BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21343_g1_i1 len=215 path=[3166:0-214]

Length=215
                                                                      Score     E

emb|CBI21977.3|  unnamed protein product                                107   5e-26   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    107   5e-26   Vitis vinifera
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    106   9e-26   
gb|AAK27968.1|AF242372_1  cysteine protease                             105   2e-25   Ipomoea batatas [batate]
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             105   2e-25   
gb|AAL14199.1|  cysteine proteinase precursor                           105   2e-25   Ipomoea batatas [batate]
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             105   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             105   4e-25   
ref|XP_006469012.1|  PREDICTED: vignain-like                            104   4e-25   
ref|XP_006469011.1|  PREDICTED: vignain-like                            104   5e-25   
emb|CAL64936.1|  putative cysteine protease 8                           102   2e-24   Trifolium pratense [peavine clover]
ref|XP_010045989.1|  PREDICTED: vignain-like                            101   2e-24   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    102   3e-24   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    102   5e-24   
gb|AAT34987.1|  putative cysteine protease                              101   6e-24   Gossypium hirsutum [American cotton]
ref|XP_004505502.1|  PREDICTED: vignain-like                            101   9e-24   
emb|CAN75313.1|  hypothetical protein VITISV_033592                   99.4    9e-24   Vitis vinifera
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            101   1e-23   
ref|XP_004505498.1|  PREDICTED: vignain-like                            100   1e-23   
ref|XP_003612210.1|  Cysteine proteinase                                100   1e-23   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            100   1e-23   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        100   2e-23   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    100   2e-23   Vitis vinifera
ref|XP_002523448.1|  cysteine protease, putative                        100   2e-23   Ricinus communis
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    100   2e-23   Vitis vinifera
emb|CBI21972.3|  unnamed protein product                                100   2e-23   
emb|CBI21973.3|  unnamed protein product                                100   2e-23   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    100   2e-23   Vitis vinifera
dbj|BAF46311.1|  cysteine proteinase precursor                          100   2e-23   Ipomoea nil [qian niu]
emb|CAN70559.1|  hypothetical protein VITISV_032465                     100   2e-23   Vitis vinifera
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  99.8    3e-23   
gb|AAP32196.1|  cysteine protease 8                                   99.8    3e-23   Trifolium repens [creeping white clover]
ref|XP_003609015.1|  Cysteine proteinase                              99.8    3e-23   
dbj|BAD29955.1|  cysteine protease                                    99.8    3e-23   Daucus carota [carrots]
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      99.8    3e-23   
emb|CDP20741.1|  unnamed protein product                              97.1    4e-23   
ref|XP_004505500.1|  PREDICTED: vignain-like                          99.4    4e-23   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      99.0    5e-23   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g           99.0    5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g           99.0    5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g           99.0    5e-23   
emb|CDP05747.1|  unnamed protein product                              99.0    6e-23   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                      99.0    6e-23   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          97.8    8e-23   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g           98.6    9e-23   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                      98.6    9e-23   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g           98.2    1e-22   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...  98.2    1e-22   Vitis vinifera
gb|AAP32197.1|  cysteine protease 10                                  97.8    1e-22   Trifolium repens [creeping white clover]
emb|CBI21976.3|  unnamed protein product                              98.2    1e-22   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g           98.2    1e-22   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...  97.8    1e-22   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg           97.8    1e-22   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g           97.8    1e-22   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g           97.8    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...  98.2    1e-22   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           97.4    1e-22   
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                 97.4    1e-22   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           97.8    1e-22   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g           97.8    1e-22   
gb|KDP23191.1|  hypothetical protein JCGZ_00324                       97.4    2e-22   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                      97.8    2e-22   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                   97.8    2e-22   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2           97.4    2e-22   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1           97.4    2e-22   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...  97.1    2e-22   
gb|KHN13721.1|  Vignain                                               97.4    2e-22   
ref|XP_003557016.1|  PREDICTED: vignain-like                          97.4    2e-22   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           97.4    2e-22   
emb|CBI21975.3|  unnamed protein product                              97.1    2e-22   
gb|KHN08187.1|  Thiol protease SEN102                                 97.4    2e-22   
ref|XP_006592465.1|  PREDICTED: vignain-like                          97.4    2e-22   
ref|XP_006592467.1|  PREDICTED: vignain-like                          97.4    2e-22   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  97.1    2e-22   
gb|KHN32069.1|  Vignain                                               97.1    2e-22   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...  97.1    2e-22   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                   97.1    3e-22   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  97.1    3e-22   
ref|XP_008780645.1|  PREDICTED: vignain-like                          96.7    3e-22   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           97.1    3e-22   
emb|CAN62459.1|  hypothetical protein VITISV_015168                   96.3    3e-22   Vitis vinifera
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                      97.1    3e-22   
ref|XP_008353751.1|  PREDICTED: actinidain-like                       95.9    3e-22   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  96.7    3e-22   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                      96.7    3e-22   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           96.7    4e-22   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...  96.7    4e-22   Vitis vinifera
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                 96.7    4e-22   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg           96.7    4e-22   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                      96.7    4e-22   
emb|CAN64655.1|  hypothetical protein VITISV_005140                   96.7    4e-22   Vitis vinifera
gb|KDP45578.1|  hypothetical protein JCGZ_17185                       96.3    4e-22   
ref|XP_004975184.1|  PREDICTED: vignain-like                          96.3    4e-22   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                      96.3    5e-22   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                      96.3    5e-22   
gb|AAP32195.1|  cysteine protease 5                                   96.3    5e-22   Trifolium repens [creeping white clover]
ref|XP_003605890.1|  Cysteine proteinase                              96.3    5e-22   
gb|AAP32198.1|  cysteine protease 12                                  96.3    5e-22   Trifolium repens [creeping white clover]
gb|KHN07749.1|  Vignain                                               95.9    5e-22   
ref|XP_002525123.1|  cysteine protease, putative                      96.3    5e-22   Ricinus communis
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                      96.3    6e-22   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                      96.7    6e-22   
ref|XP_007048796.1|  Senescence-associated gene 12                    96.3    6e-22   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...  95.9    6e-22   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...  95.9    6e-22   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                      95.9    6e-22   
ref|XP_006362420.1|  PREDICTED: vignain-like                          95.9    6e-22   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                      95.9    6e-22   
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like      94.0    6e-22   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       95.9    7e-22   
ref|XP_006592475.1|  PREDICTED: vignain-like                          95.9    7e-22   
ref|XP_003526232.1|  PREDICTED: vignain-like                          95.9    7e-22   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1               95.9    7e-22   
gb|KHN33962.1|  Vignain                                               95.9    7e-22   
ref|XP_003556992.1|  PREDICTED: vignain-like                          95.9    7e-22   
ref|XP_003527349.1|  PREDICTED: vignain-like                          95.9    7e-22   
ref|XP_002523447.1|  cysteine protease, putative                      95.9    7e-22   Ricinus communis
gb|ADV74756.1|  cysteine protease                                     95.9    8e-22   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg           95.5    9e-22   
ref|XP_006360707.1|  PREDICTED: vignain-like                          95.5    9e-22   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                      95.5    1e-21   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1               95.5    1e-21   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                      95.5    1e-21   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                   95.1    1e-21   
gb|AAP32194.1|  cysteine protease 1                                   95.1    1e-21   Trifolium repens [creeping white clover]
ref|XP_007048674.1|  Senescence-associated gene 12                    95.5    1e-21   
ref|XP_003527388.1|  PREDICTED: vignain-like                          95.5    1e-21   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                      95.1    1e-21   
ref|XP_002525124.1|  cysteine protease, putative                      95.1    1e-21   Ricinus communis
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                 95.5    1e-21   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g           95.1    1e-21   
emb|CDP18644.1|  unnamed protein product                              95.1    1e-21   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...  95.1    1e-21   
ref|XP_008354173.1|  PREDICTED: actinidain-like                       94.0    1e-21   
ref|XP_004297571.1|  PREDICTED: vignain-like                          95.1    1e-21   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g           95.1    1e-21   
ref|XP_003539989.1|  PREDICTED: vignain-like                          95.1    1e-21   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...  95.1    1e-21   
ref|XP_003539970.1|  PREDICTED: vignain-like                          95.1    1e-21   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       95.1    1e-21   
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg           95.1    1e-21   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg           95.1    1e-21   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            95.1    1e-21   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           95.1    1e-21   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            95.1    1e-21   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           95.1    1e-21   
gb|KHN13720.1|  Vignain                                               94.7    1e-21   
ref|XP_009361500.1|  PREDICTED: vignain-like                          95.1    1e-21   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                      95.1    1e-21   
gb|KHN28095.1|  Thiol protease                                        94.7    2e-21   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                      95.1    2e-21   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg           94.7    2e-21   
dbj|BAD29959.1|  cysteine protease                                    95.1    2e-21   Daucus carota [carrots]
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      94.7    2e-21   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                      94.7    2e-21   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                      94.7    2e-21   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...  94.7    2e-21   
gb|AAW78661.2|  senescence-specific cysteine protease                 94.7    2e-21   Nicotiana tabacum [American tobacco]
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                 94.7    2e-21   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg           94.7    2e-21   
gb|EMT09279.1|  Thiol protease SEN102                                 94.4    2e-21   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg           94.7    2e-21   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg           94.7    2e-21   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg           94.7    2e-21   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like      94.7    2e-21   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      94.7    2e-21   
gb|AGT97048.1|  senescence-specific cysteine protease                 94.7    2e-21   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg           94.7    2e-21   
emb|CDP18645.1|  unnamed protein product                              94.4    2e-21   
ref|XP_008340724.1|  PREDICTED: vignain-like                          94.4    2e-21   
ref|XP_006469128.1|  PREDICTED: vignain-like                          94.7    2e-21   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg              94.4    2e-21   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                      94.4    2e-21   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g           94.4    2e-21   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg           94.4    3e-21   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                      94.4    3e-21   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                      94.4    3e-21   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...  94.4    3e-21   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...  94.4    3e-21   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934  96.7    3e-21   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                      94.0    3e-21   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                      94.0    3e-21   
ref|XP_009359967.1|  PREDICTED: vignain-like                          94.0    3e-21   
gb|KHN32068.1|  Vignain                                               94.0    3e-21   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      94.0    3e-21   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  94.0    3e-21   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg           94.0    3e-21   
ref|XP_009797968.1|  PREDICTED: vignain-like                          94.0    3e-21   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                       94.0    3e-21   
ref|XP_009349242.1|  PREDICTED: vignain-like                          95.5    3e-21   
gb|AAA50755.1|  cysteine proteinase                                   94.0    4e-21   Alnus glutinosa
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg           94.0    4e-21   
ref|XP_008246197.1|  PREDICTED: vignain-like                          93.6    4e-21   
ref|XP_003607548.1|  Cysteine protease                                93.6    4e-21   
ref|XP_006360708.1|  PREDICTED: vignain-like                          93.6    4e-21   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           93.6    5e-21   
ref|XP_003607571.1|  Cysteine proteinase EP-B                         93.6    5e-21   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           93.6    5e-21   
ref|XP_004303175.1|  PREDICTED: vignain-like                          93.6    5e-21   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  93.6    5e-21   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           93.6    5e-21   
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g           93.2    6e-21   
ref|XP_008228922.1|  PREDICTED: vignain-like                          93.2    6e-21   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       93.2    6e-21   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg              93.2    6e-21   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...  93.2    6e-21   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg           93.2    6e-21   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...  93.2    7e-21   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg              93.2    7e-21   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...  93.2    7e-21   
gb|ADV41672.1|  cysteine protease                                     93.2    7e-21   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  93.2    7e-21   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg           93.2    7e-21   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg           93.2    7e-21   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                      93.2    8e-21   
ref|XP_006493641.1|  PREDICTED: xylem cysteine proteinase 1-like      93.2    8e-21   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      92.8    8e-21   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...  92.8    8e-21   
gb|AFV30165.1|  cysteine proteinase                                   92.8    8e-21   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...  92.8    8e-21   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                      92.8    9e-21   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                       92.8    9e-21   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      92.8    9e-21   
ref|XP_003607574.1|  Cysteine protease                                92.8    9e-21   
gb|KHN05669.1|  Vignain                                               92.4    9e-21   
gb|KHN38752.1|  Vignain                                               92.4    1e-20   
ref|XP_002531152.1|  cysteine protease, putative                      92.8    1e-20   Ricinus communis
ref|XP_008811650.1|  PREDICTED: vignain-like                          92.4    1e-20   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                      92.4    1e-20   
gb|KHN27806.1|  Vignain                                               92.4    1e-20   
ref|XP_004513101.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  92.4    1e-20   
ref|XP_008342800.1|  PREDICTED: thiol protease SEN102-like            91.7    1e-20   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                      92.4    1e-20   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           92.0    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007025398.1|  Senescence-associated gene 12                    92.0    1e-20   
ref|XP_003526229.1|  PREDICTED: vignain-like                          91.7    1e-20   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           92.0    1e-20   Populus trichocarpa [western balsam poplar]
emb|CDP18641.1|  unnamed protein product                              92.0    1e-20   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                      92.0    2e-20   
ref|XP_002531151.1|  cysteine protease, putative                      92.0    2e-20   Ricinus communis
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230        92.0    2e-20   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      92.0    2e-20   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg              92.0    2e-20   
ref|XP_003540013.1|  PREDICTED: vignain-like                          92.0    2e-20   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      92.0    2e-20   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  92.0    2e-20   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  92.0    2e-20   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        92.0    2e-20   
gb|KFK30176.1|  hypothetical protein AALP_AA7G227600                  92.0    2e-20   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                      91.7    2e-20   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g           91.7    2e-20   
emb|CDX75496.1|  BnaA01g02060D                                        92.0    2e-20   
dbj|BAB13759.1|  cysteine proteinase                                  91.7    2e-20   Astragalus sinicus
ref|XP_003596314.1|  Cysteine proteinase                              91.7    2e-20   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  91.7    2e-20   
ref|XP_002525147.1|  cysteine protease, putative                      91.7    2e-20   Ricinus communis
ref|XP_003599735.1|  Cysteine proteinase                              91.7    2e-20   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                  91.7    2e-20   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg           91.7    2e-20   
ref|XP_004306597.1|  PREDICTED: vignain-like                          91.7    2e-20   
ref|XP_007048792.1|  Senescence-associated gene 12                    91.7    2e-20   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...  91.7    3e-20   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg           91.7    3e-20   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      91.7    3e-20   
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  91.3    3e-20   
ref|XP_009365508.1|  PREDICTED: vignain-like                          93.6    3e-20   
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  91.3    3e-20   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      91.3    3e-20   
ref|XP_007050065.1|  Senescence-associated gene 12                    91.3    3e-20   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg              91.3    3e-20   
ref|XP_002513120.1|  cysteine protease, putative                      91.7    3e-20   Ricinus communis
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  91.3    3e-20   
gb|AFK44139.1|  unknown                                               91.3    3e-20   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                      91.3    3e-20   
ref|XP_003607647.1|  Cysteine proteinase                              91.3    3e-20   
gb|KGN62053.1|  hypothetical protein Csa_2G292830                     91.3    3e-20   
ref|NP_568651.1|  cysteine protease SAG12                             91.3    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865220.1|  senescence-associated gene 12                    91.3    4e-20   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1          90.9    4e-20   
ref|XP_004297572.1|  PREDICTED: vignain-like                          90.9    4e-20   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...  90.9    4e-20   
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1           90.9    4e-20   
emb|CDX69132.1|  BnaC01g03210D                                        90.9    5e-20   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           90.5    5e-20   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                      90.5    5e-20   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  90.5    6e-20   
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...  90.5    6e-20   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      90.5    6e-20   
ref|XP_004489011.1|  PREDICTED: vignain-like                          90.5    6e-20   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                      90.5    6e-20   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                      90.5    6e-20   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...  90.5    7e-20   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg           90.5    7e-20   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...  90.1    7e-20   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890        90.1    7e-20   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg              90.1    7e-20   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400        90.1    8e-20   
dbj|BAF56429.1|  cysteine proteinase                                  90.1    8e-20   
ref|XP_006362426.1|  PREDICTED: vignain-like                          90.1    8e-20   
dbj|BAF56430.1|  cysteine proteinase                                  90.1    8e-20   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...  90.1    9e-20   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           90.1    9e-20   
gb|EMT29822.1|  Vignain                                               89.7    1e-19   
ref|XP_006412113.1|  hypothetical protein EUTSA_v10025568mg           89.7    1e-19   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...  89.4    1e-19   
ref|XP_004290089.1|  PREDICTED: vignain-like                          89.7    1e-19   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 89.0    1e-19   
dbj|BAF56427.1|  cysteine proteinase                                  89.7    1e-19   
ref|NP_566920.1|  putative cysteine proteinase                        89.7    1e-19   
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like      89.7    1e-19   
gb|EMT20796.1|  Vignain                                               90.1    1e-19   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  89.7    1e-19   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg           89.7    1e-19   
gb|EMT15489.1|  Thiol protease SEN102                                 89.4    1e-19   
gb|ACU23533.1|  unknown                                               88.2    1e-19   
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg           89.4    1e-19   
gb|AAR92154.1|  putative cysteine protease 1                          89.4    1e-19   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                   89.4    1e-19   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                      89.4    2e-19   
gb|AHA62781.1|  RCR3-like cysteine protease                           89.4    2e-19   
ref|XP_002522559.1|  cysteine protease, putative                      89.4    2e-19   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like      89.4    2e-19   
gb|AHA62782.1|  RCR3-like cysteine protease                           89.0    2e-19   
gb|AHA62779.1|  RCR3-like cysteine protease                           89.0    2e-19   
gb|AHA62783.1|  RCR3-like cysteine protease                           89.0    2e-19   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...  89.0    2e-19   
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like      88.6    2e-19   
ref|XP_006830175.1|  hypothetical protein AMTR_s00374p00012080        89.0    2e-19   
ref|XP_004306851.1|  PREDICTED: vignain-like                          88.6    2e-19   
ref|XP_006582263.1|  PREDICTED: vignain-like                          88.6    3e-19   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      88.6    3e-19   
ref|XP_006582264.1|  PREDICTED: vignain-like                          88.6    3e-19   
ref|XP_004487578.1|  PREDICTED: vignain-like isoform X2               88.6    3e-19   
gb|KHN08873.1|  Vignain                                               88.6    3e-19   
dbj|BAF56428.1|  cysteine proteinase                                  88.6    3e-19   
ref|XP_010446933.1|  PREDICTED: xylem cysteine proteinase 1           88.6    3e-19   
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like      88.6    3e-19   
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033           88.6    3e-19   
gb|EMT29823.1|  Vignain                                               88.6    3e-19   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...  88.6    3e-19   
ref|XP_011040826.1|  PREDICTED: xylem cysteine proteinase 1           88.6    3e-19   
ref|XP_008225326.1|  PREDICTED: actinidain-like                       88.2    4e-19   
gb|AAC49135.1|  SAG12 protein                                         88.2    4e-19   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...  88.2    4e-19   
gb|AHA62780.1|  RCR3-like cysteine protease                           88.2    4e-19   
ref|XP_003527350.1|  PREDICTED: vignain-like                          88.2    4e-19   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...  88.2    4e-19   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  88.2    4e-19   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                      88.2    5e-19   
ref|XP_003538185.1|  PREDICTED: vignain-like                          88.2    5e-19   
ref|XP_002875898.1|  hypothetical protein ARALYDRAFT_485194           88.2    5e-19   
ref|XP_003596711.1|  Cysteine proteinase                              88.2    5e-19   
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like      88.2    5e-19   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      87.8    5e-19   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease       87.8    5e-19   
ref|XP_003599736.1|  Cysteine proteinase                              87.8    5e-19   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            87.8    5e-19   
gb|KHG04098.1|  Xylem cysteinease 1 -like protein                     87.8    5e-19   
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein        87.8    5e-19   
ref|XP_002869093.1|  hypothetical protein ARALYDRAFT_491113           87.8    5e-19   
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like      87.8    6e-19   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg           87.8    6e-19   
ref|NP_974687.1|  xylem cysteine proteinase 1                         87.4    6e-19   
ref|NP_566901.1|  KDEL-tailed cysteine endopeptidase CEP3             87.8    6e-19   
gb|EMT20795.1|  Vignain                                               87.4    6e-19   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  87.4    6e-19   
ref|XP_006362428.1|  PREDICTED: vignain-like                          87.4    7e-19   
ref|NP_567983.1|  xylem cysteine proteinase 1                         87.8    7e-19   
emb|CDP18154.1|  unnamed protein product                              87.8    7e-19   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160        87.4    7e-19   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      87.4    7e-19   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  87.4    7e-19   
gb|EMT29821.1|  Thiol protease SEN102                                 87.4    7e-19   
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like      87.4    7e-19   
ref|XP_007025415.1|  Senescence-associated gene 12, putative          87.4    8e-19   
ref|XP_006467666.1|  PREDICTED: vignain-like                          87.4    8e-19   
gb|AFL46179.1|  INT9 protein                                          85.9    8e-19   
ref|XP_010692582.1|  PREDICTED: ervatamin-C-like                      88.2    8e-19   
ref|XP_006284015.1|  hypothetical protein CARUB_v10005136mg           87.4    8e-19   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      87.4    8e-19   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                           87.4    8e-19   
gb|AAC49406.1|  cysteine proteinase                                   87.4    8e-19   
emb|CDX87758.1|  BnaC02g31910D                                        87.4    8e-19   
ref|XP_006280797.1|  hypothetical protein CARUB_v10026767mg           87.0    9e-19   
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                  87.0    9e-19   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                      87.0    9e-19   
ref|XP_004981743.1|  PREDICTED: cysteine proteinase EP-B 1-like       87.0    9e-19   
ref|XP_004308524.1|  PREDICTED: vignain-like                          87.0    9e-19   
dbj|BAG16370.1|  cysteine protease                                    87.0    1e-18   
gb|AAM73806.1|AF448505_1  cysteine proteinase                         87.0    1e-18   
ref|XP_004294729.1|  PREDICTED: vignain-like                          87.0    1e-18   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 89.7    1e-18   
ref|XP_002446130.1|  hypothetical protein SORBIDRAFT_06g002130        86.7    1e-18   
ref|XP_004487576.1|  PREDICTED: vignain-like                          86.7    1e-18   
gb|KHN12137.1|  Thiol protease                                        86.7    1e-18   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  87.8    1e-18   
ref|XP_010426443.1|  PREDICTED: ervatamin-B                           86.7    1e-18   
ref|XP_007043092.1|  Xylem cysteine peptidase 1                       86.7    1e-18   
ref|XP_004975183.1|  PREDICTED: vignain-like                          86.7    1e-18   
ref|XP_004506025.1|  PREDICTED: vignain-like                          86.7    2e-18   
ref|XP_010519533.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  86.7    2e-18   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...  86.7    2e-18   
ref|XP_004975182.1|  PREDICTED: vignain-like                          86.7    2e-18   
ref|XP_009774957.1|  PREDICTED: vignain-like                          86.7    2e-18   
dbj|BAC10906.1|  cysteine proteinase                                  86.7    2e-18   
ref|XP_006492751.1|  PREDICTED: xylem cysteine proteinase 1-like      86.7    2e-18   
emb|CDY39575.1|  BnaCnng09440D                                        86.7    2e-18   
ref|XP_010431170.1|  PREDICTED: senescence-specific cysteine prot...  86.3    2e-18   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  89.0    2e-18   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170        86.3    2e-18   
emb|CDY58055.1|  BnaA06g40240D                                        86.3    2e-18   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  86.3    2e-18   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                      86.3    2e-18   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  88.6    2e-18   
dbj|BAG16376.1|  cysteine protease                                    86.3    2e-18   
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                      85.9    2e-18   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                      86.3    2e-18   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                      86.3    2e-18   
ref|XP_006445818.1|  hypothetical protein CICLE_v10017565mg           85.9    2e-18   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg           85.9    2e-18   
gb|KDO63015.1|  hypothetical protein CISIN_1g041011mg                 85.9    2e-18   
ref|XP_009798777.1|  PREDICTED: oryzain beta chain-like               85.9    2e-18   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        86.3    2e-18   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                      86.3    2e-18   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                      86.3    2e-18   
gb|KDP47019.1|  hypothetical protein JCGZ_10746                       86.3    2e-18   
gb|KFM28904.1|  KDEL-tailed cysteine endopeptidase CEP1               88.6    2e-18   
ref|XP_003607546.1|  Cysteine proteinase                              86.3    2e-18   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                   85.9    2e-18   
gb|KFK34135.1|  hypothetical protein AALP_AA5G105500                  86.3    2e-18   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like            85.9    2e-18   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like            85.9    2e-18   
gb|AIA26572.1|  cysteine protease                                     85.9    3e-18   
ref|NP_001233949.1|  phytophthora-inhibited protease 1                85.9    3e-18   
emb|CDP18639.1|  unnamed protein product                              85.5    3e-18   
dbj|BAF43527.1|  cysteine proteinase                                  85.9    3e-18   
gb|AFW80235.1|  hypothetical protein ZEAMMB73_542371                  85.1    3e-18   
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  86.3    3e-18   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like            85.5    4e-18   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                      85.5    4e-18   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g           85.5    4e-18   
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  85.9    4e-18   
gb|EMT33085.1|  Vignain                                               85.5    4e-18   
ref|XP_008782844.1|  PREDICTED: xylem cysteine proteinase 1-like      85.5    4e-18   
ref|XP_010431171.1|  PREDICTED: senescence-specific cysteine prot...  84.0    4e-18   
ref|XP_010690568.1|  PREDICTED: xylem cysteine proteinase 2           85.5    4e-18   
emb|CBI30671.3|  unnamed protein product                              85.1    4e-18   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      85.5    4e-18   
ref|XP_010426325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  85.9    4e-18   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                      85.5    4e-18   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                      85.5    4e-18   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...  85.5    4e-18   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g           85.5    4e-18   
ref|XP_010526865.1|  PREDICTED: xylem cysteine proteinase 1           85.5    4e-18   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                      85.1    5e-18   
ref|XP_003635767.1|  Cysteine proteinase                              85.1    5e-18   
ref|XP_008458487.1|  PREDICTED: ervatamin-B-like                      85.1    5e-18   
ref|XP_004306813.1|  PREDICTED: vignain-like                          85.1    5e-18   
emb|CAD40110.2|  OSJNBa0035O13.9                                      84.7    5e-18   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                      85.1    5e-18   
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                      85.1    5e-18   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                      85.1    5e-18   
gb|AAX13273.1|  putative cysteine protease                            85.1    6e-18   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                      85.1    6e-18   
gb|EAY93080.1|  hypothetical protein OsI_14881                        84.7    6e-18   
ref|XP_010235884.1|  PREDICTED: xylem cysteine proteinase 1-like      85.1    6e-18   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like            85.1    6e-18   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like            84.7    6e-18   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                  86.3    6e-18   
ref|XP_006291361.1|  hypothetical protein CARUB_v10017500mg           85.1    6e-18   
gb|EMT04560.1|  Vignain                                               84.3    7e-18   
ref|XP_009617207.1|  PREDICTED: vignain-like                          85.1    7e-18   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            84.7    7e-18   
gb|KHN27797.1|  Thiol protease SEN102                                 84.7    7e-18   
emb|CDY48168.1|  BnaA06g16650D                                        85.1    7e-18   
gb|AEK97329.1|  chromoplast senescence-associated protein 12          84.0    8e-18   
gb|KCW76141.1|  hypothetical protein EUGRSUZ_D00518                   84.0    9e-18   
ref|XP_006852527.1|  hypothetical protein AMTR_s00021p00178980        84.3    9e-18   
ref|XP_009149828.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  84.7    9e-18   
emb|CDY39574.1|  BnaCnng09430D                                        84.0    1e-17   
ref|XP_009390652.1|  PREDICTED: xylem cysteine proteinase 1-like      84.3    1e-17   
ref|XP_003539770.1|  PREDICTED: vignain-like                          84.3    1e-17   
ref|XP_010686292.1|  PREDICTED: zingipain-2-like                      84.3    1e-17   
gb|ABR16787.1|  unknown                                               84.7    1e-17   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                      84.3    1e-17   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  84.3    1e-17   
ref|XP_006404272.1|  hypothetical protein EUTSA_v10010474mg           84.3    1e-17   
gb|EMS48276.1|  Fruit bromelain                                       84.3    1e-17   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           84.0    1e-17   
ref|XP_006404155.1|  hypothetical protein EUTSA_v10010521mg           84.0    1e-17   
ref|XP_010090710.1|  Xylem cysteine proteinase 1                      84.3    1e-17   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1          84.0    1e-17   
ref|XP_005844244.1|  hypothetical protein CHLNCDRAFT_139276           84.7    1e-17   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            84.0    1e-17   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            84.0    1e-17   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                   84.0    1e-17   
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like      84.0    1e-17   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      84.0    1e-17   
ref|XP_010686291.1|  PREDICTED: zingipain-2-like                      84.0    2e-17   
ref|NP_001047923.1|  Os02g0715000                                     84.0    2e-17   



>emb|CBI21977.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            EFADLTNEEF+S R  +K+ +  E T F YENVT VP T+DW +KGAVTP+K+QQ+CGCC
Sbjct  45   EFADLTNEEFRSLRNRFKAHICSEATTFKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCC  104

Query  182  WAFAAVAAIEG  214
            WAF+AVAA EG
Sbjct  105  WAFSAVAATEG  115



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            EFADLTNEEF+S R  +K+ +  E T F YENVT VP T+DW +KGAVTP+K+QQ+CGCC
Sbjct  87   EFADLTNEEFRSLRNRFKAHICSEATTFKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCC  146

Query  182  WAFAAVAAIEG  214
            WAF+AVAA EG
Sbjct  147  WAFSAVAATEG  157



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   106 bits (265),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADL NEEF++SR GYK P ++    T PF YEN++ VP T+DW +KGAVTP+K+Q +C
Sbjct  109  EFADLMNEEFRASRNGYKMPAHLSSSSTNPFRYENISAVPSTMDWRKKGAVTPIKDQGQC  168

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  169  GCCWAFSAVAATEG  182



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMET-TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            FADLTN+EFK+SR GYK P    + TPF YENV+ VP TVDW  KGAVTPVK+Q +CGCC
Sbjct  86   FADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCC  145

Query  182  WAFAAVAAIEG  214
            WAF+AVAA+EG
Sbjct  146  WAFSAVAAMEG  156



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEFK+SR  +K  +  E T PF YENVT VP T+DW +KGAVTPVK+Q +CGC
Sbjct  87   EFADLTNEEFKASRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAAIEG
Sbjct  147  CWAFSAVAAIEG  158



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMET-TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            FADLTN+EFK+SR GYK P    + TPF YENV+ VP TVDW  KGAVTPVK+Q +CGCC
Sbjct  88   FADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCC  147

Query  182  WAFAAVAAIEG  214
            WAF+AVAA+EG
Sbjct  148  WAFSAVAAMEG  158



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEF++SR GYK   ++    T PF YENV+ VP T+DW +KGAVTP+K+Q +C
Sbjct  109  EFADLTNEEFQASRNGYKMSAHLSSSSTKPFRYENVSAVPSTMDWRKKGAVTPIKDQGQC  168

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  169  GCCWAFSAVAATEG  182



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEFK SR  +K  +  E T PF YENVT VP T+DW +KGAVTPVK+Q +CGC
Sbjct  87   EFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAAIEG
Sbjct  147  CWAFSAVAAIEG  158



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEFK SR  +K  +  E T PF YENVT VP T+DW +KGAVTPVK+Q +CGC
Sbjct  87   EFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAAIEG
Sbjct  147  CWAFSAVAAIEG  158



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEFK SR  +K  +  E T PF YENVT VP T+DW +KGAVTPVK+Q +CGC
Sbjct  87   EFADLTNEEFKVSRNRFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAAIEG
Sbjct  147  CWAFSAVAAIEG  158



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +    M TT F YENV+ +P TVDW +KGAVTPVKNQ +C
Sbjct  88   QFADLTNEEFIASRNKFKGHMCSSIMRTTSFKYENVSGIPSTVDWRKKGAVTPVKNQGQC  147

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  148  GCCWAFSAVAATEG  161



>ref|XP_010045989.1| PREDICTED: vignain-like [Eucalyptus grandis]
 gb|KCW84693.1| hypothetical protein EUGRSUZ_B01513 [Eucalyptus grandis]
Length=255

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLT+EEFK+SR GYK    + T    PF YE+VT +P ++DW +KGAVTP+K+Q +CG
Sbjct  75   FADLTSEEFKASRTGYKRSSSLRTASMKPFQYESVTTIPSSMDWRKKGAVTPIKDQGQCG  134

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  135  CCWAFSAVAAMEG  147



>ref|XP_004487579.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cicer 
arietinum]
Length=335

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET---TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD TNEEFK+S  G K PL +ET   T F YENVT+VP T+DW E+GAVTP+KNQ  C
Sbjct  80   QFADQTNEEFKASLNGNKKPLRIETETETEFRYENVTEVPATMDWRERGAVTPIKNQYDC  139

Query  173  GCCWAFAAVAAIEG  214
            G CWAFA VAAIEG
Sbjct  140  GSCWAFATVAAIEG  153



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD+TNEEFK+S +G+K P+++    T  F Y N+TDV D++DW  +GAVTP+KNQ+ C
Sbjct  84   QFADMTNEEFKASHLGFK-PMHLAKSATGSFQYANLTDVSDSMDWRTRGAVTPIKNQKSC  142

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF++VAAIEG
Sbjct  143  GCCWAFSSVAAIEG  156



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET-----TPFMYENVTD-VPDTVDWVEKGAVTPVKNQ  163
            +FADLTNEEF++S  G+K P+ + +     TPF YENV+  +P +VDW +KGAVTPVKNQ
Sbjct  85   QFADLTNEEFRASYNGFKGPMVLSSQITKPTPFRYENVSSALPVSVDWRKKGAVTPVKNQ  144

Query  164  QKCGCCWAFAAVAAIEG  214
             +CGCCWAF+AVAAIEG
Sbjct  145  GQCGCCWAFSAVAAIEG  161



>ref|XP_004505502.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            ++ADLTNEEF SSR  +K  +    + TT F Y+NVT VP TVDW +KGAVTPVKNQ +C
Sbjct  89   QYADLTNEEFISSRNKFKGHMCSSIIRTTTFKYQNVTAVPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>emb|CAN75313.1| hypothetical protein VITISV_033592 [Vitis vinifera]
Length=201

 Score = 99.4 bits (246),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YE+VT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  11   EFADLTNEEFRASRNRFKAHICSTEATSFKYEHVTAVPSTVDWRKKGAVTPIKDQGQCGS  70

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  71   CWAFSAVAAMEG  82



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTP-FMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            EFAD TNEEF++SR GYK SP+     P F YE+VT VP +VDW +KGAVTPVK+Q +CG
Sbjct  88   EFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSSVDWRKKGAVTPVKDQGQCG  147

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  148  CCWAFSAVAAMEG  160



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            ++ADLTNEEF SSR  +K  +    + TT F YENV+ VP TVDW +KGAVTPVKNQ +C
Sbjct  88   QYADLTNEEFISSRNKFKGHMCSSIIRTTTFKYENVSAVPSTVDWRKKGAVTPVKNQGQC  147

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  148  GCCWAFSAVAATEG  161



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +    + TT F YENV+ +P TVDW +KGAVTPVKNQ +C
Sbjct  88   QFADLTNEEFVASRNKFKGHMCSSIIRTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQC  147

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  148  GCCWAFSAVAATEG  161



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTP-FMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            EFAD TNEEF++SR GYK SP+     P F YE+VT VP +VDW +KGAVTPVK+Q +CG
Sbjct  88   EFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSSVDWRKKGAVTPVKDQGQCG  147

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  148  CCWAFSAVAAMEG  160



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGY---KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLT EEFK+SR GY    SP  + T PF YENVT VP ++DW +KGAVTP+KNQ +CG
Sbjct  87   FADLTIEEFKASRNGYMRSSSPRQVSTKPFRYENVTAVPSSMDWRKKGAVTPIKNQGQCG  146

Query  176  CCWAFAAVAAIEG  214
             CWAF+AV A+EG
Sbjct  147  SCWAFSAVGAMEG  159



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFAD TNEEFK+SR GY     P   E T F YENV  VP ++DW +KGAVTP+K+Q +C
Sbjct  84   EFADQTNEEFKASRNGYNMSSRPRSSEITSFRYENVAAVPSSMDWRKKGAVTPIKDQGQC  143

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  144  GCCWAFSAVAAMEG  157



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEFK+SR GYK    +   E + F Y NVT VP ++DW +KGAVTP+K+Q +C
Sbjct  86   EFADLTNEEFKASRNGYKRSSNVGLSEKSSFRYGNVTAVPTSMDWRQKGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  146  GCCWAFSAVAAMEG  159



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YENVT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YENVT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YENVT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YENVT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMET-TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            FADLTN+EF +SR GY  P    + TPF YENV+ VP TVDW +KGAVTPVK+Q +CGCC
Sbjct  86   FADLTNKEFIASRNGYILPHECSSNTPFRYENVSAVPTTVDWRKKGAVTPVKDQGQCGCC  145

Query  182  WAFAAVAAIEG  214
            WAF+AVAA+EG
Sbjct  146  WAFSAVAAMEG  156



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YENVT VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYENVTAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADL+NEEFK+SR  +K  +   +  PF YENV+ VPD++DW +KGAVTPVK+Q +CGC
Sbjct  86   QFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPDSMDWRKKGAVTPVKDQGQCGC  145

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  146  CWAFSAVAAMEG  157



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +      TT F YENV+ +P TVDW +KGAVTPVKNQ +C
Sbjct  87   QFADLTNEEFVASRNKFKGHMCSSITRTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +     +TT F YENV+ +P TVDW +KGAVTPVKNQ +C
Sbjct  89   QFADLTNEEFIASRNKFKGHMCSSIAKTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP-FMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF +SR  +KS +    T  F YENVT VP T+DW +KGAVTP+KNQ +CGC
Sbjct  87   EFADLTNEEFTTSRNKFKSHVCATVTNVFRYENVTAVPATMDWRKKGAVTPIKNQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD+TNEEFK+S +G+K P+ +    T  F Y N+TDV D+VDW  +GAVTPVKNQ  C
Sbjct  82   QFADMTNEEFKASHLGFK-PMRLTKSTTGSFQYANLTDVSDSVDWRTRGAVTPVKNQGSC  140

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+ VAAIEG
Sbjct  141  GCCWAFSTVAAIEG  154



>emb|CDP20741.1| unnamed protein product, partial [Coffea canephora]
Length=165

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            +FADLTNEEF+++R  YK     E+  FMYENV  VP ++DW +KGAVT VK+Q +CGCC
Sbjct  86   QFADLTNEEFRAARNKYKPWKVCESKSFMYENVNAVPASMDWRKKGAVTGVKDQGQCGCC  145

Query  182  WAFAAVAAIEG  214
            WAF+AVAA+EG
Sbjct  146  WAFSAVAAMEG  156



>ref|XP_004505500.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            ++ADLTNEEF +SR  +K  +    + TT F Y+NVT +P TVDW +KGAVTPVKNQ +C
Sbjct  89   QYADLTNEEFIASRNKFKGHMCSSIIRTTTFKYQNVTALPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT--PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FAD+TNEEFK+SR+G+K P+  E+T   F Y N++D PD++DW  KGAVT VKNQ+ CG
Sbjct  72   QFADMTNEEFKASRLGFK-PMPTESTTGSFQYANLSDAPDSMDWRTKGAVTAVKNQRSCG  130

Query  176  CCWAFAAVAAIE  211
            CCWAF++VAAIE
Sbjct  131  CCWAFSSVAAIE  142



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP T+DW +KGAVTPVK+Q +CGC
Sbjct  56   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGC  115

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  116  CWAFSAVAAMEG  127



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP TVDW ++GAVTPVK+Q +CGC
Sbjct  87   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP TVDW ++GAVTPVK+Q +CGC
Sbjct  87   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
             FAD+TNEEF++ R GYK     ++  F YENVTDVP ++DW E+GAVTPVKNQ  CGCC
Sbjct  89   RFADMTNEEFRA-RNGYKPFTSSKSASFRYENVTDVPSSLDWREEGAVTPVKNQGDCGCC  147

Query  182  WAFAAVAAIEG  214
            WAF+AVAA EG
Sbjct  148  WAFSAVAATEG  158



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLT EEFK+SR GYK   SP  + T PF YE+VT VP ++DW +KGAVTP+K+Q +CG
Sbjct  87   FADLTIEEFKASRNGYKRSSSPRQVSTKPFRYEHVTAVPSSMDWRKKGAVTPIKDQGQCG  146

Query  176  CCWAFAAVAAIEG  214
             CWAF+AV A+EG
Sbjct  147  SCWAFSAVGAMEG  159



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    ++TT F YENVT VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSIIKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVA+ EG
Sbjct  147  GCCWAFSAVASAEG  160



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT +P TVDW +KGAVTPVK+Q +C
Sbjct  88   QFADLTNEEFIAGRNRFKGHMCSSILRTTTFKYENVTTIPSTVDWRQKGAVTPVKDQGQC  147

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  148  GCCWAFSAVAATEG  161



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      ETT F YENVT  +P T+DW +KGAVTP+K+Q +CG
Sbjct  89   QFADLTNEEFKASRNGFKGHECSTETTSFKYENVTASLPATMDWRKKGAVTPIKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>ref|XP_007132874.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
 gb|ESW04868.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
Length=329

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT +P TVDW +KGAVTPVK+Q +C
Sbjct  88   QFADLTNEEFIAGRNRFKGHMCSSILRTTTFKYENVTAIPSTVDWRQKGAVTPVKDQGQC  147

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  148  GCCWAFSAVAATEG  161



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF +SR  +K+ +   E T F YENVT VP T+DW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFGTSRNRFKAHICSTEATSFKYENVTAVPSTIDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>gb|AAP32197.1| cysteine protease 10 [Trifolium repens]
Length=272

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEFK+SR  +K  +    + TT F YEN + +P TVDW +KGAVTPVKNQ +C
Sbjct  16   KFADLTNEEFKASRNKFKGHMCSSIIRTTTFKYENASAIPSTVDWRKKGAVTPVKNQGQC  75

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA EG
Sbjct  76   GSCWAFSAVAATEG  89



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF +SR  +K+ +   E T F YENVT VP T+DW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFGTSRNRFKAHICSTEATSFKYENVTAVPSTIDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY---METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEE K +R GY+ PL    M+ T F YENVT VP T+DW +KGAVTP+K+Q +C
Sbjct  86   KFADLTNEELKVARNGYRRPLQTRPMKVTSFKYENVTAVPATMDWRKKGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+ VAA EG
Sbjct  146  GSCWAFSTVAATEG  159



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP T+DW ++GAVTPVK+Q +CGC
Sbjct  87   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_007214697.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
 gb|EMJ15896.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
Length=340

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY-METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FAD TNEE K+SR G+K   Y  +TT F YENVT VP T+DW  KGAVTPVK+Q +CG 
Sbjct  88   QFADQTNEEVKASRNGFKGREYSTKTTSFKYENVTVVPSTMDWRSKGAVTPVKDQGQCGS  147

Query  179  CWAFAAVAAIEG  214
            CWAFAAVAA+EG
Sbjct  148  CWAFAAVAAVEG  159



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP T+DW ++GAVTPVK+Q +CGC
Sbjct  87   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADL+NEEFK+SR  +K  +   +  PF YENV+ VP T+DW +KGAVTPVK+Q +CGC
Sbjct  87   QFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADL+NEEFK+SR  +K  +   +  PF YENV+ VP T+DW +KGAVTPVK+Q +CGC
Sbjct  112  QFADLSNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGC  171

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  172  CWAFSAVAAMEG  183



>ref|XP_007132871.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
 gb|ESW04865.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
Length=270

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSR---MGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R    G+     + TT F YENVT +P TVDW +KGAVTPVK+Q +C
Sbjct  53   QFADLTNEEFTAGRNRLKGHMCSSILRTTTFKYENVTAIPSTVDWRQKGAVTPVKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>gb|KDO63024.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=281

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTP--FMYENV--TDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTN+EF++   GYK  SP +  TT   F Y+N+  TDVP ++DW +KGAVTP+KNQ
Sbjct  95   QFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQ  154

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAFAAVAA+EG
Sbjct  155  KECGCCWAFAAVAAVEG  171



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF+++  GY+ P +    ETT F YENVT +  ++DW +KGAVT VKNQ +C
Sbjct  68   DFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQC  127

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  128  GCCWAFSAVAATEG  141



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP T+DW ++GAVTPVK+Q +CGC
Sbjct  87   QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>gb|KDP23191.1| hypothetical protein JCGZ_00324 [Jatropha curcas]
Length=287

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADL+NEEFK+SR GYK        ET  F YENV  VP ++DW  KGAVTP+K+Q +CG
Sbjct  136  FADLSNEEFKASRNGYKRSSIAKSSETLSFKYENVPAVPTSMDWRNKGAVTPIKDQGQCG  195

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA++G
Sbjct  196  CCWAFSAVAAMKG  208



>ref|XP_010052196.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=345

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-----ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLTNEEF++ R G++ P        + TPF YEN TDVP ++DW EKGAVTPVK+Q 
Sbjct  88   QFADLTNEEFRAFRGGFRLPKTRIGSKKDDTPFRYENFTDVPSSIDWREKGAVTPVKDQG  147

Query  167  KCGCCWAFAAVAAIEG  214
             C  CWAF+AVAA+EG
Sbjct  148  HCSSCWAFSAVAAVEG  163



>gb|KCW76116.1| hypothetical protein EUGRSUZ_D00493 [Eucalyptus grandis]
Length=354

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-----ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLTNEEF++ R G++ P        + TPF YEN TDVP ++DW EKGAVTPVK+Q 
Sbjct  97   QFADLTNEEFRAFRGGFRLPKTRIGSKKDDTPFRYENFTDVPSSIDWREKGAVTPVKDQG  156

Query  167  KCGCCWAFAAVAAIEG  214
             C  CWAF+AVAA+EG
Sbjct  157  HCSSCWAFSAVAAVEG  172



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF+++  GY+ P +    ETT F YENVT +  ++DW +KGAVT VKNQ +C
Sbjct  76   DFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQC  135

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  136  GCCWAFSAVAATEG  149



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF+++  GY+ P +    ETT F YENVT +  ++DW +KGAVT VKNQ +C
Sbjct  86   DFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>gb|KHG19386.1| KDEL-tailed cysteine endopeptidase CEP2 -like protein [Gossypium 
arboreum]
Length=274

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET-TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTN+EF +SR G K  +   T T F YEN T +P TVDW +KGAVTP+K+Q +CGC
Sbjct  53   QFADLTNQEFTASRNGLKGHMCSNTATTFKYENATALPSTVDWRKKGAVTPIKDQGQCGC  112

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  113  CWAFSAVAAMEG  124



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  70   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  129

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  130  GCCWAFSAVAATEG  143



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    ++TT F YENVT VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMRSSIIKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVA+ EG
Sbjct  147  GCCWAFSAVASAEG  160



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YE+V  VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYEHVAAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  70   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  129

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  130  GCCWAFSAVAATEG  143



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY---METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEE K +R GY+ PL    M+ T F YENVT VP T+DW +KGAVTP+K+Q +C
Sbjct  86   KFADLTNEELKIARNGYRRPLQTRPMKVTSFEYENVTAVPATMDWRKKGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+ VAA EG
Sbjct  146  GSCWAFSTVAATEG  159



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENVT VP TVDW +KGAVTP+K+Q +C
Sbjct  70   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQC  129

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  130  GCCWAFSAVAATEG  143



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENV+ VP T+DW ++GAVTP K+Q +CGC
Sbjct  107  QFADLTNEEFKASRNRFKGHMCSPQAGPFRYENVSAVPSTMDWRKEGAVTPAKDQGQCGC  166

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAAIEG
Sbjct  167  CWAFSAVAAIEG  178



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLTN+EFK++R GYK    + ++    F YENVT VP TVDW +KGAVTPVK Q +CG
Sbjct  73   FADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVTAVPSTVDWRQKGAVTPVKEQGQCG  132

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  133  CCWAFSAVAATEG  145



>ref|XP_007021896.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY13421.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
Length=333

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFAD++++EF ++R GYK+P  + T+ PF Y   TDVP ++DW EKGAVT VK+Q  CGC
Sbjct  79   EFADMSHDEFVAARTGYKNPGNLATSSPFSYAEFTDVPTSLDWREKGAVTAVKDQGDCGC  138

Query  179  CWAFAAVAAIEG  214
            CWAFAAVAA+EG
Sbjct  139  CWAFAAVAAVEG  150



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLT EEF++S  G+K  P+      F Y NVTDVP +VDW  KGAVTPVK+Q +CGC
Sbjct  34   QFADLTTEEFRASHTGFKPKPMRATGQNFGYANVTDVPPSVDWRSKGAVTPVKDQGQCGC  93

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  94   CWAFSAVAATEG  105



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>emb|CAN62459.1| hypothetical protein VITISV_015168 [Vitis vinifera]
Length=246

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF +SR  +K+ +   E T F YENVT VP T DW +KGAVTP+K+Q +CG 
Sbjct  11   EFADLTNEEFGTSRNRFKAHICSTEATSFKYENVTAVPSTXDWRKKGAVTPIKDQGQCGS  70

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  71   CWAFSAVAAMEG  82



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLTN+EFK++R GYK    + ++    F YENVT VP TVDW +KGAVTPVK Q +CG
Sbjct  87   FADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVTAVPSTVDWRQKGAVTPVKEQGQCG  146

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  147  CCWAFSAVAATEG  159



>ref|XP_008353751.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK++R G+K       T F YENVT  +P T+DW +KGAVTPVK+Q +CGC
Sbjct  89   QFADLTNEEFKATRNGFKGHECSTKTSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCGC  148

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  149  CWAFSAVAATEG  160



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD+TNEEFK+S +G+K P+ +    T  F Y N+TDV D++DW  +GAVTPVK+Q  C
Sbjct  84   QFADMTNEEFKASHLGFK-PMRLTKSTTGSFQYANLTDVSDSMDWRTRGAVTPVKDQGSC  142

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+++AAIEG
Sbjct  143  GCCWAFSSIAAIEG  156



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  78   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAAAEG  160



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YE+V  VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYEHVAAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>gb|KDO63025.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=348

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTP--FMYENV--TDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTN+EF++   GYK  SP +  TT   F Y+N+  TDVP ++DW +KGAVTP+KNQ
Sbjct  95   QFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQ  154

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAFAAVAA+EG
Sbjct  155  KECGCCWAFAAVAAVEG  171



>ref|XP_006445658.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
 gb|ESR58898.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
Length=348

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTP--FMYENV--TDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTN+EF++   GYK  SP +  TT   F Y+N+  TDVP ++DW +KGAVTP+KNQ
Sbjct  95   QFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQ  154

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAFAAVAA+EG
Sbjct  155  KECGCCWAFAAVAAVEG  171



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+K       T F YEN+T  +P T+DW +KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKTSRNGFKGHECSTKTSFKYENLTASLPATMDWRKKGAVTPIKDQGQCGC  148

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  149  CWAFSAVAATEG  160



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            EFADLTNEEF++SR  +K+ +   E T F YE+V  VP TVDW +KGAVTP+K+Q +CG 
Sbjct  87   EFADLTNEEFRASRNRFKAHICSTEATSFKYEHVXAVPSTVDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENVT VP ++DW +KGAVTP+K+Q +CG 
Sbjct  87   QFADLTNEEFKTSRNRFKGHMCSPQEGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVT--DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLT++EF+++R GYK      TT F Y NV+  D+PD+VDW  KGAVTP+K+Q +CG
Sbjct  85   QFADLTDDEFRATRTGYKPAGKARTTAFRYANVSLDDLPDSVDWRTKGAVTPIKDQGQCG  144

Query  176  CCWAFAAVAAIEG  214
            CCWAF+ VA++EG
Sbjct  145  CCWAFSTVASMEG  157



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  89   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+K       T F YEN+T  +P T+DW +KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFKGHECSTKTSFKYENLTASLPATMDWRKKGAVTPIKDQGQCGC  148

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  149  CWAFSAVAATEG  160



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +    + TT F YEN T VP TVDW +KGAVTPVKNQ +C
Sbjct  88   QFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYEN-TSVPSTVDWRKKGAVTPVKNQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+A+AA EG
Sbjct  147  GCCWAFSAIAATEG  160



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTN+EF SSR  +K  +      T+ F YEN + +P +VDW +KGAVTPVKNQ +C
Sbjct  87   QFADLTNDEFTSSRNKFKGHMCSSITRTSTFKYENASAIPSSVDWRKKGAVTPVKNQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +    + TT F YEN T VP TVDW +KGAVTPVKNQ +C
Sbjct  88   QFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYEN-TSVPSTVDWRKKGAVTPVKNQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+A+AA EG
Sbjct  147  GCCWAFSAIAATEG  160



>gb|KHN07749.1| Vignain [Glycine soja]
Length=301

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTN+EF + R G+K  +    + TT F +ENVT  P TVDW +KGAVTP+K+Q +C
Sbjct  45   QFADLTNKEFIAPRNGFKGHMCSSIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQC  104

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  105  GCCWAFSAVAATEG  118



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL--YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEF++   GYK PL    + TPF YENVT +P ++DW  KGAVTP+K+Q  CG
Sbjct  87   KFADLTNEEFRAFWNGYKRPLGASRKITPFKYENVTALPSSIDWRSKGAVTPIKDQGVCG  146

Query  176  CCWAFAAVAAIEG  214
             CWAF+AVAA EG
Sbjct  147  SCWAFSAVAATEG  159



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +T+ F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  89   QFADLTNEEFKASRNGFKGHECSTKTSSFKYENVTASLPATMDWRKKGAVTPVKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  138  QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCG  197

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  198  CCWAFSAVAATEG  210



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF +SR  +K  +   + T F YEN+T +P TVDW +KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFTASRNRFKGHMCSNKATTFKYENLTALPSTVDWRKKGAVTPIKDQGQCGC  148

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  149  CWAFSAVAAMEG  160



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR GYK   YM++T    F Y NV+ VP ++DW +KGAVT VK+Q +C
Sbjct  86   KFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR GYK   YM++T    F Y NV+ VP ++DW +KGAVT VK+Q +C
Sbjct  86   KFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  89   QFADLTNEEFKVSRNGFKGHECSTKTTSFKYENVTASLPATMDWRKKGAVTPVKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP---FMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF+    GYKS     + P   F Y N+TDVP T+DW +KGAVTP+K+Q +C
Sbjct  91   KFADLTNEEFRVVHTGYKSSFMSSSKPKTHFRYANITDVPPTMDWRKKGAVTPIKDQMEC  150

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA+EG
Sbjct  151  GSCWAFSAVAAMEG  164



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+ R  +KS +   E   F YEN+T VP ++DW +KGAVTPVKNQ +CGC
Sbjct  88   QFADLTNEEFKA-RNRFKSHMCSTEAASFRYENITAVPSSMDWRKKGAVTPVKNQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>ref|XP_006471123.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=179

 Score = 94.0 bits (232),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL----YMETTP--FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++   GY  P+       + P  F Y+NVTDVP ++DW EKGAVT +KNQ
Sbjct  90   EFSDLTNEEFRALYTGYNRPVPSVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GHCGSCWAFSAVAAVEG  166



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENVT VP ++DW +KGAVTP+K+Q +CG 
Sbjct  87   QFADLTNEEFKTSRNRFKGHMCSPQAGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              ADLT EEFK+SR G K P  + TTPF YENVT +P  +DW  KGAVT +K+Q +CG C
Sbjct  86   HLADLTVEEFKASRNGLKRPYELSTTPFKYENVTAIPAAIDWRTKGAVTSIKDQGQCGSC  145

Query  182  WAFAAVAAIEG  214
            WAF+ VAA EG
Sbjct  146  WAFSTVAATEG  156



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTN+EF + R G+K  +    + TT F +ENVT  P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNKEFIAPRNGFKGHMCSSIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  53   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  53   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEFK S+ GYK        E + F Y NVT VP ++DW + GAVTP+K+Q +C
Sbjct  86   EFADLTNEEFKVSKNGYKRSSGVGLTEKSSFRYANVTAVPTSMDWRQNGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  146  GCCWAFSAVAAMEG  159



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK----SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTN+EF++SR GYK    S  ++ +  F Y NV+ VPD VDW ++GAVTPVK+Q  
Sbjct  103  KFADLTNDEFRASRNGYKKQPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAVTPVKDQGD  162

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA+EG
Sbjct  163  CGCCWAFSAVAAMEG  177



>ref|XP_006421530.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
 gb|ESR34770.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
Length=344

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+AVAA+EG
Sbjct  147  GQCGVCWAFSAVAAVEG  163



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEF+++R GYK P      E T F YENVT  P T+DW  KGAVT +KNQ +C
Sbjct  86   EFADLTNEEFRATRNGYKMPSQKKSPEITSFKYENVT-APATMDWRLKGAVTGIKNQGQC  144

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  145  GCCWAFSAVAATEG  158



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFMGHECSTKTTAFKYENVT-APPTVDWRNKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>ref|XP_004487577.1| PREDICTED: vignain-like isoform X1 [Cicer arietinum]
Length=335

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET---TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD TNEEFK+S  G K PL +       F YENVTDVP T+DW E+GAVTP+K+Q KC
Sbjct  80   QFADQTNEEFKASLNGNKKPLGVGIATENEFRYENVTDVPATMDWRERGAVTPIKDQYKC  139

Query  173  GCCWAFAAVAAIEG  214
            G CWAFA VAA EG
Sbjct  140  GSCWAFATVAATEG  153



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+S+ G+K      +TT F YENVT  +P T+DW +KGAVTP+K+Q +CG
Sbjct  78   QFADLTNEEFKASKNGFKGHECSTKTTSFKYENVTASLPATMDWRKKGAVTPIKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLT+EEFK+SR GYK    +      PF YE+VT +P ++DW +KGAVTP+K+Q +CG
Sbjct  54   FADLTSEEFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCG  113

Query  176  CCWAFAAVAAIEG  214
            C WAF+AVAA+EG
Sbjct  114  CRWAFSAVAAMEG  126



>gb|AAP32194.1| cysteine protease 1 [Trifolium repens]
Length=292

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +    + TT F YEN + +P TVDW +KGAVTPVKNQ +C
Sbjct  36   KFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYENASAIPSTVDWRKKGAVTPVKNQGQC  95

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA EG
Sbjct  96   GSCWAFSAVAATEG  109



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT-PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF +SR  +K  +   T   F YENVT VP  +DW +KGAVTPVK+Q +CGC
Sbjct  90   QFADLTNEEFTASRNRFKGHMCSNTAASFKYENVTAVPSAMDWRQKGAVTPVKDQGQCGC  149

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  150  CWAFSAVAAMEG  161



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTVIPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            F DLT EEFK+SR GYK   SP  + T PF YE+VT VP ++DW +KGAV P+K+Q +CG
Sbjct  87   FVDLTIEEFKASRNGYKRSSSPRQVSTKPFRYEHVTAVPSSMDWRKKGAVMPIKDQGQCG  146

Query  176  CCWAFAAVAAIEG  214
             CWAF+AV A+EG
Sbjct  147  SCWAFSAVGAMEG  159



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME--TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
             FADLTNEEF++S  GYK PL      TPF YENVT +P ++DW  KGAVT +K+Q++CG
Sbjct  87   RFADLTNEEFRASWNGYKRPLDASRIVTPFKYENVTALPYSMDWRRKGAVTSIKDQRECG  146

Query  176  CCWAFAAVAAIEG  214
             CWAF+AVAA EG
Sbjct  147  SCWAFSAVAATEG  159



>gb|KDO55227.1| hypothetical protein CISIN_1g019112mg [Citrus sinensis]
Length=346

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL----YMETTP--FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY  P+       + P  F Y+NVTDVP ++DW EKGAVT +KNQ
Sbjct  90   EFSDLTNEEFRASYTGYNRPVPSVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GHCGSCWAFSAVAAVEG  166



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENV+ VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHVCSSITRTTTFKYENVSAVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +S  G K   SP    +T F YENVT VP TVDW  KGAVTP+K+Q +C
Sbjct  80   QFADLTNEEFVASHNGLKMSSSPRLFMSTSFKYENVTAVPATVDWRTKGAVTPIKDQGQC  139

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+A+AA EG
Sbjct  140  GSCWAFSAIAATEG  153



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY---METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLT EE K +R GY+ PL    M+ T F YENVT VP T+DW +KGAVTP+K+Q +C
Sbjct  86   KFADLTTEELKVARNGYRRPLQTRPMKVTSFEYENVTAVPATMDWRKKGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+ VAA EG
Sbjct  146  GSCWAFSTVAATEG  159



>ref|XP_008354173.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK++R G K       T F YENVT  +P T+DW +KGAVTPVK+Q +CGC
Sbjct  89   QFADLTNEEFKATRNGXKGHECSTKTSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCGC  148

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  149  CWAFSAVAATEG  160



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF +SR  +K      +TT F YENVT VP TVDW +KGAVTPVK+Q +CGC
Sbjct  88   QFADLTNEEFITSRNRFKGHECSTKTTSFKYENVT-VPATVDWRQKGAVTPVKDQGQCGC  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAMEG  158



>ref|XP_007132860.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
 gb|ESW04854.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
Length=343

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +    + TT F YENV+ VP TVDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSIIRTTTFKYENVSAVPSTVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AV A EG
Sbjct  147  GCCWAFSAVGATEG  160



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNKFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 7/78 (9%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS---PLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKN  160
            +FADLTNEEF+    GYKS   P  M +    T F Y N+TDVP  +DW  KGAVTP+K+
Sbjct  91   KFADLTNEEFRVLHTGYKSSSHPKIMSSSKPKTHFRYANITDVPPIMDWRRKGAVTPIKD  150

Query  161  QQKCGCCWAFAAVAAIEG  214
            Q +CGCCWAF+AVAA+EG
Sbjct  151  QMECGCCWAFSAVAAMEG  168



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM-ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YENVT VP ++DW +KGAVTP+K+Q +CG 
Sbjct  87   QFADLTNEEFKTSRNRFKGHMCSPQAGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+ VAA+EG
Sbjct  147  CWAFSTVAAVEG  158



>ref|XP_006421528.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
 gb|ESR34768.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
Length=323

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+AVAA+EG
Sbjct  147  GQCGDCWAFSAVAAVEG  163



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENV   VP T+DW +KGAVTPVK+Q +CG
Sbjct  84   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPATMDWRKKGAVTPVKDQGQCG  143

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  144  CCWAFSAVAATEG  156



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              ADLT EEFK+SR G+K P    TT F YENVT +P  +DW  KGAVTP+K+Q +CG C
Sbjct  86   HLADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  182  WAFAAVAAIEG  214
            WAF+ +AA EG
Sbjct  146  WAFSTIAATEG  156



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY---METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD TNE+FK +R GY+ P     M+ T F YENVT VP T+DW +KGAVTP+K+Q +C
Sbjct  86   KFADQTNEKFKGARNGYRRPFQTRPMKVTSFKYENVTAVPATMDWRKKGAVTPIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+ VAA EG
Sbjct  146  GSCWAFSTVAATEG  159



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              ADLT EEFK+SR G+K P    TT F YENVT +P  +DW  KGAVTP+K+Q +CG C
Sbjct  86   HLADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  182  WAFAAVAAIEG  214
            WAF+ +AA EG
Sbjct  146  WAFSTIAATEG  156



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT VP  VDW +KGAVTPVK+Q +C
Sbjct  87   QFADLTNEEFIAPRNRFKGHMCSSITRTTSFKYENVTAVPSKVDWRQKGAVTPVKDQGQC  146

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  147  GCCWAFSAVAATEG  160



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  53   QFADLTNEEFIAPRNRFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 6/74 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSR---MGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEFK+SR   MG++     +TT F YENVT  P TVDW +KGAVTPVK+Q +C
Sbjct  89   QFADLTNEEFKASRNRFMGHECS--AKTTSFKYENVT-APPTVDWRKKGAVTPVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  146  GCCWAFSAVAAMEG  159



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            FADLT+EEFK+SR GYK    +      PF YE+VT +P ++DW +KGAVTP+K+Q +CG
Sbjct  109  FADLTSEEFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCG  168

Query  176  CCWAFAAVAAIEG  214
            C WAF+AVAA+EG
Sbjct  169  CRWAFSAVAAMEG  181



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              ADLT EEFK+SR G+K P    TT F YENVT +P  +DW  KGAVTP+K+Q +CG C
Sbjct  86   HLADLTVEEFKASRNGFKRPHEFSTTTFKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  182  WAFAAVAAIEG  214
            WAF+ +AA EG
Sbjct  146  WAFSTIAATEG  156



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTNEEF+    GYK   P  M +    T F Y NVTD+P T+DW +KGAVTP+K+Q
Sbjct  90   KFSDLTNEEFRVLHTGYKRSHPKVMTSSKGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAF+AVAA+EG
Sbjct  150  KECGCCWAFSAVAAMEG  166



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET---TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFAD TN+EFK+ R GY+ P  + +   T F YENV DVP T+DW + GAVTP+KNQ  C
Sbjct  87   EFADQTNQEFKAFRNGYRRPNGLASRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPC  146

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA EG
Sbjct  147  GSCWAFSAVAATEG  160



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFAD TNEEF++SR GYK   S    +TT F YENVT VP ++DW +KGAVTPVK+Q +C
Sbjct  105  EFADQTNEEFQASRNGYKMAVSSRPSQTTLFRYENVTAVPSSMDWRKKGAVTPVKDQGQC  164

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+ +AA EG
Sbjct  165  GSCWAFSTIAATEG  178



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FAD+TN EFK+S +G+K  P+  +T  F Y N+TD P ++DW  +GAVT VKNQ+ CGC
Sbjct  72   QFADMTNGEFKASHLGFKPMPMESKTGSFQYANLTDAPHSMDWRTRGAVTAVKNQRSCGC  131

Query  179  CWAFAAVAAIE  211
            CWAF++VAAIE
Sbjct  132  CWAFSSVAAIE  142



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +F DLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  78   QFXDLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +F DLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  78   QFXDLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY---METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF++SR GYK   Y    + + F Y NVT VP ++DW +KGAVT VK+Q +C
Sbjct  86   KFADLTNEEFQASRNGYKMGSYGKASKVSSFRYANVTAVPTSMDWRQKGAVTGVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTNEEF+    GYK   P  M +    T F Y NVTD+P T+DW +KGAVTP+K+Q
Sbjct  90   KFSDLTNEEFRVLHTGYKRSHPKVMTSSKGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAF+AVAA+EG
Sbjct  150  KECGCCWAFSAVAAMEG  166



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET---TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFAD TN+EFK+ R GY+ P  + +   T F YENV DVP T+DW + GAVTP+KNQ  C
Sbjct  68   EFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPC  127

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA EG
Sbjct  128  GSCWAFSAVAATEG  141



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGY-KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFLGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>gb|EMT09279.1| Thiol protease SEN102 [Aegilops tauschii]
Length=299

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRM--GYKSPLYMETTPFMYENVT--DVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTNEEFK+++   GYKS L    T F YENV+   +P TVDW  KGAVTP+K+Q +
Sbjct  44   QFADLTNEEFKTTKANKGYKSSLERAPTGFRYENVSLDALPATVDWRTKGAVTPIKDQGQ  103

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA EG
Sbjct  104  CGCCWAFSAVAATEG  118



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YEN+   VP T+DW +KGAVTP+K+Q +CG
Sbjct  71   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENIKAPVPATMDWRKKGAVTPIKDQGQCG  130

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  131  CCWAFSAVAATEG  143



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENV   VP T+DW +KGAVTP+K+Q +CG
Sbjct  84   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPATMDWRKKGAVTPIKDQGQCG  143

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  144  CCWAFSAVAATEG  156



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGY-KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFLGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>ref|XP_006490014.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495221.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=344

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+AVAA+EG
Sbjct  147  GQCGDCWAFSAVAAVEG  163



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGY-KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFLGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>gb|AGT97048.1| senescence-specific cysteine protease [Capsicum annuum]
Length=347

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 7/77 (9%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK---SPLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKN  160
            +FADLTNEEF+   +GYK    P  M +    T F Y NVTD+P T+DW +KGAVTP+K+
Sbjct  87   KFADLTNEEFRVLHLGYKWSSHPKVMSSSKPNTHFRYANVTDIPPTMDWRKKGAVTPIKD  146

Query  161  QQKCGCCWAFAAVAAIE  211
            Q+ CGCCWAF+AVAA+E
Sbjct  147  QKDCGCCWAFSAVAAME  163



>ref|XP_006421532.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
 gb|ESR34772.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
Length=343

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+AVAA+EG
Sbjct  147  GQCGDCWAFSAVAAVEG  163



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK---SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEFK+SR G+K   S   +    F YENVT VP T+DW +KGAV P+K+Q +C
Sbjct  81   QFADLTNEEFKASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQC  140

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+A+AA EG
Sbjct  141  GSCWAFSAIAATEG  154



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 6/74 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSR---MGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEFK+SR   MG++     +TT F YENVT  P TVDW +KGAVTP+K+Q +C
Sbjct  85   QFADLTNEEFKASRNRFMGHECS--TKTTSFKYENVT-APATVDWRKKGAVTPIKDQGQC  141

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  142  GCCWAFSAVAAMEG  155



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET---TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFAD TN+EFK+ R GY+ P  + +   T F YENV DVP T+DW + GAVTP+KNQ  C
Sbjct  87   EFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPC  146

Query  173  GCCWAFAAVAAIEG  214
            G CWAF+AVAA EG
Sbjct  147  GSCWAFSAVAATEG  160



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS-----PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLTNEEF++SR G+K          E + F Y NV+ VP ++DW +KGAVTPVK+Q 
Sbjct  68   KFADLTNEEFQASRNGFKKGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQG  127

Query  167  KCGCCWAFAAVAAIEG  214
            +CGCCWAF+AVAA EG
Sbjct  128  QCGCCWAFSAVAATEG  143



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGY-KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEEFKASRNGFLGHECSTKTTTFKYENVT-APPTVDWRTKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>ref|XP_007132814.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
 gb|ESW04808.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
Length=333

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
             FADLT +EFK+SR G+K P    TTPF YENVT +P  +DW +KGAVTP+KNQ   G C
Sbjct  86   HFADLTVQEFKASRNGFKRPHEFSTTPFKYENVTAIPAAIDWRKKGAVTPIKNQ---GSC  142

Query  182  WAFAAVAAIEG  214
            WAF+ VAA EG
Sbjct  143  WAFSTVAATEG  153



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPL--YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            FAD ++EEF++SR  Y++ L      TPF YENVT +P ++DW +KGAVTP+K+Q +CGC
Sbjct  90   FADQSHEEFQASRNRYRTSLNTMSSKTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGC  149

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  150  CWAFSAVAATEG  161



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F Y+NVT  +P T+DW  KGAVTPVK+Q +CG
Sbjct  89   QFADLTNEEFKASRNGFKGHECSTKTTSFKYKNVTAALPATMDWRTKGAVTPVKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>ref|XP_008244477.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=340

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY-METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FAD TNEE K+SR G+K   Y  + T F YENVT VP T+DW  KGAVTP+K+Q +CG 
Sbjct  88   QFADQTNEEVKASRNGFKGREYSTKNTSFKYENVTVVPSTMDWRGKGAVTPMKDQGQCGS  147

Query  179  CWAFAAVAAIEG  214
            CWAFAAVAA+EG
Sbjct  148  CWAFAAVAAVEG  159



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF++SR GYK   Y +++    F Y NVT VP ++DW +KGAVT VK+Q +C
Sbjct  86   KFADLTNEEFQASRNGYKMGSYGKSSKVSSFRYANVTAVPASMDWRKKGAVTGVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTN+EFK+SR  +K      +TT F YENVT  VP T+DW +KGAVTP+K+Q +CG
Sbjct  90   QFADLTNDEFKASRNRFKGHECSTKTTSFKYENVTASVPTTMDWRKKGAVTPIKDQGQCG  149

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  150  CCWAFSAVAATEG  162



>ref|XP_008225269.1| PREDICTED: uncharacterized protein LOC103324934 [Prunus mume]
Length=768

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPL--YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            FAD ++EEF++SR  Y++ L      TPF YENVT +P ++DW +KGAVTP+K+Q +CGC
Sbjct  515  FADQSHEEFQASRNRYRTSLNPMSSKTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGC  574

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  575  CWAFSAVAATEG  586



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK++R G+K      +T+ F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  78   QFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVT-DVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK++R G+K      +T+ F YENVT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  78   QFADLTNEEFKATRNGFKGHECSTKTSSFKYENVTVPLPATMDWRKKGAVTPVKDQGQCG  137

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  138  CCWAFSAVAATEG  150



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 6/74 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSR---MGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEFK+SR   MG++     +TT F YENVT  P T+DW +KGAVTPVK+Q +C
Sbjct  89   QFADLTNEEFKASRNRFMGHECS--AKTTSFKYENVT-APPTLDWRKKGAVTPVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  146  GCCWAFSAVAAMEG  159



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF   R  +   +   ++ TT F YENVT +P TVDW +KGAVTP+K+Q +C
Sbjct  53   QFADLTNEEFIVPRNRFNGHMRFSFITTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLT EEF++S  G+K  P+      F Y NVTDVP +VDW  KGAVTP+K+Q +CGC
Sbjct  86   QFADLTTEEFRASYTGFKPKPMRATGQNFRYANVTDVPPSVDWRSKGAVTPIKDQGQCGC  145

Query  179  CWAFAAVAAIEG  214
            CWAF+AV A EG
Sbjct  146  CWAFSAVVATEG  157



>ref|XP_004505458.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cicer 
arietinum]
Length=341

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME--TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
              ADLT EEFK+SR GYK   + E   T F YENVT VPD VDW  KGAVTP+K+Q +CG
Sbjct  88   HLADLTIEEFKASRNGYKKRSHDELTITSFKYENVTGVPDDVDWRTKGAVTPIKDQGQCG  147

Query  176  CCWAFAAVAAIEG  214
             CWAF+ VAA EG
Sbjct  148  SCWAFSTVAATEG  160



>ref|XP_007214465.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
 gb|EMJ15664.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
Length=340

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY-METTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FAD TNEE K+SR G+K   Y  +TT F YENVT VP  +DW  KGAVTP+K+Q +CG 
Sbjct  88   QFADQTNEEVKASRNGFKRREYSTKTTSFKYENVTVVPAAMDWRSKGAVTPMKDQGQCGS  147

Query  179  CWAFAAVAAIEG  214
            CWAFAAVAA+EG
Sbjct  148  CWAFAAVAAVEG  159



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEF+++  GYK   +    ETT F YENVT  P ++DW +KGAVT VK+Q +C
Sbjct  86   EFADLTNEEFRATHNGYKMRSHQKSSETTSFKYENVT-APTSIDWRKKGAVTGVKDQGQC  144

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  145  GCCWAFSAVAATEG  158



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            F DLTN+EF++SR GYK   Y     T  F YENVT +P ++DW  KG VTP+K+Q +CG
Sbjct  71   FTDLTNKEFRASRNGYKRSSYSSSSGTNSFKYENVTTIPSSLDWRSKGVVTPIKDQGQCG  130

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  131  CCWAFSAVAAMEG  143



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR G+       +TT F YENVT  P TVDW  KGAVTP+K+Q +CGC
Sbjct  231  QFADLTNEEFKASRNGFMGHECSTKTTAFKYENVT-APPTVDWRNKGAVTPIKDQGQCGC  289

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  290  CWAFSAVAAMEG  301



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   ++T F Y NV+ VP  +DW  KGAVTPVK+Q +CGC
Sbjct  86   QFADLTNEEFKASRNRFKGHICSTKSTSFKYGNVSAVPSAMDWRMKGAVTPVKDQGQCGC  145

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA EG
Sbjct  146  CWAFSAVAATEG  157



>ref|XP_006446541.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
 gb|ESR59781.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
Length=346

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL------YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY  P+          + F Y+NVTDVP ++DW +KGAVT +KNQ
Sbjct  90   EFSDLTNEEFRASYTGYNRPVPSLSRQSSRPSTFKYQNVTDVPTSIDWRKKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GNCGSCWAFSAVAAVEG  166



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENV   VP  +DW +KGAVTP+K+Q +CG
Sbjct  71   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTPIKDQGQCG  130

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  131  CCWAFSAVAATEG  143



>ref|XP_003607548.1| Cysteine protease [Medicago truncatula]
 ref|XP_003637653.1| Cysteine protease [Medicago truncatula]
 gb|AES89745.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +     +T+ F YEN + VP TVDW +KGAVTPVKNQ +C
Sbjct  90   QFADLTNEEFIASRNKFKGHMCSSITKTSTFKYENAS-VPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EF+DLTNEEF+++  GY+ P    Y E T F YENVT  P T+DW  KGAVT +KNQ +C
Sbjct  86   EFSDLTNEEFRATHNGYRMPSQKKYPEITSFKYENVT-APATMDWRLKGAVTGIKNQGQC  144

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  145  GCCWAFSAVAATEG  158



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS-PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTN EFK+SR+ +K  P    T  F Y N+TDVP+++DW  +GAVTPVKNQ  CGC
Sbjct  108  QFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSMDWRTRGAVTPVKNQGSCGC  167

Query  179  CWAFAAVAAIE  211
             WAF++VAAIE
Sbjct  168  FWAFSSVAAIE  178



>ref|XP_003607571.1| Cysteine proteinase EP-B [Medicago truncatula]
 gb|AAQ63885.1| putative cysteine proteinase [Medicago truncatula]
 gb|AES89768.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF +SR  +K  +     +T+ F YEN + VP TVDW +KGAVTPVKNQ +C
Sbjct  90   QFADLTNEEFIASRNKFKGHMCSSITKTSTFKYENAS-VPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>ref|XP_010279091.1| PREDICTED: ervatamin-B [Nelumbo nucifera]
Length=345

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 7/76 (9%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-----SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLTNEEF S+  GYK      PL   +  F +EN+TD+P +VDW E GAVTPVK+QQ
Sbjct  86   KFADLTNEEFTSTSKGYKPSSKSRPLAARS--FTHENLTDLPSSVDWREMGAVTPVKDQQ  143

Query  167  KCGCCWAFAAVAAIEG  214
             CG CWAF+AVAA+EG
Sbjct  144  NCGSCWAFSAVAAVEG  159



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
             FADLTNEEF +SR  +K      ETT + YENVT VP T+DW +KGAVTP+K+Q +CGC
Sbjct  87   RFADLTNEEFTASRNRFKGHECSTETTSYKYENVT-VPATMDWRQKGAVTPIKDQGQCGC  145

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  146  CWAFSAVAAMEG  157



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTN+EF+ +R GY+ P +    E T F YENVT  P T+DW +KGAVT +K+Q +C
Sbjct  68   EFADLTNDEFRVTRNGYRMPSHKKSPEITSFKYENVT-APATMDWRKKGAVTGIKDQGQC  126

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  127  GCCWAFSAVAATEG  140



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS-PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTN EFK+SR+ +K  P    T  F Y N+TDVP+++DW  +GAVTPVKNQ  CGC
Sbjct  82   QFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSMDWRTRGAVTPVKNQGSCGC  141

Query  179  CWAFAAVAAIE  211
             WAF++VAAIE
Sbjct  142  FWAFSSVAAIE  152



>ref|XP_007132896.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
 gb|ESW04890.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
Length=308

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF + R  +K  +      TT F YENV+ VP TVDW  KGAVTPVK+Q +C
Sbjct  53   QFADLTNEEFIAPRNRFKGHVCSSITRTTTFKYENVSAVPSTVDWRLKGAVTPVKDQGQC  112

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  113  GCCWAFSAVAATEG  126



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENV   VP  +DW +KGAVTP+K+Q +CG
Sbjct  71   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTPIKDQGQCG  130

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  131  CCWAFSAVAATEG  143



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF ++R  +K  +   +  PF Y+NVT VP T+DW +KGAVTP+K+Q +CG 
Sbjct  87   QFADLTNEEFNTARNRFKGHMCSAQAGPFRYQNVTAVPATMDWRKKGAVTPIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK----SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTNEEF++SR GYK    S    + + +MY NV+ VP ++DW +KGAVTPVK+Q +
Sbjct  91   KFADLTNEEFQASRNGYKMRSQSKSSSKVSSYMYANVSAVPPSMDWTKKGAVTPVKDQGQ  150

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA EG
Sbjct  151  CGCCWAFSAVAATEG  165



>ref|XP_006470293.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470295.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL------YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++   GY  P+          + F Y+NVTDVP ++DW EKGAVT +KNQ
Sbjct  90   EFSDLTNEEFRALYTGYNRPVPSVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GHCGSCWAFSAVAAVEG  166



>ref|XP_006432594.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
 gb|ESR45834.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
Length=344

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+ VAA+EG
Sbjct  147  GQCGDCWAFSTVAAVEG  163



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTN+EF+++  GYK P      E T F YENVT  P T+DW  KGAVT +KNQ +C
Sbjct  87   EFADLTNDEFRATHNGYKMPFQKKSPEITSFKYENVT-APATMDWRLKGAVTGIKNQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK----SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTNEEF++SR GYK    S    + + F Y NV+ VP ++DW +KGAVTPVK+Q +
Sbjct  87   KFADLTNEEFQASRNGYKMRSLSKSSSKVSSFRYANVSAVPPSIDWTKKGAVTPVKDQGQ  146

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA EG
Sbjct  147  CGCCWAFSAVAATEG  161



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF++SR GYK   Y +++    F Y NVT VP ++DW +KGAVT VK+Q +C
Sbjct  86   KFADLTNEEFQASRNGYKMGSYPKSSMFSSFRYANVTAVPASMDWRKKGAVTGVKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTNE+F+    GYK   P  M +    T F Y NVTD+P T+DW +KGAVTP+K+Q
Sbjct  90   KFSDLTNEKFRVLHTGYKRSHPKVMSSSKPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAF+AVAA EG
Sbjct  150  KECGCCWAFSAVAATEG  166



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 5/75 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP----FMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTNEEFK+   G+K P  ++T      F YENVT VP ++DW  KGAVTP+K+Q +
Sbjct  86   QFADLTNEEFKAMMNGFK-PSTLKTLKATNVFSYENVTAVPSSMDWRAKGAVTPIKDQGQ  144

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA+EG
Sbjct  145  CGCCWAFSAVAAMEG  159



>ref|XP_006432617.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
 ref|XP_006494213.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495364.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR45857.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
Length=344

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+ VAA+EG
Sbjct  147  GQCGDCWAFSTVAAVEG  163



>ref|XP_006432601.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
 gb|ESR45841.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
Length=344

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  87   EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  146

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+ VAA+EG
Sbjct  147  GQCGDCWAFSTVAAVEG  163



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMET----TPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            +F+DLTNE+F+    GYK   P  M +    T F Y NVTD+P T+DW +KGAVTP+K+Q
Sbjct  90   KFSDLTNEKFRVLHTGYKRSHPKVMSSSKPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
            ++CGCCWAF+AVAA EG
Sbjct  150  KECGCCWAFSAVAATEG  166



>ref|XP_006493641.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=359

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP------FMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++S  GY+ P    ++       F Y+N+TDVP ++DW EKGAVTP+KNQ
Sbjct  102  EFSDLTNEEFRASYTGYRVPSQSSSSRQSTTASFKYQNLTDVPTSMDWREKGAVTPIKNQ  161

Query  164  QKCGCCWAFAAVAAIEG  214
             +CG CWAF+ VAA+EG
Sbjct  162  GQCGDCWAFSTVAAVEG  178



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENV-TDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K      +TT F YENV   VP  +DW +KGAVTP+K+Q +CG
Sbjct  84   QFADLTNEEFKASRNGFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTPIKDQGQCG  143

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  144  CCWAFSAVAATEG  156



>ref|XP_006470291.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
Length=346

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL------YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++   GY  P+          + F Y+NVTDVP ++DW EKGAVT +KNQ
Sbjct  90   EFSDLTNEEFRALYTGYNRPVPSVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GHCGSCWAFSAVAAVEG  166



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSR---MGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTNEEF ++R    G+ S     TT F YENVT  P TVDW ++GAVTPVKNQ  C
Sbjct  87   QFADLTNEEFIATRNKFKGHMSSSITRTTTFKYENVT-APSTVDWRQEGAVTPVKNQGTC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>ref|XP_006470292.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=346

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL------YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQ  163
            EF+DLTNEEF++   GY  P+          + F Y+NVTDVP ++DW EKGAVT +KNQ
Sbjct  90   EFSDLTNEEFRALYTGYNRPVPSVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQ  149

Query  164  QKCGCCWAFAAVAAIEG  214
              CG CWAF+AVAA+EG
Sbjct  150  GHCGSCWAFSAVAAVEG  166



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP-LYMETTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +F DLTNEEFK+SR G+K      +TT F YENVT  +P T+DW +KGAVTP K+Q +CG
Sbjct  89   QFXDLTNEEFKASRNGFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPXKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  149  CCWAFSAVAATEG  161



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSP--LYMETT---PFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLT+EEF++  +GYKSP    M T+    F Y NVT VP T+DW + GAVTPVK+Q 
Sbjct  53   KFADLTDEEFQAMHLGYKSPPSKLMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQG  112

Query  167  KCGCCWAFAAVAAIEG  214
             CG CWAF+AVAA+EG
Sbjct  113  SCGSCWAFSAVAAMEG  128



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME---TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADL+NEEFK+SR GYK   + +   +T F YENVT  P T+DW  KGAVT +K+Q +C
Sbjct  87   EFADLSNEEFKASRNGYKMYSHQQLSKSTSFKYENVT-APATMDWRTKGAVTGIKDQGQC  145

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  146  GCCWAFSAVAATEG  159



>ref|XP_003607574.1| Cysteine protease [Medicago truncatula]
 gb|AES89771.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL---YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FAD+TNEEF +SR  +K  +     +T+ F YEN + VP TVDW +KGAVTPVKNQ +C
Sbjct  90   QFADITNEEFIASRNKFKGHMCSSITKTSTFKYENAS-VPSTVDWRKKGAVTPVKNQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  149  GCCWAFSAVAATEG  162



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRM--GYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
             FADLTNEEFK+     G+       TT F YENVT VP ++DW +KGAVTP+K+Q +CG
Sbjct  60   HFADLTNEEFKAINRFKGHVCSKRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCG  119

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  120  CCWAFSAVAATEG  132



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRM--GYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
             FADLTNEEFK+     G+       TT F YENVT VP ++DW +KGAVTP+K+Q +CG
Sbjct  53   HFADLTNEEFKAINRFKGHVCSKRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCG  112

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  113  CCWAFSAVAATEG  125



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YEN+T VP ++DW ++GAVT +K+Q +CG 
Sbjct  87   QFADLTNEEFKTSRNRFKGHMCSSQAGPFRYENITAVPSSMDWRKEGAVTAIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 5/75 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTP----FMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            +FADLTNEEF++   G+K P  ++T      F YENVT VP ++DW  KGAVTP+K+Q +
Sbjct  86   QFADLTNEEFRAMMNGFK-PSTLKTLKATNVFRYENVTAVPTSMDWRAKGAVTPIKDQGQ  144

Query  170  CGCCWAFAAVAAIEG  214
            CGCCWAF+AVAA+EG
Sbjct  145  CGCCWAFSAVAAMEG  159



>ref|XP_009407029.1| PREDICTED: ervatamin-B-like [Musa acuminata subsp. malaccensis]
Length=339

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
             +ADLTN+EFK+S  G++         F YEN T VP TVDW  +GAVTPVKNQ +CGCC
Sbjct  85   RYADLTNDEFKASHGGFRPTPTKAAPTFRYENETIVPPTVDWRSRGAVTPVKNQGECGCC  144

Query  182  WAFAAVAAIEG  214
            WAF+AVAA EG
Sbjct  145  WAFSAVAAAEG  155



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              AD TNEEF +S  GYK       TPF YENVT VP+ VDW E GAVT VK+Q +CG C
Sbjct  62   HLADQTNEEFVASHNGYKHKASHSQTPFKYENVTGVPNAVDWRENGAVTAVKDQGQCGSC  121

Query  182  WAFAAVAAIEG  214
            WAF+ VAA EG
Sbjct  122  WAFSTVAATEG  132



>ref|XP_004513101.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=353

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
             FADLTNEEFKS+ +GY   L +ET  FMY    D+P  +DW +KGAVT VK+Q +CG C
Sbjct  101  RFADLTNEEFKSTYLGYLPRLRVET-EFMYHQHGDLPKNIDWRKKGAVTHVKDQGRCGSC  159

Query  182  WAFAAVAAIEG  214
            WAF+AVAA+EG
Sbjct  160  WAFSAVAAVEG  170



>ref|XP_008342800.1| PREDICTED: thiol protease SEN102-like [Malus domestica]
Length=243

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY-METTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEE KS+R  +K   Y   T+ F YENVT  VP ++DW +KGAVTP K+Q +CG
Sbjct  53   QFADLTNEELKSARNRFKGHEYSTRTSSFKYENVTTAVPASMDWRKKGAVTPNKDQGRCG  112

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  113  CCWAFSAVAATEG  125



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    FADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            FADLTNEEF+++R G K P    + T F YENVT +P T+DW  KGAVTP+K+Q +CG C
Sbjct  81   FADLTNEEFRAARNGLKIPFCEPKITSFRYENVTAIPTTMDWRIKGAVTPIKDQGQCGSC  140

Query  182  WAFAAVAAIEG  214
            WAF+A+AA EG
Sbjct  141  WAFSAIAATEG  151



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF++   GYK     + ++ F YEN++D+P ++DW   GAVTPVK+Q  CGC
Sbjct  88   KFADLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSDIPTSMDWRNDGAVTPVKDQGTCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+ VAAIEG
Sbjct  148  CWAFSTVAAIEG  159



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            EF DLTNEEFK+ R GYK       + + F YENV  VP ++DW +KGAVT +K+Q +CG
Sbjct  83   EFTDLTNEEFKAMRNGYKLRPSTSSKKSSFRYENVAAVPSSMDWRKKGAVTNIKDQGQCG  142

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  143  CCWAFSAVAAMEG  155



>ref|XP_003526229.1| PREDICTED: vignain-like [Glycine max]
Length=284

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLT+EEF   R  +   +      TT F YENVT +PD++DW +KGAVTP+KNQ  C
Sbjct  28   QFADLTSEEFIVPRNRFNGHMRFSNTRTTTFKYENVTVLPDSIDWRQKGAVTPIKNQGSC  87

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+A+AA EG
Sbjct  88   GCCWAFSAIAATEG  101



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK-SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEF++   GYK     + ++ F YEN++D+P ++DW   GAVTPVK+Q  CGC
Sbjct  88   KFADLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSDIPTSMDWRNDGAVTPVKDQGTCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+ VAAIEG
Sbjct  148  CWAFSTVAAIEG  159



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
            +FADLTN EF+++R GYK P   + T F YENV+ VP  +DW +KGAVT +K+Q +CGCC
Sbjct  86   QFADLTNVEFRAARNGYK-PKECKGTLFRYENVSAVPAAMDWRKKGAVTGIKDQGQCGCC  144

Query  182  WAFAAVAAIEG  214
            WAF+AVAA EG
Sbjct  145  WAFSAVAATEG  155



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGY-KSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNE+FK+SR G+         T F YENVT  P TVDW +KGAVTP+K+Q +CGC
Sbjct  89   QFADLTNEQFKASRNGFMGHECSAAKTSFKYENVT-APPTVDWRKKGAVTPIKDQGQCGC  147

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  148  CWAFSAVAAMEG  159



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPL-YMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGC  178
            +FADLTNEEFK+SR  +K  +   +  PF YEN+T  P ++DW +KGAVT +K+Q +CG 
Sbjct  87   QFADLTNEEFKTSRNRFKGHMCSSQAGPFRYENLTAAPSSMDWRKKGAVTAIKDQGQCGS  146

Query  179  CWAFAAVAAIEG  214
            CWAF+AVAA+EG
Sbjct  147  CWAFSAVAAVEG  158



>ref|XP_006857796.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
 gb|ERN19263.1| hypothetical protein AMTR_s00061p00215230 [Amborella trichopoda]
Length=344

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS---PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTN+EF+ +RMG+K           PFMY NV+  P ++DW +KGAVTPVK+Q +C
Sbjct  92   KFADLTNDEFRVTRMGFKGHECAARASDAPFMYANVS-APTSMDWRKKGAVTPVKDQGQC  150

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  151  GCCWAFSAVAAMEG  164



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FAD+TNEEFK+SR GY+  S   ++TT F YENVT V  ++DW +KGAVT +K+Q +CG
Sbjct  86   QFADMTNEEFKASRNGYRISSQQKIKTTFFQYENVT-VAYSMDWRKKGAVTKIKDQGQCG  144

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  145  CCWAFSAVAATEG  157



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 5/76 (7%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS-----PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQ  166
            +FADLT++EFK+SR G+K          E + F Y NV+ VP ++DW +KGAVTPVK+Q 
Sbjct  68   KFADLTSDEFKASRNGFKMGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQG  127

Query  167  KCGCCWAFAAVAAIEG  214
            +CGCCWAF+AVAA EG
Sbjct  128  QCGCCWAFSAVAATEG  143



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCGCC  181
              AD TNEEF +S  GYK       TPF YENVT VP+ VDW E GAVT VK+Q +CG C
Sbjct  86   HLADQTNEEFVASHNGYKHKGSHSQTPFKYENVTGVPNAVDWRENGAVTAVKDQGQCGSC  145

Query  182  WAFAAVAAIEG  214
            WAF+ VAA EG
Sbjct  146  WAFSTVAATEG  156



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYK--SPLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
            +FAD+TNEEFK+ R GY+  S   ++ T F YENVT VP ++DW +KGAVT +K+Q +CG
Sbjct  86   QFADMTNEEFKAIRNGYRISSQQKIKNTSFQYENVT-VPYSMDWRKKGAVTKIKDQGQCG  144

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA EG
Sbjct  145  CCWAFSAVAATEG  157



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYMET--TPFMYENVTDVPDTVDWVEKGAVTPVKNQQKCG  175
             FAD TNEEFK+SR GYK      +  T F YEN+T V  ++DW  KGAVTP+K+Q  CG
Sbjct  90   RFADQTNEEFKASRNGYKRSTQPSSSKTSFRYENMTSVLPSMDWRSKGAVTPIKDQGDCG  149

Query  176  CCWAFAAVAAIEG  214
            CCWAF+AVAA+EG
Sbjct  150  CCWAFSAVAAMEG  162



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYM---ETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            EFADLTNEEF+++  GY+ P      E T F YENVT  P T+DW +KGAVT +K+Q +C
Sbjct  86   EFADLTNEEFRATHNGYRMPSQKKSPEITSFKYENVT-APATMDWRKKGAVTGIKDQGQC  144

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA EG
Sbjct  145  GCCWAFSAVAATEG  158



>ref|XP_006857795.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
 gb|ERN19262.1| hypothetical protein AMTR_s00061p00215070 [Amborella trichopoda]
Length=342

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKS---PLYMETTPFMYENVTDVPDTVDWVEKGAVTPVKNQQKC  172
            +FADLTN+EF+ +RMG+K           PFMY NV+  P ++DW +KGAVTPVK+Q +C
Sbjct  90   KFADLTNDEFRVTRMGFKGHECAARASDAPFMYANVS-APTSMDWRKKGAVTPVKDQGQC  148

Query  173  GCCWAFAAVAAIEG  214
            GCCWAF+AVAA+EG
Sbjct  149  GCCWAFSAVAAMEG  162



>gb|KFK30176.1| hypothetical protein AALP_AA7G227600 [Arabis alpina]
Length=356

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLYME----TTPFMYENVTDVPDTVDWVEKGAVTPVKNQQK  169
            EF DLT+EEFK+  +G   P +      +T F Y ++TD+P++VDW +KGAVTPVKNQ  
Sbjct  98   EFMDLTHEEFKARYLGLAKPEFSRKRQPSTNFRYRDITDLPNSVDWRKKGAVTPVKNQGS  157

Query  170  CGCCWAFAAVAAIEG  214
            CG CWAF+ VAA+EG
Sbjct  158  CGSCWAFSTVAAVEG  172



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    EFADLTNEEFKSSRMGYKSPLY-METTPFMYENVTD-VPDTVDWVEKGAVTPVKNQQKCG  175
            +FADLTNEEFK+SR G+K   Y  +T  F YE VT  +P T+DW +KGAVTPVK+Q +CG
Sbjct  89   QFADLTNEEFKASRNGFKGQEYSTKTNSFKYEKVTAALPATMDWRKKGAVTPVKDQGQCG  148

Query  176  CCWAFAAVAAIEG  214
             CWAF+AVAA EG
Sbjct  149  SCWAFSAVAATEG  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511067545352