + L  L+TLS +    C  E++ ++
Sbjct  481  PSEIWKMTQLRHVQFNQ---LEMPDPPLD--GKDEYVLGNLRTLSRIRNFKCGEEVVKRI  535

Query  766  PNlkklglreeegeylrdeqLVCY-----------LNNLKVLHCLEKLKCFF-TKQRP--  629
            PN+KKL               +CY           L+NL  LH LE   CFF T  RP  
Sbjct  536  PNIKKLQ--------------ICYHEQFDGCSSYCLDNLVRLHKLESFGCFFFTWNRPNR  581

Query  628  --LPSPDAFPPSLKQLSLRGCQRPWKEMSV-LSALPNLEVVKLKDYAFKGSQWELIEEVF  458
              +      P SLK+L+L      W++M   +  LPNL+V+KLK  +F G++WE +E  F
Sbjct  582  DDVLRNFILPNSLKKLTLHRTNLYWEDMKTKIGLLPNLQVLKLKANSFVGTEWETVEGQF  641

Query  457  CQLKVMLI-DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
            C LK + I D +DLE+W   S +FP+L+ L L++   L EIP   GE+ TLQSI +  C+
Sbjct  642  CNLKFLQICDCSDLERWTTESAHFPRLEQLDLRHLDRLEEIPSDIGEIPTLQSIRVQYCS  701

Query  280  SSTYDSVDRIREEQEDSGNDGFTVRI  203
             +T  S  RI +EQE+  N G  VR+
Sbjct  702  KATVISARRILDEQEEFDNVGLRVRV  727



>ref|XP_009790395.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790397.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009790399.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790400.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790401.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790402.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1807

 Score =   144 bits (363),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 170/344 (49%), Gaps = 19/344 (6%)
 Frame = -3

Query  1204  DYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-  1031
             D  +L  P   SFI        + F++++VLD+ SF     FPSEI  L  +RY A    
Sbjct  1464  DLDNLLWPRDISFI-------FDSFKLVKVLDLESFNIGGTFPSEIQYLIQMRYFAAQTD  1516

Query  1030  FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYG  851
              N +P S ++L  L+T +    G  +ILP    KM +LRH++      F +         
Sbjct  1517  ANSIPSSIAKLGNLETFVVRGLGGEMILPCSLLKMVKLRHIHVNHRVSFGLHENMDESLS  1576

Query  850   ERHWDLPKLQTLSY--LSFGSCAREILTQVPNlkklg--lreeegeylrdeqLVCYLNNL  683
               H  L  L+T S   LS+G  A +IL ++P L+KL        G   +          L
Sbjct  1577  --HSQLANLETFSTPRLSYGEDAEKILRKMPKLRKLSCIFSGTFGYSRKVMGRCVRFPRL  1634

Query  682   KVLHCLEKLKCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKL  509
             + L  LE LK   +   P  LP    FP  L++L+L   + PW ++S ++ L NL ++KL
Sbjct  1635  EFLSHLESLK-LVSNSYPAKLPHKFNFPSQLRELTLSKFRLPWNQISTIAELRNLVILKL  1693

Query  508   KDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIG  329
                AF+G  WE+ +  F +LK + +D   + QW  S   FPKL+ LVL  C HL +IP  
Sbjct  1694  SLRAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSH  1753

Query  328   FGEVYTLQSIELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
             F +  +L+SIE+  CN S  +S   I+  Q ED  ND FTV I 
Sbjct  1754  FDDAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVTIQ  1797



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 172/316 (54%), Gaps = 24/316 (8%)
 Frame = -3

Query  1126  MLRVLDISFQSFMR--FPSEILCLKI-LRYLA----IGLFNDLPPSFSELCRLQTLIRWC  968
             +LRVL++   S  +  + S+ +  ++ LRYL     + ++ +LP S S L  +QTLI   
Sbjct  466   LLRVLNVYDNSLSKKIYLSKCIFDQVNLRYLGYNTQLNIYGELPSSISLLWNMQTLIIEG  525

Query  967   NGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA  788
             N   +  P E W+M++LRH+   +  + P P +           L  LQTL  +   + +
Sbjct  526   N---IFAPSEIWEMRQLRHMDIYRL-YLPDPPSSGPI-------LRNLQTLKTVMNFTWS  574

Query  787   REILTQVPNlkklglreeegeylrdeqLVCY-LNNLKVLHCLEKLKCFFTKQRPLPSPDA  611
              E+  ++PN+KKL +             + Y L+NL +L  LE L C ++    L     
Sbjct  575   EEVCKRIPNVKKLNIMFHIEGPT-----IHYCLHNLSLLCKLESLTCSYSISNNLLQKLT  629

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLID  431
             FP S+K+LSL  C+  W++++++ +L NLEV+KLK  + +G+ W  IE  F +LK +LI 
Sbjct  630   FPSSIKKLSLIFCRVNWEDLTLIGSLQNLEVLKLKYDSVRGAVWNPIEGEFLRLKFLLIH  689

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
              +DL  W A S NFP L+ LVLK    L EIP+  GE+ TL  + +  C+ S   S  +I
Sbjct  690   YSDLVYWNADSSNFPVLEKLVLKGMEKLEEIPLDIGEIPTLGFVHVNCCSESAAISALKI  749

Query  250   REEQEDSGNDGFTVRI  203
              EEQE+ GN+G  +R+
Sbjct  750   VEEQENVGNEGLRIRV  765



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score =   142 bits (359),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 114/293 (39%), Positives = 151/293 (52%), Gaps = 19/293 (6%)
 Frame = -3

Query  1054  LRYLAIG----LFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSH  887
             LRYL I     L  + P + S L  LQTL        + LP E W M +LRH+       
Sbjct  580   LRYLKISDDMQLKFESPSTISLLWNLQTLTLKLPYR-VNLPSELWDMPQLRHLISDGVVD  638

Query  886   FPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeq  707
              P P        +    +  LQTL++     C  ++L +VPNLKKLG+   E        
Sbjct  639   LPHPAV-----TQDSMIMENLQTLAHFRNFRCTIDVLDRVPNLKKLGIVYLEKGSGG---  690

Query  706   LVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVL-SALP  530
                 L NL  L  LE L     K   L +   FP SLK+L+L  C  PW+EM+V  S LP
Sbjct  691   ----LENLARLQKLESL-LVIEKDVSLLANITFPTSLKKLTLTSCCIPWEEMTVFGSVLP  745

Query  529   NLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSH  350
             NLE +KL   AFKG +W  +E  F +LKV++I   DL  W A SI+FPKL+ L L     
Sbjct  746   NLEKLKLYGNAFKGPEWSPVEGQFPRLKVLIIWENDLVWWRAESIHFPKLERLDLYEMHC  805

Query  349   LREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHRGH  191
             L EIP G G++ TL SI LW+C+ S+ +S  +I EEQ+ SGN+   + +  G 
Sbjct  806   LEEIPSGIGDIPTLLSIHLWDCSDSSINSAKQILEEQQSSGNEILQLYVDEGQ  858



>gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Erythranthe 
guttata]
Length=834

 Score =   142 bits (359),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 155/273 (57%), Gaps = 18/273 (7%)
 Frame = -3

Query  1054  LRYLAIGLFNDLPPSFS-ELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPV  878
             LRY+   + + L  SF  +L  LQTL+   N   + LP E W+M +LRH+  ++ S    
Sbjct  576   LRYVDCNMSSKLLSSFIFQLWNLQTLVVDIN---ISLPAEIWQMPQLRHIKMREISLCDP  632

Query  877   PGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVC  698
             P ++ T        L  LQTLS +    C ++++T++PNLKKLG+     E        C
Sbjct  633   PDSQNTLV------LENLQTLSTVQDFKCNQQVITRIPNLKKLGVHYRTDEIGP----FC  682

Query  697   YLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEV  518
             +  NL  L  LE L   F+    +    AFP SLK+L+L  C+ PW++MS++ +LPNLEV
Sbjct  683   W-TNLAGLRKLESLVLEFSA--GISDNIAFPDSLKKLALSECKVPWEDMSIVGSLPNLEV  739

Query  517   VKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREI  338
             +KLK  A KG +W  IE  F +LK +LID  +LE WEA + +FP L+ LVL   S L+EI
Sbjct  740   LKLKSGAAKGEKWNPIEGQFGRLKFLLIDQCELEIWEADNTHFPCLEHLVLGDVS-LKEI  798

Query  337   PIGFGEVYTLQSIELWECNSSTYDSVDRIREEQ  239
             PI F E+  L+ I L    SS + S + I EE+
Sbjct  799   PIDFAEILNLRVIVLPRVKSSLWTSAEEISEER  831



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score =   143 bits (361),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 168/317 (53%), Gaps = 13/317 (4%)
 Frame = -3

Query  1138  NGFEMLRVLDISFQSFMR-FPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCN  965
             + F++LRVLD+   +    FP  +  L  LRYLA+ G  + +P S S L  L+TL+    
Sbjct  1141  DNFKLLRVLDLECINMGHCFPRGLEHLVHLRYLAVCGDLDSIPASISCLWNLETLLVRGL  1200

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS--YLSFGSC  791
                + LP   W M +LRHV+ K  + F       ++  E    L  L TLS   L  G  
Sbjct  1201  KGKVDLPHTFWSMVKLRHVHVKSFTSF-------SFIKEDSSQLDNLVTLSSPVLFSGEE  1253

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDA  611
               +++ Q+P L+KLG    E +    +     L  L  L  LE LK  ++ +   P    
Sbjct  1254  TEKLMRQLPQLQKLGCIFSESKVDTGQGYGFPL--LGFLTQLEALKVTYSGRFCHPRKFD  1311

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLID  431
             FP +LK+L+L     PW  +S +  LPNLEV+KL   AF+G +W + E  F +LK + +D
Sbjct  1312  FPLNLKKLTLSKFCLPWDCVSEIGRLPNLEVLKLLSRAFEGERWNMKEGEFLKLKFLKLD  1371

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
               ++ QW+AS+ + PKLQ LVL+ C HL E+P GF ++ TL  IE+  C SS  +SV  +
Sbjct  1372  SLNIAQWKASADHLPKLQQLVLRNCRHLEEVPSGFADIPTLVMIEMQLCRSSAEESVRIL  1431

Query  250   REEQEDSGNDGFTVRIH  200
             +EEQ   G D   V I+
Sbjct  1432  KEEQLGLGIDDLKVLIN  1448



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score =   143 bits (360),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 181/322 (56%), Gaps = 20/322 (6%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPP--SFSELCRLQTLI--RWCN  965
             F++LRVLD+    F  FPSEIL L  LRYLA+ + + +P   + S L  LQT I  ++  
Sbjct  791   FKLLRVLDLETMRFGLFPSEILHLVSLRYLAV-MVSSIPKDMTISNLLNLQTFIFPQYVP  849

Query  964   --GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSC  791
                  + LP   W+M +LRH+Y      +  P         R   L  LQ++S LS   C
Sbjct  850   ELSGTIDLPIGIWEMSQLRHLYSTMMYLYSPPMVSANEVSYRV--LENLQSVSGLSPRCC  907

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP------  629
               EI   +  +K LG+   E E+  + +  C L+NL  LH LE L      ++P      
Sbjct  908   TEEIFEAIKKVKNLGISGSENEFHSEPR--C-LDNLIYLHELEALSIVSYSRQPDGLFLR  964

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQ-WELIEEVFCQ  452
             LP  D+FPP+LK+L+LR     W++M+++S LP LEV++LK+ AF G+  WE+ +E F +
Sbjct  965   LPHLDSFPPNLKKLTLRRTWLSWEDMTIISELPELEVLQLKEDAFAGNTVWEVTKEGFPK  1024

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             LK +L++  DL  W A    FP L+ ++++ C++L+EIP GF +  TLQ IEL  C+ S 
Sbjct  1025  LKFLLLEELDLGYWVADDDYFPCLERIIIRNCTYLKEIPQGFADSTTLQQIELRRCSPSL  1084

Query  271   YDSVDRIREEQEDS-GNDGFTV  209
                 ++I+++QE+  GN+   V
Sbjct  1085  VTLAEKIQKKQEEEIGNNILKV  1106



>ref|XP_009761713.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Nicotiana sylvestris]
Length=320

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 114/317 (36%), Positives = 166/317 (52%), Gaps = 17/317 (5%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGAC-  956
             F++L+VLD+ +     F   I  L  LRY+A  +  D  PS ++L  LQT+I  CN A  
Sbjct  13    FKLLKVLDV-YNVRCDFSCVIPKLIHLRYVAANI--DEAPSLAKLWNLQTII-LCNFASK  68

Query  955   -LILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYG--ERHWDLPKLQTLSYLSFGSCAR  785
              L LP+E W M E+RH+  + S H P      ++    E+   L  LQTL   S    A 
Sbjct  69    DLHLPQEIWTMSEIRHLDIRWSIHMPNSLATESYNSIEEQPLFLNNLQTLVLCSSPYLA-  127

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKL--KCFFTKQRPLPSPDA  611
             EIL + P       +    +  R       L+ L +L  LE L  +        + S D 
Sbjct  128   EILRRTP----YLNKLTILDESRHPDCPAILDPLSLLQELETLTIEADLGSDLMILSRDI  183

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVMLI  434
             FPP+LKQL L      W++M VL+ LPNLEV+K    AF+G+ W+L E+V F +LK + +
Sbjct  184   FPPNLKQLKLSYATLQWEDMVVLANLPNLEVLKAYS-AFEGTNWKLNEDVVFQKLKYLRL  242

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                 LE+WEA++ NF  L+ L+L     L EIP   G++  L+ I++  C+++   S  +
Sbjct  243   QYGGLERWEATNDNFSMLEQLLLYGFRKLEEIPQSIGDIMILKLIQIERCSAAAVTSAKK  302

Query  253   IREEQEDSGNDGFTVRI  203
             I++EQE  GN G  VRI
Sbjct  303   IQQEQESWGNYGLQVRI  319



>ref|XP_010319426.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 170/321 (53%), Gaps = 21/321 (7%)
 Frame = -3

Query  1093  FMRFPSEILCLKILRYLAI-GLFNDLPPSFSELCRLQTLIRWCNGAC-LILPEETWKMKE  920
             F  FP  I  L  LRYL +  L  ++P S SEL  LQTLI  C+    + LP++ W +K 
Sbjct  4     FDSFPLVITKLFHLRYLHVEHLRLNIPESISELLNLQTLISNCSPVSGMTLPKKIWLLKN  63

Query  919   LRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglr  740
             L+++   ++++ P P             +P L+    L + SC  E+ + +PNLK L + 
Sbjct  64    LKYISLGRNTYLPSPRINKNLVTV----MPNLEKFFGLCYTSCTNEVFSSIPNLKILTIH  119

Query  739   eeegeylrdeqLVCY-LNNLKVLHCLEKLKCFFTKQRPLPSPD-AFPPSLKQLSLRGCQR  566
                         + Y L ++  L  LE  K  +      P     FP S+++L+L  C +
Sbjct  120   VPITFKEEI---ISYRLLDMSSLRKLEAFKLSWNSSWENPIKTFVFPTSVRRLTLSFCSK  176

Query  565   -PWKEMS-VLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVMLIDIADLEQWEASSI  395
               W+E+S     LPNLE +KLK        W + ++V F  LK++L+   +L++WEASS 
Sbjct  177   FIWEEISSTFIMLPNLEELKLKYCEADDDVWIMSDKVIFKSLKLLLLSDLNLKRWEASSD  236

Query  394   NFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGF  215
             NFP L+ LVLK C  L+EIP  FGE+ TL+SIEL +C++++ DS   I +EQED GN+  
Sbjct  237   NFPNLKRLVLKICEDLQEIPTDFGEICTLESIELHDCSATSEDSARNIEQEQEDMGNNML  296

Query  214   TVRIHRGHNDE*HSNLPGSVY  152
              V I        +SN  GS++
Sbjct  297   KVYIR-------NSNRNGSLF  310



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score =   142 bits (358),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 155/292 (53%), Gaps = 22/292 (8%)
 Frame = -3

Query  1048  YLAIGLFNDLPPSFSELC-RLQTLIRWCNGAC-----LILPEETWKMKELRHVYFKKSSH  887
             Y  +  F  +P S   L   LQTL+   +GA      +++P + W+M +LRH+       
Sbjct  584   YRTLSKFEFVPSSSIPLLWNLQTLLIDGSGANVKKRPIVVPSKVWEMPQLRHIVMD-LGF  642

Query  886   FPVP-GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrde  710
              P P  T+ T        L  LQTLS +    C +E+  ++PNLKKL  R    +     
Sbjct  643   LPTPVDTQDTIT------LENLQTLSTMHNFRCTKEVFERIPNLKKLKARYLNVKDWSFY  696

Query  709   qLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVL-SAL  533
                C L+NL  LH LE L      +  L    AFP SLK+LSL  C+ PW  ++++ S L
Sbjct  697   ---C-LHNLAHLHRLESLS--LIAEDLLLEKTAFPTSLKRLSLSKCRIPWGHITIIGSLL  750

Query  532   PNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCS  353
             PNLEV+KL + AF+GS+W  +E  F +LKV+ I  +DL  W A   +FP L+SL L+   
Sbjct  751   PNLEVLKLLNNAFRGSEWSPVEGQFPRLKVLFISDSDLVSWRADDFHFPHLESLFLRLMH  810

Query  352   HLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIHR  197
              L EIP G G + TL+SI L +C+    +S  +I EEQ   GN+   VR+ R
Sbjct  811   KLEEIPSGIGHIETLRSIHLNKCSELVVNSAKQILEEQSSYGNE-LEVRVDR  861



>ref|XP_011072138.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=427

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 117/294 (40%), Positives = 156/294 (53%), Gaps = 33/294 (11%)
 Frame = -3

Query  1114  LDISFQSFMRFPSEILCLKILRYLAIGLFNDLP----PSFSELCRLQTLI-RWCNGACLI  950
             +DI FQ    +P++      LRYL +   N +P    P+ S L  LQTLI  +  GA L 
Sbjct  161   VDIDFQ----YPTK------LRYLYMN--NVMPLNFEPTISLLWNLQTLILSFPIGANL-  207

Query  949   LPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQ  770
              P E W M +LRH+      HF +P   +T   E    +  L TL+      C  + L +
Sbjct  208   -PSEIWDMPQLRHLI--SDGHFDLPHPVVT---ENSMIMENLHTLANFQNFRCTIDFLDR  261

Query  769   VPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQ  590
             VPNLKKLG+   E            L NL  L  LE L   F K   L +   FP SLK+
Sbjct  262   VPNLKKLGIIRYEKSSSG-------LENLARLQKLESLY-LFEKNVSLLANITFPTSLKK  313

Query  589   LSLRGCQRPWKEMSVL-SALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQ  413
             LSL  C  PW+EM+V  S LPNLE + L   AFKG++W  +E  F +LKV++I   DL +
Sbjct  314   LSLSNCCIPWEEMTVFGSVLPNLEKLTLYRNAFKGAEWSPVEGQFPRLKVLIIVCNDLVR  373

Query  412   WEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
             W A SI+FP L+ L L+    L EIP G G++ TL SI LW+C+ S+ +S  +I
Sbjct  374   WRAESIHFPNLERLHLESMECLEEIPSGIGDIPTLLSIHLWKCSDSSVNSAKQI  427



>emb|CDP08033.1| unnamed protein product [Coffea canephora]
Length=869

 Score =   142 bits (357),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 114/337 (34%), Positives = 158/337 (47%), Gaps = 35/337 (10%)
 Frame = -3

Query  1201  YKDLPKPSICSFIAFGRVQ-----------QLNGFEMLRVLDISFQSF--MRFPSEILCL  1061
             YK  P  +  SF++FG  +               F++LRVLDI       +  P ++  L
Sbjct  530   YKTQPAKNARSFLSFGHNEIKLDPNLSPDDVFKQFKLLRVLDILSVKLPTIHLPKKLSNL  589

Query  1060  KILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHF  884
              +L+ +AI      LP + S L  LQTLI       L +  + W M +LRH+    S   
Sbjct  590   VLLKLIAINCEVEILPKTMSSLLNLQTLIVHTGSPTLDIQADIWAMTKLRHLITNSSMSL  649

Query  883   PVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqL  704
             P    + T  G        LQTLS +S  S   E+L +  NLKKLG+    G  ++    
Sbjct  650   PRCQEQSTISGN-------LQTLSVVSPESLTNEVLERAKNLKKLGISGNLGTLMKANGE  702

Query  703   VCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNL  524
                  N K+L               LP P  FP  L +LSL+     W +MS+L  L  L
Sbjct  703   SNNDVNSKLL--------------ALPQPHRFPARLTKLSLQNTSLGWDQMSILGKLQYL  748

Query  523   EVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLR  344
             EV+KLKDYAF G  W+  E  F  LKV+ I   DL+ WEA + +FP+L+ L+L+ C  L 
Sbjct  749   EVLKLKDYAFTGEDWQTEEGGFLSLKVLFIGATDLKCWEAQANDFPELRCLILRQCKQLW  808

Query  343   EIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQED  233
              IP  F ++  L++I L     S   S  RIR+ Q D
Sbjct  809   RIPPDFVDMKKLEAIHLEHTTGSVISSARRIRQLQID  845



>ref|XP_009799885.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-16 [Nicotiana sylvestris]
Length=1826

 Score =   143 bits (360),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 113/342 (33%), Positives = 165/342 (48%), Gaps = 15/342 (4%)
 Frame = -3

Query  1204  DYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-  1031
             D  +L  P   SFI        + F++++VLD+ SF     FPSEI  L  +RY A    
Sbjct  1483  DLDNLLWPRDISFI-------FDSFKLVKVLDLESFNIGGTFPSEIQYLIQMRYFAAQTD  1535

Query  1030  FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYG  851
              N +P S ++L  L+T +    G  +ILP    KM +LRH++      F +         
Sbjct  1536  ANSIPSSIAKLGNLETFVVRGLGGEMILPCSLLKMVKLRHIHVNHRVSFGLHENMDESLS  1595

Query  850   ERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklg--lreeegeylrdeqLVCYLNNLKV  677
                       +   LS+G  A +IL ++P L+KL        G   +          L+ 
Sbjct  1596  HSQLXXXXXXSTPRLSYGEDAEKILRKMPKLRKLSCIFSGTFGYSRKVMGRCVRFPRLEF  1655

Query  676   LHCLEKLKCFFTKQRP--LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKD  503
             L  LE LK   +   P  LP    FP  L++L+    + PW ++S ++ LPNL ++KL  
Sbjct  1656  LSHLESLK-LVSNSYPAKLPHKFNFPSQLRELTFSKFRLPWNQISTIAELPNLVILKLSL  1714

Query  502   YAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFG  323
              AF+G  WE+ +  F +LK + +D   + QW  S   FPKL+ LVL  C HL +IP  F 
Sbjct  1715  RAFEGDHWEVKDSDFPELKYLKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSHFD  1774

Query  322   EVYTLQSIELWECNSSTYDSVDRIREEQ-EDSGNDGFTVRIH  200
             +  +L+SIE+  CN S  +S   I+  Q ED  ND FTV I 
Sbjct  1775  DAVSLKSIEVNWCNWSVANSAQEIQTTQREDMANDSFTVTIQ  1816



>ref|XP_009800104.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800105.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800106.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1741

 Score =   142 bits (359),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 171/324 (53%), Gaps = 16/324 (5%)
 Frame = -3

Query  1138  NGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCN  965
             + F++++VLD+ SF     FPSEI  L  LRY A     + +P S ++L  L+T +    
Sbjct  1409  DSFKLVKVLDLESFNIGGTFPSEIQSLIHLRYFAARTGASSIPSSIAKLWNLETFVVRGL  1468

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD--LPKLQTLS--YLSFG  797
             G  + LP    K+ +LRH++ K  + F +        GE   D  L  L+T S  +LS+G
Sbjct  1469  GGEVKLPSSLLKLVKLRHIHVKNCASFSLHDN----MGESLADCQLDNLETFSTPHLSYG  1524

Query  796   SCAREILTQVPNlkklg-lreeegeylrdeqLVCYL-NNLKVLHCLEKLKCFFTKQRP--  629
                  IL +VP L+KL  +  E   Y +     C L   L+ L  LE LK   +   P  
Sbjct  1525  EDTEMILRKVPKLRKLSCIFSETFGYSKIVMGRCVLFPRLESLSHLESLK-LVSNSYPAK  1583

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP   +FP  L++L+L   + PW ++S +  LPNLE++KL   AF+G+ WE+ +  F +L
Sbjct  1584  LPHVFSFPSRLRELTLSKFRLPWSQISTIGELPNLEILKLHLRAFEGNHWEVKDSEFPEL  1643

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
               + +D  ++ QW  S   FPKL+ LVL  C  L +IP  F +  +L+SIE+  CN S  
Sbjct  1644  TYLELDDINIAQWSVSDDAFPKLKCLVLTKCKRLEKIPSHFDDSVSLRSIEVNWCNLSVA  1703

Query  268   DSVDRIREEQ-EDSGNDGFTVRIH  200
             +S   I+  Q E+  N  FTVRI 
Sbjct  1704  ESAQEIQTTQHEEMANGAFTVRIQ  1727



>emb|CDP12798.1| unnamed protein product [Coffea canephora]
Length=1266

 Score =   142 bits (357),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 160/315 (51%), Gaps = 22/315 (7%)
 Frame = -3

Query  1132  FEMLRVLDISFQSF-MRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGAC  956
             F++L VLD+   +F   FP E++ L  LRYLAI     +P   + L RL+T +   +G  
Sbjct  960   FKLLGVLDLGGFNFNYEFPMEVVLLVHLRYLAISSIWSVPSEIANLSRLETFLVTASGRN  1019

Query  955   LILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYL--SFGSC  791
             + LP   W ++ LRH+    S H   F V     +       DL  L+TLS    S    
Sbjct  1020  VALPNTIWNIQSLRHLCITNSHHGFGFLVDNLAGSL------DLKHLETLSLAIDSSSQS  1073

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPL-PSPD  614
              ++ILT++P++++L     +             N + VL  L +++    K R L P   
Sbjct  1074  LQKILTKLPSIRRLKCVPLQDSSSSR-------NWILVLDGLSRIESL--KVRNLAPLEI  1124

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP  LK+L+L     PW E+S +  LP+LEV+KL++ A    +WE+    F  L+ + +
Sbjct  1125  KFPLYLKKLTLSHTNMPWSEISTIGKLPSLEVLKLRNKAIDREKWEMKAGEFLSLRFLEL  1184

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                DL  W A+S NF +L+ LV++ C  L E+P   GE   L+ IEL  C  S   SV +
Sbjct  1185  SQLDLRSWTATSDNFSRLEKLVVQSCWKLEEVPSCLGECLNLEMIELKWCRESAVTSVKQ  1244

Query  253   IREEQEDSGNDGFTV  209
             I+ EQ D+GN+G  +
Sbjct  1245  IQREQMDAGNEGLRI  1259



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 113/332 (34%), Positives = 177/332 (53%), Gaps = 23/332 (7%)
 Frame = -3

Query  1156  GRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND-------LPPSFSEL  998
             G +Q+L  F+ LR+L+++  +   FPS I+ L  LRYLA+  ++        +PPS + L
Sbjct  541   GIMQELERFKKLRILELASPTLDAFPSCIVGLFQLRYLALTFYSSTDDQDIYVPPSINGL  600

Query  997   CRLQTLIR------WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD  836
               LQ+LI        C     ILP + + +  LRH+   +++      +    +GER   
Sbjct  601   QYLQSLILKFPKYFRCPKFSFILPSQIFNLWRLRHLSLDRNN------SDTCEFGERSLI  654

Query  835   LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKL  656
             L  +Q LS  +   C   +  Q PNLKKL +  +  EY+   + +  L+NL  L  LE+L
Sbjct  655   LNNMQCLSGWNPLCCTSSVFKQFPNLKKLQISGDHEEYITSYE-MKGLHNLCNLDQLEEL  713

Query  655   KCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFK-GSQW  479
             K        LP P+AFP +LK+LS        +++ +LS LP LE +KLK  +   G +W
Sbjct  714   KFDGMPHSTLPHPEAFPKNLKKLSFSKTHVNLEDLRILSKLPKLEALKLKFCSSNIGMEW  773

Query  478   ELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSI  299
             E+ EE F QLK +L+    +  W ASS +FP+L+ L L  C+++  IP  F E+ TLQ I
Sbjct  774   EVTEEGFPQLKFLLLSRLGIRHWRASSDHFPRLERLFLVECANMISIPEDFVEITTLQLI  833

Query  298   ELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             ++  C  S  +S  +I++E ED  N G ++ +
Sbjct  834   DIRMCKESVVNSAKKIQQEIED--NYGGSIEV  863



>emb|CDP08019.1| unnamed protein product [Coffea canephora]
Length=1758

 Score =   142 bits (358),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 160/307 (52%), Gaps = 13/307 (4%)
 Frame = -3

Query  1138  NGFEMLRVLDIS-FQSFMRFPSEILCLKILRYLAIGLF-NDLPPSFSELCRLQTLIRWCN  965
             + F++LRVLD   F   +  P EI  L  LRYLA+G +   +P S ++L +L+TLI    
Sbjct  1005  HNFKLLRVLDFECFNLGISLPIEIGILVQLRYLAVGGYLKSIPQSIADLRKLKTLIVKGL  1064

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLS--YLSFGSC  791
                + LP   W++  LRH++      F      +   G+  + L  L + S   LS G  
Sbjct  1065  SGKITLPNTIWRITSLRHLHVNLHVAFDSDAEEL---GDS-FILENLVSFSCPSLSCGED  1120

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD-  614
             A  I+ ++PNL KL     E           +   L  L  LE LK F+    PL + + 
Sbjct  1121  AERIIKRLPNLCKLSCIFYESPDSSMNCN--HFPRLNCLTHLESLKIFYYGS-PLNNGEF  1177

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
             + P +LK+L+L   + PW  +S +  LPNL+V+KL   AF+G  W+ +EE F  LK + +
Sbjct  1178  SLPLNLKKLTLSNFRLPWSHISTIGRLPNLKVLKLLSGAFEGKIWD-VEEEFQNLKFLRL  1236

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
             D  ++ QW AS  +FPKL+ LVL+ C  L EIP  FG +YTL  IE+  C  S  +S  +
Sbjct  1237  DNLNIAQWNASCDDFPKLERLVLQNCKDLEEIPEDFGNIYTLGMIEVHWCGRSAEESAKK  1296

Query  253   IREEQED  233
             I EE  D
Sbjct  1297  IEEEYGD  1303


 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 147/302 (49%), Gaps = 48/302 (16%)
 Frame = -3

Query  1132  FEMLRVLDISFQSF-MRFPSEILCLKILRYLAIGLF-NDLPPSFSELCRLQTLIRWCNGA  959
             F++LRVLD    +  + FP EI  L  LRYLA+G +   +P S + L +L+TL+      
Sbjct  1479  FKLLRVLDFECINLGVSFPVEIGLLLFLRYLAVGRYMRSIPHSMANLRKLETLV------  1532

Query  958   CLILPEETWKMKELRHV--YFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYLSFGS  794
                       +K LR V      S++   F  P                      LS G 
Sbjct  1533  ----------VKGLRDVEELVDSSANLVSFSCPS---------------------LSCGE  1561

Query  793   CAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD  614
              A  I+ ++PNL KL     E +             LK L  LE LK F+    PL + +
Sbjct  1562  DAERIIKRLPNLCKLSCIFYESQDSSTSYN--RFPRLKFLSHLESLKIFYYGN-PLHNAE  1618

Query  613   -AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
                P SLK+L+L     PW  +S +S+LPNLEV+KL   AF G  W+++E+ F +LK + 
Sbjct  1619  FNLPLSLKELTLSRFCLPWTHISAISSLPNLEVLKLLSGAFMGRTWDMMEDEFQKLKFLS  1678

Query  436   IDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD  257
             ++  D+ +W AS  + P+L+ LVL++C  L +IP    ++ +L++IE+  C  S  +S  
Sbjct  1679  LETLDIAEWNASYDHLPRLERLVLQHCKDLEKIPEDLSDITSLETIEVHWCGQSVEESAI  1738

Query  256   RI  251
              I
Sbjct  1739  EI  1740



>gb|EYU38159.1| hypothetical protein MIMGU_mgv1a025995mg [Erythranthe guttata]
Length=769

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 161/299 (54%), Gaps = 26/299 (9%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIR----  974
             L+   +LR+LD     F  FP ++L L  LRYLA+     LP S S+L  L+ LI     
Sbjct  461   LDDSRLLRILDALTVRFYLFPIQVLKLVELRYLALTYNGKLPSSISKLPNLECLIVDRHM  520

Query  973   --WCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSF  800
                  G    LP E W MK+L+H+     +  P P             LPKL TLS +S 
Sbjct  521   AIRSAGKPQWLPVEIWDMKKLKHLQIM-GNEVPDPCEGSV--------LPKLSTLSDISS  571

Query  799   GSCAREILTQVPNlkklglreeegeylrd--eqLVCYLNNLKVLHCLEKLKCFFT----K  638
              SC R +L  +PNLKKLG+R E         E   C+ +++ +L+ LE LKC       K
Sbjct  572   HSCTRSVLESIPNLKKLGIRIEISSDAASDCEPSSCF-DHISLLNKLESLKCVIVNPTLK  630

Query  637   QRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVF  458
               PL S   FP  LK+L L G   PW+EMS +++LPNLEV+KL+ YAF+G +WE+ +  F
Sbjct  631   NPPLLS--VFPLGLKKLCLSGLGYPWEEMSKIASLPNLEVLKLRCYAFRGPKWEIEDNRF  688

Query  457   CQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECN  281
              +L+ +LI+ +DL  W A   +F  L  L +K+C  L+++P  F     L+ I++ +C+
Sbjct  689   MRLEFLLIEDSDLMHWTAGKESFRFLDCLSIKHCYRLKQVPRKFSS--DLREIQVRDCS  745



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score =   141 bits (356),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 171/310 (55%), Gaps = 17/310 (5%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F++L+VLD     +  F   I  L  LRY+   + +  P S ++LC LQT+I +   
Sbjct  145   ISDFKLLKVLDAREIGY-DFSHIIPQLVHLRYVDARIQD--PSSLAKLCNLQTIIIYSRI  201

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               + LP E W M E++HV  ++    P P   ++   ++   L  LQTL+  S    A E
Sbjct  202   NIVQLPVEIWTMSEIKHVIIEQMD-MPNP---LSIEEQQPLFLNNLQTLALDSSPFLA-E  256

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR-PLPSPDAF-  608
             IL + PN+ KL +R         + + C +N    L  LEKL    T+   P     AF 
Sbjct  257   ILKRTPNVDKLKIRAANTHNEWSDFVDCLIN----LQRLEKLSITATEDNSPRILSSAFC  312

Query  607   PPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVMLID  431
              P+LK L L     PW++M+VL+ LPNLEV+K  D+AF G+ W+L E+V F +LK + I 
Sbjct  313   APNLKHLRLAETSLPWEDMAVLANLPNLEVLK-ADHAFTGTDWDLNEDVVFQKLKYLRIK  371

Query  430   IAD-LEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
              AD LE WEA+S +FP L+ LVL++   L +IP  FGE+ TL+ +++  C+ +  DS   
Sbjct  372   RADDLEMWEAASDSFPMLEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARN  431

Query  253   IREEQEDSGN  224
             I E+Q+  GN
Sbjct  432   ILEDQQSWGN  441


 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 166/319 (52%), Gaps = 20/319 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F++L+VLD     +  F   I  L  LRY+   + N  P S ++L  LQT+I +   
Sbjct  990   ISDFKLLKVLDAREIGY-DFSHIIPQLVHLRYIDARIEN--PSSLAKLFNLQTIIVYSRR  1046

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCA--  788
               + LP E W M +++H+  ++    P P +     G++  +   L  L  L+  S    
Sbjct  1047  N-VQLPAEIWTMSQIKHLDIEQMD-MPNPLS----IGDQQPEFLYLNNLQTLALDSSPFL  1100

Query  787   REILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR-PLPSPDA  611
              EIL + PN++KL +R         + + C +N    L  LEKL    T+   P     A
Sbjct  1101  AEILERTPNVEKLKIRAANTHNEWSDFVDCLIN----LQRLEKLSITATEDNSPRILSSA  1156

Query  610   F-PPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVML  437
             F  P+LK L L     PW+EM VL+ LPNLEV+K  D AF G+ W L E+V F +LK + 
Sbjct  1157  FCAPNLKHLRLAYTSLPWEEMDVLANLPNLEVLK-ADSAFNGTDWTLNEDVVFQKLKYLR  1215

Query  436   I-DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             I    DLE+WEA+S NFP L+ LVL++   L EIP   GE+ TL+ +++  CN +   S 
Sbjct  1216  IWSADDLERWEATSDNFPMLEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSA  1275

Query  259   DRIREEQEDSGNDGFTVRI  203
               I +EQ+  GN    + I
Sbjct  1276  RNILQEQQGWGNCELQIEI  1294



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 118/333 (35%), Positives = 171/333 (51%), Gaps = 28/333 (8%)
 Frame = -3

Query  1189  PKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPS  1010
             P+ S    +   R++ L    +LRVLDI    F RFP EIL L  LRYLA+   + LP S
Sbjct  509   PRISATEVLRVLRIKLLGFPRLLRVLDILEVKFRRFPKEILRLINLRYLALST-SKLPSS  567

Query  1009  FSELCRLQTLIRWCNGACLILPE---ETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHW  839
              S L  LQ LI     +  +  E   ET  M +LRH+  K    F V      WY +++ 
Sbjct  568   ISRLWNLQILIVEVIASSCVRLEVTPETLGMAQLRHIKLKG---FYV------WYDDKYR  618

Query  838   D----LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLH  671
             +      +LQ+LS ++       IL  +PNL+KLG+  +E         V ++ +L  LH
Sbjct  619   EDFVVQDQLQSLSTIAISQLTDRILRTIPNLEKLGIFCDEK--------VDHVRDLSRLH  670

Query  670   CLEKLKCFFT-KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAF  494
              L  LKC      R   S   FP SLK+L+LR C     +M+ +  LPNLE++KL+   F
Sbjct  671   KLHSLKCTSVYDGRTHFSNLIFPDSLKKLTLRDCGIRDPDMNRIGKLPNLEILKLQGCQF  730

Query  493   KGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVY  314
                +WE  E  F +L+ +L++  +L  W A   +F +LQ L +++CS L  IP+   ++ 
Sbjct  731   VSRKWEPDEGEFHRLRFLLMENLNLVNWVADESHFRRLQHLFIQHCSDLEAIPLVIRDIP  790

Query  313   TLQSIELWECNSSTYDSVDRIREEQEDSGNDGF  215
             TLQ IE+  C  S  +S   I+EEQ +  NDG 
Sbjct  791   TLQVIEVHNCRPSVMNSARMIQEEQLE--NDGL  821



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 167/347 (48%), Gaps = 40/347 (12%)
 Frame = -3

Query  1237  RLVFYSDVDWNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLK  1058
             R++  +D D+N Y    K + C++     V QL     L V D  +++  RFPS +    
Sbjct  567   RVLRAADTDFNSYG---KNTHCTY-TLEDVFQLVNSRYLAVDDFRYENLFRFPSSV----  618

Query  1057  ILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPV  878
                YL              L  LQTLI   +   ++ P E WKM +LRHV F      P 
Sbjct  619   ---YL--------------LWNLQTLI-VTSIDPVVAPSEIWKMTQLRHVLFPSGLEMPD  660

Query  877   P--GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqL  704
             P  G +     +  + L  LQTLS +    C  E++ ++PN+ KL +  E  ++      
Sbjct  661   PPLGGQ-----DGEFVLGNLQTLSLIRNFKCGEEVVKRIPNITKLKICYEGEKFGGYLSS  715

Query  703   VCYLNNLKVLHCLEKLKCFFTKQRPLPSPDAF-----PPSLKQLSLRGCQRPWKEMSV-L  542
                L NL  L  LE   C+F     L   D       P S+K+L+L      W++M   +
Sbjct  716   YYCLKNLGRLGKLESFDCYFDNGYELNRNDMLQNFIIPNSIKKLTLSWTYLKWEDMKTKI  775

Query  541   SALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI-DIADLEQWEASSINFPKLQSLVL  365
               LPNLEV+KLK  +F G +WE +E  FC L+ + I + +DLE W   S +FP+L+ L L
Sbjct  776   GWLPNLEVLKLKYKSFLGGEWETVEGQFCNLRFLQICEDSDLEWWTTDSTHFPRLEQLKL  835

Query  364   KYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGN  224
                  L+EIP   GE+ TL SIEL  C+ S   S   I +EQED GN
Sbjct  836   WDLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAKEILDEQEDLGN  882



>ref|XP_010319246.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 167/323 (52%), Gaps = 24/323 (7%)
 Frame = -3

Query  1132  FEMLRVLDI--SFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGA  959
             F +LRVL I  +   F  FP  I  L  L+YL +    D+P S S+L  LQTLI      
Sbjct  568   FNLLRVLSIFNTNGYFKSFPLVITKLFHLKYLQVRFDGDIPNSISDLQDLQTLICSNYSF  627

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVP--GTRMTWYGERHWDLPKLQTLSYLSFGSCAR  785
              + LP E W MK LR++     ++ P P  G+ +T        +P L+ LS + F SC  
Sbjct  628   YVNLPREIWMMKNLRYICMGGVTYLPSPRRGSLVT-------RMPNLEELSGVCFTSCTN  680

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPD---  614
             E+ + +PN+K+L +           + +        +  L KL  F  K   L       
Sbjct  681   EVFSGIPNIKRLIIHVPYFRKQFPHRKLD-------MSRLTKLVAFKFKGSTLFQYTIKG  733

Query  613   -AFPPSLKQLSLRGCQRPWKEMS-VLSALPNLEVVKLKDYAFKGSQWELIEE-VFCQLKV  443
               FP SL++LSL  C   W ++S ++  LPNLE +KLK        W L +E  F  LK+
Sbjct  734   FGFPTSLRRLSLTLCSFVWADISPIVMMLPNLEELKLKQCGDMLKTWRLSDEDKFKSLKL  793

Query  442   MLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDS  263
             +L+  + L+ WEA+S NFP L+ LVLK C  L+EIP  FGE+ TL+SIEL  C+++  DS
Sbjct  794   LLLSGSSLKHWEATSDNFPNLKRLVLKNCYRLQEIPADFGEIGTLESIELHNCSTTADDS  853

Query  262   VDRIREEQEDSGNDGFTVRIHRG  194
                I +EQE+ GN    V IH+ 
Sbjct  854   AREIVQEQEEMGNYFLKVYIHKS  876



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 172/347 (50%), Gaps = 30/347 (9%)
 Frame = -3

Query  1225  YSDVDWNDYKDLPKPSICSFIAFGRVQQLNGFEMLRVLDISFQSFMRFPSEILCLKILRY  1046
             YSD+D+ +         CS ++         F++L+VLD+ +     F   I  L  LRY
Sbjct  515   YSDLDFTE-------RFCSIVS--------QFKLLKVLDV-YNVRCDFSCVIPKLIHLRY  558

Query  1045  LAIGLFNDLPPSFSELCRLQTLI-RWCNGACLILPEETWKMKELRHVYFKKSSHFPVP--  875
             +A  +  D  PS ++L  LQ++I R      L LP+E W M E+RH+  + S H P P  
Sbjct  559   VAANI--DEAPSLAKLWNLQSIILRNFASKDLHLPQEIWTMSEIRHLDIRWSIHMPNPLA  616

Query  874   GTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCY  695
                     E+   L  LQTL       C+   L ++        +    +  R       
Sbjct  617   AESHNSIEEQPLFLNNLQTLVL-----CSSPYLVEILRRTPYLNKLTVLDESRHSDCPAI  671

Query  694   LNNLKVLHCLEKL--KCFFTKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLE  521
             L+ L +L  LE L  +        + S D FPP+LKQL L      W++M VL+ LPNLE
Sbjct  672   LDPLSLLQELETLTIEADLGSDPMILSRDIFPPNLKQLKLSYTTLQWEDMVVLANLPNLE  731

Query  520   VVKLKDYAFKGSQWELIEEV-FCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLR  344
             V+K    AF+G+ W L E+V F +LK + +    LE+WEA++ NFP L+ L+L     L 
Sbjct  732   VLKAYS-AFEGTYWRLNEDVVFQKLKYLRLQYGSLERWEATNDNFPMLEQLLLYGFRKLE  790

Query  343   EIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRI  203
             EIP   GE+  L+ I++  C+++   S  +I++EQE  GN G  VRI
Sbjct  791   EIPQSIGEIMILKLIQIERCSAAAVTSAKKIQQEQESWGNYGLQVRI  837



>ref|XP_011084836.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=481

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 149/277 (54%), Gaps = 16/277 (6%)
 Frame = -3

Query  1021  LPPSFSELCRLQTLIRWCNG-----ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTW  857
             LP S S+L  LQTL+    G     + L+LP + W+M +LRH+ F + S    P      
Sbjct  127   LPLSISKLKILQTLMIRVYGWDTSDSILVLPFQIWEMPKLRHLIFFQGSMLHTPSAAAPS  186

Query  856   YGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKV  677
              G+    L  LQTL   +F   +  I   +PNLKKL L  ++    +  +    LNNL  
Sbjct  187   GGQV---LENLQTLYVDNFRFTSNTI-EMIPNLKKLKLYYDDASTAKWAKYC--LNNLVH  240

Query  676   LHCLEKLKCFFT-----KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVK  512
             L  LE L   FT     +  P P+  AFPP LK+L+L  C+ PW+ M+V+ +L NLEV+K
Sbjct  241   LCQLETLNLMFTFMLMCEVDPFPASFAFPPKLKKLTLSKCRLPWQGMAVIRSLLNLEVLK  300

Query  511   LKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPI  332
             L+  A  G +WE  +  F +LK +L++  +L  W   S +FP L+ LV+K C  L +IP 
Sbjct  301   LRYIAIIGEEWEYSDGEFQRLKFLLMEKLNLRSWSVESTHFPCLERLVIKQCLQLEDIPC  360

Query  331   GFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGND  221
               G++ TL+ IE+   + S  DS   I+EEQ   GND
Sbjct  361   EIGDIPTLELIEVDGGSKSAADSAVFIQEEQRSLGND  397



>emb|CDP21622.1| unnamed protein product, partial [Coffea canephora]
Length=935

 Score =   140 bits (352),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 166/327 (51%), Gaps = 42/327 (13%)
 Frame = -3

Query  1129  EMLRVLDIS---FQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCN  965
             ++LRVLD+    F+++  FP E+  L  LRYLA+     N +P + + L RLQT +   N
Sbjct  622   KLLRVLDLGELVFRAY--FPMEVFLLVHLRYLALRTKEVNFVPAAIANLSRLQTFLLRGN  679

Query  964   GACLILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYLSFG-  797
             G   +LP+  W +K LRH++         FPV    ++         P L  L  LS   
Sbjct  680   GIDCLLPKTIWSIKTLRHLWITDPDAGFMFPVENLEVS---------PGLDHLDTLSLAI  730

Query  796   ----SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLK----CFFT  641
                    +++LT++PN+++L     E   +         N +    CL +L+    C F 
Sbjct  731   DPSSQNLQKMLTKLPNIRRLRCEMTESTRIG--------NGILGFDCLSQLESLTLCLFH  782

Query  640   KQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV  461
                       FP +LK+L+L   ++PW E+S +  LP LEV+KL   +F G +WE+ E  
Sbjct  783   GY-----GFKFPLNLKKLTLFCNKQPWSEISTIGKLPKLEVLKLLHDSFVGEEWEMKEGE  837

Query  460   FCQLKVM-LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWEC  284
             F  L+V+ L  + D   W ASS NFP L+ LV+++C  L E+P   GE  TL+ IE+  C
Sbjct  838   FPSLRVLKLRALWDFRSWTASSDNFPHLEKLVVEWCRELEEVPFCLGECPTLEMIEVRGC  897

Query  283   NSSTYDSVDRIREEQEDSGNDGFTVRI  203
               S   SV +I++EQ D GN+   + I
Sbjct  898   RESVASSVKQIQQEQIDMGNEVLKILI  924



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 110/316 (35%), Positives = 154/316 (49%), Gaps = 18/316 (6%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFND-LPPSFSELCRLQTLIRWCNGA  959
              F++LRVL+     F  FP ++  L +L+Y+++    D LPP+ S L  LQTLI      
Sbjct  378   AFKLLRVLEAKSLRFAVFPPDLCQLVLLKYISMSCKLDILPPAMSTLWSLQTLIVDTTAR  437

Query  958   CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDL--PKLQTLSYLSFGSCAR  785
              L +  + WKM +LRH++   S+  P P T       R   L    LQTLS +S  SC +
Sbjct  438   TLQIKSDIWKMPQLRHLHTNASTSLPCPTT------PRCETLVNANLQTLSSISPQSCTK  491

Query  784   EILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCF----FTKQRPLPSP  617
             E+  + P LKKL +  +     R         +L  L  LE LK       +  + LP  
Sbjct  492   ELFERTPKLKKLAICGKLAVLFRANGRSNVFESLCALDFLENLKLLNEYVSSPLKRLPQE  551

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
               FP  L  L+L     PW +MS L  L NLEV+KLK  AFKG +W      F  L+ + 
Sbjct  552   HNFPRKLTMLTLSKTLLPWNQMSTLGKLANLEVLKLKINAFKGDRWRTESGGFQSLQFLH  611

Query  436   IDIADLEQWE-ASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             I    L  W+ A++ + P L+SLVLK+C  LR +P   G + TLQ I+L   N S   S 
Sbjct  612   IGSTGLSSWDVAAADHLPVLKSLVLKHCPDLRRLPPSLGHISTLQLIDLSCTNPSVASSA  671

Query  259   DRIR----EEQEDSGN  224
               I     ++ +  GN
Sbjct  672   KDIENLKLKQAQQKGN  687



>emb|CDP11831.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 171/351 (49%), Gaps = 40/351 (11%)
 Frame = -3

Query  1240  SRLVFYSDVDWNDY--KDLPKPSICSFIAFGRVQQ----------LNGFEMLRVLDISFQ  1097
             SR +F  +  ++DY     P  ++ SF++FG+ +              F +LRVLDI   
Sbjct  488   SRRLFCINSQFSDYISNQQPAQNVRSFLSFGQEETTLNQDLCPNVFKQFNLLRVLDILSI  547

Query  1096  SFM--RFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCNGACLILPEETWKM  926
                  RFP ++  L +L+++AI      LP   S L  L+TL+       L +    W M
Sbjct  548   KLPGPRFPVQLPNLILLKFIAIYCDLKTLPEEMSSLLNLKTLVVRTTSLALAIEANIWAM  607

Query  925   KELRHVYFKKSSHFP-----VPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPN  761
              +LRH++   S+  P      PG      GE       LQTLS +S  S  +E+  +  N
Sbjct  608   TKLRHLHTNTSTTLPKCPDQSPG------GE------NLQTLSTVSPESLTKEVFKRAKN  655

Query  760   lkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFF----TKQRPLPSPDAFPPSLK  593
             LKKLG+R +    +       + ++L  +  LE LK +     +K   LP    FPP L 
Sbjct  656   LKKLGIRGKLHNLVEGNGESSFFDSLCEVDSLENLKLYGDDVNSKLLALPQAHKFPPRLT  715

Query  592   QLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQ  413
             +LSL      W  MS+L  L  LEV+KLKDYAFKG  W+  +  F  LKV  I   DL +
Sbjct  716   RLSLHNTSLDWNYMSILGDLRYLEVLKLKDYAFKGDYWKTKQGGFPSLKVFFIGATDLTR  775

Query  412   WEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             W+A + +FP+L+ L+LK C  L+ IP  F  +  L+ I++      T DSV
Sbjct  776   WDAKANDFPELKCLILKQCKTLQRIPSDFAFMKNLEMIKV----EHTKDSV  822



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 165/319 (52%), Gaps = 20/319 (6%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNG  962
             ++ F++L+VLD     F  F   I  L  LRY+     ND P S ++L  LQ++I +   
Sbjct  555   ISDFKLLKVLDAHEIGF-DFSRIIPQLVHLRYVD-ARVND-PSSLAKLFNLQSIIIYSQK  611

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
               + LP E W M E+  V    +   P P       GE+   +  L TL+  S  +   +
Sbjct  612   KNVQLPTEIWTMSEIERVDIT-AVDMPNPPI-----GEQPLFMNNLHTLAVKS-SAVVLK  664

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLP---SPDA  611
             IL ++PNL KL + +             +L+ L VL  L  L          P   S D 
Sbjct  665   ILRRIPNLNKLKINDVRRTEWY-----AFLDCLIVLQGLVTLNIQAAASLNSPFFLSRDI  719

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEV-FCQLKVMLI  434
             F P+L +LSL     PW++M+VL+ LPNLEV+K  D AF G+ W+L E+V F +L  + +
Sbjct  720   FLPNLTKLSLNSTFFPWEDMAVLAKLPNLEVLK-ADNAFWGTDWKLDEDVVFPKLNCLAV  778

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                +LE+WEA+S NFP L+ L L +   L EIP   GE+ TL+SIE+  CNS+   S  +
Sbjct  779   RHGNLERWEATSDNFPMLEELYLSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITSAKQ  838

Query  253   IREEQEDSGNDGFTVRIHR  197
             IRE QE  GN  F +R  R
Sbjct  839   IRENQEIYGNYEFQLRFVR  857



>gb|EYU29923.1| hypothetical protein MIMGU_mgv1a026346mg, partial [Erythranthe 
guttata]
Length=303

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 146/296 (49%), Gaps = 29/296 (10%)
 Frame = -3

Query  1024  DLPPSFSELCRLQTLIRWCNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGER  845
              LP S S L  LQTL +      +  P E W M +LRH+ F    + P P  R     E 
Sbjct  16    QLPFSISLLWNLQTL-KIAGFGGVFAPPEIWAMPQLRHLEFSTWIYLPDPSFRR----EE  70

Query  844   HWD---LPKLQTLSYLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVL  674
               +   L  LQTL  +       E+  ++PN+KKL +               +L N+  L
Sbjct  71    KVNVIVLKNLQTLKRVLNLKLTDEVCKRLPNVKKLKIMYFGLSKSSRYN---HLYNIGRL  127

Query  673   HCLEKLKCFF---------------TKQRP---LPSPDAFPPSLKQLSLRGCQRPWKEMS  548
             H LE L+ +F               +  RP   L     FP SLK+L+L G    W+E+ 
Sbjct  128   HKLESLRVYFCGDFSVFQILKYIVCSPLRPRGNLLKNLKFPTSLKKLTLSGSNLDWEELK  187

Query  547   VLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIADLEQWEASSINFPKLQSLV  368
              + +LPNLEV+KL+ ++ +GS+W  IE  F +LK + I  + L+ W A S +FP L++LV
Sbjct  188   GIGSLPNLEVLKLEYHSVRGSKWNPIEGQFLRLKYLRIAHSTLKYWNAESFHFPALENLV  247

Query  367   LKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             L+    L EIP G GE+ TL  I L++C+ S   S   I EEQ+  GN+   VRI 
Sbjct  248   LQKLHKLAEIPSGIGEIPTLGLIHLYDCSKSAAISAMGILEEQQSQGNEDLRVRIQ  303



>gb|EYU24400.1| hypothetical protein MIMGU_mgv1a026464mg, partial [Erythranthe 
guttata]
Length=731

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 163/302 (54%), Gaps = 22/302 (7%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCN-  965
             L+   +LR+LD     F  FP E++ L  LRYLA+    +LP S S+L  L+ LI   + 
Sbjct  419   LDHSRLLRMLDALTIRFYLFPIEVIKLIELRYLALTYNGNLPSSISQLSSLECLIVGRHL  478

Query  964   -----GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSF  800
                  G    LP E W MK+L+H+         + GT +    E  + LP L TLS ++ 
Sbjct  479   VIRPAGRPPCLPLEIWDMKKLKHLR--------IMGTEIPDPCEGSF-LPNLSTLSDMNT  529

Query  799   GSCAREILTQVPNlkklglreeegeylrdeqL-VCYLNNLKVLHCLEKLKCFFTK---QR  632
              SC R +L  +PNLKKLG+R E    +   Q  +   +++  L  LE LKC       + 
Sbjct  530   RSCTRSVLESIPNLKKLGIRIEISPDVTTYQEPLSCFDHISHLEKLESLKCVIVNPILKN  589

Query  631   PLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQ  452
             P P    FP  LK+LSL G   PW+EMS +  LPNLEV+KL+  AF+G +WE+  + F +
Sbjct  590   P-PPLSIFPSGLKKLSLSGLGYPWEEMSKIDLLPNLEVLKLRCCAFRGPRWEVETKRFLR  648

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             L+ +LI+ +DL  W A   +FP L  L +K+C  L+EIP   G  + L  I++ +C+ S 
Sbjct  649   LEFILIEDSDLVHWTAGRGSFPFLDCLSIKHCYKLQEIPRRLG--FELGKIQVVDCSPSI  706

Query  271   YD  266
              +
Sbjct  707   VN  708



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 106/306 (35%), Positives = 152/306 (50%), Gaps = 11/306 (4%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGL--FNDLPPSFSELCRLQTLIRWCNG  962
              F +LRV D       RF  E   L  LRY+A  L     LP    EL  +QTLI     
Sbjct  164   AFPLLRVFDTESIKINRFCKEFFQLYHLRYIAFSLDSIKFLPKHVGELWNVQTLIVNTQQ  223

Query  961   ACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCARE  782
                 +  +   M  LRH++   S+  P P    T   +       LQTLS ++  SC   
Sbjct  224   INFDIQADILNMPRLRHLHTNTSAKLPTPANPKT--SKTTLVNQSLQTLSTIAPESCTEY  281

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRP-----LPSP  617
             +L++ PNLKKLG+R +  + +   + + + NN+K L  LE LK     Q       LP  
Sbjct  282   VLSRAPNLKKLGIRGKIAKLMEPSRSILF-NNVKRLQFLENLKLINVGQTDQTQLRLPPA  340

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVML  437
               FP  L++L+L      W +MSVL  L  L+V+KLKD AFKG  WEL +  F  L+V+ 
Sbjct  341   SLFPTKLRRLTLSDTWLEWDDMSVLKQLEYLQVLKLKDNAFKGEHWELNDGGFPFLEVLC  400

Query  436   IDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVD  257
             I+ A+L  W AS  +FP+L+ L +  C  L +IPIG  ++ +LQ ++L     S   S  
Sbjct  401   IERANLVSWNASGDHFPRLKHLHIS-CDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAR  459

Query  256   RIREEQ  239
              I+ ++
Sbjct  460   EIQAKK  465



>ref|XP_009618258.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618266.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618270.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana tomentosiformis]
Length=1741

 Score =   140 bits (353),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 171/324 (53%), Gaps = 16/324 (5%)
 Frame = -3

Query  1138  NGFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTLIRWCN  965
             + F++++VLD+ SF     FPSEI  L  LRY A     + +P S ++L  L+T +    
Sbjct  1409  DNFKLVKVLDLESFNIGGTFPSEIQSLIHLRYFAARTGASSIPSSIAKLWNLETFVVRGL  1468

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWD--LPKLQTLS--YLSFG  797
             G  + LP    K+ +LRH++ K  + F +        GE   D  L  L+T S  +LS+G
Sbjct  1469  GGEVKLPSSLLKLVKLRHIHVKNCASFSLHDN----MGESLADCQLDNLETFSTPHLSYG  1524

Query  796   SCAREILTQVPNlkklg-lreeegeylrdeqLVCYL-NNLKVLHCLEKLKCFFTKQRP--  629
                  IL +VP L+KL  +  E   Y +     C L   L+ L  LE LK   +   P  
Sbjct  1525  EDTEMILRKVPKLRKLSCIFSETFGYSKIVMGRCVLFPRLESLSHLESLK-LISNSYPAK  1583

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQL  449
             LP   +FP  L++L+L   + PW ++S +  LPNLE++KL   AF+G+ WE+ +  F +L
Sbjct  1584  LPHVFSFPSRLRELTLSKFRLPWGQISTIGELPNLEILKLHLRAFEGNHWEVKDSEFPEL  1643

Query  448   KVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTY  269
             K + +D  ++ QW  S   FPKL+ LVL  C  L +IP  F +  +L+SIE+  CN    
Sbjct  1644  KYLELDDINIAQWSVSDDAFPKLKCLVLIKCKRLEKIPSHFDDSVSLRSIEVNWCNWFVA  1703

Query  268   DSVDRIREEQ-EDSGNDGFTVRIH  200
             +S   I+  Q E+  N  FTVRI 
Sbjct  1704  NSAQEIQTTQHEEMANGAFTVRIQ  1727



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score =   140 bits (353),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 170/317 (54%), Gaps = 12/317 (4%)
 Frame = -3

Query  1135  GFEMLRVLDI-SFQSFMRFPSEILCLKILRYLAIGL-FNDLPPSFSELCRLQTL-IRWCN  965
              F++L+VLD+ +      F   I  L  L +LA+G   + +P S + L  L+TL ++   
Sbjct  1140  NFKLLKVLDLEAINMGSSFADGIDSLIQLIFLAVGGDIDSIPSSLANLRNLETLLVKGLK  1199

Query  964   GACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY--LSFGSC  791
             G  ++LPE  W+M  LRHV+ K ++ F +   ++T  G   + L  L +LS   L FG  
Sbjct  1200  GKKVLLPESIWRMTSLRHVHVKNNASFTLQ-PKVTGIG---FQLKNLVSLSVPSLIFGED  1255

Query  790   AREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSPDA  611
             A E++  +PNL++L     +    RD         L+ L  LE LK  +  +    SP  
Sbjct  1256  ADEMIRMLPNLRELSCIFSKSRGSRDYYQ---FPRLEKLTQLESLKIVYRGRTIKTSPFN  1312

Query  610   FPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLID  431
             FP  LK+L+L      W  +S + +L NLE++KL    F+ ++WE+ E  F +LK + +D
Sbjct  1313  FPLGLKKLTLINFFLRWDHISTIGSLENLEILKLLSSTFEDTRWEMKEGEFHKLKYLKLD  1372

Query  430   IADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDRI  251
               ++  W AS  + P LQ LVL+ C +L+E+PI F  + TLQ IE+  C  S  +++ R+
Sbjct  1373  SPNIVNWVASCDDLPNLQQLVLQKCENLKEVPIDFVRIPTLQLIEVQRCGDSVEEAIRRL  1432

Query  250   REEQEDSGNDGFTVRIH  200
             ++EQ + G +   V I+
Sbjct  1433  QQEQFEYGIEDLKVLIN  1449



>gb|EYU17708.1| hypothetical protein MIMGU_mgv1a001149mg [Erythranthe guttata]
Length=877

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 111/328 (34%), Positives = 172/328 (52%), Gaps = 33/328 (10%)
 Frame = -3

Query  1141  LNGFEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCN-  965
             L    +LRVL+     F  FP E+L L  LRYLA+    +LP S S+L  LQ LI + + 
Sbjct  555   LEHLRLLRVLEARSIRFYEFPMEVLKLVQLRYLALLYNGNLPSSISKLWNLQYLIVFQHP  614

Query  964   ------GACLILPEETWKMKELRHV--YFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSY  809
                   G  L LP E W M EL+++  Y ++  H    G+           +P L  LS 
Sbjct  615   RIVKSVGNLLYLPIEIWNMNELKYLQTYGRELPHPCCEGSL----------IPNLLNLSG  664

Query  808   LSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR-  632
             +   SCA+ +L ++PNLK+L +  E      +    C+ +++ +LH L++L C+      
Sbjct  665   VGPQSCAKSVLEKIPNLKELRINIELAPDATEPL-TCF-DHISLLHQLQELGCYIMNPTL  722

Query  631   ------PLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI  470
                   PL     FP SL +L LRG   PW+EM  +S+LPNL  + L+ YAF+G +WE+ 
Sbjct  723   KTDVVTPLVPLSDFPSSLTELHLRGLGYPWEEMRKISSLPNLTHLLLECYAFRGPKWEVR  782

Query  469   EEVFCQLKVMLIDIADLEQWEASSIN-FPKLQSLVLKYCSHLREIPIGFGEVYTLQSIEL  293
             +  F +L+ + I+  DLEQW   + +  P + SL + +C  L+EIP+ FG+  +L  I L
Sbjct  783   DNEFQRLESLEIEDIDLEQWTFQNCHCLPVIVSLHIAHCYKLKEIPLTFGK--SLVHITL  840

Query  292   WECNSSTYDSVDRIREEQED--SGNDGF  215
              ECN        ++++E +D  +G + F
Sbjct  841   VECNPMAVKCAIKLKKEWDDKYAGRERF  868



>gb|EYU17689.1| hypothetical protein MIMGU_mgv1a024130mg [Erythranthe guttata]
Length=872

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 169/329 (51%), Gaps = 23/329 (7%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLI---RWC--  968
               +LRVLD     F  FP E+L L  LRYLA+     LPPS S+L +L+ LI    +C  
Sbjct  554   LRLLRVLDALTIRFYEFPIEVLKLIQLRYLALTYNGILPPSISKLWKLEYLIVHRHFCIV  613

Query  967   -NGA--CLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFG  797
              +GA     LP E W MKEL+H+      + P P             LP L TL  +S  
Sbjct  614   KSGANYSSYLPMEVWDMKELKHLEVT-GRNLPNPSEGSL--------LPNLLTLLDVSPQ  664

Query  796   SCAREILTQVPNlkklglreeegeylrdeqL----VCYLNNLKVLHCLEKLKCFFTKQRP  629
             SC +++   +PNL+KLG+R E      +       V +LN LK L C+     F TK   
Sbjct  665   SCTKDVFEGMPNLQKLGIRIEFAPDASESSNCFDHVSHLNELKSLKCVVVNPVFDTKVVA  724

Query  628   LPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELI-EEVFCQ  452
              P    FP  LK+LSL G   PW++M+ ++ LPNLEV+KL+ +AF+GS WE+    +F +
Sbjct  725   PPKFSIFPERLKKLSLSGFGYPWEDMNKIALLPNLEVLKLQCHAFRGSIWEMHGSALFRE  784

Query  451   LKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSST  272
             L+ +LI+  DL  W A   +FP L+ L +K+C  L  IP        L+ IE+ +CN S 
Sbjct  785   LRYLLIEDTDLVHWTAEDGSFPWLKRLSIKHCYKLERIPRRLITYGFLELIEVVDCNPSV  844

Query  271   YDSVDRIREEQEDSGNDGFTVRIHRGHND  185
              +    I EE  +  N+   VRI     D
Sbjct  845   VNVALEI-EESREKRNNYIDVRIRSSWED  872



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 166/325 (51%), Gaps = 25/325 (8%)
 Frame = -3

Query  1132  FEMLRVLDISFQSFMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTL------IRW  971
             F++LRVLD+  +    FP  IL L +LRYLA+ +        S+L  LQTL      I  
Sbjct  549   FKLLRVLDLEKKMIFDFPIVILDLVLLRYLALTIRRSGILPISKLLNLQTLTVRPHPIYT  608

Query  970   CNGACLILPEETWKMKELRHVYFKKSSHFPVPGTRMTWYGE-RHWDLPKLQTLSYLSFGS  794
              +G    LP   WK+ +LRH++        +   +M    E ++  L  +QT+S L    
Sbjct  609   SSGKMYSLPNFIWKLSQLRHLH---CWCMYLDSPQMVSENEVKNLVLENIQTVSGLIPSC  665

Query  793   CAREI---LTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCL-------EKLKCFF  644
             C +EI   + +V  L+  G  +E    +  E  + YL  L+ L+         ++L C  
Sbjct  666   CTKEIFEAIKKVKKLEIAGKAKEFQSEMGWETNLKYLKELEALNVTVLPAVISDRLPCLI  725

Query  643   TKQRPLPSPDAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEE  464
                   P P +FPP+LK+L+L     PW  M++ S LPNLEV++LK+YAF G +WE+ E 
Sbjct  726   N-----PGPGSFPPNLKKLTLSRTCLPWNCMNIFSKLPNLEVLELKNYAFSGDEWEITEM  780

Query  463   VFCQLKVMLIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWEC  284
              F +LK +L++   L  W A+   F  L+ + ++ C  L+EIP GF +  TLQ IEL +C
Sbjct  781   GFPKLKCLLLEDLYLRYWTATDDYFQCLERVCIRECRLLQEIPEGFADSVTLQLIELHKC  840

Query  283   NSSTYDSVDRIREEQEDSGNDGFTV  209
                      +I+E  E+ GN+   V
Sbjct  841   YHPLVTFAKQIQETHEELGNNMLKV  865



>emb|CDP15705.1| unnamed protein product [Coffea canephora]
Length=1302

 Score =   140 bits (352),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 105/311 (34%), Positives = 162/311 (52%), Gaps = 21/311 (7%)
 Frame = -3

Query  1129  EMLRVLDISFQSFMR-FPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGACL  953
             ++LRVLD+    F + FP E++ L  LRYL +     +P +   L RL+ LI     + +
Sbjct  958   KLLRVLDLGVFKFGKSFPMEVVLLIHLRYLVLNGIRSIPSAIDNLSRLKILIVQKPLSVV  1017

Query  952   ILPEETWKMKELRHVYFKKSSH-FPVPGTRMTWYGERHWDLPKLQTLSYLSFGS--CARE  782
              LP+  W +K L ++  K  SH F  P   +    E   DL  L TLS     S  C ++
Sbjct  1018  ELPDTIWNIKTLSYLRTKDRSHGFIFPDGNL----EVSPDLDHLDTLSLAIDPSSQCLQK  1073

Query  781   ILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLK----CFFTKQRPLPSPD  614
             IL ++P++++L     +             N + V  CL  L+     FF          
Sbjct  1074  ILKKLPSIRRLKCGRSDDFKAAARN----CNKILVFDCLNHLQSLRLTFFDGYGF-----  1124

Query  613   AFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLI  434
              FP +LK+L+L+   +PW E+S +  LP+LEV+KL   +F G +W + E  F  L+V+ +
Sbjct  1125  KFPLNLKKLTLKWNSQPWSEISTIGKLPHLEVLKLLQDSFVGEEWVVKEGEFPNLRVLQL  1184

Query  433   DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSVDR  254
                D+ +W ASS NF  L+ LV+ +C  L E+P   GE  TL+ IE+  C+ S  +SV++
Sbjct  1185  STLDICRWTASSGNFSHLEKLVVNWCEELEEVPSCLGECPTLEMIEVKWCHESILNSVEQ  1244

Query  253   IREEQEDSGND  221
             IR+EQ D GN+
Sbjct  1245  IRQEQMDGGNE  1255



>gb|EYU24406.1| hypothetical protein MIMGU_mgv1a002161mg [Erythranthe guttata]
Length=707

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 153/286 (53%), Gaps = 26/286 (9%)
 Frame = -3

Query  1093  FMRFPSEILCLKILRYLAIGLFNDLPPSFSELCRLQTLIRWCNGAC------LILPEETW  932
             F  FP ++L L  LRYL++    +LP S S+L  L+ LI     A       L LP E W
Sbjct  403   FYLFPIDVLKLVELRYLSLTYNGNLPSSISKLSNLECLIVGRPLAITSVENPLCLPVEIW  462

Query  931   KMKELRHVYFKKSSHFPVPGTRMTWYGERHWDLPKLQTLSYLSFGSCAREILTQVPNlkk  752
              MK+L+H+ F  S+  P PG            LP L TLS +S  SC   +   +PNLKK
Sbjct  463   DMKKLKHLQFTGSNQVPDPGEGSF--------LPNLVTLSDISARSCNTGVFRSIPNLKK  514

Query  751   lglreeegeylrde-------qLVCYLNNLKVLHCLEKLKCFFTKQR---PLPSPDAFPP  602
             LG+R E       +       Q + +L  L+ L C+     F T      P P    FP 
Sbjct  515   LGIRIELSPDEATDREPLSCFQHISHLEKLESLKCVVVNPIFNTTGIAVCPPPPLSVFPS  574

Query  601   SLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVMLIDIAD  422
              LK+LSL G   PW+EMS ++ LPNLEV+KL+ YAF+G +WE+ +  F +L+ +LI+ +D
Sbjct  575   GLKKLSLCGLGYPWEEMSKIALLPNLEVLKLRSYAFRGPKWEVEDNRFLRLEFILIEDSD  634

Query  421   LEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWEC  284
             L +W A + +FP L+ L +K+C  L+ +P  F   + L  I++ +C
Sbjct  635   LVRWTAGNGSFPFLECLNIKHCYKLQAMPRKFS--FDLGKIQVVDC  678



>gb|EYU21846.1| hypothetical protein MIMGU_mgv1a022576mg, partial [Erythranthe 
guttata]
Length=348

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 116/334 (35%), Positives = 166/334 (50%), Gaps = 35/334 (10%)
 Frame = -3

Query  1135  GFEMLRVLDISFQSFMRFPS------EILCLKILRYLAIGL----FNDLPPSFSELCRLQ  986
              F +LRVL    ++   +        ++  L  LR+LAIG         P S   L  LQ
Sbjct  6     SFRLLRVLKAVDENLYSYEENSYSLEDVFRLVNLRFLAIGADWRQIPTFPSSVYLLWNLQ  65

Query  985   TLI-RWCNGACLILPEETWKMKELRHVYFKK-SSHFPVPGTRMTWYGERHWDLPKLQTLS  812
             TLI +  + A  + P E WKM +LRHV F +     P PG +     +  + L  LQTL 
Sbjct  66    TLIVKGIDDA--VAPPEIWKMPQLRHVQFDQLEMPDPPPGGQ-----DDEFVLGNLQTLL  118

Query  811   YLSFGSCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQR  632
              +    C  E++ ++PN+ KL +   E E          LNNL  L  LE L+  F+   
Sbjct  119   EIRNFRCGEEVVKRIPNVNKLQICCNEFEGFSSYC----LNNLGRLCKLESLR--FSLYS  172

Query  631   PLPSPD--------AFPPSLKQLSLRGCQRPWKEMSV-LSALPNLEVVKLKDYAFKGSQW  479
              +  P+          P SLK+L+L G  + W++M   +  LPNL+V+KLK+ +F G +W
Sbjct  173   LIKKPNRNDLMQNLILPNSLKKLTLYGTNQYWEDMKTKIGLLPNLQVLKLKENSFVGPEW  232

Query  478   ELIEEVFCQLKVMLI-DIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQS  302
             E  E  FC L+ + I    DLE W   S +FP+L+ L L+Y   L EIP   GE+ +L+S
Sbjct  233   ETAEGQFCSLRFLQIFGCRDLECWTTDSTHFPRLEHLDLQYLDKLEEIPSCIGEISSLES  292

Query  301   IELWECNSSTYDSVDRIREEQEDSGNDGFTVRIH  200
             I L  C+ +   S  RI +EQE+ GN G  VR  
Sbjct  293   IYLEICSDAAVISAKRILDEQEELGNSGIRVRAQ  326



>emb|CDP18040.1| unnamed protein product [Coffea canephora]
Length=1243

 Score =   139 bits (351),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 168/324 (52%), Gaps = 21/324 (6%)
 Frame = -3

Query  1129  EMLRVLDISFQSF-MRFPSEILCLKILRYLAI--GLFNDLPPSFSELCRLQT-LIRWCNG  962
             ++LRVLD+    F   FP E+  L  LRYLA+   L + +P + + L RLQT L+R    
Sbjct  927   KLLRVLDLGELEFGAYFPMEVFLLAHLRYLALRLNLIDSIPTAIANLSRLQTFLLRGGYF  986

Query  961   ACLILPEETWKMKELRHVYFKKSSH---FPVPGTRMTWYGERHWDLPKLQTLSYL--SFG  797
                +LP+  W +K LRH++    +    FPV       Y E    L  L TLS    S  
Sbjct  987   TYCLLPKTIWNIKTLRHLWTTNPATGFIFPVE------YLEVSPGLDHLDTLSLAIDSSS  1040

Query  796   SCAREILTQVPNlkklglreeegeylrdeqLVCYLNNLKVLHCLEKLKCFFTKQRPLPSP  617
                ++ILT++PN+++L     +               + V  CL +L+   T +      
Sbjct  1041  QSLQKILTKLPNIRRLSCNMRKSREEATRIG----ERILVFDCLSQLESL-TLRFLYGYG  1095

Query  616   DAFPPSLKQLSLRGCQRPWKEMSVLSALPNLEVVKLKDYAFKGSQWELIEEVFCQLKVM-  440
               FP +LK+L+L   ++PW E+S +  LP LEV+KL D +  G +WE+ E  F  L+V+ 
Sbjct  1096  FKFPLNLKKLTLFYNKQPWSEISTIGKLPKLEVLKLLDDSVVGEEWEMKEGEFPSLRVLK  1155

Query  439   LIDIADLEQWEASSINFPKLQSLVLKYCSHLREIPIGFGEVYTLQSIELWECNSSTYDSV  260
             L ++ +L  W ASS NFP L+ LV++ C +L E+P   GE  TL+ IE+  C  S   SV
Sbjct  1156  LSNLWNLRSWTASSDNFPCLEKLVVRNCENLEEVPSCLGECPTLEMIEVKRCRESVASSV  1215

Query  259   DRIREEQEDSGNDGFTVRIHRGHN  188
              ++++EQ D GN+   + I    N
Sbjct  1216  KQVQQEQIDMGNEVLKILIEMCAN  1239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3141968393492