BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21343_g2_i1 len=108 path=[3595:0-107]

Length=108
                                                                      Score     E

ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      57.8    1e-08   
ref|XP_009352952.1|  PREDICTED: fruit bromelain-like                  57.4    2e-08   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                      57.4    2e-08   
gb|AAQ54544.1|  cysteine proteinase                                   54.3    3e-08   Malus domestica [apple tree]
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...  56.6    4e-08   
ref|XP_006852525.1|  hypothetical protein AMTR_s00021p00178750        55.1    5e-08   
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...  54.3    6e-08   
ref|XP_008350674.1|  PREDICTED: zingipain-2-like                      54.7    1e-07   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                      54.7    2e-07   
ref|XP_008371737.1|  PREDICTED: vignain-like                          53.5    2e-07   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                  54.7    2e-07   
ref|NP_001148894.1|  LOC100282514 precursor                           54.7    2e-07   Zea mays [maize]
emb|CAQ00119.1|  papain-like cysteine proteinase                      53.1    2e-07   Hordeum vulgare subsp. vulgare [barley]
tpg|DAA40428.1|  TPA: Vignain                                         54.7    2e-07   
ref|XP_002462602.1|  hypothetical protein SORBIDRAFT_02g028840        54.7    2e-07   Sorghum bicolor [broomcorn]
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                      54.7    2e-07   
ref|NP_568651.1|  cysteine protease SAG12                             54.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865220.1|  senescence-associated gene 12                    54.3    2e-07   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                      54.3    3e-07   
gb|AAC49135.1|  SAG12 protein                                         54.3    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87758.1|  BnaC02g31910D                                        53.9    3e-07   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease       53.9    3e-07   Brassica napus [oilseed rape]
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      53.9    3e-07   
gb|AEK97329.1|  chromoplast senescence-associated protein 12          53.5    3e-07   
ref|XP_004308225.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  53.9    4e-07   
gb|AAC35211.1|  cysteine proteinase                                   53.9    4e-07   Hemerocallis hybrid cultivar
ref|XP_009128825.1|  PREDICTED: ervatamin-B                           53.9    4e-07   
ref|XP_004243398.1|  PREDICTED: ervatamin-B                           53.9    4e-07   
ref|XP_006348972.1|  PREDICTED: oryzain alpha chain-like              53.1    5e-07   
ref|XP_009790365.1|  PREDICTED: ervatamin-B-like                      53.1    5e-07   
gb|KFK23231.1|  hypothetical protein AALP_AAs59427U000100             52.8    5e-07   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  53.9    6e-07   
ref|XP_003635767.1|  Cysteine proteinase                              53.1    7e-07   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      53.1    8e-07   
ref|XP_009609383.1|  PREDICTED: ervatamin-B                           52.8    9e-07   
ref|XP_004957245.1|  PREDICTED: vignain-like                          52.8    9e-07   
sp|P84347.1|MEX2_JACME  RecName: Full=Chymomexicain                   51.6    9e-07   Jacaratia mexicana [bonete]
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...  52.8    1e-06   
ref|XP_003608898.1|  Cysteine proteinase                              52.0    1e-06   
ref|XP_002461961.1|  hypothetical protein SORBIDRAFT_02g011230        52.8    1e-06   Sorghum bicolor [broomcorn]
emb|CAA84378.1|  cysteine proteinase                                  52.8    1e-06   Vicia sativa [spring vetch]
ref|XP_004515849.1|  PREDICTED: vignain-like                          52.4    1e-06   
ref|XP_010545993.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  52.4    1e-06   
ref|XP_004304987.1|  PREDICTED: vignain-like                          52.4    1e-06   
gb|ACJ84467.1|  unknown                                               51.6    1e-06   Medicago truncatula
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg           52.4    1e-06   
ref|XP_010545992.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  52.4    1e-06   
ref|XP_010545991.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  52.4    1e-06   
emb|CAQ00108.1|  papain-like cysteine proteinase                      52.4    1e-06   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004956157.1|  PREDICTED: oryzain alpha chain-like              52.4    2e-06   
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1               52.0    2e-06   
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...  50.4    2e-06   
gb|EEC70177.1|  hypothetical protein OsI_00904                        52.0    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...  52.0    2e-06   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...  52.0    2e-06   
dbj|BAA94210.1|  putative cysteine protease                           52.0    2e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82174.1|  unnamed protein product                              52.0    2e-06   
ref|XP_006417940.1|  hypothetical protein EUTSA_v10008102mg           52.0    2e-06   
ref|XP_004987388.1|  PREDICTED: xylem cysteine proteinase 2-like      52.0    2e-06   
ref|XP_004967598.1|  PREDICTED: xylem cysteine proteinase 2-like      52.0    2e-06   
ref|XP_010238315.1|  PREDICTED: ervatamin-B-like                      51.6    2e-06   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...  51.6    2e-06   
ref|XP_006449484.1|  hypothetical protein CICLE_v10017947mg           51.6    2e-06   
ref|NP_001148278.1|  thiol protease SEN102 precursor                  52.0    2e-06   Zea mays [maize]
gb|ACF84958.1|  unknown                                               52.0    2e-06   Zea mays [maize]
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                   51.6    2e-06   
emb|CCW72556.1|  KDEL cysteine protease                               51.6    2e-06   
ref|NP_001170085.1|  hypothetical protein                             52.0    2e-06   Zea mays [maize]
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                   51.6    2e-06   
ref|XP_010914479.1|  PREDICTED: ervatamin-B-like                      51.6    2e-06   
emb|CDY39574.1|  BnaCnng09430D                                        51.2    2e-06   
ref|XP_009390411.1|  PREDICTED: vignain-like                          50.1    2e-06   
gb|KCW74087.1|  hypothetical protein EUGRSUZ_E02728                   51.2    3e-06   
gb|ADQ27799.1|  mitogenic proteinase                                  50.4    3e-06   
gb|AAT34987.1|  putative cysteine protease                            51.6    3e-06   Gossypium hirsutum [American cotton]
gb|AAK83567.1|  cysteine proteinase CC23                              49.7    3e-06   Vasconcellea cundinamarcensis
ref|XP_006660790.1|  PREDICTED: vignain-like                          51.2    3e-06   
dbj|BAJ85314.1|  predicted protein                                    51.6    3e-06   
ref|NP_001063560.1|  Os09g0497500                                     51.2    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                      51.6    3e-06   
gb|EEC84816.1|  hypothetical protein OsI_31898                        51.2    3e-06   Oryza sativa Indica Group [Indian rice]
gb|EAZ45240.1|  hypothetical protein OsJ_29883                        51.2    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002867702.1|  hypothetical protein ARALYDRAFT_329301           51.6    3e-06   
ref|XP_006291370.1|  hypothetical protein CARUB_v10017509mg           51.6    3e-06   
ref|XP_010682353.1|  PREDICTED: vignain-like                          51.2    3e-06   
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  51.2    3e-06   
emb|CDY48168.1|  BnaA06g16650D                                        51.2    3e-06   
ref|XP_010059014.1|  PREDICTED: zingipain-2-like                      51.2    3e-06   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                       50.8    4e-06   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...  51.2    4e-06   
ref|XP_008392874.1|  PREDICTED: vignain-like                          51.2    4e-06   
dbj|BAJ99186.1|  predicted protein                                    51.2    4e-06   
ref|XP_002880913.1|  hypothetical protein ARALYDRAFT_481640           51.2    4e-06   
ref|XP_002513120.1|  cysteine protease, putative                      51.2    4e-06   Ricinus communis
ref|XP_008229136.1|  PREDICTED: zingipain-2                           51.2    4e-06   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg           51.2    4e-06   
ref|XP_004966191.1|  PREDICTED: oryzain alpha chain-like              51.2    4e-06   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  51.2    4e-06   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           50.8    4e-06   
sp|P60994.1|ERVB_TABDI  RecName: Full=Ervatamin-B; Short=ERV-B        49.7    4e-06   Tabernaemontana divaricata [crepe jasmine]
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           50.8    4e-06   
ref|XP_011100224.1|  PREDICTED: zingipain-2                           50.8    4e-06   
ref|XP_010515152.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  50.8    4e-06   
ref|XP_010503462.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  50.8    4e-06   
ref|XP_004978769.1|  PREDICTED: oryzain alpha chain-like              50.8    4e-06   
ref|XP_003559200.1|  PREDICTED: ervatamin-C-like                      50.8    4e-06   
ref|XP_006306520.1|  hypothetical protein CARUB_v10012525mg           50.8    4e-06   
pdb|1GEC|E  Chain E, Glycyl Endopeptidase-complex With Benzyloxyc...  49.7    5e-06   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg           50.8    5e-06   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      50.8    5e-06   
ref|XP_006351440.1|  PREDICTED: vignain-like                          50.8    5e-06   
ref|XP_004236298.1|  PREDICTED: vignain-like                          50.8    5e-06   
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                    50.8    5e-06   Solanum lycopersicum
emb|CBI21941.3|  unnamed protein product                              50.8    5e-06   
ref|XP_002275891.1|  PREDICTED: zingipain-2                           50.8    5e-06   Vitis vinifera
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like      50.8    5e-06   
gb|AAA74430.1|  cysteine proteinase                                   50.8    5e-06   Mesembryanthemum crystallinum
gb|ACU18368.1|  unknown                                               49.7    6e-06   Glycine max [soybeans]
gb|ABI30273.1|  VXH-B                                                 50.1    6e-06   Vasconcellea x heilbornii [babaco]
ref|XP_009761201.1|  PREDICTED: ervatamin-B-like                      50.4    6e-06   
ref|XP_007044884.1|  Cysteine proteinases superfamily protein         50.8    6e-06   
emb|CDY58055.1|  BnaA06g40240D                                        50.4    6e-06   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400        50.4    6e-06   
ref|XP_003565571.1|  PREDICTED: ervatamin-B                           50.4    6e-06   
ref|XP_006378264.1|  hypothetical protein POPTR_0010s06080g           50.1    6e-06   
ref|XP_010058815.1|  PREDICTED: zingipain-2-like                      50.1    6e-06   
gb|EMS57469.1|  KDEL-tailed cysteine endopeptidase CEP1               50.4    6e-06   
dbj|BAG16370.1|  cysteine protease                                    50.4    6e-06   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_010426322.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  50.4    6e-06   
dbj|BAG16376.1|  cysteine protease                                    50.4    7e-06   Brassica rapa var. perviridis [kabuna]
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  50.4    7e-06   
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                   50.4    7e-06   
ref|XP_010248838.1|  PREDICTED: vignain-like                          50.4    7e-06   
gb|AAM73806.1|AF448505_1  cysteine proteinase                         50.4    7e-06   Brassica napus [oilseed rape]
ref|XP_002312656.2|  hypothetical protein POPTR_0008s18350g           50.4    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010059348.1|  PREDICTED: zingipain-2-like                      50.4    7e-06   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                      50.4    7e-06   
ref|XP_002454392.1|  hypothetical protein SORBIDRAFT_04g029960        50.4    7e-06   Sorghum bicolor [broomcorn]
ref|XP_002437462.1|  hypothetical protein SORBIDRAFT_10g027570        50.4    7e-06   Sorghum bicolor [broomcorn]
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                      50.4    7e-06   
ref|XP_003578656.1|  PREDICTED: ervatamin-B-like                      50.4    7e-06   
ref|XP_009604790.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  48.9    7e-06   
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                      50.4    7e-06   
gb|KCW73671.1|  hypothetical protein EUGRSUZ_E02263                   50.1    7e-06   
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                      50.1    8e-06   
ref|XP_006362426.1|  PREDICTED: vignain-like                          50.1    8e-06   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            50.1    8e-06   
gb|KHN05804.1|  Vignain                                               50.1    8e-06   
ref|XP_002515048.1|  cysteine protease, putative                      50.1    8e-06   Ricinus communis
ref|XP_010245279.1|  PREDICTED: vignain-like                          50.1    8e-06   
ref|XP_008780645.1|  PREDICTED: vignain-like                          49.7    8e-06   
ref|XP_009359516.1|  PREDICTED: vignain-like                          50.1    8e-06   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  50.1    9e-06   
ref|NP_001063936.1|  Os09g0562700                                     49.3    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571326.1|  PREDICTED: ervatamin-B-like                      50.1    9e-06   
gb|AAB37233.1|  cysteine proteinase                                   50.1    9e-06   Phalaenopsis sp. SM9108
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  50.1    9e-06   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      50.1    9e-06   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      50.1    9e-06   
ref|XP_006360708.1|  PREDICTED: vignain-like                          50.1    9e-06   
ref|XP_006360707.1|  PREDICTED: vignain-like                          50.1    9e-06   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  50.1    9e-06   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...  50.1    9e-06   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      50.1    1e-05   
ref|XP_010913142.1|  PREDICTED: ervatamin-B-like                      50.1    1e-05   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           50.1    1e-05   
gb|ABI30276.1|  VXH-C                                                 49.7    1e-05   Vasconcellea x heilbornii [babaco]
ref|XP_006415613.1|  hypothetical protein EUTSA_v10009660mg           50.1    1e-05   
ref|XP_010058970.1|  PREDICTED: zingipain-2-like                      50.1    1e-05   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      50.1    1e-05   
gb|KHN07963.1|  Vignain                                               49.7    1e-05   
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                  50.1    1e-05   
dbj|BAC75924.1|  cysteine protease-2                                  50.1    1e-05   Helianthus annuus
ref|XP_003593763.1|  Cysteine proteinase                              50.1    1e-05   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           49.7    1e-05   
gb|AFJ15104.1|  mexicain-like cystein protease                        49.7    1e-05   
emb|CDY15571.1|  BnaA08g28550D                                        49.7    1e-05   
ref|XP_006404274.1|  hypothetical protein EUTSA_v10010486mg           50.1    1e-05   
gb|ABI30272.1|  VXH-A                                                 49.7    1e-05   Vasconcellea x heilbornii [babaco]
gb|ABI30275.1|  VS-A                                                  49.7    1e-05   Vasconcellea stipulata
ref|XP_010475355.1|  PREDICTED: ervatamin-B-like                      49.7    1e-05   
emb|CAA20473.1|  cysteine proteinase-like protein                     49.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391873.1|  PREDICTED: xylem cysteine proteinase 1-like      49.7    1e-05   
ref|NP_001237379.1|  cysteine proteinase precursor                    50.1    1e-05   
gb|ACU23531.1|  unknown                                               50.1    1e-05   Glycine max [soybeans]
ref|NP_567686.2|  putative cysteine proteinase                        49.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521644.1|  PREDICTED: ervatamin-B-like                      49.7    1e-05   
gb|KDP31767.1|  hypothetical protein JCGZ_12228                       49.7    1e-05   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg           49.7    1e-05   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           49.7    1e-05   
gb|AFJ15103.1|  mexicain-like cystein protease                        49.7    1e-05   
gb|EMT09945.1|  hypothetical protein F775_52429                       49.7    1e-05   
gb|EAZ10092.1|  hypothetical protein OsI_32402                        49.7    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009110997.1|  PREDICTED: ervatamin-B-like                      49.7    1e-05   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  49.7    1e-05   
ref|NP_001042970.2|  Os01g0347600                                     48.5    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010501342.1|  PREDICTED: ervatamin-B-like                      49.7    1e-05   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      49.7    1e-05   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       49.7    1e-05   
gb|AFW85697.1|  hypothetical protein ZEAMMB73_051316                  49.3    1e-05   
ref|XP_010061449.1|  PREDICTED: zingipain-1-like                      49.7    1e-05   
ref|XP_006469054.1|  PREDICTED: oryzain alpha chain-like              48.5    1e-05   
gb|KHG06908.1|  Vignain                                               49.7    1e-05   
ref|XP_010070267.1|  PREDICTED: zingipain-2                           49.7    1e-05   
ref|NP_001237199.1|  cysteine proteinase precursor                    49.7    1e-05   
gb|AIA26572.1|  cysteine protease                                     49.7    1e-05   
gb|EEE70232.1|  hypothetical protein OsJ_30346                        49.7    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004513101.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  49.7    1e-05   
gb|AAA92063.1|  cysteinyl endopeptidase                               49.7    1e-05   Vigna radiata [mung bean]
ref|XP_010462580.1|  PREDICTED: ervatamin-B-like                      49.3    1e-05   
ref|XP_007037813.1|  Cysteine proteinases superfamily protein iso...  49.3    1e-05   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  50.1    1e-05   
ref|XP_008239373.1|  PREDICTED: vignain-like                          49.7    1e-05   
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg           49.7    1e-05   
ref|XP_008450203.1|  PREDICTED: vignain-like                          48.5    1e-05   
gb|EMT00545.1|  Vignain                                               48.9    1e-05   
gb|KDO45769.1|  hypothetical protein CISIN_1g041120mg                 49.3    1e-05   
ref|XP_006446742.1|  hypothetical protein CICLE_v10015835mg           49.3    1e-05   
ref|XP_003593772.1|  Cysteine proteinase                              49.3    1e-05   
ref|XP_008659254.1|  PREDICTED: ervatamin-B-like                      49.3    2e-05   
gb|EMT11858.1|  Vignain                                               49.3    2e-05   
ref|XP_004294729.1|  PREDICTED: vignain-like                          49.3    2e-05   
gb|AHA56102.1|  cysteine protease                                     49.3    2e-05   
ref|XP_007037812.1|  Cysteine proteinases superfamily protein iso...  49.3    2e-05   
gb|KHN27802.1|  Vignain                                               48.9    2e-05   
ref|XP_003593765.1|  Cysteine proteinase                              49.3    2e-05   
ref|XP_010911536.1|  PREDICTED: thiol protease SEN102-like            48.9    2e-05   
ref|NP_680113.3|  KDEL-tailed cysteine endopeptidase CEP2             49.3    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AES64023.2|  papain family cysteine protease                       49.3    2e-05   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg           49.3    2e-05   
ref|XP_006306197.1|  hypothetical protein CARUB_v10011832mg           49.3    2e-05   
gb|EYU40491.1|  hypothetical protein MIMGU_mgv1a018119mg              48.9    2e-05   
ref|XP_002875897.1|  hypothetical protein ARALYDRAFT_347926           49.3    2e-05   
ref|XP_004515851.1|  PREDICTED: vignain-like                          49.3    2e-05   
ref|XP_004501841.1|  PREDICTED: vignain-like                          49.3    2e-05   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       49.3    2e-05   
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  48.9    2e-05   
gb|KDO77829.1|  hypothetical protein CISIN_1g037516mg                 49.3    2e-05   
emb|CAA06243.1|  pre-pro-TPE4A protein                                49.3    2e-05   Pisum sativum [garden pea]
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  48.9    2e-05   
ref|XP_006468205.1|  PREDICTED: actinidain-like                       49.3    2e-05   
emb|CDY10188.1|  BnaC05g04310D                                        48.9    2e-05   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                      48.9    2e-05   
ref|XP_009119072.1|  PREDICTED: ervatamin-B                           48.9    2e-05   
gb|KHN12137.1|  Thiol protease                                        48.9    2e-05   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            48.9    2e-05   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            48.9    2e-05   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            48.9    2e-05   
gb|KGN62053.1|  hypothetical protein Csa_2G292830                     48.9    2e-05   
sp|P82474.1|CPGP2_ZINOF  RecName: Full=Zingipain-2; AltName: Full...  48.1    2e-05   Zingiber officinale [ginger]
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...  48.9    2e-05   
ref|XP_007025397.1|  Senescence-associated gene 12, putative          48.9    2e-05   
ref|XP_009617207.1|  PREDICTED: vignain-like                          48.9    2e-05   
ref|XP_002511277.1|  cysteine protease, putative                      48.9    2e-05   Ricinus communis
ref|XP_009774957.1|  PREDICTED: vignain-like                          48.9    2e-05   
ref|XP_008799976.1|  PREDICTED: vignain-like                          48.1    2e-05   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                      48.9    2e-05   
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...  48.1    2e-05   
ref|XP_010099502.1|  KDEL-tailed cysteine endopeptidase CEP2          48.9    2e-05   
emb|CAQ00110.1|  papain-like cysteine proteinase                      49.3    2e-05   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003559414.1|  PREDICTED: senescence-specific cysteine prot...  48.9    2e-05   
ref|XP_010102922.1|  hypothetical protein L484_018940                 48.9    2e-05   
ref|XP_010466086.1|  PREDICTED: probable cysteine proteinase At3g...  48.9    2e-05   
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg           48.9    2e-05   
emb|CDX86529.1|  BnaC08g01740D                                        48.9    2e-05   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  48.9    2e-05   
ref|NP_001136636.1|  hypothetical protein precursor                   48.9    2e-05   Zea mays [maize]
dbj|BAD29955.1|  cysteine protease                                    48.9    2e-05   Daucus carota [carrots]
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  48.9    2e-05   
ref|XP_004953685.1|  PREDICTED: xylem cysteine proteinase 1-like      48.9    2e-05   
ref|XP_010911312.1|  PREDICTED: senescence-specific cysteine prot...  47.8    2e-05   
ref|XP_008246197.1|  PREDICTED: vignain-like                          48.5    2e-05   
gb|KGN53064.1|  hypothetical protein Csa_4G013580                     48.1    2e-05   
ref|XP_004150630.1|  PREDICTED: vignain-like                          48.1    2e-05   
ref|XP_010487883.1|  PREDICTED: probable cysteine proteinase At3g...  48.9    2e-05   
gb|KFK27640.1|  hypothetical protein AALP_AA8G409600                  48.5    2e-05   
ref|NP_563764.1|  Cysteine proteinases superfamily protein            48.9    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AHA62778.1|  RCR3-like cysteine protease                           48.9    3e-05   
ref|XP_008451632.1|  PREDICTED: ervatamin-B-like                      48.5    3e-05   
gb|EAZ11801.1|  hypothetical protein OsJ_01675                        48.5    3e-05   
gb|EAY73926.1|  hypothetical protein OsI_01810                        48.5    3e-05   
gb|KFK22654.1|  hypothetical protein AALP_AAs45238U000100             48.9    3e-05   
ref|XP_008811650.1|  PREDICTED: vignain-like                          48.5    3e-05   
emb|CDY66628.1|  BnaAnng22610D                                        48.5    3e-05   
ref|XP_010695980.1|  PREDICTED: vignain-like                          48.5    3e-05   
dbj|BAJ95283.1|  predicted protein                                    48.5    3e-05   
emb|CAB09698.1|  cysteine proteinase                                  48.5    3e-05   
ref|XP_008228922.1|  PREDICTED: vignain-like                          48.5    3e-05   
dbj|BAD53944.1|  putative cysteine protease                           48.5    3e-05   
gb|EAY73929.1|  hypothetical protein OsI_01813                        48.5    3e-05   
gb|KDP26711.1|  hypothetical protein JCGZ_17869                       48.1    3e-05   
ref|XP_002889596.1|  hypothetical protein ARALYDRAFT_887827           48.5    3e-05   
ref|XP_010536661.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  48.5    3e-05   
gb|EAY87283.1|  hypothetical protein OsI_08685                        48.5    3e-05   
dbj|BAB63884.1|  putative cysteine protease                           48.5    3e-05   
ref|NP_001047923.1|  Os02g0715000                                     48.5    3e-05   
ref|XP_008454483.1|  PREDICTED: ervatamin-B-like                      48.5    3e-05   
gb|AFW67599.1|  hypothetical protein ZEAMMB73_513726                  47.4    3e-05   
ref|XP_008646166.1|  PREDICTED: xylem cysteine proteinase 1-like      48.5    3e-05   
gb|AFW73105.1|  hypothetical protein ZEAMMB73_931917                  48.5    3e-05   
ref|XP_006644091.1|  PREDICTED: fruit bromelain-like                  48.5    3e-05   
ref|XP_006362428.1|  PREDICTED: vignain-like                          48.5    3e-05   
ref|XP_002437487.1|  hypothetical protein SORBIDRAFT_10g027980        48.5    3e-05   
ref|XP_002437488.1|  hypothetical protein SORBIDRAFT_10g027990        48.5    3e-05   
emb|CDM81223.1|  unnamed protein product                              48.5    3e-05   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                       48.5    3e-05   
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550        48.5    3e-05   
ref|XP_002883179.1|  hypothetical protein ARALYDRAFT_318695           48.1    3e-05   
gb|ABR16787.1|  unknown                                               48.5    3e-05   
ref|XP_009594595.1|  PREDICTED: vignain                               48.1    3e-05   
gb|KHN27806.1|  Vignain                                               48.1    3e-05   
gb|KGN48503.1|  hypothetical protein Csa_6G490180                     48.5    3e-05   
ref|XP_004172030.1|  PREDICTED: vignain-like                          48.5    3e-05   
ref|XP_010932269.1|  PREDICTED: LOW QUALITY PROTEIN: vignain-like     48.5    3e-05   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                   48.1    3e-05   
sp|P84346.1|MEX1_JACME  RecName: Full=Mexicain                        47.4    4e-05   
ref|XP_004167542.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  48.1    4e-05   
pdb|1MEG|A  Chain A, Crystal Structure Of A Caricain D158e Mutant...  47.4    4e-05   
pdb|1PPO|A  Chain A, Determination Of The Structure Of Papaya Pro...  47.4    4e-05   
ref|XP_008797119.1|  PREDICTED: vignain-like                          47.8    4e-05   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      48.1    4e-05   
prf||1910332A  Cys endopeptidase                                      48.5    4e-05
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...  48.5    4e-05   
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                      48.1    4e-05   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                      48.1    4e-05   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                      48.1    4e-05   
sp|P82473.1|CPGP1_ZINOF  RecName: Full=Zingipain-1; AltName: Full...  47.4    4e-05   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg              48.1    4e-05   
ref|XP_004964022.1|  PREDICTED: cysteine proteinase EP-B 1-like       48.1    4e-05   
ref|XP_006415023.1|  hypothetical protein EUTSA_v10007931mg           48.1    4e-05   
ref|XP_002531151.1|  cysteine protease, putative                      48.1    4e-05   
ref|XP_004152297.1|  PREDICTED: vignain-like                          48.1    4e-05   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           48.1    4e-05   
ref|XP_009779832.1|  PREDICTED: vignain-like                          48.1    4e-05   
gb|AAW78660.1|  cysteine protease                                     48.1    4e-05   
gb|ACB70409.1|  cysteine protease                                     48.1    4e-05   
ref|XP_008340271.1|  PREDICTED: vignain-like                          47.0    4e-05   
ref|XP_009392372.1|  PREDICTED: ervatamin-B-like                      47.8    4e-05   
ref|XP_010670725.1|  PREDICTED: ervatamin-B isoform X2                47.8    4e-05   
gb|EMT01703.1|  Vignain                                               47.8    4e-05   
ref|NP_001042969.1|  Os01g0347500                                     48.1    4e-05   
ref|XP_010417893.1|  PREDICTED: ervatamin-B-like                      48.1    4e-05   
emb|CBI14901.3|  unnamed protein product                              47.8    4e-05   
ref|XP_010040205.1|  PREDICTED: zingipain-2-like                      47.4    4e-05   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  48.1    4e-05   
ref|XP_007155505.1|  hypothetical protein PHAVU_003G207200g           48.1    5e-05   
gb|AAW34135.1|  cysteine protease gp2b                                48.1    5e-05   
gb|AAW34134.1|  cysteine protease gp2a                                48.1    5e-05   
ref|XP_008454482.1|  PREDICTED: ervatamin-B-like                      48.1    5e-05   
ref|XP_004299172.1|  PREDICTED: vignain-like                          48.1    5e-05   
gb|EMT09279.1|  Thiol protease SEN102                                 47.8    5e-05   
ref|XP_009333898.1|  PREDICTED: vignain                               48.1    5e-05   
ref|XP_007025398.1|  Senescence-associated gene 12                    47.8    5e-05   
emb|CDY63262.1|  BnaCnng41770D                                        47.4    5e-05   
gb|KHN10462.1|  Vignain                                               48.1    5e-05   
ref|XP_009387347.1|  PREDICTED: vignain-like                          48.1    5e-05   
ref|XP_010670721.1|  PREDICTED: ervatamin-B isoform X1                47.8    5e-05   
ref|XP_003607546.1|  Cysteine proteinase                              47.8    5e-05   
ref|XP_010478268.1|  PREDICTED: ervatamin-B-like                      47.8    5e-05   
ref|XP_010460683.1|  PREDICTED: ervatamin-B-like                      47.8    5e-05   
ref|XP_010499428.1|  PREDICTED: ervatamin-B-like                      47.8    5e-05   
ref|XP_003549830.2|  PREDICTED: vignain-like                          48.1    5e-05   
ref|XP_006303584.1|  hypothetical protein CARUB_v10011106mg           47.8    5e-05   
ref|XP_004145321.1|  PREDICTED: vignain-like                          47.0    5e-05   
pdb|2BDZ|A  Chain A, Mexicain From Jacaratia Mexicana                 47.0    5e-05   
emb|CBI21976.3|  unnamed protein product                              47.8    5e-05   
ref|XP_008381611.1|  PREDICTED: ervatamin-B                           47.8    5e-05   
gb|ABI30274.1|  VS-B                                                  47.8    5e-05   
emb|CBI21373.3|  unnamed protein product                              47.4    5e-05   
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800        47.8    5e-05   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          47.8    5e-05   
ref|XP_002531152.1|  cysteine protease, putative                      47.8    5e-05   
ref|XP_002467676.1|  hypothetical protein SORBIDRAFT_01g032090        47.8    5e-05   
gb|EMT08349.1|  hypothetical protein F775_43327                       47.8    6e-05   
gb|AJA74411.1|  cysteine protease                                     47.8    6e-05   
gb|AGW21712.1|  cysteine protease 2                                   45.8    6e-05   
ref|XP_004963863.1|  PREDICTED: cysteine proteinase EP-B 2-like       47.8    6e-05   
ref|XP_010042370.1|  PREDICTED: zingipain-2-like                      46.2    6e-05   
ref|XP_004306851.1|  PREDICTED: vignain-like                          47.8    6e-05   
ref|XP_004308524.1|  PREDICTED: vignain-like                          47.8    6e-05   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...  47.8    6e-05   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...  47.8    6e-05   
ref|XP_002437490.1|  hypothetical protein SORBIDRAFT_10g028000        47.8    6e-05   
ref|XP_003142769.1|  ctsf protein                                     48.1    6e-05   
gb|AAU81593.1|  cysteine proteinase                                   46.6    6e-05   
gb|ACN27279.1|  unknown                                               47.4    6e-05   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg           47.8    6e-05   
gb|AAW34136.1|  cysteine protease gp3a                                48.1    6e-05   
ref|XP_006342530.1|  PREDICTED: xylem cysteine proteinase 1-like      47.8    6e-05   
ref|XP_009767259.1|  PREDICTED: xylem cysteine proteinase 1-like      47.8    6e-05   
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                      47.8    6e-05   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                      47.8    6e-05   
gb|EFO21301.2|  ctsf protein                                          48.1    6e-05   
ref|XP_010690568.1|  PREDICTED: xylem cysteine proteinase 2           47.8    6e-05   
ref|XP_010523123.1|  PREDICTED: ervatamin-B-like                      47.8    6e-05   
ref|XP_006280686.1|  hypothetical protein CARUB_v10026650mg           47.8    6e-05   
emb|CAA40073.1|  endopeptidase (EP-C1)                                47.8    6e-05   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...  47.8    6e-05   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g           47.8    6e-05   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      47.8    6e-05   
ref|XP_009357242.1|  PREDICTED: ervatamin-B                           47.8    6e-05   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...  47.8    6e-05   
ref|XP_010943503.1|  PREDICTED: xylem cysteine proteinase 1-like      47.8    6e-05   
dbj|BAB70669.1|  cysteine proteinase                                  46.6    6e-05   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                      47.8    6e-05   
gb|EMS46068.1|  Fruit bromelain                                       47.8    6e-05   
ref|XP_010929953.1|  PREDICTED: vignain isoform X2                    47.4    6e-05   
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                      47.8    6e-05   
ref|XP_006849993.1|  hypothetical protein AMTR_s00022p00166050        47.8    6e-05   
emb|CAN75313.1|  hypothetical protein VITISV_033592                   46.6    6e-05   
gb|EMT03209.1|  Vignain                                               47.8    7e-05   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          47.8    7e-05   
ref|XP_010522111.1|  PREDICTED: ervatamin-B                           47.4    7e-05   
gb|EYU22236.1|  hypothetical protein MIMGU_mgv1a008784mg              47.8    7e-05   
ref|XP_004306836.1|  PREDICTED: vignain-like                          47.4    7e-05   
gb|KHN27797.1|  Thiol protease SEN102                                 47.4    7e-05   
ref|XP_010441769.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  47.8    7e-05   
ref|XP_006592475.1|  PREDICTED: vignain-like                          47.4    7e-05   
sp|P43156.1|CYSP_HEMSP  RecName: Full=Thiol protease SEN102; Flag...  47.8    7e-05   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      47.4    7e-05   
ref|XP_009620556.1|  PREDICTED: xylem cysteine proteinase 1-like      47.8    7e-05   
ref|XP_002278323.2|  PREDICTED: vignain                               47.8    7e-05   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      47.4    7e-05   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g           47.4    7e-05   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...  47.0    7e-05   
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44             47.8    7e-05   
ref|XP_004485885.1|  PREDICTED: LOW QUALITY PROTEIN: xylem cystei...  47.4    7e-05   
dbj|BAJ99761.1|  predicted protein                                    47.4    7e-05   
ref|XP_010519533.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  47.4    7e-05   
ref|XP_010442505.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  47.4    7e-05   
ref|XP_002463749.1|  hypothetical protein SORBIDRAFT_01g005350        47.8    7e-05   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  47.4    7e-05   
ref|XP_003540013.1|  PREDICTED: vignain-like                          47.4    7e-05   
ref|XP_004970977.1|  PREDICTED: cysteine proteinase EP-B 2-like       47.4    7e-05   
pdb|1PCI|A  Chain A, Procaricain                                      47.4    7e-05   
emb|CDP15898.1|  unnamed protein product                              47.4    7e-05   
gb|EAY73832.1|  hypothetical protein OsI_01708                        47.4    7e-05   
ref|NP_001042927.1|  Os01g0330300                                     47.4    7e-05   
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                    47.4    7e-05   
ref|XP_006291361.1|  hypothetical protein CARUB_v10017500mg           47.4    7e-05   
ref|XP_002875898.1|  hypothetical protein ARALYDRAFT_485194           47.4    7e-05   
emb|CBI21977.3|  unnamed protein product                              47.4    7e-05   
ref|XP_010426325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  47.4    7e-05   
ref|NP_566901.1|  KDEL-tailed cysteine endopeptidase CEP3             47.4    7e-05   
gb|KHN05669.1|  Vignain                                               47.4    7e-05   
ref|XP_004169236.1|  PREDICTED: vignain-like                          47.0    8e-05   
ref|NP_001151293.1|  cysteine protease 1 precursor                    47.4    8e-05   
ref|XP_010538207.1|  PREDICTED: ervatamin-B-like                      47.4    8e-05   
gb|AFW67600.1|  cysteine protease 1                                   47.4    8e-05   
ref|NP_565649.1|  cysteine proteinase-like protein                    47.4    8e-05   
gb|KHG13330.1|  Vignain                                               47.4    8e-05   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  47.4    8e-05   
ref|XP_009137125.1|  PREDICTED: zingipain-2                           47.4    8e-05   
ref|XP_002864049.1|  hypothetical protein ARALYDRAFT_495086           47.4    8e-05   
sp|P10056.2|PAPA3_CARPA  RecName: Full=Caricain; AltName: Full=Pa...  47.4    8e-05   
ref|XP_006422878.1|  hypothetical protein CICLE_v10030102mg           47.0    8e-05   
ref|XP_004974180.1|  PREDICTED: vignain-like                          47.4    8e-05   
ref|XP_010040301.1|  PREDICTED: zingipain-2-like                      46.6    8e-05   
ref|XP_008356984.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  47.8    8e-05   
ref|NP_568722.1|  KDEL-tailed cysteine endopeptidase CEP1             47.4    8e-05   
gb|AAL14199.1|  cysteine proteinase precursor                         47.4    8e-05   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 46.6    8e-05   
ref|NP_001151278.1|  LOC100284911 precursor                           47.4    8e-05   
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like      47.4    8e-05   
gb|ACG38044.1|  vignain precursor                                     47.4    8e-05   
ref|XP_008340724.1|  PREDICTED: vignain-like                          47.4    8e-05   
emb|CAA49504.1|  papaya proteinase omega                              47.4    8e-05   
gb|AAR92154.1|  putative cysteine protease 1                          47.4    8e-05   
emb|CAN62838.1|  hypothetical protein VITISV_003391                   47.0    8e-05   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       47.4    8e-05   
ref|XP_010686290.1|  PREDICTED: zingipain-2-like                      47.4    8e-05   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  47.4    8e-05   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        47.4    9e-05   
ref|XP_004966285.1|  PREDICTED: oryzain alpha chain-like              47.4    9e-05   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230        47.4    9e-05   
gb|ABF70145.1|  cysteine protease, putative                           47.4    9e-05   
ref|XP_006839079.1|  hypothetical protein AMTR_s00090p00106390        46.2    9e-05   
ref|XP_009599970.1|  PREDICTED: xylem cysteine proteinase 1-like      47.4    9e-05   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...  47.4    9e-05   
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...  47.8    9e-05   
gb|KGN65787.1|  hypothetical protein Csa_1G528520                     47.0    9e-05   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                       47.0    9e-05   
ref|XP_009143808.1|  PREDICTED: ervatamin-B                           47.4    9e-05   
emb|CDY17221.1|  BnaA05g09670D                                        47.4    9e-05   
ref|XP_003378245.1|  cathepsin F                                      47.4    9e-05   
ref|XP_001634814.1|  predicted protein                                47.0    9e-05   
gb|KHN38752.1|  Vignain                                               47.0    9e-05   
ref|XP_010431170.1|  PREDICTED: senescence-specific cysteine prot...  47.0    9e-05   
emb|CDM84819.1|  unnamed protein product                              47.4    9e-05   
ref|XP_010503593.1|  PREDICTED: senescence-specific cysteine prot...  45.1    9e-05   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...  47.0    9e-05   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...  47.0    9e-05   
emb|CAN70559.1|  hypothetical protein VITISV_032465                   47.0    9e-05   
emb|CAN64655.1|  hypothetical protein VITISV_005140                   47.0    9e-05   
ref|XP_008805113.1|  PREDICTED: vignain-like                          47.4    9e-05   
ref|XP_004297572.1|  PREDICTED: vignain-like                          47.0    9e-05   
gb|KCW45397.1|  hypothetical protein EUGRSUZ_L00917                   46.2    9e-05   
ref|XP_010250858.1|  PREDICTED: cysteine proteinase COT44             47.4    1e-04   
ref|XP_004986890.1|  PREDICTED: fruit bromelain-like                  47.0    1e-04   
gb|AAK63125.1|  putative cysteine protease                            45.1    1e-04   



>ref|XP_009352793.1| PREDICTED: zingipain-2-like [Pyrus x bretschneideri]
Length=344

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGITQIKT KL+SLSEQQL+DCD  + GC G
Sbjct  155  VAAIEGITQIKTGKLISLSEQQLVDCDTDNNGCQG  189



>ref|XP_009352952.1| PREDICTED: fruit bromelain-like [Pyrus x bretschneideri]
Length=315

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGITQIKT KL+SLSEQQL+DCD  + GC G
Sbjct  126  VAAIEGITQIKTGKLISLSEQQLVDCDTDNNGCQG  160



>ref|XP_009352795.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIKT KL+SLSEQQL+DCD  + GC G
Sbjct  155  VAAVEGITQIKTGKLISLSEQQLVDCDTDNNGCQG  189



>gb|AAQ54544.1| cysteine proteinase [Malus domestica]
Length=98

 Score = 54.3 bits (129),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIKT KL+SLSEQQL++CD  + GC G
Sbjct  61   VAAVEGITQIKTGKLISLSEQQLVNCDTDNNGCQG  95



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI ++KT KL+SLSEQQL+DCD+ + GCHG
Sbjct  119  VAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHG  153



>ref|XP_006852525.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
 gb|ERN13992.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
Length=227

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT KLVSLSEQQL+DCD  + GC G
Sbjct  42   VAALEGITKIKTGKLVSLSEQQLIDCDTENDGCMG  76



>ref|XP_011005484.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI ++KT KL+SLSEQQL+DCD+ + GCHG
Sbjct  11   VAAIEGIIKLKTGKLISLSEQQLVDCDVGNNGCHG  45



>ref|XP_008350674.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=313

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT +L+SLSEQQL+DCD  + GC G
Sbjct  127  VAAVEGITKIKTGQLISLSEQQLVDCDTSNXGCQG  161



>ref|XP_008345990.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT +L+SLSEQQL+DCD  + GC G
Sbjct  155  VAAVEGITKIKTGQLISLSEQQLVDCDTSNXGCQG  189



>ref|XP_008371737.1| PREDICTED: vignain-like [Malus domestica]
Length=222

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT +L+SLSEQQL+DCD  + GC G
Sbjct  36   VAAVEGITKIKTGQLISLSEQQLVDCDTSNSGCQG  70



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD+   GC G
Sbjct  156  VAAIEGATQIKKGKLISLSEQQLVDCDINDYGCRG  190



>ref|NP_001148894.1| LOC100282514 precursor [Zea mays]
 gb|ACF85709.1| unknown [Zea mays]
 gb|ACG33327.1| vignain precursor [Zea mays]
Length=356

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  160  VAAIEGINQIKNGKLVSLSEQELVDCDTKAIGCAG  194



>emb|CAQ00119.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ +IKT +LVSLSEQQL+DCD  S GC G
Sbjct  172  VAAIEGMNKIKTGELVSLSEQQLVDCDTRSSGCSG  206



>tpg|DAA40428.1| TPA: Vignain [Zea mays]
Length=377

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  181  VAAIEGINQIKNGKLVSLSEQELVDCDTKAIGCAG  215



>ref|XP_002462602.1| hypothetical protein SORBIDRAFT_02g028840 [Sorghum bicolor]
 gb|EER99123.1| hypothetical protein SORBIDRAFT_02g028840 [Sorghum bicolor]
Length=384

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  160  VAAIEGINQIKNGKLVSLSEQELVDCDTKAIGCAG  194



>ref|XP_009352948.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=364

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT IKT KL+SLSEQQL+DCD  + GC G
Sbjct  155  VAAVEGITPIKTGKLISLSEQQLVDCDTDNNGCQG  189



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEG  194



>ref|XP_002865220.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41479.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEG  194



>ref|XP_009352792.1| PREDICTED: zingipain-1-like [Pyrus x bretschneideri]
Length=344

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIKT KL SLSEQQL++CD  + GC G
Sbjct  155  VAAVEGITQIKTGKLTSLSEQQLVNCDTDNNGCQG  189



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEG  194



>emb|CDX87758.1| BnaC02g31910D [Brassica napus]
Length=346

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSG  194



>gb|AAD53011.1|AF089848_1 senescence-specific cysteine protease [Brassica napus]
Length=346

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSG  194



>ref|XP_008368206.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=344

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT KL+SLSEQQL+ CD  + GC+G
Sbjct  155  VAAVEGITEIKTGKLISLSEQQLVSCDTSNSGCNG  189



>gb|AEK97329.1| chromoplast senescence-associated protein 12 [Brassica rapa var. 
parachinensis]
Length=260

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  74   VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSG  108



>ref|XP_004308225.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=358

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGC  101
            VAA+EGIT+IKT KL+SLSEQQL+DCD+ + GC
Sbjct  165  VAAVEGITKIKTGKLISLSEQQLVDCDVQNNGC  197



>gb|AAC35211.1| cysteine proteinase [Hemerocallis hybrid cultivar]
Length=359

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V A+EGI QIKT +LVSLSEQQL+DCD  + GC+G
Sbjct  159  VVAVEGINQIKTNELVSLSEQQLVDCDTKNSGCNG  193



>ref|XP_009128825.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY50483.1| BnaA02g24130D [Brassica napus]
Length=346

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG TQIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCSG  194



>ref|XP_004243398.1| PREDICTED: ervatamin-B [Solanum lycopersicum]
Length=342

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAAIEGI +IKT KLVSLSEQQL+DCD+ S   GC+G
Sbjct  150  VAAIEGINKIKTGKLVSLSEQQLMDCDVYSDNQGCNG  186



>ref|XP_006348972.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=288

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAAIEGI +IKT KLVSLSEQQL+DCD+ S   GC G
Sbjct  96   VAAIEGINKIKTGKLVSLSEQQLMDCDVYSDNQGCKG  132



>ref|XP_009790365.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=288

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKT KLVSLSEQQL+DCD+ S   GC+G
Sbjct  113  VAAVEGINKIKTGKLVSLSEQQLVDCDVFSDNQGCNG  149



>gb|KFK23231.1| hypothetical protein AALP_AAs59427U000100 [Arabis alpina]
Length=248

 Score = 52.8 bits (125),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQQL+DCD    GC G
Sbjct  62   VAAIEGVAQIKKGKLISLSEQQLVDCDTNDFGCSG  96



>ref|XP_008340275.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=660

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+IKT KL+SLSEQQL+ CD  + GC+G
Sbjct  155  VAAVEGITEIKTGKLISLSEQQLVSCDTSNSGCNG  189


 Score = 51.2 bits (121),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCH  104
            VAA+EGIT+IKT +L+SLSEQQL+ CD  + GC 
Sbjct  474  VAAVEGITKIKTGQLISLSEQQLVSCDTSNFGCQ  507



>ref|XP_003635767.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH39221.1| papain family cysteine protease [Medicago truncatula]
Length=338

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKTE LVSLSEQQL+DCD+ S   GC G
Sbjct  150  VAAVEGINKIKTENLVSLSEQQLIDCDIKSGNEGCEG  186



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V A+EGI QIKT+KL+SLSEQQL++CD  + GC G
Sbjct  155  VTAVEGIIQIKTDKLISLSEQQLVNCDTDNNGCQG  189



>ref|XP_009609383.1| PREDICTED: ervatamin-B [Nicotiana tomentosiformis]
Length=309

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKT KLVSLSEQQL+DCD+ S   GC+G
Sbjct  119  VAAVEGINKIKTGKLVSLSEQQLVDCDVYSDNQGCNG  155



>ref|XP_004957245.1| PREDICTED: vignain-like [Setaria italica]
Length=358

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QIK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  160  VAAMEGINQIKNGKLVSLSEQELVDCDTEAVGCAG  194



>sp|P84347.1|MEX2_JACME RecName: Full=Chymomexicain [Jacaratia mexicana]
Length=215

 Score = 51.6 bits (122),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I+T KL+SLSEQ+LLDCD  S GC G
Sbjct  31   VATVEGINKIRTGKLISLSEQELLDCDRRSHGCKG  65



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG  QIK  KL+SLSEQQL+DCD  + GC G
Sbjct  156  VAAIEGAAQIKKGKLISLSEQQLVDCDTNNFGCEG  190



>ref|XP_003608898.1| Cysteine proteinase, partial [Medicago truncatula]
Length=260

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            + A+EGI QIKT+KLVSLSEQ+L+DCD  ++ GC+G
Sbjct  76   IVAVEGINQIKTQKLVSLSEQELVDCDTEVNQGCNG  111



>ref|XP_002461961.1| hypothetical protein SORBIDRAFT_02g011230 [Sorghum bicolor]
 gb|EER98482.1| hypothetical protein SORBIDRAFT_02g011230 [Sorghum bicolor]
Length=380

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KLVSLSEQ+L+DCD +  GC G
Sbjct  192  VAVVEGIYQIRTGKLVSLSEQELVDCDTLDAGCDG  226



>emb|CAA84378.1| cysteine proteinase [Vicia sativa]
Length=359

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            +AA+EGI QIKT+KLVSLSEQQL+DCD   + GC+G
Sbjct  158  IAAVEGINQIKTQKLVSLSEQQLVDCDTEENEGCNG  193



>ref|XP_004515849.1| PREDICTED: vignain-like [Cicer arietinum]
Length=360

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            + A+EGI QIKT+KLVSLSEQQL+DCD+  + GC+G
Sbjct  158  IVAVEGINQIKTQKLVSLSEQQLVDCDIEKNRGCNG  193



>ref|XP_010545993.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like isoform 
X2 [Tarenaya hassleriana]
Length=314

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  157  VAAVEGINQIKTKKLVSLSEQELVDCDTYQNQGCNG  192



>ref|XP_004304987.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=368

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDC--DLISLGCHG  107
            VA IEGIT+IK++KL+SLSEQQL+DC  D I+ GC G
Sbjct  170  VATIEGITKIKSDKLISLSEQQLVDCNRDQINRGCRG  206



>gb|ACJ84467.1| unknown [Medicago truncatula]
 gb|AFK41099.1| unknown [Medicago truncatula]
Length=249

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            + A+EGI QIKT+KLVSLSEQ+L+DCD  ++ GC+G
Sbjct  158  IVAVEGINQIKTQKLVSLSEQELVDCDTEVNQGCNG  193



>ref|XP_006398274.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
 dbj|BAJ33714.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39727.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
Length=347

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG T+IK  KL+SLSEQQL+DCD    GC G
Sbjct  161  VAAIEGATKIKKGKLISLSEQQLVDCDTNDFGCSG  195



>ref|XP_010545992.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like isoform 
X1 [Tarenaya hassleriana]
Length=361

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  157  VAAVEGINQIKTKKLVSLSEQELVDCDTYQNQGCNG  192



>ref|XP_010545991.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Tarenaya 
hassleriana]
Length=361

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  157  VAAVEGINQIKTKKLVSLSEQELVDCDTYQNQGCNG  192



>emb|CAQ00108.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91836.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96948.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97337.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA IEGI QIKT KL SLSEQ+L+DCD +  GC+G
Sbjct  180  VAVIEGIHQIKTGKLASLSEQELVDCDKLDHGCNG  214



>ref|XP_004956157.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=380

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KLVSLSEQ+L+DCD +  GC G
Sbjct  192  VATVEGIYQIRTGKLVSLSEQELVDCDTLDHGCDG  226



>gb|KEH31736.1| KDEL-tailed cysteine endopeptidase CEP1 [Medicago truncatula]
Length=360

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            + A+EGI QIKT+KLVSLSEQ+L+DCD  ++ GC+G
Sbjct  158  IVAVEGINQIKTQKLVSLSEQELVDCDTEVNQGCNG  193



>ref|XP_011014387.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI ++KT KL+SLSEQQL+DCD+ + GC G
Sbjct  11   VAAIEGIIKLKTGKLISLSEQQLVDCDVGNKGCGG  45



>gb|EEC70177.1| hypothetical protein OsI_00904 [Oryza sativa Indica Group]
 gb|EEE54115.1| hypothetical protein OsJ_00884 [Oryza sativa Japonica Group]
Length=327

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+TQI+T KL  LSEQ+L+DCD  S GC G
Sbjct  130  VAAIEGLTQIRTGKLTPLSEQELVDCDTGSSGCAG  164



>ref|XP_010441658.1| PREDICTED: senescence-specific cysteine protease SAG12 [Camelina 
sativa]
Length=346

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG  QIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGAAQIKKGKLISLSEQQLVDCDTNDFGCDG  194



>ref|XP_010494742.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=346

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG  QIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGAAQIKKGKLISLSEQQLVDCDTNDFGCEG  194



>dbj|BAA94210.1| putative cysteine protease [Oryza sativa Japonica Group]
 dbj|BAB16480.1| putative cysteine protease [Oryza sativa Japonica Group]
Length=349

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+TQI+T KL  LSEQ+L+DCD  S GC G
Sbjct  152  VAAIEGLTQIRTGKLTPLSEQELVDCDTGSSGCAG  186



>emb|CDM82174.1| unnamed protein product [Triticum aestivum]
 emb|CDM82279.1| unnamed protein product [Triticum aestivum]
Length=359

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ +I+T +LVSLSEQQL+DCD  S GC G
Sbjct  170  VAAIEGMNKIRTGELVSLSEQQLVDCDTGSSGCSG  204



>ref|XP_006417940.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
 gb|ESQ36293.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
Length=344

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD--LISLGCHG  107
            VAAIEGI QIKT KLVSLSEQQL+DCD    + GC G
Sbjct  158  VAAIEGINQIKTGKLVSLSEQQLIDCDTGTYNKGCSG  194



>ref|XP_004987388.1| PREDICTED: xylem cysteine proteinase 2-like [Setaria italica]
Length=371

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I+T KL+SLSEQ+L+DCD +  GC G
Sbjct  183  VAAVEGINKIRTGKLLSLSEQELVDCDTLDKGCKG  217



>ref|XP_004967598.1| PREDICTED: xylem cysteine proteinase 2-like [Setaria italica]
Length=371

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I+T KL+SLSEQ+L+DCD +  GC G
Sbjct  183  VAAVEGINKIRTGKLLSLSEQELVDCDTLDKGCKG  217



>ref|XP_010238315.1| PREDICTED: ervatamin-B-like [Brachypodium distachyon]
Length=347

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+ QIK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  161  VAAMEGLNQIKNGKLVSLSEQELVDCDAEAVGCAG  195



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG T+IK  KL+SLSEQQL+DCD    GC G
Sbjct  162  VAAIEGATKIKKGKLISLSEQQLVDCDKYDYGCEG  196



>ref|XP_006449484.1| hypothetical protein CICLE_v10017947mg [Citrus clementina]
 gb|ESR62724.1| hypothetical protein CICLE_v10017947mg [Citrus clementina]
Length=340

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+I+T +L+SLSEQQ+LDC  +S GC+G
Sbjct  158  VAAVEGITKIRTGRLISLSEQQVLDCS-VSRGCYG  191



>ref|NP_001148278.1| thiol protease SEN102 precursor [Zea mays]
 gb|ACG30386.1| thiol protease SEN102 precursor [Zea mays]
Length=374

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KLVSLSEQ+L+DCD +  GC G
Sbjct  186  VAVVEGIYQIRTGKLVSLSEQELVDCDTLDDGCDG  220



>gb|ACF84958.1| unknown [Zea mays]
 tpg|DAA39674.1| TPA: thiol protease SEN102 [Zea mays]
Length=374

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KLVSLSEQ+L+DCD +  GC G
Sbjct  186  VAVVEGIYQIRTGKLVSLSEQELVDCDTLDDGCDG  220



>gb|KCW76140.1| hypothetical protein EUGRSUZ_D00517 [Eucalyptus grandis]
Length=324

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIE ITQIKT KL+ LSEQQL+DC + + GC G
Sbjct  138  VAAIESITQIKTGKLLELSEQQLVDCTIENYGCSG  172



>emb|CCW72556.1| KDEL cysteine protease, partial [Lilium longiflorum]
Length=356

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            +AA+EGI QIKT+ LVSLSEQ+L+DCD  ++ GC+G
Sbjct  160  IAAVEGINQIKTKNLVSLSEQELIDCDTEVNQGCNG  195



>ref|NP_001170085.1| hypothetical protein [Zea mays]
 gb|ACN35755.1| unknown [Zea mays]
 tpg|DAA39662.1| TPA: hypothetical protein ZEAMMB73_231678 [Zea mays]
Length=385

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KLVSLSEQ+L+DCD +  GC G
Sbjct  181  VAVVEGIYQIRTGKLVSLSEQELVDCDTLDDGCDG  215



>gb|KCW76139.1| hypothetical protein EUGRSUZ_D00515 [Eucalyptus grandis]
Length=339

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIE ITQIKT KL+ LSEQQL+DC + + GC G
Sbjct  153  VAAIESITQIKTGKLLELSEQQLVDCTIENYGCSG  187



>ref|XP_010914479.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=340

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI+QIKT  L+ L+ QQ++DCD  SLGC G
Sbjct  151  VAAIEGISQIKTGNLIPLAPQQIMDCDPNSLGCKG  185



>emb|CDY39574.1| BnaCnng09430D [Brassica napus]
Length=294

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  91   VAAVEGINQIKTNKLVSLSEQELVDCDTKQNQGCNG  126



>ref|XP_009390411.1| PREDICTED: vignain-like, partial [Musa acuminata subsp. malaccensis]
Length=197

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V+ IEGIT+IKT+KL+SLSEQ L+DCD  +  C G
Sbjct  12   VSTIEGITKIKTDKLISLSEQALVDCDFSNGACDG  46



>gb|KCW74087.1| hypothetical protein EUGRSUZ_E02728, partial [Eucalyptus grandis]
Length=304

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QIK+ KL SLS+QQL+DCD  S GC G
Sbjct  132  VAAVEGIMQIKSGKLPSLSKQQLIDCDTESNGCEG  166



>gb|ADQ27799.1| mitogenic proteinase [Vasconcellea cundinamarcensis]
Length=214

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I T KL+SLSEQ+LLDCD  S GC+G
Sbjct  31   VATVEGINKIVTGKLISLSEQELLDCDRRSHGCNG  65



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAAIEGITQI T KL+SLSEQ+L+DCD   I  GC G
Sbjct  156  VAAIEGITQISTGKLISLSEQELVDCDTKGIDHGCEG  192



>gb|AAK83567.1| cysteine proteinase CC23 [Vasconcellea cundinamarcensis]
Length=176

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I T KL+SLSEQ+LLDCD  S GC G
Sbjct  30   VATVEGINKIVTGKLISLSEQELLDCDRRSHGCKG  64



>ref|XP_006660790.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=346

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  +LVSLSEQ+L+DCD  ++GC G
Sbjct  153  VAAIEGINQIKNGELVSLSEQELVDCDDEAVGCGG  187



>dbj|BAJ85314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ +I+T +LVSLSEQ L+DCD +S GC G
Sbjct  177  VAAIEGMNKIRTGELVSLSEQVLVDCDTVSTGCGG  211



>ref|NP_001063560.1| Os09g0497500 [Oryza sativa Japonica Group]
 dbj|BAF25474.1| Os09g0497500 [Oryza sativa Japonica Group]
 dbj|BAG93138.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  +LVSLSEQ+L+DCD  ++GC G
Sbjct  152  VAAIEGINQIKNGELVSLSEQELVDCDDEAVGCGG  186



>ref|XP_010054326.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=419

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIE ITQIKT KL+ LSEQQL+DC + + GC G
Sbjct  153  VAAIESITQIKTGKLLELSEQQLVDCTIENYGCSG  187



>gb|EEC84816.1| hypothetical protein OsI_31898 [Oryza sativa Indica Group]
Length=350

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  +LVSLSEQ+L+DCD  ++GC G
Sbjct  153  VAAIEGINQIKNGELVSLSEQELVDCDDEAVGCGG  187



>gb|EAZ45240.1| hypothetical protein OsJ_29883 [Oryza sativa Japonica Group]
Length=350

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI QIK  +LVSLSEQ+L+DCD  ++GC G
Sbjct  153  VAAIEGINQIKNGELVSLSEQELVDCDDEAVGCGG  187



>ref|XP_002867702.1| hypothetical protein ARALYDRAFT_329301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43961.1| hypothetical protein ARALYDRAFT_329301 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I T +LVSLSEQ+L+DC+L++ GC+G
Sbjct  164  VAAVEGINKIVTGELVSLSEQELVDCNLVNNGCYG  198



>ref|XP_006291370.1| hypothetical protein CARUB_v10017509mg [Capsella rubella]
 gb|EOA24268.1| hypothetical protein CARUB_v10017509mg [Capsella rubella]
Length=360

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINQIKTKKLVSLSEQELVDCDTNQNEGCNG  191



>ref|XP_010682353.1| PREDICTED: vignain-like [Beta vulgaris subsp. vulgaris]
Length=357

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +A++EGI QIKT++L+SLSEQ+L+DCD  + GC G
Sbjct  155  IASVEGINQIKTKQLLSLSEQELVDCDHDNYGCEG  189



>ref|XP_009149829.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2 [Brassica 
rapa]
Length=359

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINQIKTNKLVSLSEQELVDCDTKQNQGCNG  191



>emb|CDY48168.1| BnaA06g16650D [Brassica napus]
Length=359

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINQIKTNKLVSLSEQELVDCDTKQNQGCNG  191



>ref|XP_010059014.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=356

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QIK+ KL SLS+QQL+DCD  S GC G
Sbjct  173  VAAVEGIMQIKSGKLPSLSKQQLIDCDTESNGCEG  207



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAA+EGIT++ TEKL+SLSEQ+L+DCD   I  GC G
Sbjct  138  VAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEG  174



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEGI ++KT KL+SLSEQQL+DC+  + GC G
Sbjct  154  VAAIEGIIKLKTGKLISLSEQQLVDCNAGNKGCQG  188



>ref|XP_008392874.1| PREDICTED: vignain-like [Malus domestica]
Length=362

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  157  VAAVEGINQIKTXKLVSLSEQELVDCDTEQNQGCNG  192



>dbj|BAJ99186.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99631.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA IEGI +IK  +LVSLSEQQL+DCD +  GC+G
Sbjct  197  VATIEGIHKIKRGRLVSLSEQQLVDCDFLDGGCNG  231



>ref|XP_002880913.1| hypothetical protein ARALYDRAFT_481640 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57172.1| hypothetical protein ARALYDRAFT_481640 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGIT+I   +LVSLSEQQLLDCD   + GCHG
Sbjct  157  VAAVEGITKITKGELVSLSEQQLLDCDTDYNQGCHG  192



>ref|XP_002513120.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49623.1| cysteine protease, putative [Ricinus communis]
Length=362

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGIT+IKT KL+SLSEQ+L+DCD  S   GC G
Sbjct  153  VAAVEGITEIKTGKLISLSEQELVDCDTNSEDQGCQG  189



>ref|XP_008229136.1| PREDICTED: zingipain-2 [Prunus mume]
Length=343

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD+ +   GC+G
Sbjct  156  VAAVEGINQIKTGKLVSLSEQELVDCDVKTGNEGCNG  192



>ref|XP_007214244.1| hypothetical protein PRUPE_ppa023515mg [Prunus persica]
 gb|EMJ15443.1| hypothetical protein PRUPE_ppa023515mg [Prunus persica]
Length=343

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD+ +   GC+G
Sbjct  156  VAAVEGINQIKTGKLVSLSEQELVDCDVKTGNEGCNG  192



>ref|XP_004966191.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=374

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I T KLVSLSEQ+L+DCD  S GC G
Sbjct  171  VAAMEGINKIATGKLVSLSEQELIDCDRKSHGCKG  205



>ref|XP_010054325.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Eucalyptus 
grandis]
Length=473

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIE ITQIKT KL+ LSEQQL+DC + + GC G
Sbjct  176  VAAIESITQIKTGKLLELSEQQLVDCTIENYGCSG  210



>ref|XP_007132817.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
 gb|ESW04811.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
Length=340

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA EGI QI T KLVSLSEQ+L+DCD +  GC G
Sbjct  154  VAATEGIYQITTGKLVSLSEQELVDCDSVDQGCDG  188



>sp|P60994.1|ERVB_TABDI RecName: Full=Ervatamin-B; Short=ERV-B [Tabernaemontana divaricata]
 pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray 
Crystal Structure Of A Plant Cysteine Protease Ervatamin 
B: Insight Into The Structural Basis Of Its Stability And 
Substrate Specificity.
Length=215

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+E I +I+T +L+SLSEQ+L+DCD  S GC+G
Sbjct  31   VAAVESINKIRTGQLISLSEQELVDCDTASHGCNG  65



>ref|XP_007211535.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
 gb|EMJ12734.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
Length=339

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QIKT  L+SLSEQQLLDC   + GC G
Sbjct  155  VAAVEGINQIKTGNLISLSEQQLLDCTSGNYGCGG  189



>ref|XP_011100224.1| PREDICTED: zingipain-2 [Sesamum indicum]
Length=348

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAAIEGIT+IKT KLVSLSEQ+L+DCD    + GC G
Sbjct  157  VAAIEGITKIKTGKLVSLSEQELVDCDSTPDNQGCRG  193



>ref|XP_010515152.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2 [Camelina 
sativa]
Length=360

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINQIKTNKLVSLSEQELVDCDTNQNEGCNG  191



>ref|XP_010503462.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Camelina 
sativa]
Length=360

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINQIKTNKLVSLSEQELVDCDTNQNEGCNG  191



>ref|XP_004978769.1| PREDICTED: oryzain alpha chain-like [Setaria italica]
Length=369

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+I+T KL+SLS QQL+DCD +  GC G
Sbjct  184  VAAVEGITKIRTGKLLSLSVQQLVDCDKLDSGCKG  218



>ref|XP_003559200.1| PREDICTED: ervatamin-C-like [Brachypodium distachyon]
Length=371

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCH  104
            VA IEG+T IKT KL+SLSEQQL+DCD+   GC+
Sbjct  187  VATIEGLTFIKTGKLISLSEQQLVDCDMYDGGCN  220



>ref|XP_006306520.1| hypothetical protein CARUB_v10012525mg [Capsella rubella]
 gb|EOA39418.1| hypothetical protein CARUB_v10012525mg [Capsella rubella]
Length=350

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGC  101
            +AA EG+T+I  +KLVSLSEQQL+DCD +S GC
Sbjct  162  IAAAEGLTKIIGKKLVSLSEQQLIDCDTVSAGC  194



>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- 
Glycine-methylene Covalently Bound To Cysteine 
25
Length=216

 Score = 49.7 bits (117),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCH  104
            VA +EGI +IKT  LV LSEQ+L+DCDL S GC+
Sbjct  31   VATVEGINKIKTGNLVELSEQELVDCDLQSYGCN  64



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG  QIK  KL+SLSEQQL+DCD    GC G
Sbjct  160  VAAIEGAAQIKKGKLISLSEQQLVDCDPNDYGCEG  194



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAAIEGITQI    LVSLSEQQ++DCD+   + GCHG
Sbjct  149  VAAIEGITQINNGNLVSLSEQQVVDCDVKDGNRGCHG  185



>ref|XP_006351440.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=360

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            V A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VVAVEGINQIKTKKLVSLSEQELVDCDTTENQGCNG  191



>ref|XP_004236298.1| PREDICTED: vignain-like [Solanum lycopersicum]
Length=360

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            V A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VVAVEGINQIKTKKLVSLSEQELVDCDTTENQGCNG  191



>gb|ABV22590.1| KDEL-tailed cysteine endopeptidase [Solanum lycopersicum]
Length=360

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            V A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VVAVEGINQIKTKKLVSLSEQELVDCDTTENQGCNG  191



>emb|CBI21941.3| unnamed protein product [Vitis vinifera]
Length=354

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +I+T KLVSLSEQ+LLDCD+ S   GC+G
Sbjct  155  VAAVEGINKIRTGKLVSLSEQELLDCDIDSGNEGCNG  191



>ref|XP_002275891.1| PREDICTED: zingipain-2 [Vitis vinifera]
Length=358

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +I+T KLVSLSEQ+LLDCD+ S   GC+G
Sbjct  159  VAAVEGINKIRTGKLVSLSEQELLDCDIDSGNEGCNG  195



>ref|XP_009384829.1| PREDICTED: xylem cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=349

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QI T  L SLSEQ+L+DCD  + GCHG
Sbjct  162  VAAVEGINQIVTGNLTSLSEQELIDCDSENNGCHG  196



>gb|AAA74430.1| cysteine proteinase [Mesembryanthemum crystallinum]
Length=367

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    AAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            AA+EGI QI T +L+SLSEQQL+DCD  + GC G
Sbjct  157  AAVEGINQITTGQLISLSEQQLIDCDTQNSGCRG  190



>gb|ACU18368.1| unknown [Glycine max]
Length=227

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEENAGCNG  193



>gb|ABI30273.1| VXH-B, partial [Vasconcellea x heilbornii]
Length=266

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I T +LVSLSEQ+LLDC+  S GC G
Sbjct  165  VAAVEGINKIVTGRLVSLSEQELLDCERRSYGCRG  199



>ref|XP_009761201.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=344

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD+ S   GC+G
Sbjct  153  VAAVEGINKIKTGKLVSLSEQELVDCDVNSDNQGCNG  189



>ref|XP_007044884.1| Cysteine proteinases superfamily protein [Theobroma cacao]
 gb|EOY00716.1| Cysteine proteinases superfamily protein [Theobroma cacao]
Length=530

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V A+EGI +IKT +LVSLSEQ+L+DCD  S GC+G
Sbjct  179  VVAVEGINKIKTGELVSLSEQELVDCDRESQGCNG  213



>emb|CDY58055.1| BnaA06g40240D [Brassica napus]
Length=322

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQ+L+DCD    GC G
Sbjct  136  VAAIEGVAQIKKGKLISLSEQELVDCDTNDGGCMG  170



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAA+EGITQIKT KLVSLSEQ+++DCD      GC+G
Sbjct  159  VAAVEGITQIKTGKLVSLSEQEVVDCDTKGEDQGCNG  195



>ref|XP_003565571.1| PREDICTED: ervatamin-B [Brachypodium distachyon]
Length=364

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ +I+T  LVSLSEQQL+DCD  S GC G
Sbjct  175  VAAIEGMNKIRTGTLVSLSEQQLVDCDKGSSGCAG  209



>ref|XP_006378264.1| hypothetical protein POPTR_0010s06080g, partial [Populus trichocarpa]
 gb|ERP56061.1| hypothetical protein POPTR_0010s06080g, partial [Populus trichocarpa]
Length=300

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +IKT +LVSLSEQ+L+DCD  + GC G
Sbjct  132  VAAVEGINKIKTGELVSLSEQELVDCDSDNHGCDG  166



>ref|XP_010058815.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=298

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  114  VAAVEGITQIKSGKLPVLSEQQLIDCDTENNGCEG  148



>gb|EMS57469.1| KDEL-tailed cysteine endopeptidase CEP1 [Triticum urartu]
Length=332

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T KL SLSEQ+L+DCD +  GC+G
Sbjct  144  VAVVEGIYQIQTGKLASLSEQELVDCDKLDHGCNG  178



>dbj|BAG16370.1| cysteine protease [Brassica oleracea var. italica]
Length=332

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQ+L+DCD    GC G
Sbjct  151  VAAIEGVAQIKKGKLISLSEQELVDCDTNDDGCMG  185



>ref|XP_010426322.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Camelina 
sativa]
Length=360

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT+KLVSLSEQ+L DCD   + GC+G
Sbjct  156  VAAVEGINQIKTKKLVSLSEQELADCDTNQNEGCNG  191



>dbj|BAG16376.1| cysteine protease [Brassica rapa var. perviridis]
Length=333

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQ+L+DCD    GC G
Sbjct  152  VAAIEGVAQIKKGKLISLSEQELVDCDTNDGGCMG  186



>ref|XP_006367781.1| PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed cysteine endopeptidase 
CEP1-like [Solanum tuberosum]
Length=339

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAAIEG+ +IKT KL+SLSEQ+L+DCDL S  GC G
Sbjct  152  VAAIEGLNKIKTGKLISLSEQELVDCDLGSNEGCEG  187



>gb|KCW74661.1| hypothetical protein EUGRSUZ_E03389 [Eucalyptus grandis]
Length=340

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  156  VAAVEGITQIKSGKLPVLSEQQLIDCDTKNNGCEG  190



>ref|XP_010248838.1| PREDICTED: vignain-like [Nelumbo nucifera]
Length=387

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QI++ KL SLSEQ+L+DCD+ I+ GC+G
Sbjct  172  VAAVEGINQIRSGKLTSLSEQELVDCDIKINQGCNG  207



>gb|AAM73806.1|AF448505_1 cysteine proteinase [Brassica napus]
 gb|AAM73807.1|AF448506_1 cysteine proteinase [Brassica napus]
 emb|CDX77621.1| BnaC07g18750D [Brassica napus]
Length=343

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQ+L+DCD    GC G
Sbjct  157  VAAIEGVAQIKKGKLISLSEQELVDCDTNDDGCMG  191



>ref|XP_002312656.2| hypothetical protein POPTR_0008s18350g [Populus trichocarpa]
 gb|EEE90023.2| hypothetical protein POPTR_0008s18350g [Populus trichocarpa]
Length=358

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +IKT +L+SLSEQ+L+DCD  + GC+G
Sbjct  157  VAAVEGINKIKTGELISLSEQELVDCDSDNHGCNG  191



>ref|XP_010059348.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74683.1| hypothetical protein EUGRSUZ_E03413 [Eucalyptus grandis]
Length=352

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  168  VAAVEGITQIKSGKLPVLSEQQLIDCDTKNNGCEG  202



>ref|XP_009101555.1| PREDICTED: ervatamin-B-like [Brassica rapa]
 gb|AAD53012.1|AF089849_1 senescence-specific cysteine protease [Brassica napus]
Length=344

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ QIK  KL+SLSEQ+L+DCD    GC G
Sbjct  158  VAAIEGVAQIKKGKLISLSEQELVDCDTNDGGCMG  192



>ref|XP_002454392.1| hypothetical protein SORBIDRAFT_04g029960 [Sorghum bicolor]
 gb|EES07368.1| hypothetical protein SORBIDRAFT_04g029960 [Sorghum bicolor]
Length=356

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD-LISLGCHG  107
            VAA+EGI QI T KLVSLSEQ+L+DCD ++  GC G
Sbjct  163  VAAVEGINQIVTGKLVSLSEQELMDCDTMLDHGCEG  198



>ref|XP_002437462.1| hypothetical protein SORBIDRAFT_10g027570 [Sorghum bicolor]
 gb|EER88829.1| hypothetical protein SORBIDRAFT_10g027570 [Sorghum bicolor]
Length=366

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA+EGI  I+T  LV LSEQQL+DCD ++ GC+G
Sbjct  182  IAAVEGINAIRTRNLVPLSEQQLVDCDKLNHGCNG  216



>ref|XP_010059344.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74668.1| hypothetical protein EUGRSUZ_E03399 [Eucalyptus grandis]
Length=340

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  156  VAAVEGITQIKSGKLPVLSEQQLIDCDTKNNGCEG  190



>ref|XP_003578656.1| PREDICTED: ervatamin-B-like [Brachypodium distachyon]
Length=377

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI QI+T  L+SLSEQ+L+DCD +  GC G
Sbjct  189  VAVVEGIHQIRTGNLISLSEQELVDCDTLDYGCDG  223



>ref|XP_009604790.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like, partial 
[Nicotiana tomentosiformis]
Length=187

 Score = 48.9 bits (115),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EG+ +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  79   VAATEGMNKIKTGKLISLSEQELVDCDTSSDMGCEG  114



>ref|XP_008349211.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=345

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGITQIKT KL+SLSEQQL+ CD   + GC G
Sbjct  155  VAAVEGITQIKTGKLISLSEQQLVXCDTDNNRGCQG  190



>gb|KCW73671.1| hypothetical protein EUGRSUZ_E02263, partial [Eucalyptus grandis]
Length=313

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  129  VAAVEGITQIKSGKLPVLSEQQLIDCDTENNGCEG  163



>ref|XP_010059331.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74654.1| hypothetical protein EUGRSUZ_E03378 [Eucalyptus grandis]
Length=340

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ KL  LSEQQL+DCD  + GC G
Sbjct  156  VAAVEGITQIKSGKLPVLSEQQLIDCDTENNGCEG  190



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  153  VAATEGINEIKTGKLISLSEQELVDCDTSSDMGCEG  188



>ref|XP_006582266.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=341

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA EGI QI+T  LVSLSEQ+L+DCD +  GC G
Sbjct  156  IAATEGIHQIRTGNLVSLSEQELVDCDSVDHGCKG  190



>gb|KHN05804.1| Vignain [Glycine soja]
Length=295

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  91   VVAVEGINQIKTNKLVSLSEQELVDCDTKKNAGCNG  126



>ref|XP_002515048.1| cysteine protease, putative [Ricinus communis]
 gb|EEF47602.1| cysteine protease, putative [Ricinus communis]
Length=359

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +IKT +L+SLSEQ+L+DC+ ++ GC G
Sbjct  157  VAAVEGINKIKTGELISLSEQELVDCNSVNHGCDG  191



>ref|XP_010245279.1| PREDICTED: vignain-like [Nelumbo nucifera]
Length=361

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT  LVSLSEQ+L+DCD   + GC+G
Sbjct  159  VAAVEGINQIKTNNLVSLSEQELVDCDTTYNQGCNG  194



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score = 49.7 bits (117),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA EGI QI T KL SLSEQQL+DCD  + GC G
Sbjct  100  VAATEGIAQISTGKLTSLSEQQLVDCDKKNGGCDG  134



>ref|XP_009359516.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=362

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI QIKT++LVSLSEQ+L+DCD   + GC+G
Sbjct  157  VAAVEGINQIKTKELVSLSEQELVDCDTEQNQGCNG  192



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            +AAIEGITQI T  LVSLSEQQL+DCD+   + GC+G
Sbjct  151  IAAIEGITQINTGNLVSLSEQQLVDCDVKDGNNGCNG  187



>ref|NP_001063936.1| Os09g0562700 [Oryza sativa Japonica Group]
 dbj|BAF25850.1| Os09g0562700, partial [Oryza sativa Japonica Group]
Length=235

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +IK  KLVSLSEQ+L+DCD +  GC G
Sbjct  39   VAVVEGIQKIKKGKLVSLSEQELVDCDTLDSGCDG  73



>ref|XP_003571326.1| PREDICTED: ervatamin-B-like [Brachypodium distachyon]
Length=363

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+ +I+T  LVSLSEQQL+DCD  S GC G
Sbjct  173  VAAIEGMNKIRTGTLVSLSEQQLVDCDNGSSGCAG  207



>gb|AAB37233.1| cysteine proteinase [Phalaenopsis sp. SM9108]
Length=359

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI QIKT+KL+SLSEQ+L+DCD   + GC+G
Sbjct  161  VAAVEGINQIKTKKLLSLSEQELIDCDTDENNGCNG  196



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  135  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  170



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAAIE ITQIKT  LV LSEQQL+DCD    + GCHG
Sbjct  138  VAAIEAITQIKTGNLVYLSEQQLVDCDANDGNHGCHG  174



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  153  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  188



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  153  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  188



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  153  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  188



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  153  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  188



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  154  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  189



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  155  VAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEG  190



>ref|XP_010913142.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=339

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGC  101
            VAAIEGITQIKT  L+SL+ QQL+DCD  S GC
Sbjct  150  VAAIEGITQIKTGNLMSLAPQQLVDCDNDSRGC  182



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAAIEGI ++KT KL+SLSEQQL+DCD+  +  GC G
Sbjct  151  VAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQGCGG  187



>gb|ABI30276.1| VXH-C [Vasconcellea x heilbornii]
Length=282

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I T KL+SLSEQ+LLDCD  S GC G
Sbjct  165  VATVEGINKIVTGKLISLSEQELLDCDRRSHGCDG  199



>ref|XP_006415613.1| hypothetical protein EUTSA_v10009660mg [Eutrema salsugineum]
 gb|ESQ33966.1| hypothetical protein EUTSA_v10009660mg [Eutrema salsugineum]
Length=344

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+T+I    LVSLSEQQL+DCD +  GC G
Sbjct  159  VAAVEGVTKIARGNLVSLSEQQLVDCDRVDKGCGG  193



>ref|XP_010058970.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74037.1| hypothetical protein EUGRSUZ_E02660 [Eucalyptus grandis]
Length=343

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI+QI + KL  LSEQQL+DCD  S GC G
Sbjct  156  VAAVEGISQITSGKLPVLSEQQLIDCDTESYGCDG  190



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V A EGI QI T KL SLSEQQL+DCD ++ GC G
Sbjct  152  VVATEGIAQISTGKLTSLSEQQLVDCDKVNGGCGG  186



>gb|KHN07963.1| Vignain [Glycine soja]
Length=295

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  91   VVAVEGINQIKTNKLVSLSEQELVDCDTEENAGCNG  126



>gb|KFK34125.1| hypothetical protein AALP_AA5G104600 [Arabis alpina]
Length=348

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  143  VAAVEGINKIKTNKLVSLSEQELVDCDTYQNEGCNG  178



>dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus]
Length=362

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD-LISLGCHG  107
            VAA+EGI +IKT +LVSLSEQ+L+DCD L + GC+G
Sbjct  157  VAAVEGINKIKTNELVSLSEQELVDCDTLENQGCNG  192



>ref|XP_003593763.1| Cysteine proteinase [Medicago truncatula]
Length=350

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +IK   L+SLSEQQL+DCD  S GC G
Sbjct  151  VAAVEGIVKIKNGNLISLSEQQLVDCDRQSSGCGG  185



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAAIE ITQIKT  LVSLSEQQL+DCD+   + GC G
Sbjct  148  VAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDG  184



>gb|AFJ15104.1| mexicain-like cystein protease, partial [Jacaratia mexicana]
Length=323

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I T KL+SLSEQ+LLDCD  S GC G
Sbjct  139  VATVEGINKIVTGKLISLSEQELLDCDRRSHGCKG  173



>emb|CDY15571.1| BnaA08g28550D [Brassica napus]
Length=343

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISL--GCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+ +   GC G
Sbjct  157  VAAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSG  193



>ref|XP_006404274.1| hypothetical protein EUTSA_v10010486mg [Eutrema salsugineum]
 gb|ESQ45727.1| hypothetical protein EUTSA_v10010486mg [Eutrema salsugineum]
Length=361

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  156  VAAVEGINKIKTNKLVSLSEQELVDCDTYQNEGCNG  191



>gb|ABI30272.1| VXH-A, partial [Vasconcellea x heilbornii]
Length=318

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I T +LVSLSEQ+LLDC+  S GC G
Sbjct  165  VAAVEGINKIVTGQLVSLSEQELLDCERRSYGCRG  199



>gb|ABI30275.1| VS-A [Vasconcellea stipulata]
Length=318

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI +I T +LVSLSEQ+LLDC+  S GC G
Sbjct  165  VAAVEGINKIVTGQLVSLSEQELLDCERRSYGCRG  199



>ref|XP_010475355.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISL--GCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+ +   GC G
Sbjct  126  VAAIEGINKIKTGNLVSLSEQQLIDCDVDTYNKGCSG  162



>emb|CAA20473.1| cysteine proteinase-like protein [Arabidopsis thaliana]
 emb|CAB79307.1| cysteine proteinase-like protein [Arabidopsis thaliana]
Length=355

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+ +I T +L+SLSEQ+L+DC+L++ GC+G
Sbjct  163  VAAVEGLNKIVTGELISLSEQELVDCNLVNNGCYG  197



>ref|XP_009391873.1| PREDICTED: xylem cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=349

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QI T  L SLSEQQL+DCD  + GC+G
Sbjct  162  VAAVEGINQIVTGNLTSLSEQQLIDCDTQNNGCNG  196



>ref|NP_001237379.1| cysteine proteinase precursor [Glycine max]
 dbj|BAC77521.1| cysteine proteinase [Glycine max]
 dbj|BAC77522.1| cysteine proteinase [Glycine max]
Length=362

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTKKNAGCNG  193



>gb|ACU23531.1| unknown [Glycine max]
Length=362

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTKKNAGCNG  193



>ref|NP_567686.2| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE84771.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=356

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+ +I T +L+SLSEQ+L+DC+L++ GC+G
Sbjct  163  VAAVEGLNKIVTGELISLSEQELVDCNLVNNGCYG  197



>ref|XP_010521644.1| PREDICTED: ervatamin-B-like [Tarenaya hassleriana]
Length=345

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGC  101
            VAA+EG+T+I T  LVSLSEQQLLDCD    GC
Sbjct  166  VAAVEGLTKITTGNLVSLSEQQLLDCDRYHKGC  198



>gb|KDP31767.1| hypothetical protein JCGZ_12228 [Jatropha curcas]
Length=315

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD    S GC+G
Sbjct  126  VAAVEGINKIKTGKLVSLSEQELVDCDTHNDSQGCNG  162



>ref|XP_007214697.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
 gb|EMJ15896.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
Length=340

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAA+EGITQ+ T KL+SLSEQ+++DCD+    LGC G
Sbjct  154  VAAVEGITQLTTSKLISLSEQEVVDCDINGKDLGCGG  190



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAAIE ITQIKT  LVSLSEQQL+DCD+   + GC G
Sbjct  174  VAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDG  210



>gb|AFJ15103.1| mexicain-like cystein protease, partial [Jacaratia mexicana]
Length=348

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +I T KL+SLSEQ+LLDCD  S GC G
Sbjct  164  VATVEGINKIVTGKLISLSEQELLDCDRRSHGCKG  198



>gb|EMT09945.1| hypothetical protein F775_52429 [Aegilops tauschii]
Length=351

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+  IK  KLVSLSEQ+L+DCD  ++GC G
Sbjct  156  VAAMEGLNHIKNGKLVSLSEQELVDCDAEAVGCAG  190



>gb|EAZ10092.1| hypothetical protein OsI_32402 [Oryza sativa Indica Group]
Length=382

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +IK  KLVSLSEQ+L+DCD +  GC G
Sbjct  187  VAVVEGIQKIKKGKLVSLSEQELVDCDTLDSGCDG  221



>ref|XP_009110997.1| PREDICTED: ervatamin-B-like [Brassica rapa]
Length=343

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISL--GCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+ +   GC G
Sbjct  157  VAAIEGINKIKTGNLVSLSEQQLIDCDVSAFNKGCSG  193



>ref|XP_004293931.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=345

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG+T+IKT +L+SLSEQQL+DC   + GC G
Sbjct  158  VAAVEGLTKIKTGQLISLSEQQLVDCSHQNGGCRG  192



>ref|NP_001042970.2| Os01g0347600 [Oryza sativa Japonica Group]
 dbj|BAF04884.2| Os01g0347600 [Oryza sativa Japonica Group]
Length=211

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAAIEG+T+I+T +L  LSEQ+L+DCD  S GC G
Sbjct  23   VAAIEGLTKIRTGQLTPLSEQELVDCDTNSNGCGG  57



>ref|XP_010501342.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+   + GC G
Sbjct  126  VAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSG  162



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  154  VAATEGINKIKTGKLISLSEQELVDCDTRSDMGCEG  189



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAA+EGITQ+ T+KL+SLSEQ+L+DCD      GC G
Sbjct  153  VAAVEGITQLTTQKLISLSEQELVDCDTKGEDQGCQG  189



>gb|AFW85697.1| hypothetical protein ZEAMMB73_051316 [Zea mays]
Length=298

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VA+IEG+ QIKT +LVSLSEQQ++DCD      GCHG
Sbjct  106  VASIEGVHQIKTGRLVSLSEQQIVDCDRGGNDHGCHG  142



>ref|XP_010061449.1| PREDICTED: zingipain-1-like [Eucalyptus grandis]
 gb|KCW68390.1| hypothetical protein EUGRSUZ_F02043 [Eucalyptus grandis]
Length=340

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGITQIK+ +L  LSEQQL+DCD  + GC G
Sbjct  156  VAAVEGITQIKSGELPVLSEQQLIDCDTENNGCEG  190



>ref|XP_006469054.1| PREDICTED: oryzain alpha chain-like [Citrus sinensis]
Length=212

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI ++KT KLVSLSEQ+L+DCD+ S   GC+G
Sbjct  23   VAAVEGINKLKTGKLVSLSEQELVDCDVNSENQGCNG  59



>gb|KHG06908.1| Vignain [Gossypium arboreum]
Length=361

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  157  VVAVEGINQIKTNKLVSLSEQELIDCDTEENQGCNG  192



>ref|XP_010070267.1| PREDICTED: zingipain-2 [Eucalyptus grandis]
 gb|KCW89603.1| hypothetical protein EUGRSUZ_A01887 [Eucalyptus grandis]
Length=349

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAA+EG+ QIKT KLVSLSEQ+L+DCD+   + GC G
Sbjct  161  VAAVEGLNQIKTGKLVSLSEQELMDCDVGKHNQGCSG  197



>ref|NP_001237199.1| cysteine proteinase precursor [Glycine max]
 dbj|BAC77523.1| cysteine proteinase [Glycine max]
 dbj|BAC77524.1| cysteine proteinase [Glycine max]
Length=362

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEENAGCNG  193



>gb|AIA26572.1| cysteine protease [Cicer arietinum]
 gb|AJA74417.1| cysteine protease [Cicer arietinum]
Length=347

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD  S   GC G
Sbjct  159  VAAVEGINKIKTGKLVSLSEQELIDCDTKSGNEGCEG  195



>gb|EEE70232.1| hypothetical protein OsJ_30346 [Oryza sativa Japonica Group]
Length=443

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VA +EGI +IK  KLVSLSEQ+L+DCD +  GC G
Sbjct  77   VAVVEGIQKIKKGKLVSLSEQELVDCDTLDSGCDG  111



>ref|XP_004513101.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=353

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD  S   GC G
Sbjct  165  VAAVEGINKIKTGKLVSLSEQELIDCDTKSGNEGCEG  201



>gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata]
Length=362

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTDKLVSLSEQELVDCDKEENQGCNG  193



>ref|XP_010462580.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+   + GC G
Sbjct  126  VAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSG  162



>ref|XP_007037813.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY22314.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=313

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEENQGCNG  193



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS-LGCHG  107
            VAA EGI +IKT KL+SLSEQ+L+DCD  S +GC G
Sbjct  615  VAATEGINEIKTGKLISLSEQELVDCDTSSDMGCEG  650



>ref|XP_008239373.1| PREDICTED: vignain-like [Prunus mume]
Length=363

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEQNQGCNG  193



>ref|XP_007209277.1| hypothetical protein PRUPE_ppa007566mg [Prunus persica]
 gb|EMJ10476.1| hypothetical protein PRUPE_ppa007566mg [Prunus persica]
Length=363

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEQNQGCNG  193



>ref|XP_008450203.1| PREDICTED: vignain-like [Cucumis melo]
Length=224

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+E I QIKT +LVSLSEQ+++DCD    GC G
Sbjct  36   VAAVESIHQIKTNELVSLSEQEVVDCDYRDGGCRG  70



>gb|EMT00545.1| Vignain [Aegilops tauschii]
Length=270

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    AAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            AA+EGI  I+T  LVSLS QQL+DCD  S GC G
Sbjct  80   AAMEGINSIRTRNLVSLSAQQLIDCDKGSFGCRG  113



>gb|KDO45769.1| hypothetical protein CISIN_1g041120mg [Citrus sinensis]
Length=340

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI ++KT KLVSLSEQ+L+DCD+ S   GC+G
Sbjct  172  VAAVEGINKLKTGKLVSLSEQELVDCDVNSENQGCNG  208



>ref|XP_006446742.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
 gb|ESR59982.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
Length=341

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI ++KT KLVSLSEQ+L+DCD+ S   GC+G
Sbjct  152  VAAVEGINKLKTGKLVSLSEQELVDCDVNSENQGCNG  188



>ref|XP_003593772.1| Cysteine proteinase [Medicago truncatula]
Length=339

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCH  104
            V AIEGI  I T KL++LSEQ+LLDCD IS GC+
Sbjct  136  VGAIEGINAITTGKLINLSEQELLDCDPISGGCN  169



>ref|XP_008659254.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=359

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VA+IEG+ QIKT +LVSLSEQQ++DCD      GCHG
Sbjct  167  VASIEGVHQIKTGRLVSLSEQQIVDCDRGGNDHGCHG  203



>gb|EMT11858.1| Vignain [Aegilops tauschii]
Length=310

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QI T +LVSLSEQQLLDC   + GC G
Sbjct  135  VAAVEGIHQITTGQLVSLSEQQLLDCTTENHGCGG  169



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAA+EGITQ+ T KL+SLSEQ+L+DCD+  +  GC G
Sbjct  152  VAAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSG  188



>gb|AHA56102.1| cysteine protease [Ambrosia artemisiifolia]
Length=386

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            V A+EGI  I+T KLV  SEQQL+DCD+ + GC G
Sbjct  161  VVALEGINAIRTGKLVKFSEQQLVDCDMTNAGCDG  195



>ref|XP_007037812.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY22313.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma 
cacao]
Length=362

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELVDCDTEENQGCNG  193



>gb|KHN27802.1| Vignain, partial [Glycine soja]
Length=288

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA EGI QI T  LVSLSEQ+L+DCD +  GC G
Sbjct  102  VAATEGIYQITTGNLVSLSEQELVDCDSVDHGCDG  136



>ref|XP_003593765.1| Cysteine proteinase [Medicago truncatula]
 gb|AES64016.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EG  +I T +L+SLSEQQL+DCD  + GCHG
Sbjct  180  VAAVEGAVKINTGELISLSEQQLVDCDERNSGCHG  214



>ref|XP_010911536.1| PREDICTED: thiol protease SEN102-like, partial [Elaeis guineensis]
Length=274

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD-LISLGCHG  107
            V A+EGI QIKT+KL+SLSEQ+L+DCD   + GC+G
Sbjct  156  VVAVEGINQIKTKKLISLSEQELIDCDNRNNHGCNG  191



>ref|NP_680113.3| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
 sp|Q9STL4.1|CEP2_ARATH RecName: Full=KDEL-tailed cysteine endopeptidase CEP2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB41164.1| cysteine endopeptidase-like protein [Arabidopsis thaliana]
 gb|AEE78403.1| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
Length=361

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI-SLGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VAAVEGINKIKTNKLVSLSEQELVDCDTKQNEGCNG  193



>gb|AES64023.2| papain family cysteine protease [Medicago truncatula]
Length=374

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCH  104
            V AIEGI  I T KL++LSEQ+LLDCD IS GC+
Sbjct  171  VGAIEGINAITTGKLINLSEQELLDCDPISGGCN  204



>ref|XP_006291442.1| hypothetical protein CARUB_v10017578mg [Capsella rubella]
 gb|EOA24340.1| hypothetical protein CARUB_v10017578mg [Capsella rubella]
Length=340

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+I   +LVSLSEQQLLDC+  + GC G
Sbjct  155  VAAVEGITKISKGELVSLSEQQLLDCNTENTGCGG  189



>ref|XP_006306197.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
 gb|EOA39095.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
Length=344

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL--ISLGCHG  107
            VAAIEGI +IKT  LVSLSEQQL+DCD+   + GC G
Sbjct  157  VAAIEGINKIKTGNLVSLSEQQLIDCDVGTYNKGCSG  193



>gb|EYU40491.1| hypothetical protein MIMGU_mgv1a018119mg, partial [Erythranthe 
guttata]
Length=302

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT I+T KL+SLS Q+L+DCD  +L C G
Sbjct  103  VAAVEGITYIRTNKLMSLSAQELVDCDTGNLQCEG  137



>ref|XP_002875897.1| hypothetical protein ARALYDRAFT_347926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52156.1| hypothetical protein ARALYDRAFT_347926 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            VAA+EGI +IKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VAAVEGINKIKTNKLVSLSEQELVDCDTNQNEGCNG  193



>ref|XP_004515851.1| PREDICTED: vignain-like [Cicer arietinum]
Length=360

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD-LISLGCHG  107
            + A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  IVAVEGINQIKTQKLVSLSEQELVDCDNQKNEGCNG  193



>ref|XP_004501841.1| PREDICTED: vignain-like [Cicer arietinum]
Length=362

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD-LISLGCHG  107
            V A+EGI QIKT KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  VVAVEGINQIKTNKLVSLSEQELIDCDNQENQGCNG  193



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLI--SLGCHG  107
            VAA+EGITQ+ T+KL+SLSEQ+L+DCD      GC G
Sbjct  153  VAAVEGITQLTTKKLISLSEQELVDCDTKGEDQGCQG  189



>ref|XP_004169046.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like, partial 
[Cucumis sativus]
Length=314

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IK  KL+SLSEQ+L+DCD+ S   GC+G
Sbjct  130  VAAVEGINKIKAGKLISLSEQELVDCDVTSGNQGCNG  166



>gb|KDO77829.1| hypothetical protein CISIN_1g037516mg [Citrus sinensis]
Length=330

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+I+T +L+SLSEQQ+LDC   S GC+G
Sbjct  148  VAAVEGITKIRTGRLISLSEQQVLDCSG-SRGCYG  181



>emb|CAA06243.1| pre-pro-TPE4A protein [Pisum sativum]
Length=360

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDL-ISLGCHG  107
            + A+EGI QIKT+KLVSLSEQ+L+DCD   + GC+G
Sbjct  158  IVAVEGINQIKTQKLVSLSEQELVDCDTGGNEGCNG  193



>ref|XP_004148072.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cucumis 
sativus]
Length=317

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IK  KL+SLSEQ+L+DCD+ S   GC+G
Sbjct  130  VAAVEGINKIKAGKLISLSEQELVDCDVTSGNQGCNG  166



>ref|XP_006468205.1| PREDICTED: actinidain-like [Citrus sinensis]
Length=340

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGIT+I+T +L+SLSEQQ+LDC   S GC+G
Sbjct  158  VAAVEGITKIRTGRLISLSEQQVLDCSG-SRGCYG  191



>emb|CDY10188.1| BnaC05g04310D [Brassica napus]
Length=343

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISL--GCHG  107
            VAAIEGIT+IKT  L+ LSEQQL+DCD  S   GC G
Sbjct  156  VAAIEGITKIKTGNLIPLSEQQLIDCDTGSYNKGCSG  192



>ref|XP_008225219.1| PREDICTED: ervatamin-C-like [Prunus mume]
Length=341

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCD--LISLGCHG  107
            VAA+EGI QIKT KL+SLSEQQLLDC     + GC+G
Sbjct  155  VAAVEGIIQIKTGKLISLSEQQLLDCTSGYDNQGCNG  191



>ref|XP_009119072.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY57814.1| BnaA10g28030D [Brassica napus]
Length=344

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISL--GCHG  107
            VAAIEGIT+IKT  L+ LSEQQL+DCD  S   GC G
Sbjct  157  VAAIEGITKIKTGNLIPLSEQQLIDCDTGSYNKGCSG  193



>gb|KHN12137.1| Thiol protease [Glycine soja]
Length=341

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA EGI QI T  LVSLSEQ+L+DCD +  GC G
Sbjct  156  IAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEG  190



>ref|XP_006582265.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA EGI QI T  LVSLSEQ+L+DCD +  GC G
Sbjct  157  IAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEG  191



>ref|XP_003526212.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA EGI QI T  LVSLSEQ+L+DCD +  GC G
Sbjct  157  IAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEG  191



>ref|XP_003526209.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=342

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            +AA EGI QI T  LVSLSEQ+L+DCD +  GC G
Sbjct  157  IAATEGIHQISTGNLVSLSEQELVDCDSVDDGCEG  191



>gb|KGN62053.1| hypothetical protein Csa_2G292830 [Cucumis sativus]
Length=340

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLIS--LGCHG  107
            VAA+EGI +IK  KL+SLSEQ+L+DCD+ S   GC+G
Sbjct  153  VAAVEGINKIKAGKLISLSEQELVDCDVTSGNQGCNG  189



>sp|P82474.1|CPGP2_ZINOF RecName: Full=Zingipain-2; AltName: Full=Cysteine proteinase 
GP-II [Zingiber officinale]
 pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|B Chain B, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|C Chain C, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|D Chain D, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
Length=221

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    VAAIEGITQIKTEKLVSLSEQQLLDCDLISLGCHG  107
            VAA+EGI QI T  L+SLSEQQL+DC   + GC G
Sbjct  33   VAAVEGINQIVTGDLISLSEQQLVDCTTANHGCRG  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584