BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21311_g3_i3 len=576 path=[297:0-87 5210:88-162 489:163-204
5308:205-268 2642:269-303 5464:304-319 1294:320-396 735:397-433
1789:434-440 1796:441-446 5519:447-467 5540:468-478 1545:479-575]

Length=576
                                                                      Score     E

ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...    104   2e-24   
emb|CDP15101.1|  unnamed protein product                                102   4e-24   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...    101   1e-23   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...    100   2e-23   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...  99.8    5e-23   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  98.6    1e-22   
ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...  97.8    2e-22   
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    5e-22   
ref|NP_001055844.2|  Os05g0477900                                     96.7    9e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAT01364.1|  unknown protein                                       96.7    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  95.9    1e-21   
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           95.5    2e-21   
gb|ABY21307.1|  pollen allergen Pla o 3                               95.1    3e-21   Platanus orientalis
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    5e-21   
gb|ACP43542.1|  lipid transfer protein                                94.4    5e-21   Chimonanthus praecox [wintersweet]
gb|AAT68262.1|  lipid transfer protein                                94.0    6e-21   Nicotiana glauca [glaucous tobacco]
gb|AAS13435.1|  lipid-transfer protein                                94.0    6e-21   Nicotiana attenuata
gb|AAT68263.1|  lipid transfer protein                                94.0    6e-21   Nicotiana glauca [glaucous tobacco]
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    7e-21   
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    7e-21   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    94.0    7e-21   Nicotiana tabacum [American tobacco]
gb|AAY84146.1|  lipid transfer protein                                94.0    8e-21   Catharanthus roseus [chatas]
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    8e-21   
emb|CAL07989.1|  lipid transfer protein                               93.6    9e-21   Platanus x hispanica [London plane tree]
ref|XP_009594799.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    1e-20   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      93.2    1e-20   Nicotiana glauca [glaucous tobacco]
gb|ACQ42221.1|  lipid transfer protein                                93.2    1e-20   Chimonanthus praecox [wintersweet]
emb|CDP12680.1|  unnamed protein product                              93.2    2e-20   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    3e-20   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    3e-20   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    4e-20   
ref|XP_003566138.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    5e-20   
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    6e-20   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    6e-20   
dbj|BAP11221.1|  hypothetical protein                                 90.9    8e-20   
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    8e-20   
dbj|BAP11218.1|  hypothetical protein                                 90.9    9e-20   
dbj|BAP11219.1|  hypothetical protein                                 90.5    9e-20   
dbj|BAP11220.1|  hypothetical protein                                 90.5    1e-19   
dbj|BAP11226.1|  hypothetical protein                                 90.5    1e-19   
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    1e-19   
ref|XP_009778826.1|  PREDICTED: uncharacterized protein LOC104228120  93.2    1e-19   
ref|XP_009631015.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    3e-19   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    3e-19   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    3e-19   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           89.7    3e-19   
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    3e-19   
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    4e-19   
gb|AAY43800.1|  FSLTP2                                                89.4    4e-19   Gossypium hirsutum [American cotton]
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       89.4    4e-19   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    89.4    4e-19   Gossypium hirsutum [American cotton]
gb|AAY83345.1|  non-specific lipid transfer protein precursor         89.0    5e-19   Fragaria x ananassa
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    6e-19   
gb|AAT68264.1|  lipid transfer protein                                89.0    6e-19   Nicotiana glauca [glaucous tobacco]
gb|KHG30577.1|  Non-specific lipid-transfer                           88.6    6e-19   
emb|CAC86258.1|  lipid transfer protein                               88.6    7e-19   Fragaria x ananassa
ref|XP_002305878.2|  lipid transfer family protein                    88.6    7e-19   Populus trichocarpa [western balsam poplar]
gb|ABK96515.1|  unknown                                               88.6    7e-19   Populus trichocarpa x Populus deltoides
gb|AAL27855.1|  lipid transfer protein precursor                      88.6    8e-19   Davidia involucrata
gb|ABK94706.1|  unknown                                               88.2    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            88.2    1e-18   
gb|AEI70829.1|  non-specific lipid-transfer protein                   87.8    1e-18   
gb|ADY68820.1|  lipid transfer protein 3                              87.8    2e-18   
gb|AAY43801.1|  FSLTP3                                                87.4    2e-18   Gossypium hirsutum [American cotton]
gb|AAY83343.1|  non-specific lipid transfer protein precursor         87.4    2e-18   Fragaria x ananassa
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    2e-18   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    2e-18   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  87.4    2e-18   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    2e-18   Vitis vinifera
ref|XP_009618455.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    3e-18   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    3e-18   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   
gb|KFK24679.1|  hypothetical protein AALP_AA8G011100                  86.3    5e-18   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              86.3    5e-18   
emb|CBW38497.1|  lipid transfer protein                               85.9    5e-18   
gb|AEI70827.1|  non-specific lipid-transfer protein                   86.3    6e-18   
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   Vitis vinifera
emb|CBI18043.3|  unnamed protein product                              86.7    6e-18   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   
gb|ADV02773.1|  lipid transfer protein 1b                             85.1    7e-18   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    7e-18   
gb|AAT68265.1|  lipid transfer protein precursor                      85.5    7e-18   Nicotiana glauca [glaucous tobacco]
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    8e-18   
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    8e-18   
gb|AAQ96338.1|  lipid transfer protein                                85.9    9e-18   Vitis aestivalis
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    9e-18   
gb|KHG10481.1|  Non-specific lipid-transfer 3                         86.3    9e-18   
gb|AEI70828.1|  non-specific lipid-transfer protein                   85.5    9e-18   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          85.5    9e-18   Lactuca sativa [cultivated lettuce]
gb|KHG09865.1|  Non-specific lipid-transfer P3                        85.5    9e-18   
ref|XP_006438990.1|  hypothetical protein CICLE_v10033098mg           85.5    9e-18   
gb|AEC04836.1|  lipid transfer protein                                85.5    1e-17   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    1e-17   
dbj|BAO51648.1|  lipid transfer protein                               85.1    1e-17   
emb|CAN70512.1|  hypothetical protein VITISV_005630                   85.1    1e-17   Vitis vinifera
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            85.1    1e-17   Gossypium hirsutum [American cotton]
gb|AFM35695.1|  nonspecific lipid transfer protein                    85.1    1e-17   
gb|AFR43276.1|  lipid transfer protein precursor                      85.1    2e-17   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         84.7    2e-17   Fragaria x ananassa
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  84.7    2e-17   Ricinus communis
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            84.7    2e-17   Corylus avellana [European hazelnut]
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    2e-17   
gb|AGC08425.1|  lipid transfer protein                                84.7    2e-17   
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    3e-17   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            84.3    3e-17   Gossypium hirsutum [American cotton]
emb|CDP14198.1|  unnamed protein product                              84.3    3e-17   
emb|CBW38499.1|  lipid transfer protein                               83.6    3e-17   
gb|AEN70935.1|  lipid transfer protein                                84.3    3e-17   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           84.0    3e-17   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           84.0    3e-17   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  83.2    4e-17   Morus nigra
gb|AEI70830.1|  non-specific lipid-transfer protein                   84.0    4e-17   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            83.6    5e-17   Gossypium hirsutum [American cotton]
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    5e-17   
gb|AGC08428.1|  lipid transfer protein                                84.0    5e-17   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           84.0    5e-17   
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    5e-17   
gb|AEN70918.1|  lipid transfer protein                                83.6    5e-17   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    5e-17   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         83.2    6e-17   Retama raetam [retem]
gb|ABG54494.1|  putative allergen Rub i 3                             83.2    6e-17   Rubus idaeus [European raspberry]
gb|AFR43288.1|  lipid transfer protein precursor                      83.2    7e-17   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   83.6    7e-17   
gb|ADR66942.1|  non-specific lipid transfer protein                   83.2    7e-17   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    83.2    7e-17   Prunus dulcis [sweet almond]
gb|KHN40623.1|  Non-specific lipid-transfer protein                   83.2    7e-17   
ref|NP_001236518.1|  uncharacterized protein LOC100306032 precursor   83.2    7e-17   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  83.2    7e-17   Prunus avium [gean]
gb|ADR66943.1|  non-specific lipid transfer protein                   83.2    8e-17   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         83.2    8e-17   Fragaria x ananassa
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    8e-17   
ref|NP_001275802.1|  lipid-transfer protein precursor                 82.8    9e-17   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    9e-17   
gb|AGH27864.1|  lipid transfer protein precursor                      82.8    1e-16   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
emb|CDO96795.1|  unnamed protein product                              82.8    1e-16   
gb|AGW21333.1|  lipid transfer protein                                82.4    1e-16   
gb|AGC08426.1|  lipid transfer protein                                82.4    1e-16   
emb|CCK33472.1|  lipid transfer protein precursor                     81.6    1e-16   
gb|AHG99490.1|  lipid-transfer protein                                82.4    1e-16   
gb|AFR43289.1|  lipid transfer protein precursor                      82.4    1e-16   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  82.4    1e-16   Helianthus annuus
ref|NP_001268120.1|  lipid transfer protein precursor                 82.4    2e-16   
gb|ACE07187.1|  Art v 3 allergen precursor                            82.0    2e-16   Artemisia vulgaris [common wormwood]
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  82.0    2e-16   Gossypium hirsutum [American cotton]
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    2e-16   
gb|AEN70936.1|  lipid transfer protein                                82.0    2e-16   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  82.0    2e-16   Gossypium hirsutum [American cotton]
gb|KHN29511.1|  Non-specific lipid-transfer protein                   82.0    2e-16   
ref|NP_001268074.1|  lipid transfer protein precursor                 82.0    2e-16   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    2e-16   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    2e-16   
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    81.6    2e-16   
gb|KHG21711.1|  Non-specific lipid-transfer                           81.6    2e-16   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    82.0    2e-16   Prunus persica
emb|CBW38498.1|  lipid transfer protein                               81.3    3e-16   
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           81.3    3e-16   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    3e-16   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    81.3    3e-16   
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         80.9    4e-16   Malus domestica [apple tree]
gb|AEN70916.1|  lipid transfer protein                                81.3    4e-16   
emb|CBW38504.1|  lipid transfer protein                               80.5    4e-16   
ref|XP_007033549.1|  Lipid transfer protein 3, putative               80.9    4e-16   
emb|CBW38503.1|  lipid transfer protein                               80.5    5e-16   
gb|AEN70919.1|  lipid transfer protein                                80.9    5e-16   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           80.9    5e-16   
ref|XP_010451927.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    5e-16   
gb|AFR43294.1|  lipid transfer protein precursor                      80.9    5e-16   
ref|XP_010043259.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    5e-16   
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  80.9    5e-16   Leonurus japonicus [Chinese motherwort]
gb|ABH03042.1|  non-specific lipid transfer protein                   80.9    5e-16   Solanum sogarandinum
gb|AEN70917.1|  lipid transfer protein                                80.9    5e-16   
gb|ADR66953.1|  non-specific lipid transfer protein                   80.9    6e-16   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    6e-16   
gb|ADR66950.1|  non-specific lipid transfer protein                   80.5    6e-16   
ref|XP_002872988.1|  predicted protein                                80.5    7e-16   
ref|NP_187489.1|  lipid-transfer protein 6                            80.5    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    7e-16   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 81.3    8e-16   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    80.1    8e-16   
gb|AFR43295.1|  lipid transfer protein precursor                      80.1    9e-16   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 80.1    9e-16   
gb|ACU24604.1|  unknown                                               80.5    9e-16   Glycine max [soybeans]
ref|XP_006407744.1|  hypothetical protein EUTSA_v10021759mg           80.5    9e-16   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       80.1    9e-16   Artemisia vulgaris [common wormwood]
gb|ABQ53932.1|  lipid transfer protein                                80.1    1e-15   Sesamum indicum [beniseed]
gb|AGH32497.1|  non-specific lipid transfer protein                   80.1    1e-15   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  80.1    1e-15   Prunus dulcis [sweet almond]
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
gb|ADR66945.1|  non-specific lipid transfer protein                   80.1    1e-15   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         79.7    1e-15   Fragaria x ananassa
gb|ADR66949.1|  non-specific lipid transfer protein                   79.7    1e-15   
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
gb|AFK37572.1|  unknown                                               79.7    1e-15   
ref|XP_003605293.1|  Non-specific lipid-transfer protein              79.7    1e-15   
ref|XP_010253092.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    1e-15   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       79.7    1e-15   
ref|XP_006842466.1|  hypothetical protein AMTR_s00077p00068900        79.3    1e-15   
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           79.7    1e-15   
gb|ACQ42222.1|  lipid transfer protein 1                              79.3    2e-15   Chimonanthus praecox [wintersweet]
gb|AAR22488.1|  allergen Mal d 3                                      79.3    2e-15   Malus domestica [apple tree]
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       79.3    2e-15   Artemisia vulgaris [common wormwood]
ref|NP_001189842.1|  lipid-transfer protein 6                         79.3    2e-15   
emb|CBW38501.1|  lipid transfer protein                               79.0    2e-15   
emb|CDY33268.1|  BnaA01g19350D                                        80.1    2e-15   
gb|AGH13363.1|  lipid transfer protein                                79.0    2e-15   
emb|CAB96874.1|  mal d 3                                              78.6    2e-15   Malus domestica [apple tree]
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
gb|AAT80649.1|  lipid transfer protein precursor                      79.0    2e-15   Malus domestica [apple tree]
gb|ACE07189.1|  Art v 3 allergen precursor                            79.0    2e-15   Artemisia vulgaris [common wormwood]
gb|KEH29195.1|  Lipid transfer protein                                80.5    2e-15   
ref|XP_008792224.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           79.0    2e-15   
gb|AEN70933.1|  lipid transfer protein                                79.0    2e-15   
gb|KHL91133.1|  hypothetical protein QW71_36410                       79.0    2e-15   
gb|AEI70826.1|  non-specific lipid-transfer protein                   79.0    2e-15   
ref|XP_009146980.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  79.0    2e-15   Gerbera hybrid cultivar
ref|XP_002884695.1|  hypothetical protein ARALYDRAFT_478179           79.0    2e-15   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   79.0    3e-15   
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
gb|ABA29446.1|  non-specific lipid transfer protein                   79.0    3e-15   Vitis vinifera
gb|KFK36763.1|  lipid transfer protein                                79.0    3e-15   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           78.6    3e-15   
gb|AFI61838.1|  harmalin                                              78.6    3e-15   
emb|CDY27974.1|  BnaC05g43760D                                        78.6    3e-15   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  78.6    3e-15   
gb|AGH27866.1|  lipid transfer protein precursor                      78.6    3e-15   
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  78.6    3e-15   Pyrus communis
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  78.6    3e-15   Solanum pennellii
gb|ADR66946.1|  non-specific lipid transfer protein                   78.6    3e-15   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           78.6    3e-15   
ref|XP_008388345.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
gb|AGH32496.1|  non-specific lipid transfer protein                   78.6    4e-15   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         78.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AEN70915.1|  lipid transfer protein                                78.6    4e-15   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    4e-15   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  79.0    4e-15   
ref|XP_003623615.1|  Non-specific lipid-transfer protein              78.2    4e-15   
sp|O24037.1|NLTP1_SOLPN  RecName: Full=Non-specific lipid-transfe...  78.2    4e-15   Solanum pennellii
ref|XP_008244927.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
gb|AET05731.1|  lipid transfer protein isoform b                      77.4    5e-15   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   78.2    5e-15   
gb|ADR66948.1|  non-specific lipid transfer protein                   78.2    5e-15   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  78.2    5e-15   Solanum chilense
gb|AAF14232.1|AF109195_1  lipid transfer protein                      77.8    6e-15   Hordeum vulgare [barley]
dbj|BAI94498.1|  lipid transfer protein                               77.8    7e-15   
ref|XP_010931359.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    7e-15   
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  77.0    7e-15   Vitis sp.
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           77.8    8e-15   
gb|AET05730.1|  lipid transfer protein isoform a                      77.0    8e-15   
dbj|BAJ85137.1|  predicted protein                                    78.6    8e-15   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    8e-15   
emb|CDY36007.1|  BnaA05g29430D                                        77.4    8e-15   
ref|XP_002532868.1|  Nonspecific lipid-transfer protein precursor...  77.4    9e-15   Ricinus communis
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    77.4    9e-15   
gb|AGH27863.1|  lipid transfer protein precursor                      77.4    1e-14   
gb|AGW21344.1|  lipid transfer protein                                77.4    1e-14   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   77.4    1e-14   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   77.4    1e-14   Citrus jambhiri [citronelle]
ref|XP_009609143.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    1e-14   
gb|ADR66947.1|  non-specific lipid transfer protein                   77.4    1e-14   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        77.4    1e-14   Vitis cinerea var. helleri x Vitis vinifera
ref|XP_009372012.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  77.0    1e-14   Hordeum vulgare [barley]
ref|XP_009148874.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
gb|ADK60918.1|  lipid transfer protein                                77.0    1e-14   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    77.0    1e-14   
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
gb|AGH13362.1|  lipid transfer protein                                76.3    1e-14   
ref|XP_009136622.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    1e-14   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   76.6    1e-14   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
emb|CDP14199.1|  unnamed protein product                              76.6    2e-14   
gb|KCW88359.1|  hypothetical protein EUGRSUZ_A00745                   77.8    2e-14   
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 76.6    2e-14   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
sp|P27631.1|NLTP_DAUCA  RecName: Full=Non-specific lipid-transfer...  76.6    2e-14   
gb|KDP20367.1|  hypothetical protein JCGZ_05250                       76.6    2e-14   
ref|XP_002314213.2|  hypothetical protein POPTR_0009s03020g           76.6    2e-14   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           77.4    2e-14   
gb|KHG13955.1|  Non-specific lipid-transfer 1                         76.3    2e-14   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           76.6    2e-14   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  75.9    2e-14   
gb|ABO28527.1|  lipid transfer protein                                76.3    2e-14   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 76.3    2e-14   
gb|ACL01093.1|  lipid transfer protein                                76.3    2e-14   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
gb|AHB19226.1|  non specific lipid transfer protein 1B                76.3    3e-14   
dbj|BAI94496.1|  lipid transfer protein                               76.3    3e-14   
ref|XP_002323072.2|  hypothetical protein POPTR_0016s14290g           77.0    3e-14   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               76.3    3e-14   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 80.1    3e-14   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
gb|AFR31532.1|  lipid transfer protein                                76.3    3e-14   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  75.5    3e-14   
emb|CDP07650.1|  unnamed protein product                              76.3    3e-14   
ref|WP_039311159.1|  hypothetical protein                             75.5    3e-14   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    3e-14   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               75.9    3e-14   
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    3e-14   
gb|AFR43292.1|  lipid transfer protein precursor                      75.9    3e-14   
gb|AAT80652.1|  lipid transfer protein precursor                      75.9    3e-14   
gb|AAT80650.1|  lipid transfer protein precursor                      75.9    4e-14   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    4e-14   
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           75.5    4e-14   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       75.5    4e-14   
ref|XP_006369492.1|  hypothetical protein POPTR_0001s23940g           75.5    4e-14   
emb|CBW38502.1|  lipid transfer protein                               75.1    4e-14   
ref|XP_011041979.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
gb|KHG09723.1|  Non-specific lipid-transfer                           75.5    5e-14   
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             75.5    5e-14   
prf||2115353B  lipid transfer protein                                 75.1    5e-14
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
emb|CDX73941.1|  BnaA03g31060D                                        75.1    6e-14   
emb|CDM80997.1|  unnamed protein product                              75.1    6e-14   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  75.1    6e-14   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   75.1    7e-14   
ref|NP_001044654.1|  Os01g0822900                                     75.1    7e-14   
gb|EYU23196.1|  hypothetical protein MIMGU_mgv1a016221mg              75.5    7e-14   
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    7e-14   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       75.1    7e-14   
sp|Q42616.1|NLTP3_BRANA  RecName: Full=Non-specific lipid-transfe...  75.1    7e-14   
gb|ABU49731.1|  putative non-specific lipid transfer protein a1       74.7    7e-14   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    7e-14   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 74.3    8e-14   
gb|AFK45186.1|  unknown                                               74.7    8e-14   
ref|XP_011041978.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    8e-14   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   
gb|KHG09722.1|  Non-specific lipid-transfer                           74.7    8e-14   
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   
prf||2115353A  lipid transfer protein                                 74.7    8e-14
ref|XP_003605309.1|  Non-specific lipid-transfer protein              79.3    8e-14   
gb|ABB90546.1|  lipid transfer protein                                74.7    9e-14   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  74.7    9e-14   
emb|CAN76145.1|  hypothetical protein VITISV_034315                   75.1    1e-13   
gb|AAX20049.1|  putative non-specific lipid transfer protein          74.3    1e-13   
ref|XP_011002608.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-13   
gb|AAL25839.1|  lipid transfer precursor protein                      74.3    1e-13   
emb|CDY00655.1|  BnaC03g36390D                                        74.3    1e-13   
gb|AET05732.1|  lipid transfer protein isoform c                      73.9    1e-13   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  74.3    1e-13   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
gb|AHB19225.1|  non specific lipid transfer protein 1C                74.3    1e-13   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           74.7    1e-13   
emb|CDX90642.1|  BnaA03g41390D                                        74.7    1e-13   
gb|AHB19227.1|  non specific lipid transfer protein 1A                74.3    1e-13   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  74.3    1e-13   
emb|CDM80963.1|  unnamed protein product                              74.3    1e-13   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       73.9    1e-13   
gb|AAT80665.1|  lipid transfer protein precursor                      73.9    1e-13   
gb|AGC08424.1|  lipid transfer protein                                75.5    1e-13   
gb|AFR43293.1|  lipid transfer protein precursor                      74.3    1e-13   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
gb|ACZ06858.1|  lipid transfer protein                                74.3    1e-13   
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    2e-13   
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              73.9    2e-13   
dbj|BAK05317.1|  predicted protein                                    73.9    2e-13   
gb|AFR43285.1|  lipid transfer protein precursor                      73.9    2e-13   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               73.9    2e-13   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  73.6    2e-13   
ref|XP_003623613.1|  Non-specific lipid-transfer protein              73.9    2e-13   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      73.9    2e-13   
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   73.9    2e-13   
gb|AAC63372.1|  lipid transfer protein                                73.6    2e-13   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  73.6    2e-13   
emb|CDY18379.1|  BnaA04g22080D                                        73.6    2e-13   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              73.6    2e-13   
ref|XP_009115846.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  73.6    2e-13   
gb|ACM78614.1|  lipid transfer protein 2                              73.6    2e-13   
ref|XP_010558406.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  73.6    2e-13   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
gb|ABF06565.1|  non-specific lipid transfer-like protein              73.2    3e-13   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              73.2    3e-13   
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
gb|AAM00272.1|AF363505_1  lipid transfer protein 1                    73.6    3e-13   
sp|O24418.1|NLTP6_GOSHI  RecName: Full=Non-specific lipid-transfe...  73.2    3e-13   
emb|CAA42832.1|  LTP 1                                                73.6    3e-13   
ref|XP_006292062.1|  hypothetical protein CARUB_v10018257mg           73.2    3e-13   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  72.4    3e-13   
ref|XP_006403900.1|  hypothetical protein EUTSA_v10010829mg           73.2    3e-13   
ref|XP_002269620.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
ref|XP_004249706.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    4e-13   
emb|CAB96876.2|  pru p 1                                              72.4    4e-13   
gb|KDP45688.1|  hypothetical protein JCGZ_17295                       72.8    4e-13   
emb|CDX93316.1|  BnaC04g45800D                                        72.8    4e-13   
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  72.8    4e-13   
gb|EPS73763.1|  non-specific lipid-transfer protein                   73.2    4e-13   
gb|ABA33862.1|  phospholipid transfer protein 1                       72.8    4e-13   
ref|XP_002323667.1|  putative lipid transfer family protein           72.8    4e-13   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              72.8    4e-13   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  72.8    4e-13   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_002877813.1|  hypothetical protein ARALYDRAFT_485512           72.8    5e-13   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
ref|XP_010426733.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
gb|EYU42011.1|  hypothetical protein MIMGU_mgv1a016819mg              72.4    5e-13   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               72.4    5e-13   
ref|XP_010257636.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           72.4    5e-13   
emb|CAA85484.1|  lipid transfer protein precursor                     72.4    5e-13   
ref|XP_010503855.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    5e-13   
emb|CDX78016.1|  BnaA09g32110D                                        72.4    5e-13   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 72.4    5e-13   
emb|CAH04985.1|  type 1 non-specific lipid transfer protein precu...  72.4    5e-13   
gb|AAT80663.1|  lipid transfer protein precursor                      72.4    5e-13   
gb|KFK34404.1|  hypothetical protein AALP_AA5G140700                  72.4    5e-13   
emb|CDY16295.1|  BnaC01g23300D                                        72.4    6e-13   
gb|AES79831.2|  Lipid transfer protein                                72.8    6e-13   
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              72.4    6e-13   
gb|ABE11609.1|  lipid-transfer protein precursor                      72.4    6e-13   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              72.4    6e-13   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  72.4    6e-13   
emb|CAH69198.1|  type 1 non specific lipid transfer protein precu...  72.4    6e-13   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  71.6    6e-13   
ref|XP_007033548.1|  Non-specific lipid-transfer protein, putative    73.6    6e-13   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           72.4    6e-13   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  71.6    6e-13   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               72.4    6e-13   
ref|NP_001176316.1|  Os11g0115466                                     72.4    6e-13   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 72.0    7e-13   
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    7e-13   
gb|AAM22768.1|  lipid transfer protein                                71.6    7e-13   
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 72.4    7e-13   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  72.0    7e-13   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    7e-13   
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  72.0    7e-13   
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    7e-13   
ref|NP_001065986.1|  Os12g0115000                                     72.0    7e-13   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    7e-13   
ref|XP_007134822.1|  hypothetical protein PHAVU_010G079000g           72.0    7e-13   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 72.0    7e-13   
gb|AAA74624.1|  lipid transfer protein precursor                      72.0    7e-13   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           73.6    7e-13   
emb|CDM80964.1|  unnamed protein product                              72.0    7e-13   
gb|KEH29225.1|  Lipid transfer protein                                72.0    7e-13   
dbj|BAB09777.1|  lipid transfer protein-like                          72.0    8e-13   
ref|NP_190728.1|  pathogenesis-related protein LTP5                   72.0    8e-13   
gb|ABA33848.1|  phospholipid transfer protein 1                       72.0    8e-13   
ref|XP_006400974.1|  hypothetical protein EUTSA_v10014841mg           73.2    8e-13   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        72.0    9e-13   
gb|AGC08421.1|  lipid transfer protein                                72.4    9e-13   
gb|ABA33857.1|  phospholipid transfer protein 1                       72.0    9e-13   
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   72.0    9e-13   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           72.4    9e-13   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  72.0    9e-13   
ref|XP_004506518.1|  PREDICTED: uncharacterized protein LOC101489329  73.9    9e-13   
dbj|BAC77694.1|  lipid transfer protein                               72.0    9e-13   
gb|AEG79730.2|  lipid transfer protein precursor                      72.0    1e-12   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              71.6    1e-12   
emb|CAT99613.1|  lipid transfer protein                               70.9    1e-12   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 72.4    1e-12   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             72.4    1e-12   
gb|EYU27746.1|  hypothetical protein MIMGU_mgv1a018860mg              71.2    1e-12   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           72.0    1e-12   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSP-WAEAQVSCADIYNQMSPCADYVKSGGAVPAACC  323
            MA V + K L S LL+C+    VLSP  A A ++C  ++N + PC +YV  GG VPA CC
Sbjct  40   MANVLSKKFLLSFLLICL----VLSPPQARAVITCDTVFNDLKPCLNYVLVGGNVPAECC  95

Query  322  QALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              LK+++    T  DRQS C C+K     AT EQ+ RA  LP  C V  PFKI  DVDC+
Sbjct  96   NGLKSLIVKAITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGVKVPFKISRDVDCT  155

Query  142  AV  137
             V
Sbjct  156  KV  157



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 1/119 (1%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA   +LK L  +L + ++  +      +AQ+SC  + N +SPC  ++ +GG VP ACC 
Sbjct  6    MAKASSLKPLVFVLFVSMLIMSFFRS-GQAQISCDTVKNDLSPCIGFIMNGGKVPPACCS  64

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
             L T+++  KT+ DRQSAC C+K     AT +QLK A  +P  C V  PFKI  DVDCS
Sbjct  65   GLNTLLSLAKTRTDRQSACSCLKSVAESATDDQLKNAAQIPHSCGVNLPFKISRDVDCS  123



>ref|XP_009608993.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = -3

Query  463  LLLLCII--TFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLK  290
            L+++CI   T  +L+P A+A +SC  +  ++SPC +YV+ GGA+PA CC  +K + N   
Sbjct  7    LVVMCIAAATSVMLTPHADAAISCGQVVTRLSPCINYVRQGGALPAPCCSGIKALNNQAT  66

Query  289  TKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            T  DRQ+AC CIK   A  +      A  LPS C V  P+KI P +DCS V
Sbjct  67   TTPDRQAACNCIKSAAASISGINFNLAGSLPSKCGVNLPYKISPSIDCSTV  117



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSP-WAEAQVSCADIYNQMSPCADYVKSGGAVPAACC  323
            MA V +   L S LL+C+    VLSP    A ++C  +++ + PC  YV  GG VP  CC
Sbjct  1    MASVLSKTFLLSFLLICL----VLSPPQTRAVITCDTVFSDLKPCLSYVLVGGNVPTECC  56

Query  322  QALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              LK+++ N  T  DRQ AC C+K+    AT EQ+ RA  LP  C V  PFKI  DVDC+
Sbjct  57   NGLKSLITNATTTEDRQMACSCVKNLATAATDEQVDRAASLPGKCGVNVPFKISRDVDCT  116

Query  142  AV  137
             V
Sbjct  117  KV  118



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = -3

Query  445  ITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSA  266
            I+  V  P A A ++C  +YN + PC  YV  GG+VP  CC  LK+++ N  T  DRQSA
Sbjct  20   ISMVVAPPPAMAGITCDTVYNDLQPCLSYVLVGGSVPEECCSGLKSLLANATTTPDRQSA  79

Query  265  CQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            C C+K+  + AT E++ RA  +   C    PFKI PDVDCS V
Sbjct  80   CSCVKNLASAATGEEVSRAASITGQCGANVPFKISPDVDCSKV  122



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWA---EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKT  308
            KQL   L +CI+  A  +  A   +  V+C  +Y+ + PC  YV  G +VP  CC  LK+
Sbjct  4    KQLFPFLFICIVATATNTAAATAADETVTCNTVYDSLEPCLGYVLGGASVPPECCSGLKS  63

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            ++   +T+ DRQSACQC+K   + AT +Q+ RA  +P  CK   PFKI  +VDCS +
Sbjct  64   LLGAARTRTDRQSACQCVKSVASSATGDQISRAASIPGICKAKLPFKISANVDCSKI  120



>ref|XP_009778825.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=115

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +  S L +C++   V +P A+A+++C  +Y+ + PC  YV  G ++P+ CC  +K++++ 
Sbjct  5    KFLSFLFICMM---VAAPPAKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIST  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              T  DRQSAC C+K   ++AT ++L RA G+P  C    PF I P+VDCS V
Sbjct  62   ATTTADRQSACSCVKSLASRATGDELSRAAGIPGKCGANVPFDISPNVDCSKV  114



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 0/111 (0%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  L  + II   V  P A+A ++C  +Y+ + PC +YV  GG+VP  CC  L++++ +
Sbjct  6    RLMLLSFILIIYMVVAPPPAKAVITCDTVYDGVKPCLNYVLFGGSVPIDCCNGLESLIAS  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              T  DRQSAC C+K   + AT E+L RA  +P  C    PF+I P+VDCS
Sbjct  66   ATTTADRQSACSCVKSLASHATDEELSRAASIPGQCGASVPFEISPNVDCS  116



>ref|NP_001055844.2| Os05g0477900 [Oryza sativa Japonica Group]
 dbj|BAF17758.2| Os05g0477900 [Oryza sativa Japonica Group]
Length=129

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
            A A +SC+ +YN + PC  YV+SGGAVPAACC  ++++V   +T  DR++AC C+K+  A
Sbjct  34   ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAA  93

Query  238  KATPEQ-LKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             A     + RA GLP  C V  PFKI P+V+C+AV
Sbjct  94   GAAGGPYISRAAGLPGRCGVSVPFKISPNVNCNAV  128



>gb|AAT01364.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY98428.1| hypothetical protein OsI_20343 [Oryza sativa Indica Group]
 gb|EEE64096.1| hypothetical protein OsJ_18927 [Oryza sativa Japonica Group]
Length=138

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
            A A +SC+ +YN + PC  YV+SGGAVPAACC  ++++V   +T  DR++AC C+K+  A
Sbjct  34   ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAA  93

Query  238  KATPE-QLKRAQGLPSYCKVPFPFKIGPDVDCSAVPKEYN  122
             A     + RA GLP  C V  PFKI P+V+C+A  K  N
Sbjct  94   GAAGGPYISRAAGLPGRCGVSVPFKISPNVNCNAYVKTKN  133



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = -3

Query  481  LKQLTSLLLLCI--ITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKT  308
            + ++ SL ++CI  +  A+++  AEA V+C  +   +SPC DYV+ GGA+PA CC  +++
Sbjct  1    MAKVASLAVVCIAAMLIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRS  60

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +   T  DRQ+ C C+K      +   L  A  LP+ C V  P+KI P +DC+ V
Sbjct  61   LFSAASTTQDRQTVCNCMKSAAGAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKV  117



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 71/120 (59%), Gaps = 5/120 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA-VPAACCQALKTM  305
            + +++ L ++C++  A  SP A+AQ++C  + N +SPC  YV  GG  VPA CC  +K +
Sbjct  5    VTRVSFLAIVCLVLGATTSPKAQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCNGIKNL  64

Query  304  VNNLKTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +TK DRQ+ C CIK+ V+ +    +   L  A  LP  C V  P++I P+ DC++V
Sbjct  65   YGQAQTKTDRQAICSCIKNAVSNSGFNYSRSNLNNAANLPKKCGVNIPYQISPNTDCNSV  124



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + +L  LLL C++  A   P AEA ++C  +  +++PC  Y++SGGAV  ACC  +K + 
Sbjct  6    VAKLACLLLACMVATA---PHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALN  62

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            N+ KT  DRQ+AC C+K      +  QL  A  L   C V  P+KI P +DCS V
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV  117



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 72/124 (58%), Gaps = 10/124 (8%)
 Frame = -3

Query  478  KQLTSLLLLCIIT----------FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAA  329
            KQL  LL +CI+               +  A+A V+C  +Y+ + PC  YV  G +VP  
Sbjct  4    KQLFPLLFICIVVSVASITATATNTAAATAADATVTCNTVYDSLEPCLGYVLGGASVPPE  63

Query  328  CCQALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVD  149
            CC  LK++++  +T++DRQSACQC+K   + AT +Q+ RA  +P  CK   PFKI  +VD
Sbjct  64   CCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQISRAASIPGICKAKVPFKISANVD  123

Query  148  CSAV  137
            CS +
Sbjct  124  CSKI  127



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -3

Query  466  SLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            S++++C++  ++L  S  AEA  SC  + + ++PC  Y+KSGG+VP  CC  +K++    
Sbjct  7    SIVVVCLMFSSILLSSLQAEAAFSCGTVVSSLTPCLTYLKSGGSVPTTCCSGVKSLNAAA  66

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K+  A  T  +L+ A  LP+ C V  P+KI P  DCS V
Sbjct  67   KTTPDRQTACNCMKNAAAGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKV  118



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (58%), Gaps = 1/116 (1%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAV-LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTM  305
            + ++  L+++C+   +V L+P A+A +SC  + + ++PC  YV  GGA+PA CC  ++++
Sbjct  1    MAKVALLVVVCMAAVSVMLTPHADAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESL  60

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             N   +  DRQ+AC CIK   A         A  LP  C V  P+KI P +DCS V
Sbjct  61   NNQATSTPDRQTACNCIKSAAASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTV  116



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  +   +SPC  YV+ GGA+PA CC  +K++ N   +  DRQ+AC CIK
Sbjct  19   LTPHADAAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               A         A  LPS C V  P+KI P +DCS V
Sbjct  79   SAAAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  +   ++PC +YV+ GGA+PAACC  +KT+ +   +  DRQ+AC CIK
Sbjct  19   LTPHADAAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                  +      A  LP  C V  P+KI P +DCS V
Sbjct  79   SAARSISGINFGLASSLPGKCGVNLPYKISPSIDCSTV  116



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            LT L+ L  IT  V++P A   ++C  + N + PC  Y+K+GG++PA CC  +K + ++ 
Sbjct  7    LTKLVGLIFITMLVVAPHAAQALTCGQVLNMVMPCLGYLKNGGSIPATCCGGVKNLASSA  66

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KTK DRQ AC+C+K   AK+      RA  LPS C V +   I P +DCS V
Sbjct  67   KTKPDRQQACKCLKP-AAKSYGINYDRANKLPSACGVDYKINISPTIDCSTV  117



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = -3

Query  478  KQLTSLLLLCI-ITFAVLSPWA--EAQVSCADIYNQMSPCADYVKSGG-AVPAACCQALK  311
            KQ   +LL+CI +  A ++     +A ++C  ++  + PC  YV  GG +VP+ CC  +K
Sbjct  10   KQPFPMLLICIAVVMATITATTSQDATLTCNTVFTTLEPCLSYVLGGGLSVPSECCNGIK  69

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +M+N   T  DRQSAC+CIK  V+ A P  + RA  +P  CK   PFKI P VDCS
Sbjct  70   SMLNGAYTIADRQSACKCIKSVVSSAAPGPVSRAAKVPGICKANVPFKISPHVDCS  125



>gb|AAT45202.1| lipid transfer protein 1 precursor [Nicotiana tabacum]
Length=124

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  +   +SPC  YV+ GGA+PA CC  + ++ N   +  DRQ+AC CIK
Sbjct  26   LTPHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIK  85

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               A  +      A  LPS C V  P+KI P +DCS V
Sbjct  86   SAAAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  123



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            KQL  L++L  I     +P     ++C D+ N +  C  YV  GG VP +CC  +K +++
Sbjct  10   KQLLGLVIL--IWMLAYNPRPSEALTCDDVNNNLISCLSYVAGGGKVPTSCCSGVKNLLS  67

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              KT+ DRQ+AC C+K    +A  +QLKRAQ +P  C +  PF I  DVDCS V
Sbjct  68   LAKTRNDRQTACSCLKSLAVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKV  121



>ref|XP_009800887.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
 dbj|BAK19152.1| lipid transfer protein [Nicotiana tabacum]
Length=117

 Score = 93.6 bits (231),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  +   +SPC  YV+ GGA+PA CC  + ++ N   +  DRQ+AC CIK
Sbjct  19   LTPHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               A  +      A  LPS C V  P+KI P +DCS V
Sbjct  79   SAAAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + +L  LLL C++  A   P AEA ++C  +  +++PC  +++SGGAV  ACC  +K + 
Sbjct  6    VAKLACLLLACMVATA---PHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALN  62

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            N+ KT  DRQ+AC C+K      +  QL  A  L   C V  P+KI P +DCS V
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV  117



>ref|XP_009594799.1| PREDICTED: non-specific lipid-transfer protein 4-like [Nicotiana 
tomentosiformis]
Length=123

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -3

Query  445  ITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSA  266
            I   V  P A A ++C  +YN + PC  YV  GG+V   CC  LK+++ +  T  D QSA
Sbjct  20   ICMVVAPPPAMAAITCDTVYNDLQPCLSYVLIGGSVSTECCSGLKSLLASATTTPDHQSA  79

Query  265  CQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            C C+K+  + AT E++ RA  +P  C    PFKI PDVDCS V
Sbjct  80   CSCVKNLASAATGEEVSRAARIPGQCGANVPFKISPDVDCSKV  122



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  + + ++PC  YV  GGA+PA CC  +K++ N   +  DRQ+AC CIK
Sbjct  19   LTPQADAAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              V   +      A  LP  C V  P+KI P +DCS V
Sbjct  79   SAVGSISGINFGLASSLPGKCGVNLPYKISPSIDCSTV  116



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVL-SPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++ L  + ++T A++ +P+ EA ++C  + + +SPC  YV++GG+VPA+CCQ +  + + 
Sbjct  6    ISVLAFVVMVTGALMVTPYVEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVAALNSA  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+AC C+K  ++  +  Q   A  LP  C V  P++I P  DCS V
Sbjct  66   AKTTADRQAACSCLKSALSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKV  118



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA    L +L +L++   +     S   +AQ+SC  + N + PC  +V +GG V  ACC 
Sbjct  1    MANSSGLLKLGTLVIFVSMLIMSFSHGGQAQISCDTVDNDLLPCLSFVLNGGKVAPACCS  60

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
             +KT+++  KT+ DRQS C C+K     AT  QLK A  +P  C V  PF+I  ++DCS 
Sbjct  61   GIKTLLSLAKTQTDRQSVCSCLKSVAQSATNGQLKNAAQIPHLCGVNVPFQISRNIDCSK  120

Query  139  V  137
            V
Sbjct  121  V  121



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = -3

Query  466  SLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKT  287
            S++ +  +  A+++  AEA V+C  +   +SPC DYV+ GGA+P  CC  ++ + +   T
Sbjct  8    SVMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGIRNLFSAAST  67

Query  286  KLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              DRQ+ C C+K      +   L  A  LPS C V  P+KI P +DC+ V
Sbjct  68   TQDRQTVCNCMKSAARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKV  117



>ref|XP_009608991.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608992.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=106

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 58/99 (59%), Gaps = 0/99 (0%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            +L+P A+A +SC  +   +SPC  YV+ GGA+PA CC  +K + +   T  DRQ+AC CI
Sbjct  7    MLTPQADAAISCRQVVTSLSPCISYVRQGGALPAPCCSGIKALNSQATTTPDRQAACICI  66

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K   A  +      A  LPS C V  P+KI P +DCS V
Sbjct  67   KSAAAGVSGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  105



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = -3

Query  448  IITFAVLS-PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQ  272
            ++ F V++ P AEA ++C  +  QM+PC +Y+++GG VPAACC  +KT+    KT  DRQ
Sbjct  15   VLAFMVVAAPNAEAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAKTTPDRQ  74

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + C C+K    +    ++  A  LP  C +  P+KI P  DCS V
Sbjct  75   TTCSCMKSAATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKV  119



>ref|XP_003566138.1| PREDICTED: non-specific lipid-transfer protein P5-like [Brachypodium 
distachyon]
Length=130

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = -3

Query  421  WAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKD--  248
             A A +SC+ +YN + PC  YV+SGG VP ACC  +K +V+  ++  DR++ C C+K+  
Sbjct  34   GARAALSCSTVYNTLMPCLGYVQSGGTVPRACCTGIKRLVSGARSTQDRRTVCVCLKNVS  93

Query  247  GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              AK  P  L RA GLP+ C VP P+K GP+  CS++
Sbjct  94   SGAKGGP-YLTRAAGLPARCGVPLPYKTGPNDSCSSI  129



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 4/118 (3%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWAE---AQVSCADIYNQMSPCADYVKSGG-AVPAACCQALK  311
            KQL SLLL+CI      S  AE     V+C+ +Y+++ PC  YV  GG +VP+ CC  +K
Sbjct  4    KQLFSLLLICIAVATTPSIAAEDAITVVTCSTVYSRLEPCLGYVLGGGLSVPSECCNGIK  63

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            ++    +T  DRQ  C+C+K+  + AT  ++ RA  L   CKV   FKI PD DCS V
Sbjct  64   SLHRAARTTADRQRFCRCLKNVRSNATNTRISRASQLTGICKVNALFKIRPDFDCSKV  121



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 3/124 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGG--AVPAAC  326
            MA+    K    L LLC++  +  SP AEA +SC+ +Y+ ++PC  Y+  G   AVPA C
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLIGGSKQAVPAGC  60

Query  325  CQALKTMVNNLKTKLDRQSACQCIKDGVAK-ATPEQLKRAQGLPSYCKVPFPFKIGPDVD  149
            C  ++++     T +DRQS C C+K G A   +     +A  L + C V  P+KI P++D
Sbjct  61   CSGIQSLYTAASTTVDRQSVCSCLKAGAASLGSSIDANKAATLLNKCGVTVPYKISPNID  120

Query  148  CSAV  137
            CS V
Sbjct  121  CSKV  124



>dbj|BAP11221.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11224.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            LLC++  A +     AQV+C+ + N +SPC  YV +GGAVP  CC  ++T+ N  +T  D
Sbjct  1    LLCLMANAFMG--TRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  277  RQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+ C+C+K  V     T   L+ A GLP  C +  P+KI P  DC  V
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKV  107



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = -3

Query  484  NLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGG-AVPAACCQALKT  308
            ++KQL  LLL+CI   A      +A VSC  +Y+ + PC  +V +GG  VP+ACC  LK+
Sbjct  2    SIKQLFPLLLICIALAAT---ATDAAVSCNTVYSNLEPCLGFVLNGGPTVPSACCSGLKS  58

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            ++    T  DRQSAC+CIK   + A   Q+ RA  LP  C    P++I P+VDCS +
Sbjct  59   LLVAAGTTADRQSACKCIKSLASSANGVQIGRASQLPGICNAHIPYQISPNVDCSKI  115



>dbj|BAP11218.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11222.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11223.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            LLC++  A +     AQV+C  + N +SPC  YV +GGAVP  CC  ++T+ N  +T  D
Sbjct  1    LLCLMANAFMG--TRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  277  RQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+ C+C+K  V     T   L+ A GLP  C +  P+KI P  DC  V
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKV  107



>dbj|BAP11219.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11225.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            LLC++  A +     AQV+C+ + N +SPC  YV +GGAVP  CC  ++T+ N  +T  D
Sbjct  1    LLCLMANAFMG--TRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  277  RQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+ C+C+K  V     T   L+ A GLP  C +  P+KI P  DC  V
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>dbj|BAP11220.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            LLC++  A +     AQV+C  + N +SPC  YV +GGAVP  CC  ++T+ N  +T  D
Sbjct  1    LLCLMANAFMG--TRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  277  RQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+ C+C+K  V     T   L+ A GLP  C +  P+KI P  DC  V
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>dbj|BAP11226.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            LLC++  A +     AQV+C+ + N +SPC  YV  GGAVP  CC  ++T+ N  +T  D
Sbjct  1    LLCLMANAFMG--TRAQVTCSVVVNDLSPCISYVSGGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  277  RQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+ C+C+K  V     T   L+ A GLP  C +  P+KI P  DC  V
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 0/109 (0%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            LL + II      P A+A ++C  +Y+ + PC +YV  GG V   CC  L++++ +  T 
Sbjct  10   LLFILIIYMVAAPPPAKAVITCDTVYDGVKPCLNYVLFGGIVSTDCCNGLESVIASATTI  69

Query  283  LDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             D QS C CIK   ++AT ++L RA  +P  C    PF+I P+VDCS V
Sbjct  70   ADHQSTCSCIKSLASQATDDELSRAASIPGQCGATIPFEISPNVDCSKV  118



>ref|XP_009778826.1| PREDICTED: uncharacterized protein LOC104228120 [Nicotiana sylvestris]
Length=226

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = -3

Query  415  EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAK  236
            EA +S   +Y+ + PC  YV  GG +P  CC  LK++++  KT+ DRQS C C K   + 
Sbjct  50   EALLSSDTVYSSLQPCIGYVLGGGTLPPECCSGLKSLISIAKTRPDRQSFCSCAKGAASS  109

Query  235  ATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
             TPE+L RA GL   C    PFKI PD+DCS
Sbjct  110  TTPEELARANGLAGRCHARVPFKISPDMDCS  140



>ref|XP_009631015.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=102

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  427  SPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKD  248
            +P  +A+++C  +Y+ + PC  YV  G ++P+ CC  +K+++ +  T  DRQ AC C+K 
Sbjct  5    APPVKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIASATTTADRQIACSCVKS  64

Query  247  GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              ++AT ++L RA G+P  C    PF I PDVDCS V
Sbjct  65   LASRATGDELSRAAGIPGKCGANVPFDISPDVDCSKV  101



>ref|XP_004963700.1| PREDICTED: non-specific lipid-transfer protein 2A-like, partial 
[Setaria italica]
Length=127

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
            A A +SC+ +YN + PC  YV+SGG VP ACC  ++ +V+  +T  DR++ C C+K+  A
Sbjct  23   AGAALSCSTVYNTLMPCLGYVQSGGTVPRACCSGIQRLVSGARTTPDRRAICTCLKNVAA  82

Query  238  KATPE-QLKRAQGLPSYCKVPFPFKIGPDVDCSAVPKEYN*TYI  110
             A     + RA GLP  C VP P+K+ P+++C++    +N  ++
Sbjct  83   GAAGGPYISRAAGLPGRCGVPLPYKLSPNMNCNSDGMSFNTRHV  126



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -3

Query  481  LKQLTSLLL-LCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAV--PAACCQALK  311
            +++ T L+L + ++  A+  P AEA +SC  + N +SPC +YV  GGA   P  CC  +K
Sbjct  1    MEKATCLVLAVTMVVVALAPPQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIK  60

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            T+ N   +  DRQ+ C C+K    +A+P  +  A  LP  C V  P++I P  DCS V
Sbjct  61   TLYNQASSTADRQAVCGCLKSVAGQASPAIIGTAAALPGKCGVSIPYEISPSTDCSKV  118



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            L+L+C++  A +S   +AQV+C  + N +SPC  YV  GGAV   CC  ++T+ N  ++ 
Sbjct  16   LVLVCLMGSAFVS--TKAQVTCRTVVNDLSPCISYVSYGGAVTTNCCNGVRTLYNAARST  73

Query  283  LDRQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DRQ+ C C+K  V+    T  QL  A GLP  C +  P++I P  DCS V
Sbjct  74   ADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRV  124



>ref|XP_004245220.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA+  +L +  SLL L  I  A  SP  +A ++C+ ++N + PC  YV  GG VP  CC+
Sbjct  1    MAISKDLVKPLSLLFLIYIVIAA-SPRVDAAITCSSVFNGLIPCLSYVVKGGKVPPTCCR  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVP-FPFKIGPDVDCS  143
             +K++ +  KT  D Q  C C+K   +  +    K A  LP  C V   PFKI P VDCS
Sbjct  60   GIKSLYSIAKTTADHQGVCSCLKMAASSVSGIDFKNAAALPGKCGVKNIPFKISPKVDCS  119

Query  142  AV  137
             V
Sbjct  120  KV  121



>ref|XP_009615065.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=125

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 68/124 (55%), Gaps = 3/124 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYV--KSGGAVPAAC  326
            MA+    K    L LLC++  +  SP AEA +SC+ +Y+ ++PC  Y+   S  A PA C
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLMGSSKQAAPAGC  60

Query  325  CQALKTMVNNLKTKLDRQSACQCIKDGVAK-ATPEQLKRAQGLPSYCKVPFPFKIGPDVD  149
            C  ++++     T  DRQS C C+K G A   +     +A  L S C V  P+KI P++D
Sbjct  61   CSGIQSLYTAASTTADRQSVCSCLKAGAASLGSSIDTNKAATLLSKCGVTVPYKISPNID  120

Query  148  CSAV  137
            CS V
Sbjct  121  CSKV  124



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = -3

Query  466  SLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMVN  299
            SL L C++   ++  +P A+  V+C  + N ++PC +Y++    GAVP  CC  +K++ +
Sbjct  6    SLKLACVVVLGMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              +T  DRQ+AC+CIK   A  T      A GLP  C V  P+KI P+ DC+
Sbjct  66   AAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPNTDCN  117



>gb|KDP21874.1| hypothetical protein JCGZ_00661 [Jatropha curcas]
Length=119

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWA----EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTM  305
            + S+ L+ I++ AV+  +A     A ++C D+  +++PC  Y++SGG VP  CC  ++T+
Sbjct  1    MASVKLVMIVSLAVMMMFAPMAARAAITCGDVVRELTPCVGYLQSGGQVPGNCCNGIRTL  60

Query  304  VNNLKTKLDRQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             N  +T  DRQ+ CQC++  V+  + +   L  AQ LP+ C V  P+KI P  +C  V
Sbjct  61   YNAAQTTPDRQAVCQCLESAVSNFRYSSYNLGLAQSLPAKCNVNIPYKIDPSTNCKNV  118



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+C  + N ++PC +Y++    GAVP  CC  +K++ 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC++V
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + +SPC +YVKSGGAVPAACC  ++++ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+ C C+K             A GLP  C V  P+KI    +C+AV
Sbjct  64   AKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + +SPC +YVKSGGAVPAACC  ++++ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+ C C+K             A GLP  C V  P+KI    +C+AV
Sbjct  64   AKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAV  116



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A + C  + + + PC +YV  GGA+PA CC  +K++ N   +  DRQ+AC CIK
Sbjct  19   LTPHADAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               A         A  LP  C V  P+KI P +DCS V
Sbjct  79   SAAASIKGINFSHAGSLPGKCGVNLPYKISPSIDCSTV  116



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+C  + N ++PC +Y++    GAVP  CC  +K++ 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC++V
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + +SPC  YVKSGGAVPAACC  ++ +   
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGM  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+AC C+K             A GLP  C V  P+KI    +C+AV
Sbjct  64   AKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQS  269
            +I   V +P AEA +SC  + + ++ C  Y++ GGAVPAACC  LK + +   T  DRQ 
Sbjct  14   LIAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQG  73

Query  268  ACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             C C+K    K +      A GLPS C V   +KI P  DC +V
Sbjct  74   VCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  466  SLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            SL L C  ++   V +P AEA +SC  + + ++ C  Y++ GGAVPAACC  LK + +  
Sbjct  6    SLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAA  65

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             T  DRQ  C C+K    K +      A GLPS C V   +KI P  DC +V
Sbjct  66   TTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSV  117



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 3/108 (3%)
 Frame = -3

Query  460  LLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKL  281
            +L+C++   V +P AEA ++C  +   ++PC +Y+K GG VP ACC  +K++    KT  
Sbjct  15   VLMCMV---VSAPHAEAAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTA  71

Query  280  DRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            DRQ+AC C+K          L  A  LP  C V  P+KI P  DCS V
Sbjct  72   DRQAACNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  466  SLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            SL L C  ++   V +P AEA +SC  + + ++ C  Y++ GGAVPAACC  LK + +  
Sbjct  6    SLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSAA  65

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             T  DRQ  C C+K    K +      A GLPS C V   +KI P  DC +V
Sbjct  66   TTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = -3

Query  460  LLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKL  281
            L++C+    V +P AEA ++C  + + ++PC +Y+K GGAVPAACC  ++++ +  KT  
Sbjct  9    LVVCL-AVVVGAPLAEA-ITCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTA  66

Query  280  DRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            DRQ+AC C+K   A      L  A GLP  C V  P+KI P  +C+
Sbjct  67   DRQAACNCLKTASASIKGINLSLAAGLPGKCGVSVPYKISPSTNCN  112



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = -3

Query  466  SLLLLCIIT--FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC +     V++P+AEA +SC  + + ++PC  Y+  GGAVP ACC  +K + N  
Sbjct  5    AMMVLCAVVTCMVVVAPYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K      +      A  LP  C V  P+KI P  DCS V
Sbjct  64   KTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGVSIPYKISPGTDCSKV  115



>gb|ADY68820.1| lipid transfer protein 3 [Gossypium herbaceum subsp. africanum]
 gb|ADY68822.1| lipid transfer protein 3 [Gossypium barbadense]
 gb|ADY68824.1| lipid transfer protein 3 [Gossypium hirsutum]
 gb|AEN70921.1| lipid transfer protein [Gossypium darwinii]
 gb|AEN70923.1| lipid transfer protein [Gossypium tomentosum]
 gb|AEN70925.1| lipid transfer protein [Gossypium barbadense var. brasiliense]
 gb|AEN70927.1| lipid transfer protein [Gossypium barbadense var. peruvianum]
 gb|AEN70929.1| lipid transfer protein [Gossypium hirsutum subsp. latifolium]
Length=120

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + N ++PC +Y++    GAVP  CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCN  117



>gb|AAY43801.1| FSLTP3 [Gossypium hirsutum]
Length=116

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + N ++PC +Y++    GAVP  CC  +K++ 
Sbjct  4    KLACVVVLCMV---VGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  60

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC+
Sbjct  61   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCN  113



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + ++PC +YVKSGGAVPAACC  ++++ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASSIAPCVNYVKSGGAVPAACCNGVRSLNSA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+ C C+K             A GLP  C V  P+KI    +C+AV
Sbjct  64   AKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = -3

Query  466  SLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            SL L C  ++   V +P AEA ++C  + + ++ C  Y++ GGA+P ACC  LK++ +  
Sbjct  6    SLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSAA  65

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ  C C+K    K +      A GLPS C V  P+KI P  DC  V
Sbjct  66   KTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTV  117



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLS--PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            QL  L  L ++ F +++  P AEA V+C  + N + PC  YV +GGA+  ACC  +KT+ 
Sbjct  6    QLLKLACLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCLSYVTNGGALNPACCNGVKTLY  65

Query  301  NNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            N  +T  DRQ+ C C+K  +     T      A GLP+ C V  P+KI P  DC +V
Sbjct  66   NLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPARCGVNIPYKISPSTDCKSV  122



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G LK  + +L++C++  A L   A A V+C D+   ++PC  YV+ GG +P  CC 
Sbjct  1    MASSGVLKLASLMLVVCMVVSATL--QARAAVTCGDVVRTLTPCISYVQYGGPLPDNCCN  58

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPE--QLKRAQGLPSYCKVPFPFKIGPDVDC  146
             +KT+    +T  DRQ+ C+CIK  V   +     L  A GLP  C +  P+ I P  DC
Sbjct  59   GVKTLYGEAQTSADRQNVCKCIKSAVNGFSYSNFNLGLAAGLPGKCGLHLPYTISPSTDC  118

Query  145  SAV  137
            + V
Sbjct  119  NKV  121



>ref|XP_002276372.1| PREDICTED: non-specific lipid-transfer protein 1 [Vitis vinifera]
 emb|CBI15816.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 3/115 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            LK   +++L+C++   V +P A+A V+C+ +   ++PC +Y+  GGA+P++CC  +K + 
Sbjct  7    LKLACTVVLVCLL---VTAPQADATVTCSQVTQLLNPCVNYLIYGGAIPSSCCAGVKQVK  63

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               KT  DR++AC CI+DG A            LPS C V  P+KI P  DCS +
Sbjct  64   AASKTGEDRRTACSCIQDGAAMIPGIDYNLVASLPSQCGVSLPYKISPSTDCSRI  118



>ref|XP_009618455.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
 gb|AHB86570.1| non-specific lipid-transfer protein LTP1.1 [Nicotiana tabacum]
Length=129

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 64/125 (51%), Gaps = 11/125 (9%)
 Frame = -3

Query  478  KQLTSLLLLCI-----------ITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPA  332
            KQL S L +CI           IT       A+  V+C  + N +  C  YV  GG VP+
Sbjct  4    KQLLSFLFICIPLVVVAVITATITTTAAPIAADETVTCDTVINSLRSCLGYVIGGGIVPS  63

Query  331  ACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDV  152
             CC  LK+++   +T  D QSAC+C+K   +  T E+  R   +P  CK   PFKI PDV
Sbjct  64   ECCNGLKSLLIVARTTADHQSACKCLKSIDSGVTREEFSRVASIPRICKAKVPFKISPDV  123

Query  151  DCSAV  137
            DCS +
Sbjct  124  DCSKI  128



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  466  SLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            SL L C  ++   V +P AEA ++C  + + ++ C  Y++ GGAVPAACC  LK++ +  
Sbjct  6    SLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAVPAACCSGLKSLNSAA  65

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             T  DRQ  C C+K    K +      A GLPS C V   +KI P  DC  V
Sbjct  66   ATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTV  117



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            ++  S++ L +    + SP     ++C  +Y  ++PC  Y++SGGAV   CC  +++++ 
Sbjct  4    RRARSVVGLQLAMVLLASPRGTKAITCPQVYGDLTPCIQYLRSGGAVAPQCCSGVRSLLA  63

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              +T  DR++AC+CIK   A  +   + RA  LP  C V  P+KI P  DCS +
Sbjct  64   AARTVTDRRTACRCIKTAAAGLSGLDIGRASALPGKCGVSIPYKISPSTDCSKI  117



>ref|XP_011095136.1| PREDICTED: non-specific lipid-transfer protein-like [Sesamum 
indicum]
Length=118

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 9/123 (7%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G+LK L  L++LC++   V +P AEA +SCA +  ++SPC  Y+KSGG +P ACC 
Sbjct  1    MAGSGSLK-LACLIILCLV---VTAPHAEAAISCASVMTKLSPCLSYIKSGGGLPPACCS  56

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVA--KATPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
              K++ +   T  D Q+ C CIK  V   +A P  +     +P+ C V  P+K  P +DC
Sbjct  57   GAKSLNDAASTTPDLQAVCGCIKILVPSLRANPAYI---NSIPAKCGVNLPYKYSPSLDC  113

Query  145  SAV  137
            S V
Sbjct  114  SKV  116



>gb|KFK24679.1| hypothetical protein AALP_AA8G011100 [Arabis alpina]
Length=120

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 71/122 (58%), Gaps = 7/122 (6%)
 Frame = -3

Query  490  VGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALK  311
            + N++ +  + LL     ++++  +EA V+C  + + + PCA YV  GG VP  CC  ++
Sbjct  1    MANMRVVVPVFLL---IASMVASGSEAAVNCNTVVSYLYPCATYVAQGGVVPVRCCYGIR  57

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            T++   +T  DRQ  C+CIK+ +A      +P+ LK A  L + C+V  P+KI P  +C+
Sbjct  58   TLIGQARTTGDRQGVCRCIKNALAGVSYTPSPKYLKNASNLLNRCRVSLPYKISPSTNCN  117

Query  142  AV  137
            ++
Sbjct  118  SI  119



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGAVP-AACCQALKTMVNNLKTKLDRQSACQCIKD  248
            P AEA +SC  + + +SPC ++V  GG  P  +CC+ +KT+ N      DRQ+ C C+K 
Sbjct  17   PQAEAAISCGTVASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLKS  76

Query  247  GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              + ATP  +  A  LP  C V  P+KI P  DCS+V
Sbjct  77   VASSATPAIISNAAALPGKCGVSIPYKISPSTDCSSV  113



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V +P+AEA +SC  + N ++PC  Y+  GGAVP ACC  +K + N  KT  DRQ+AC C+
Sbjct  4    VAAPYAEA-LSCGQVSNSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = -3

Query  466  SLLLLCIIT--FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC +     V +P+AEA ++C  + + ++PC  Y+  GGAVP ACC  +K + N  
Sbjct  5    AMMVLCAVVTCMVVAAPYAEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K      +      A  LP  C V  P+KI P  DCS V
Sbjct  64   KTTPDRQAACGCLKSAYNSISGVNAGNAASLPGKCGVSIPYKISPGTDCSKV  115



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 3/117 (3%)
 Frame = -3

Query  484  NLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGG-AVPAACCQALKT  308
            ++KQL  LLLL  I  AV +   +A V+C  +Y  + PC  +V +GG  VP+ACC  LK+
Sbjct  2    SIKQLFPLLLL--ICVAVAATATDAAVTCNTVYTDLEPCLGFVLNGGLTVPSACCGGLKS  59

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            ++    T  DRQSAC+CIK   + A   Q+ RA  LP  CKV  P++I P+VDCS +
Sbjct  60   LLVAAGTTADRQSACKCIKSLASSANGVQIGRATQLPRICKVNVPYQISPNVDCSKI  116



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +++ L+L+C++   V SP A   +SC D+  Q++PC +Y++S G +P ACC  +K + N+
Sbjct  8    KVSCLVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNS  64

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              T  DR++AC+C+ +     +      A GLP  C V  P+KI P  +C  V
Sbjct  65   AATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV  117



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +++ L+L+C++   V SP A   +SC D+  Q++PC +Y++S G +P ACC  +K + N+
Sbjct  29   KVSCLVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNS  85

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              T  DR++AC+C+ +     +      A GLP  C V  P+KI P  +C  V
Sbjct  86   AATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV  138



>ref|XP_006482792.1| PREDICTED: non-specific lipid-transfer protein 8-like [Citrus 
sinensis]
Length=127

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVNNLKTKLDRQ  272
            +I F  L+P +EA +SC+D+   + PC +Y+KSG G  PAACC     + +   +  D++
Sbjct  23   LIMFLFLTPKSEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKK  82

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +AC CIK    K  P   + AQ LP+ C +  P  + P+VDCS +
Sbjct  83   TACGCIKTAAQKMNPNS-QLAQALPTNCGITLPVPVSPNVDCSKI  126



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            +SC+ +   + PC DYV++GGAVP  CC+ ++++  +  T  DRQ+ C C+K+  +  T 
Sbjct  3    MSCSTVVTDLYPCLDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVTG  62

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              L  A GLP  C V  P++I P VDC+ V
Sbjct  63   LNLDLAAGLPQKCGVSIPYQISPSVDCATV  92



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G +K   ++ +L +I  +      +A +SC  + + +SPC +Y   GG +P ACC 
Sbjct  1    MASYGVMKLSLTVAVLSMIISSGPYVHVDAAISCGQLASLLSPCVNYFVKGGPLPPACCS  60

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
             ++T+ +  KT  DRQ+ CQC+K   A      L  A  +P  C V FP+KI P  DCS 
Sbjct  61   GVRTLNSAAKTTADRQATCQCLKSAAASIPGLNLGLANSIPGKCGVNFPYKISPSTDCSR  120

Query  139  V  137
            V
Sbjct  121  V  121



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  430  LSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            L+P A+A +SC  +   ++PC +YV+ GG +P ACC  +KT+ +   +  DRQ+AC CIK
Sbjct  19   LTPHADAAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIK  78

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVD  149
                  +      A  LP  C V  P+KI P +D
Sbjct  79   SAAGSISGINFGLASSLPGKCGVNLPYKISPSID  112



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 7/125 (6%)
 Frame = -3

Query  499  MAVVGNLKQLTSLL--LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAAC  326
            MA  G L +L  L+  + C++  A   P AEA V+C  + N + PC  YV +GGA+  AC
Sbjct  1    MASSGQLLKLGCLVVVMFCMVAGA---PKAEAAVTCGQVVNSLVPCISYVGNGGALDPAC  57

Query  325  CQALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDV  152
            C  ++T+ N  +T  DRQ+ C C+K  +     T      A GLP+ C V  P+KI P  
Sbjct  58   CNGVRTLYNLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPST  117

Query  151  DCSAV  137
            DC +V
Sbjct  118  DCKSV  122



>ref|XP_006367906.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWAEAQ--VSCADIYNQMSPCADYVKSGG-AVPAACCQALKT  308
            KQ+  LLL+CI      S  AE    V+C+ +Y+ + PC  YV  GG +VP+ CC  +K+
Sbjct  4    KQVFPLLLICIAVATAASIAAEDATVVTCSTVYSSLEPCLGYVLGGGLSVPSECCSGIKS  63

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +    +T  DRQ  C+C+K+  + AT  ++ RA  L   CKV   FKI PD DCS V
Sbjct  64   LHRAARTTADRQRFCRCLKNVRSNATDTRINRASKLTGICKVNAFFKIRPDFDCSKV  120



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  ++++C++  A      EA ++C  + + +SPC  Y++ GGAVP ACC  +K++ ++
Sbjct  8    KLACVMVICMVMAAPA--AVEAAITCGQVASALSPCISYLQKGGAVPPACCSGIKSLNSS  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+AC+C+K+  +  +   L  A GLP  C V  P+KI P  DC+ V
Sbjct  66   AKTTADRQAACKCLKNFSSTVSGINLSLASGLPGKCGVSVPYKISPSTDCTKV  118



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDG  245
            P A   ++C  + + +S C  YV+SGG++PA+CC  ++++  + KT  DR++ C C+K  
Sbjct  22   PHAANAITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKST  81

Query  244  VAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             A+ +  +   A GLPS C V  PF I P  DCS V
Sbjct  82   AARISGIKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>gb|KHG10481.1| Non-specific lipid-transfer 3 [Gossypium arboreum]
Length=140

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G LK ++ +L++C+   +     A+A ++C+D+ N + PC  YV++GG   AACC 
Sbjct  1    MASSGVLKLVSMILIVCMTVMSA-PKAAKAAITCSDVVNHLIPCLSYVQNGGTPAAACCS  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
             +K +    +T  DRQ+ C+CIK  V     T   L  A GLP+ C +  P+ I P  DC
Sbjct  60   GVKALYGEAQTSPDRQNVCKCIKSAVNGIPYTSNNLNLAAGLPAKCGLQLPYSISPSTDC  119

Query  145  S  143
            +
Sbjct  120  N  120



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -3

Query  466  SLLLLCIIT--FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC +     V++P+AEA ++C  + + ++PC  Y+  GGAVP ACC  +K++ +  
Sbjct  5    AMMVLCAVVTCMVVVAPYAEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKSLNSAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K   +  +      A  LP  C V  P+KI P  DCS V
Sbjct  64   KTTPDRQAACGCLKSAYSSISGINEGNAASLPGKCGVNIPYKISPGTDCSKV  115



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 4/116 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIIT-FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTM  305
            + ++ +++   ++T   V +P+AEA ++C  + + +S CA Y+++GGAVP ACC  +K++
Sbjct  1    MARMATMVFCVVVTCMVVAAPYAEAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSL  60

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +  +T  DRQ+ C C+K             A  LP  C V  P+KI P  DCS V
Sbjct  61   NSAARTTPDRQTVCGCLKRASGGVNASN---AASLPGKCGVNIPYKISPSTDCSKV  113



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 3/118 (3%)
 Frame = -3

Query  490  VGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALK  311
            +  LK +  L+LLC++   VL P A   ++C  + +Q   C  Y++ GG  PAACC  ++
Sbjct  1    MAGLKLICGLVLLCML---VLEPMATTALTCGQVASQTGSCIRYLQRGGNPPAACCNGVR  57

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +    +T  DRQ+AC+C++      +    K A GLP+ C V  P+KI P  +C+ V
Sbjct  58   NLNRQARTTRDRQTACRCLQTAARTISGINAKLAAGLPAKCGVKIPYKISPSTNCNRV  115



>ref|XP_006438990.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|ESR52230.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|KDO46019.1| hypothetical protein CISIN_1g043898mg [Citrus sinensis]
Length=118

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVNNLKTKLDRQ  272
            +I F  L+P +EA +SC+D+   + PC +Y+KSG G  PAACC     + +   +  D++
Sbjct  14   LIMFLFLTPKSEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKK  73

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +AC CIK    K  P   + AQ LP+ C +  P  + P+VDCS +
Sbjct  74   TACGCIKTAAQKMNPNS-QLAQALPTNCGITLPVPVSPNVDCSKI  117



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 70/115 (61%), Gaps = 4/115 (3%)
 Frame = -3

Query  472  LTSLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            + +L L+C  +    V+SP A+A ++C  + + ++PC  Y++SGG+VP  CC  +K++ N
Sbjct  1    MAALKLVCALVACMLVVSPVAQAAITCGQVTSSVAPCIQYLRSGGSVPPPCCNGIKSLNN  60

Query  298  NLKTKLDRQSACQCIKDGVAKATPE-QLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              +T  DRQ AC+C+++  AKA P      A GLP  C V  P+KI    +C++V
Sbjct  61   AARTTPDRQQACRCLQN-AAKAIPGINTNLAAGLPGKCGVNIPYKISTSTNCASV  114



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = -3

Query  472  LTSLLLLC---IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + SL L+C   ++   V  P  E+ ++C  + + ++PC  Y+++GG +P+ACC  ++++ 
Sbjct  1    MVSLKLVCLALVVGLVVAMPLTESAITCGQVRSWVAPCLGYLRAGGKIPSACCSGIRSLN  60

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            N  +T  DR++ C+C++          L     LP  C V  P+KI P  DCS V
Sbjct  61   NAARTTHDRRTTCRCVQSAAGNIQGLNLGLVSALPGKCGVRIPYKISPSTDCSRV  115



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (60%), Gaps = 3/107 (3%)
 Frame = -3

Query  457  LLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            L+C++   V +P+AEA ++C  + ++++PC  Y+KSGGA  AACC  +K++ +   T  D
Sbjct  14   LMCML---VATPFAEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPAD  70

Query  277  RQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            R++AC C+K   A  +      A  LPS C V  P+ I   VDC+ V
Sbjct  71   RKAACGCLKSAAASISGMNTAAASSLPSKCGVSIPYPISTSVDCAKV  117



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +++ L+L+C++   V SP A   +SC D+  Q++PC +Y++S G +P ACC  +K + N+
Sbjct  8    KVSCLVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNS  64

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
              T  DR++AC+C+ +     +      A GLP  C V  P+KI P  +C
Sbjct  65   AATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNC  114



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + + ++PC +Y++    GA+P  CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+AC+CIK   A         A GLP  C V  P+KI P  DCS+V
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSV  119



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 2/113 (2%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  ++++C++     S   EA ++C  + + +SPC +Y+KSGG VP  CC  +K + + 
Sbjct  8    KLACVMVICMVVAVPAS--VEAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNSA  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ+AC+C+K             A GLP  C V  P+KI P  DCS V
Sbjct  66   AQTTADRQTACKCLKSLSGSIPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+C  + + ++PC +Y++    GA+P  CC  +K++ 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+AC+CIK   A         A GLP  C V  P+KI P  DCS+V
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSV  119



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDG  245
            P AEA ++C+ + N + PC  YV +GG VP  CCQ +K++    KT  DR+S C C+K  
Sbjct  26   PRAEAAITCSTVVNSLIPCLSYVMNGGKVPPTCCQGIKSLYGAAKTAADRRSVCSCLKTA  85

Query  244  VAKATPEQLKRAQGLPSYCKVP-FPFKIGPDVDCSAV  137
             +  +    K A  LP  C V   PFKI P  DCS V
Sbjct  86   ASSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKV  122



>ref|XP_008388344.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLS--PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            QL  L  L ++ F +++  P AEA V+C  + + ++PC  YVK GGA+  ACC  ++T+ 
Sbjct  6    QLLKLACLVVVMFCMVACVPKAEAAVTCGQMVSDLTPCISYVKXGGALAPACCNGVRTLF  65

Query  301  NNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               +T  DRQS C C+K  +     T      A GLP+ C V  P+KI P  DC +V
Sbjct  66   TLAQTXPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCSVNIPYKISPSTDCKSV  122



>ref|XP_006367725.1| PREDICTED: non-specific lipid-transfer protein 4-like [Solanum 
tuberosum]
Length=123

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 7/112 (6%)
 Frame = -3

Query  460  LLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGG---AVPAACCQALKTMVNNLK  290
             LLCI+   ++SP AEA +SC  +Y+++ PC  Y+  G    A PA CC  ++++     
Sbjct  14   FLLCIV---IISPQAEAAISCNTVYSKLMPCLSYLMGGSNKSAAPAGCCSGIQSLYTAAS  70

Query  289  TKLDRQSACQCIKDGVAK-ATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            T  DRQ  C C+K G A         +A  L S C V  P+KI PD+DCS V
Sbjct  71   TTTDRQGVCSCLKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPDIDCSKV  122



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + +SPC  YVKSGGAVPA CC  ++ +   
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGM  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+ C C+K             A GLP  C V  P+KI    +C+AV
Sbjct  64   AKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>ref|XP_002528683.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF33672.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=114

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L S L+LC++   V  P     ++C  + + +S C  Y++SGGAVP ACC  ++ + + 
Sbjct  7    KLISFLVLCLV---VAMPMTTEAITCGQVVSGLSSCLSYLRSGGAVPPACCNGVRGLNSA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ  C+C+K   A      L  A  LP  C V  P+KI P  DC ++
Sbjct  64   AKTTADRQQVCECLKSAAAGI---NLSNASSLPGKCNVNIPYKISPSTDCKSI  113



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 72/121 (60%), Gaps = 10/121 (8%)
 Frame = -3

Query  490  VGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALK  311
            +G+LK L   +LLC++   V +P A A ++C  I   ++PC  Y+K+GG +P +CC+ ++
Sbjct  1    MGSLK-LVCAVLLCMM---VAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVR  56

Query  310  TMVNNLKTKLDRQSACQCIKD---GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
             + +  +T  DRQSAC C+KD   G+A   P     A GLP  C V  P+KI P  +C+ 
Sbjct  57   AVNDASRTTSDRQSACNCLKDTAKGIAGLNPNL---AAGLPGKCGVNIPYKISPSTNCNN  113

Query  139  V  137
            V
Sbjct  114  V  114



>ref|XP_008778991.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAE-AQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQ  272
            ++  A+L+P    A ++C+D+Y  + PC  Y++SGGAV + CC  L+++V   +T  DR+
Sbjct  13   VLAMALLAPPCRVAAITCSDVYGDLLPCVQYIQSGGAVASQCCSGLQSLVAAARTADDRR  72

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +AC C+K   A +    +KRA  LP  C V  P+K+ P  DC+ +
Sbjct  73   AACTCLKSAAA-SFKGNVKRASSLPGKCGVSVPYKLSPSTDCNKI  116



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  490  VGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALK  311
            +  LK +  L+LLC++   VL P A   ++C  + +Q   C  Y++ GG  PAACC  ++
Sbjct  1    MAGLKLICGLVLLCML---VLEPMATTALTCGQVASQTGSCIRYLQRGGNPPAACCNGVR  57

Query  310  TMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
             +    +T  DRQ+AC+C++      +    K A GLP+ C V  P+KI P  +C+
Sbjct  58   NLNRQARTTRDRQTACRCLQTAARTISGINTKLAAGLPAKCGVKIPYKISPSTNCN  113



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 2/108 (2%)
 Frame = -3

Query  460  LLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKL  281
            L+L ++  A  SP     ++C  +Y  ++PC  Y++SGGAV   CC  +++++   +T  
Sbjct  14   LVLAMVLLA--SPRGTKAITCPQVYGDLNPCIQYLRSGGAVAPQCCSGVRSLLAAARTVT  71

Query  280  DRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            DR++AC+CIK   A  +   + RA+ LP  C V  P+KI    DCS +
Sbjct  72   DRRTACRCIKTAAAGLSGLDIGRARALPGKCGVSIPYKISASTDCSKI  119



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 4/114 (4%)
 Frame = -3

Query  466  SLLLLCIITF--AVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMVN  299
            SL L C++ F   V +P A+  +SC  I + ++PC  Y+K  GA   P ACC  ++++ +
Sbjct  6    SLKLTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLNS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              KT  DRQ+AC CIK      +      A GLP  C +  P+KI P  DC ++
Sbjct  66   AAKTTPDRQAACSCIKSAATGISGINYSTAAGLPGKCGINIPYKISPSTDCKSI  119



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 3/110 (3%)
 Frame = -3

Query  466  SLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKT  287
            +L++LC+    V  P AEA ++C  +   ++PC +YV+SGG VP +CC  ++ +V   KT
Sbjct  11   ALVILCMAVLVV--PHAEA-ITCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLVGAAKT  67

Query  286  KLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              DR++AC C+K    +    +   A GLP  C V  PF I   V+C+ V
Sbjct  68   TADRRTACNCLKSAAGRIPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V +P+AEA +SC  + + ++PC  Y+  GGAVP ACC  +K + N  KT  DRQ+AC C+
Sbjct  4    VAAPYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AEN70935.1| lipid transfer protein [Gossypium aridum]
 gb|AEN70937.1| lipid transfer protein [Gossypium lobatum]
Length=120

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            +L  +L+LC++   V +P A+  V+C  +   ++PC  Y++  GA  VP  CC  +K++ 
Sbjct  8    KLACVLVLCMV---VGAPLAQGAVTCGQVTTSLAPCIGYLRGNGAGTVPQGCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLPS C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPSKCGVNIPYKISPSTDCN  117



>ref|XP_006429570.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
 ref|XP_006481183.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42810.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
Length=117

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKT  308
            LK   ++LL+C++  A   P A+A V+C  + + +  C  YV    GGAVP ACC  +K+
Sbjct  3    LKLACAVLLMCMVMGA---PIAQAAVTCGQVTSSLQACMPYVTGPGGGAVPPACCSGIKS  59

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +   T  DRQS C C+K          L  A GLP  C V  P++I P VDCS V
Sbjct  60   LNSAATTTPDRQSVCNCLKTAAGSIRNLNLNLASGLPRQCGVNIPYQISPSVDCSRV  116



>ref|XP_006369490.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
 gb|ERP66059.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
Length=108

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVNNLKTKLDRQ  272
            ++ F +L+P +EA +SC+D+   + PC  Y+ +G G  PAACC  +  +  +  T  D+Q
Sbjct  4    LMMFLLLTPPSEAAISCSDVIKDLRPCVSYLMNGTGKPPAACCSGISAIQASASTTADKQ  63

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +AC CIK    +  P   + AQ LP+ C +  PF + P+VDCS +
Sbjct  64   AACNCIKSASKQINPSP-QLAQALPANCGITLPFTVSPNVDCSKI  107



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + ++PC +Y+++GG VPA CC  ++++ N  KT  DRQ+AC C+K        
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG  60

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              L  A GLP  C V  P+KI P  DC +V
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSV  90



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = -3

Query  466  SLLLLCIIT--FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC +     V +P+AEA +SC  + + ++PC  Y+  GGAVP ACC  +K++    
Sbjct  5    AMMVLCAVVTCMVVAAPYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNCAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K      +      A  LP  C V  P+KI P  DCS V
Sbjct  64   KTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  115



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 62/114 (54%), Gaps = 4/114 (4%)
 Frame = -3

Query  466  SLLLLCIITF--AVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMVN  299
            SL L C++     V +P A+  V+C  +   ++PC +Y++    GAVP  CC  +K++ +
Sbjct  6    SLKLACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              +T  DRQ+AC+CIK   A         A GLP  C V  P+KI P  DCS V
Sbjct  66   AAQTTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDCSRV  119



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGG-AVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKAT  230
            V+C  +Y+ + PC  YV  GG +VP+ CC   K++++   T  DRQSAC+CIK   + A 
Sbjct  29   VTCNMVYSSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNAN  88

Query  229  PEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              QL RA  LP  CK   PFKI P VDCS V
Sbjct  89   EAQLSRAATLPRICKTNVPFKISPHVDCSKV  119



>gb|AGC08428.1| lipid transfer protein [Gossypium hirsutum]
Length=124

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -3

Query  466  SLLLLCIITF--AVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMVN  299
            SL L C++ F   V +P A+  +SC  I + ++PC  Y+K  GA   P ACC  ++++ +
Sbjct  6    SLKLTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLNS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
              KT  DRQ+AC CIK      +      A GLP  C +  P+KI P  DC
Sbjct  66   AAKTTPDRQAACSCIKSAATGISGINYSTAAGLPGKCGINIPYKISPSTDC  116



>ref|XP_007206148.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
 sp|Q43019.1|NLTP3_PRUDU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Prunus dulcis]
 emb|CAA65477.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80966.1| putative allergen Pru du 3.02 [Prunus dulcis x Prunus persica]
 gb|ACE80967.1| putative allergen Pru p 3.02 [Prunus dulcis x Prunus persica]
 gb|EMJ07347.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
Length=123

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G L +L  L+ + +   AV  P A A VSC  + N ++PC +YV +GGA+  +CC 
Sbjct  1    MASSGQLLKLVCLVAV-MCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCT  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
             ++++ +  +T  DRQS C C+K  V     T      A GLP  C V  P+KI P  DC
Sbjct  60   GVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDC  119

Query  145  SAV  137
             ++
Sbjct  120  KSI  122



>ref|XP_010922738.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=117

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAE-AQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQ  272
            ++  A+L+P      ++C+D+Y  + PC  Y++SGGAV   CC  L+T+V   +T  DR+
Sbjct  13   VLAMALLAPPCRVTAITCSDVYGDLLPCVQYIQSGGAVAPQCCSGLRTLVAAARTGDDRR  72

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +AC C+K   A  + + + RA  LP  C V  P+K+ P  DCS +
Sbjct  73   TACTCLKTAAASFSGD-VSRASKLPGKCGVSIPYKLSPSTDCSKI  116



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + + ++PC +Y++    GAVP  CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASISGINFGIASGLPGKCGVNIPYKISPSTDCN  117



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            L L+ +I   V  P A+A ++C  +   ++PC +YVKSGGAVPAACC  ++++ +  KT 
Sbjct  8    LALVALICIVVAVPVAQA-ITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTT  66

Query  283  LDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DR+  C C+K             A GLP  C V  P+KI    +C+ V
Sbjct  67   ADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV  115



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++  ++L+C++     +P A+A ++C  + + ++PC  Y++ GGAVP  CC  +KT+V++
Sbjct  5    KVACVVLICMVMVGA-APIAQA-ITCGQVVSNLTPCITYLQRGGAVPGQCCNGVKTLVSS  62

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  D+Q+AC C+K   A         A  LP  C V  P+KI P  +C+++
Sbjct  63   AQTTADKQTACNCLKSTAATIPNINFGNAGSLPGKCGVNLPYKISPSTNCASI  115



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  + LLCI+   V  P A+A ++C  +   ++PC +YVK+GGAVPAACC  ++ + + 
Sbjct  8    KLALVALLCIV---VAVPVAQA-ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQ  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ  C C+K+            A GLP  C V  P+KI    +C+ V
Sbjct  64   AKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV  116



>gb|AFR43288.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
Length=120

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = -3

Query  466  SLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVK--SGGAVPAACCQALKTMVN  299
            SL L C++   +L  +P A+  +SC  +   + PC  YV+  S G  P  CC+ ++++ +
Sbjct  6    SLKLACVVVLCLLVGAPLAQGAISCVQVKYSLLPCVGYVRGNSAGPAPPDCCKGIRSLKS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              + +LDRQ+AC+CIK   A  +      A GLP  CKV  P+KI P +DC  V
Sbjct  66   AARRRLDRQAACKCIKSLAADISDINYSVAAGLPGQCKVHIPYKISPSIDCKRV  119



>ref|NP_001236948.1| uncharacterized protein LOC100306062 precursor [Glycine max]
 gb|ACU14054.1| unknown [Glycine max]
Length=125

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS-GGAVPAACCQALKTM  305
            +K  + ++ + +++F  + P AEA++ C  +   ++PC  Y++  GG VPAACC  ++++
Sbjct  8    MKVTSCMVAVLMVSFGHIIPLAEAEIPCGRVQITVAPCIGYLRGPGGGVPAACCNGVRSI  67

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                KT  DRQ  C+C+K          L     LPS C V  P+KI P +DC+ V
Sbjct  68   NKEAKTTPDRQGVCRCLKTTALSLPGLNLATLAALPSKCGVNLPYKISPTIDCNTV  123



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = -3

Query  478  KQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
              +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N
Sbjct  4    SSMTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINN  62

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              KT  DRQ+AC C+K   A         A  LP  C V  P+KI P  +C+ V
Sbjct  63   LAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|ACN11576.1| lipid transfer protein 3 precursor [Prunus dulcis]
Length=123

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 3/123 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G L +L  L+ + +   AV  P A A VSC  + N ++PC +YV +GGA+  +CC 
Sbjct  1    MASSGQLLKLVCLVAV-MCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCT  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
             ++++ +  +T  DRQS C C+K  V     T      A GLP  C V  P+KI P  DC
Sbjct  60   GVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDC  119

Query  145  SAV  137
              +
Sbjct  120  KTI  122



>gb|KHN40623.1| Non-specific lipid-transfer protein [Glycine soja]
Length=121

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVK-SGGAVPAACCQALKTMVNNLKT  287
            ++++ + +F  + P AEA++ C  +   ++PC  Y++ SGG VPA CC  +K++ N  KT
Sbjct  13   MVVVWMFSFGHIIPLAEAEIPCGRVQITVAPCIGYLRGSGGGVPAPCCNGVKSINNQAKT  72

Query  286  KLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              DRQ  C+C+K  V       L     LPS C +  P+KI P +DC+
Sbjct  73   IPDRQGVCRCLKSTVLSLPGLNLATLSALPSKCGINLPYKITPTIDCN  120



>ref|NP_001236518.1| uncharacterized protein LOC100306032 precursor [Glycine max]
 gb|ACU14011.1| unknown [Glycine max]
Length=124

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS-GGAVPAACCQALKTMVNNLKT  287
            ++++ + +F  + P AEA+  C  +   ++PC  Y++  GG VPA CC  +K++ N  KT
Sbjct  13   MVVVWMFSFGHIIPLAEAETPCGRVQITVAPCIGYLRGPGGGVPAPCCNGVKSINNQAKT  72

Query  286  KLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              DRQ  C+C+K  V       L     LPS C +  P+KI P +DC+ V
Sbjct  73   TPDRQGVCRCLKSTVLSLAGLNLATLSALPSKCGINLPYKITPTIDCNTV  122



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K   A         A  LP  C V  P+KI P  +C+ V
Sbjct  65   KTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNINNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K   A         A  LP  C V  P+KI P  +C+ V
Sbjct  65   KTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L+ + LLCI+   V  P A+A ++C  + + ++PC +YVKSGGAVPA CC  ++++ + 
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASSIAPCVNYVKSGGAVPAGCCNGIRSLNSA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+ C C+K             A GLP    V  P+KI    +C+AV
Sbjct  64   AKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKXGVNVPYKISTSTNCAAV  116



>ref|XP_011005034.1| PREDICTED: non-specific lipid-transfer protein 8-like [Populus 
euphratica]
Length=108

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (61%), Gaps = 2/105 (2%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVNNLKTKLDRQ  272
            ++ F +++P ++A +SC+D+   + PC +Y+ +G G  PAACC  + ++     T  D+Q
Sbjct  4    LMMFLLVTPPSDAAISCSDVIKDLRPCVNYLMNGTGKPPAACCSGISSIQAAASTTADKQ  63

Query  271  SACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            SAC CIK    +  P+  + AQ LP+ C +  PF + P+VDCS +
Sbjct  64   SACNCIKSASKQMNPKP-QLAQALPANCGITLPFTVSPNVDCSKI  107



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L S L+LC++   V  P +   ++C  +   ++PC  +++SGG +P  CC  ++++   
Sbjct  5    KLVSALVLCML---VTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAA  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ+AC C+K          L  A GLP  C V  P+KI    DCS V
Sbjct  62   ARTTPDRQTACNCLKQAAGSIPNLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>ref|XP_010683517.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG--GAVPAACCQALKTMVNNLKTKLDR  275
            +I   VL+P A+A V+C  +   ++PC +Y+++G  GAVP  CC  +KT+    ++  DR
Sbjct  17   LIALVVLAPQAKATVTCGTVATSLTPCLNYLQAGASGAVPGGCCTGIKTLNGAAQSTPDR  76

Query  274  QSACQCIKDGVAKATPE-QLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            Q  CQC+K   AKA P   +  A  +P  C V  P+K+ P  DCS+V
Sbjct  77   QMVCQCLKSA-AKAMPNVNVGLASSIPPKCGVNIPYKLDPSTDCSSV  122



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A      L  A  LP  C V  P++I P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>ref|XP_009372010.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLS--PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            QL  L  L ++ F +++  P A+A ++C  + + ++PC  YV++GGA+  ACC  ++T+ 
Sbjct  6    QLLKLACLVVVMFCMVACVPKADAAMTCGQVVSDLTPCISYVRAGGALAPACCNGVRTLF  65

Query  301  NNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               +T  DRQS C C+K  +     T      A GLP+ C V  P+KI P  DC +V
Sbjct  66   TLAQTTPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDCKSV  122



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = -3

Query  454  LCIITFAVLSPWAE-AQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLD  278
            L +    + +P  E A ++C  + + ++PC +Y++ GGAVP ACC  +K++ +  KT  D
Sbjct  12   LVVAVMVIAAPHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNSAAKTTPD  71

Query  277  RQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            RQ+AC C+K         Q   A  LP+ C V  P+KI P  DCS V
Sbjct  72   RQTACNCLKSAAVSNPSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>emb|CDO96795.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 1/116 (1%)
 Frame = -3

Query  484  NLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTM  305
            N K + ++++L ++    L+P AEA ++C  + + ++PC  Y+K+GG+VP  CC  ++ +
Sbjct  7    NSKVVGAVIMLTVVA-GELAPRAEAVIACGQVISFLTPCTRYLKNGGSVPGNCCAGVRHL  65

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            V   +T  DR+SAC C+K         +L  AQ LP  C     ++I P +DCS V
Sbjct  66   VAAARTPADRKSACTCLKGAYRGYPGIKLPNAQSLPKKCGANVRYRIIPTIDCSRV  121



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A      L  A  LP  C V  P++I P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>gb|AGC08426.1| lipid transfer protein [Gossypium hirsutum]
Length=120

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAAC  326
            MA  G LK    +++LC++   V +P A+  V+C  +   ++PC +Y++    GAVP  C
Sbjct  1    MASSGVLK-FACVVVLCMV---VGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGC  56

Query  325  CQALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
            C  +K++ +  +T  DRQ+AC+CIK   A         A GLP  C V  P+KI P  DC
Sbjct  57   CSGIKSLNSAAQTTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDC  116

Query  145  SAV  137
            + V
Sbjct  117  NKV  119



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + ++PC  Y+K GGAVP  CC  +K++    KT  DRQ+AC+C+K   +    
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG  60

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A GLP  C V  P+KI P  DCS+V
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV  90



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L S L+LC++   V  P +   ++C  +   ++PC  +++SGG +P  CC  ++++   
Sbjct  5    KLVSALVLCML---VTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAA  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ+AC C+K          L  A GLP  C V  P+KI    DCS V
Sbjct  62   ARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|AFR43289.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43290.1| lipid transfer protein precursor [Gossypium barbadense]
 gb|KHG07849.1| Non-specific lipid-transfer 6 [Gossypium arboreum]
Length=120

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = -3

Query  466  SLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKSGGAVPAA--CCQALKTMVN  299
            SL L C++   +L  +P A+  +SC  +   + PC  YV+   A PA   CC+ ++++ +
Sbjct  6    SLKLACVVVLCLLVGAPLAQGAISCVQVKYSLLPCVGYVRGNNAGPAPPDCCKGIRSLKS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              + +LDRQ+AC+CIK   A  +      A GLP  CKV  P+KI P +DC  V
Sbjct  66   AARRRLDRQAACKCIKSLAADISDINYSVAAGLPGQCKVHIPYKISPSIDCKRV  119



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -3

Query  466  SLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC  +    V +P+ EA +SC  + + ++PC  Y+  GGAVP ACC  +K++ +  
Sbjct  5    AMMVLCAGVTCMVVGAPYTEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K      +      A   P  C V  P+KI P  DCS V
Sbjct  64   KTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKV  115



>ref|NP_001268120.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33393.1|AF467945_1 lipid transfer protein isoform 1 [Vitis vinifera]
Length=119

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + + PCA Y++ GG+VPA CC  +K++ +  KT +DRQ+AC+C+K        
Sbjct  29   ITCGQVASAVGPCASYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLKTFSGSIPG  88

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A GLP  C V  P+KI P  DCS V
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|ACE07187.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=116

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQS  269
            ++   + S +AEA ++C+D+ N+++PC +Y+K GG VPA CC  +K + +  KT  DRQ+
Sbjct  13   VVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQT  71

Query  268  ACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            AC C+K         +   A  LPS C V  P+KI  + DC+ V
Sbjct  72   ACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV  115



>sp|Q42762.1|NLTP1_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA75599.1| nonspecific lipid transfer protein precursor [Gossypium hirsutum]
Length=116

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+   + N ++PC +Y++    GAVP  CC  +K++ 
Sbjct  4    KLACVVVLCMVVGA---PLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLN  60

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T   RQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC++V
Sbjct  61   SAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  115



>ref|XP_004245221.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=123

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = -3

Query  460  LLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG---GAVPAACCQALKTMVNNLK  290
             LLCI+   ++SP  EA +SC  +Y+++ PC  Y+  G    A PA CC  ++++     
Sbjct  14   FLLCIV---IISPQTEAAISCNTVYSKLMPCLSYLMGGSNRAAAPAGCCSGIQSLYTAAS  70

Query  289  TKLDRQSACQCIKDGVAK-ATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            T  DRQ  C C+K G A         +A  L S C V  P+KI P++DCS V
Sbjct  71   TTTDRQGVCSCLKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPNIDCSQV  122



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 3/111 (3%)
 Frame = -3

Query  466  SLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKS-GGAVPAACCQALKTMVNN  296
            SL L C++   ++  +P A+  V+C  +   ++PC  Y++  GG VP  CC  +K++ + 
Sbjct  6    SLKLACVVVLCMVLGAPLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNSA  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
             +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  66   AQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  116



>sp|Q43129.1|NLTP2_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=GH3; Flags: Precursor [Gossypium hirsutum]
 gb|AAB34774.1| LTP [Gossypium hirsutum]
 gb|AAY43799.1| NSLTP1 [Gossypium hirsutum]
Length=120

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = -3

Query  466  SLLLLCIITF--AVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMVN  299
            SL L C++     V +P A+  V+   + N ++PC +Y++    GAVP  CC  +K++ +
Sbjct  6    SLKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNS  65

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              +T   RQ+AC+CIK   A  T      A GLP  C V  P+KI P  DC++V
Sbjct  66   AAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>gb|KHN29511.1| Non-specific lipid-transfer protein [Glycine soja]
Length=122

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS-GGAVPAACCQALKTM  305
            +K  + ++ + +++F  + P AEA++ C  +   ++PC  Y++  GG VPAACC  ++++
Sbjct  8    MKVTSCMVAVLMVSFGHIIPLAEAEIPCGRVQITVAPCIGYLRGPGGGVPAACCNGVRSI  67

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
                KT  DRQ  C+C+K          L     LPS C V  P+KI P +DC+
Sbjct  68   NKEAKTTPDRQGVCRCLKTTALSLPGLNLATLAALPSKCGVNLPYKISPTIDCN  121



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  403  SCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATPE  224
            +C  + + +SPC  Y++ GGAVPA CC  +K++ +  KT  DRQ+AC+C+K   +  +  
Sbjct  30   TCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGI  89

Query  223  QLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                A GLP  C V  P+KI P  DCS V
Sbjct  90   NYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            ++L+ +++   + P  EA + C  + + ++PC  YV   GA+   CC+ +  +    +T 
Sbjct  10   VVLIAVVSIMSVVPEGEAAIGCGTVVSYLNPCLPYVTGTGAL-GGCCKGINDLYAAAQTT  68

Query  283  LDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DRQS C C+KD  A  +   L +A GLPS C +  P+KI P  DCS V
Sbjct  69   ADRQSVCGCLKDLAASTSGVNLGKAAGLPSQCGLNIPYKISPSTDCSKV  117



>ref|XP_010025406.1| PREDICTED: non-specific lipid-transfer protein 8-like [Eucalyptus 
grandis]
 gb|KCW62060.1| hypothetical protein EUGRSUZ_H04731 [Eucalyptus grandis]
Length=119

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVNNLKTKLDRQSACQCIKD  248
            P +E+ +SC+D+   + PC  Y+KSG G  PAACC  + ++ N   +  D+++AC C+K+
Sbjct  23   PVSESAISCSDVVKDLRPCVSYLKSGSGNPPAACCAGVTSLANAATSSADKKAACACLKN  82

Query  247  GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               K  P   + AQ LPS C V  P  + P+VDCS +
Sbjct  83   AAQKMNPNA-QLAQALPSKCGVTLPVAVSPNVDCSKI  118



>ref|XP_007017081.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
 gb|EOY34700.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
Length=119

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQS  269
            +++  V +P+  A +SC  + N ++PC  Y   GG VP  CC+ +KT+     T  DR++
Sbjct  15   LVSMLVAAPYVNATISCEQVTNWLTPCITYGLFGGTVPPGCCEGIKTLNAASNTTEDRRA  74

Query  268  ACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             C C+K+G AK       R   LP  C    P+K+  D+DCS V
Sbjct  75   QCNCVKEGAAKIPGLNYDRVNELPGKCGTTCPYKLSYDLDCSKV  118



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 64/115 (56%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+C  + + ++PC  Y++    GA+P  CC  +K++ 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+AC+CIK             A GLP  C V  P+KI P  DC++V
Sbjct  65   SAAQTTPDRQAACKCIKSAATGIRGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>gb|AAM22767.2| lipid transfer protein 2 precursor [Prunus persica]
Length=123

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G L +L  L+ + +   AV  P A A VSC  + N ++PC +YV +GGA+  +CC 
Sbjct  1    MASSGQLLKLVCLVAV-MCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCT  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATP---EQLKRAQGLPSYCKVPFPFKIGPDVD  149
             ++++ +  +T  DRQS C C+K  V    P        A GLP  C V  P+KI P  D
Sbjct  60   GVRSLYSLAQTTADRQSICNCLKQAV-NGIPYPNANAGLAAGLPGKCGVNIPYKISPSTD  118

Query  148  CSAV  137
            C ++
Sbjct  119  CKSI  122



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V +P+ EA +SC  + + ++PC  Y+  GGAVP ACC  +K++ +  KT  DRQ+AC C+
Sbjct  4    VAAPYTEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGVNAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_003522081.1| PREDICTED: non-specific lipid-transfer protein 3-like [Glycine 
max]
Length=130

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGA-VPAACCQALKTMVNNLKTKLDRQSACQCIKD  248
            P A+ +VSC  + + ++PC  YV  GGA VPA CC  ++ +    +TK DRQ+ C CIK+
Sbjct  29   PMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQTKPDRQAVCNCIKN  88

Query  247  GVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             V  +    +   L  A  LP  C V  P++I PD DC+ V
Sbjct  89   AVRNSGFTYSHFNLNLAANLPKNCGVNIPYQISPDTDCTRV  129



>ref|XP_006407743.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49196.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=113

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  + +++ PC  YV  GG VPA+CC  ++T+    +T  DRQS C+CIK+ + 
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  238  KA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +   L  A  LP+ C V  P++I P  +C ++
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDSI  112



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YVK GGAVP ACC+ ++T+    
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSNLAPCIPYVKGGGAVPPACCKGIRTVSGLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K      +      A  LP  C V  P+KI   ++C+AV
Sbjct  65   KTTADRQAACNCLKQLSGSISGVNPNNAAALPGKCGVNVPYKINTFINCAAV  116



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  427  SPWAEAQVSCADIYNQMSPCADYVK-SGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            +P A+  +SC  +   ++PC  Y++ SGGAVP++CC  +K + +  +T  DR++AC CIK
Sbjct  21   APLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIK  80

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                  +      A  +PS C V  P++I P++DCS+V
Sbjct  81   SAAGSISGINYALASQMPSKCGVSIPYQISPNIDCSSV  118



>ref|XP_004506487.1| PREDICTED: non-specific lipid-transfer protein 3-like [Cicer 
arietinum]
Length=124

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 8/120 (7%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGG-AVPAACCQALKTM  305
            + +L    +LC++TF    P AE  V+C  + N ++ C  Y+  GG  VPA CC  ++ +
Sbjct  7    VSKLVCFAILCLVTFG---PKAEGAVTCGQVVNNLTSCVSYIMYGGNTVPAQCCNGVRNL  63

Query  304  VNNLKTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +T  DR++ C CIK+ V+ +    +   L  A  LP  C V  P++I P+ DC++V
Sbjct  64   NAMAQTTPDRRAVCSCIKNAVSSSGFTYSNTNLNLAASLPRRCGVNIPYQISPNTDCNSV  123



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = -3

Query  487  GNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKT  308
            G +K +  ++L+ +++   + P  EA + C  + +++SPC  YV   GA+   CC+ +K 
Sbjct  3    GTIKSML-VVLIAVVSIMSVVPEGEAAIGCGTVVSKLSPCIPYVTGKGAL-GGCCKGIKG  60

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +  K+  DRQS C C+K   A  +   L +A  LP  C V  P+KI P  DCS V
Sbjct  61   LYDLAKSTGDRQSVCNCLKFLAASTSGVNLGKAAALPGQCGVSIPYKISPSTDCSKV  117



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T+L L+  +  AV    A   ++C  + + ++PC  YV+SGGAVP ACC  ++T+    
Sbjct  6    VTNLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLA  62

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K+     +      A GLP  C V  P+KI    +C+ V
Sbjct  63   RTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  +   ++PC  Y++  GA  VP  CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V + +AEA +SC  + + ++PC  Y+  GGAVP ACC  +K + N  KT  DRQ+AC C+
Sbjct  4    VAAHYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_007033549.1| Lipid transfer protein 3, putative [Theobroma cacao]
 gb|EOY04475.1| Lipid transfer protein 3, putative [Theobroma cacao]
Length=115

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = -3

Query  472  LTSLLLLC--IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            + SL L+C  ++   V+ P A + +SCA++   +S C  Y+++GG++P+ CC  LK++  
Sbjct  1    MASLKLVCALVLCMLVVEPMATSAISCANVAGMLSSCIKYLRNGGSLPSNCCAGLKSLNT  60

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              + K  RQ+ C+C+++     T  +    +GLP  C V  P+KI    +C+ V
Sbjct  61   QARNKGIRQAVCRCLQNAAKTITGLKTNLVEGLPRRCGVKIPYKISTSTNCNRV  114



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V + +AEA +SC  + + ++PC  Y+  GGAVP ACC  +K + N  KT  DRQ+AC C+
Sbjct  4    VAATYAEA-LSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + + ++PC  Y+   GA  VP++CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>ref|XP_002879751.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56010.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  L+L C+I    ++  + A +SC  + + ++PC  YV  GG +PA CC  ++ + N 
Sbjct  6    KLACLVLACMIVAGPIT--SNAALSCGSVNSNLAPCIGYVLQGGTIPAGCCSGVRNLNNI  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLK--RAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ AC CI+ G A+A    L   RA G+P  C V  P+KI    +C  V
Sbjct  64   AKTTPDRQQACNCIQ-GAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_010451927.1| PREDICTED: non-specific lipid-transfer protein 10 [Camelina sativa]
Length=116

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = -3

Query  436  AVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQC  257
            ++LS  +EA VSC  +   + PCA YV  GG +P +CC  ++ +    K+  DRQ  C+C
Sbjct  14   SILSRGSEAAVSCNAVVANLYPCAVYVAQGGTIPGSCCTGIRMLNGQAKSASDRQGVCRC  73

Query  256  IKD--GVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            IK   G    + + LK A  LP+ C V  P+KI P  +C+++
Sbjct  74   IKSALGGVSYSSKNLKNAATLPAKCGVKLPYKIDPSTNCNSI  115



>gb|AFR43294.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKSGGAVPA--ACCQAL  314
            + +  SL L C++   +L  +P A+  +SC  + + + PC  YV+   A PA   CC+ +
Sbjct  1    MARSMSLKLSCVVVLCLLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGI  60

Query  313  KTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +++ +  + +LDRQ+AC+CIK   A  +      A GLP  C V  P+KI P +DC  V
Sbjct  61   RSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRV  119



>ref|XP_010043259.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010043269.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Eucalyptus grandis]
Length=124

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 61/120 (51%), Gaps = 4/120 (3%)
 Frame = -3

Query  487  GNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKT  308
            G LK     + +  +  A + P      SC  + N++ PCA YV +GG VP ACC  +++
Sbjct  5    GLLKTAALAVAIVYMVVANVPPATPQMSSCNQVVNRLMPCASYVVNGGGVPPACCSGIQS  64

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPE---QLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +  KT  DRQ  C C+K  V    P     +  A GLP+ C V  P+KI P  DC +V
Sbjct  65   LNSTAKTTADRQGVCNCLKS-VLNGIPSNAYNISLATGLPATCGVDIPYKISPSTDCKSV  123



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 1/115 (1%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            +  L  L+   +I  AV++P AEA + C  + ++M+PC  YV   G +   CC  +K ++
Sbjct  1    MAALIKLMCTMLIVAAVVAPLAEAAIGCNTVASKMAPCLPYVTGKGPL-GGCCGGVKGLI  59

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +  +T  DRQ+ C C+K      +   L  A GLP  C V  P++I P+ DCS V
Sbjct  60   DAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKV  114



>gb|ABH03042.1| non-specific lipid transfer protein [Solanum sogarandinum]
Length=114

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + ++   +LLC++   V++P AEA ++C  + + ++PC  Y+ + G +   CC  +K+++
Sbjct  4    VSKIACFVLLCMV---VVAPHAEA-LTCGQVTSSLAPCFPYLMNRGPL-GGCCGGVKSLL  58

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               +T  DRQ+AC C+K   +  T   L +A GLPS C V  P+KI P  DCS V
Sbjct  59   GQAQTTADRQTACTCLKSAASSFTGLDLGKAAGLPSACSVNIPYKISPSTDCSKV  113



>gb|AEN70917.1| lipid transfer protein [Gossypium schwendimanii]
Length=120

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            ++  +L+LC++   V +P A+  V+C  +   ++PC  Y+   GA  VP  CC  +K++ 
Sbjct  8    KIACVLVLCMV---VGAPLAQGAVTCGQVTTSLAPCIGYLTGNGAGTVPQGCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YVK GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSNLAPCIPYVKGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P++I P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++   ++LC++   V +P AEA ++C  + + ++PC  Y+++ G +   CC  +K +VN+
Sbjct  6    KIACFVVLCMV---VAAPCAEA-ITCGQVTSNLAPCLAYLRNTGPL-GRCCGGVKALVNS  60

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ AC C+K      +   L +A GLPS C V  P+KI P  DCS V
Sbjct  61   ARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKV  113



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P+KI P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            +L LC++  ++ +  +EA VSC  +   + PC  YV  GG +P +CC  +K +    K+ 
Sbjct  5    VLPLCLLLASMFARGSEAAVSCNAVQADLYPCLAYVVQGGNIPQSCCTGIKMLKQQAKSA  64

Query  283  LDRQSACQCIKDGVAKATPEQ--LKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DRQ+ C+CIK  V + +     LK A  LP  C V  P+KI P  +C+++
Sbjct  65   SDRQAVCRCIKSAVGRVSYSSTYLKNAATLPGKCGVKLPYKIDPSTNCNSI  115



>ref|NP_187489.1| lipid-transfer protein 6 [Arabidopsis thaliana]
 sp|Q9LDB4.1|NLTP6_ARATH RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP 
6; AltName: Full=Xylogen-like protein 15; Short=AtXYP15; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51363.1|AC012562_24 putative nonspecific lipid-transfer protein; 75707-75272 [Arabidopsis 
thaliana]
 gb|AAF76932.1| lipid transfer protein 6 [Arabidopsis thaliana]
 gb|AAL24433.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM10179.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM63704.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 dbj|BAE73271.1| xylogen like protein 15 [Arabidopsis thaliana]
 gb|AEE74676.1| lipid-transfer protein 6 [Arabidopsis thaliana]
Length=113

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  +   + PC  YV  GG VP  CC  L T+ +  +T +DRQ  C+CIK  + 
Sbjct  17   GEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIG  76

Query  238  KAT--PEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              T  P  ++ A  LPS C V  P+K  P  DC ++
Sbjct  77   GLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSI  112



>ref|XP_010486423.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC+    ++ PC  YV  GGAVP +CC  +K + +  +T  DRQS C+CIK  + 
Sbjct  17   GEAAVSCSTTVAELYPCVSYVVQGGAVPESCCNGIKALNSQAQTAADRQSVCRCIKSAIG  76

Query  238  KA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                T   L  A  LPS C +  P+K  P  +C ++
Sbjct  77   GVSYTSNNLNNALSLPSKCGLSLPYKFSPSTNCDSI  112



>gb|KHN43734.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=155

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 5/100 (5%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGA-VPAACCQALKTMVNNLKTKLDRQSACQCIKD  248
            P A+ +VSC  + + ++PC  YV  GGA VPA CC  ++ +    +TK DRQ+ C CIK+
Sbjct  25   PMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQTKPDRQAVCNCIKN  84

Query  247  GVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
             V  +    +   L  A  LP  C V  P++I PD DC++
Sbjct  85   AVRNSGFTYSHFNLNLAANLPKNCGVNIPYQISPDTDCTS  124



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +  AV    A   ++C  + + ++PC  YV+SGGAVP ACC  ++T+    
Sbjct  6    VTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLA  62

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K+     +      A GLP  C V  P+KI    +C+ V
Sbjct  63   RTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AFR43295.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 4/119 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVL--SPWAEAQVSCADIYNQMSPCADYVKSGGAVPA--ACCQAL  314
            + +  SL L C++    L  +P A+  +SC  + + + PC  YV+   A PA   CC+ +
Sbjct  1    MARSMSLKLACVVVLCSLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGI  60

Query  313  KTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +++ +  + +LDRQ+AC+CIK   A  +      A GLP  C V  P+KI P +DC  V
Sbjct  61   RSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRV  119



>gb|KDO64078.1| hypothetical protein CISIN_1g033544mg [Citrus sinensis]
Length=117

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (53%), Gaps = 5/117 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKS--GGAVPAACCQALKT  308
            LK   ++LL+C++  A   P A+A V+C  + + +  C  YV    GGAVP ACC  +K+
Sbjct  3    LKLACAVLLMCMVMGA---PIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKS  59

Query  307  MVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +   T  DRQS C C+K          L  A  LP  C V  P++I P VDCS V
Sbjct  60   LNSAATTTPDRQSVCNCLKTAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDCSRV  116



>gb|ACU24604.1| unknown [Glycine max]
Length=130

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGA-VPAACCQALKTMVNNLKTKLDRQSACQCIKD  248
            P A+ +VSC  + + ++PC  YV  GGA VPA CC  ++ +    +TK DRQ+ C CIK+
Sbjct  29   PMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQTKPDRQAVCNCIKN  88

Query  247  GVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             V  +    +      A  LP  C V  P++I PD DC+ V
Sbjct  89   AVRNSGFTYSHFNFNLAANLPKNCGVNIPYQISPDTDCTRV  129



>ref|XP_006407744.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49197.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=129

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  + +++ PC  YV  GG VPA+CC  ++T+    +T  DRQS C+CIK+ + 
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  238  KA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAVPKE  128
                +   L  A  LP+ C V  P++I P  +C    K 
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDRYVKN  115



>gb|ACE07188.1| Art v 3.0301 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 0/113 (0%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++  +  + ++   V + +AE+ ++C+D+  ++SPC  Y+K GG VPA CC  +K + + 
Sbjct  4    KMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+AC C+K         +   A  LPS C +  P+K+  + DC+ V
Sbjct  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            ++L+ +++   + P  EA + C  + + ++ C  YV   GA+   CC+ +K +    +T 
Sbjct  10   VVLIAVVSIMSVVPEGEAAIGCGTVVSYLNSCFPYVTGTGAL-GGCCKGIKDLYAAAQTT  68

Query  283  LDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DRQS C C+KD  A  T   L +A GLPS C +  P+KI P  DCS V
Sbjct  69   ADRQSVCDCLKDLAASTTGVDLGKAAGLPSQCGLNIPYKIIPSTDCSKV  117



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWA-EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            +L  ++L C++  A   P+A E  +SC  + ++M+PC  Y+ +GG +PA CC  +K+++ 
Sbjct  6    KLACVVLACMVAVA---PYAAEGAISCGMVTSKMAPCLGYL-TGGTLPATCCAGVKSLLA  61

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            + +T  DRQ+AC C+K             A  LPS C V  P+KI P  DC+ V
Sbjct  62   SAQTTPDRQAACSCLKSASGGIAGLNYGNAASLPSKCGVNIPYKISPSTDCTKV  115



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P++I P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            Q    L++  +  A+    AEA ++C  + N+++PCA Y+++GG   A CC  ++ +   
Sbjct  7    QKVVFLVMLSMAAALSFGGAEAALTCGQVVNKLTPCASYIQNGGTPAANCCGGIRALYGM  66

Query  295  LKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQS C C+K  +A    T  +   A GLP  C V  P+KI P  DC ++
Sbjct  67   AQTTPDRQSVCNCLKQAIAGIPYTGAKAGLAAGLPGKCGVNIPYKINPSTDCKSI  121



>gb|ADR66945.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=119

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQ-VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +T L L+  +   V  P A+AQ ++C  + + ++PC +YVKSGGAVP ACC  ++T+   
Sbjct  6    MTKLALVVALCMVVSVPIAQAQAITCGQVVSTLAPCINYVKSGGAVPPACCNGIRTLNGL  65

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DRQ+AC  +K             A  LP  C V  P+KI    +C+AV
Sbjct  66   AKTTADRQAACNRLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISISTNCAAV  118



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            L L+ +I   V  P A+A ++C  + + ++PC +YVKSGGAVPAACC+ +  + +  KT 
Sbjct  8    LALVALICIVVAVPVAQAAITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTT  67

Query  283  LDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             DRQ  C C+K             A GLP  C V  P+KI    +C+ V
Sbjct  68   ADRQQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV  116



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRDVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P+KI P  +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEA----QVSCADIYNQMSPCADYVKSGGAVPA  332
            MA  G +K   +  ++ I   AV+S  A A    ++SC  + + ++PC +YV +GG VP 
Sbjct  1    MARSGMIK---ATFIVLIAVAAVVSTEAAAPPPPKISCGKVTSTLAPCFEYVLNGGKVPN  57

Query  331  ACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDV  152
            +CC  +K++     T  DR+  C C+K   + A+P  +  A+ LP  C V  P++I P +
Sbjct  58   SCCDGVKSLYKEASTTADRREVCVCLKSVTSSASPGVINNAKSLPGKCGVSIPYEITPAI  117

Query  151  DCSAV  137
            DC+ V
Sbjct  118  DCNKV  122



>gb|AFK37572.1| unknown [Medicago truncatula]
 gb|AES87490.2| Lipid transfer protein [Medicago truncatula]
Length=126

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 10/120 (8%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQV-SCADIYNQMSPCADYVKSGG-AVPAA-CCQALKTM  305
            +L  L ++C++TF    P AEA V SC  +   + PC  Y+ +GG  VPAA CC  ++ +
Sbjct  9    RLVCLAIVCLVTFG---PKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNL  65

Query  304  VNNLKTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +T  DR++ C CIK+ V+++    T   L  A GLP  C V  P++I P+ DC++V
Sbjct  66   NTMAQTTNDRRAVCTCIKNAVSQSGFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  125



>ref|XP_003605293.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=121

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 10/120 (8%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQV-SCADIYNQMSPCADYVKSGG-AVPAA-CCQALKTM  305
            +L  L ++C++TF    P AEA V SC  +   + PC  Y+ +GG  VPAA CC  ++ +
Sbjct  4    RLVCLAIVCLVTFG---PKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNL  60

Query  304  VNNLKTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +T  DR++ C CIK+ V+++    T   L  A GLP  C V  P++I P+ DC++V
Sbjct  61   NTMAQTTNDRRAVCTCIKNAVSQSGFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  120



>ref|XP_010253092.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=114

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -3

Query  415  EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAK  236
            +A +SC  + +Q++PC  Y+  GGAV   CC+ ++ +  + +T  DR++AC CIK   A 
Sbjct  21   DAGISCGQVTSQLAPCITYLVRGGAVSPLCCRGVRGLSASARTTRDRRTACGCIKSASAG  80

Query  235  ATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +L  A  LP  C+V  P+KI P  DCS V
Sbjct  81   IRGLKLALAASLPGRCRVRIPYKISPSTDCSRV  113



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSG-GAVPAACCQALKTMVN  299
            +L  +L++C++  A   P AEA ++C  + + +S C  Y++ G  A P ACC  ++++  
Sbjct  8    KLACVLVMCMVVGA---PLAEAAITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLNA  64

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              KT  DRQ AC+C+K          L  A GLP  C V  P+KI P VDCS
Sbjct  65   AAKTTADRQQACKCLKSASNSIPGIDLNLAAGLPGKCGVSIPYKISPSVDCS  116



>ref|XP_006842466.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
 gb|ERN04141.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
Length=114

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -3

Query  415  EAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAK  236
            +  VSC  +++ + PC  Y++ GG VP ACC  +K++    KT  DR++ C C+K  VA 
Sbjct  21   DGAVSCNSVFSYLGPCVPYLRGGGKVPTACCGGIKSVNGMAKTTPDRRAVCGCLKQAVAG  80

Query  235  ATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +      AQGLP  C V  P+ + P  DCS +
Sbjct  81   ISGINYSLAQGLPKACGVSIPYTLSPSTDCSKI  113



>ref|XP_007206161.1| hypothetical protein PRUPE_ppa013565mg [Prunus persica]
 gb|EMJ07360.1| hypothetical protein PRUPE_ppa013565mg [Prunus persica]
Length=116

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 7/115 (6%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            +K    +LL+C++        A+A + C+ +   + PC  Y+K+GGAVP  CC  +++++
Sbjct  8    MKVAVLMLLMCMV-------MAQAVIPCSRVSQYVGPCISYLKTGGAVPVPCCNGIRSLI  60

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                T  DRQ  C+C+       T  + +   GLP  C V  P+ IGP+VDC+ +
Sbjct  61   GLAGTTPDRQGVCRCLVATAKSITGIKGELVSGLPRACNVRLPYPIGPNVDCNRI  115



>gb|ACQ42222.1| lipid transfer protein 1 [Chimonanthus praecox]
Length=116

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDG  245
            P  EA ++C  + + +SPC  Y++SGGA+ + CC  ++++ N  K+  DRQ+AC C+K  
Sbjct  21   PHVEA-ITCGQVASALSPCITYLRSGGALQSNCCAGVRSLNNAAKSTTDRQTACGCLKSA  79

Query  244  VAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +  +  Q   A  LPS C V  P+K  P  DCS V
Sbjct  80   ASSISGIQYGLAGSLPSKCGVSIPYKTSPSTDCSKV  115



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + ++PC  YV+SGGAVP ACC  ++T+    +T  DRQ+AC C+K+     + 
Sbjct  25   ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG  84

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A GLP  C V  P+KI    +C+ V
Sbjct  85   VNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|ACE07186.1| Art v 3.0201 allergen precursor [Artemisia vulgaris]
Length=114

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -3

Query  448  IITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQS  269
            ++   V S +AEA + C+D+ N++S C  Y+K GG VPA CC  +K + +  KT  DRQ+
Sbjct  11   VVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQT  69

Query  268  ACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            AC C+K         +   A  LPS C V  P+KI  + DC+ V
Sbjct  70   ACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV  113



>ref|NP_001189842.1| lipid-transfer protein 6 [Arabidopsis thaliana]
 gb|AEE74677.1| lipid-transfer protein 6 [Arabidopsis thaliana]
Length=117

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  +   + PC  YV  GG VP  CC  L T+ +  +T +DRQ  C+CIK  + 
Sbjct  17   GEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIG  76

Query  238  KAT--PEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
              T  P  ++ A  LPS C V  P+K  P  DC +
Sbjct  77   GLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDS  111



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V + +AEA +SC  + + ++PC  Y+  GGAVP ACC  +K++ +  KT  DRQ+AC C+
Sbjct  4    VAANYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>emb|CDY33268.1| BnaA01g19350D [Brassica napus]
Length=146

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 74/130 (57%), Gaps = 8/130 (6%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L++LL++C++   V +P AEA +SC  + + +  C +Y+  GG VP  CC  ++ + + 
Sbjct  6    KLSTLLIVCML---VSAPMAEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLHSM  62

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLK--RAQGLPSYCKVPFPFKIGPDVDCSAVPKEYN  122
             +T  DRQ AC+CI+ G A+A   +L   RA  LP  C+V   + I    +C+ +   + 
Sbjct  63   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRISYPISARTNCNKIGVFHF  121

Query  121  *TYI*YRPEK  92
              YI  RP+K
Sbjct  122  FLYI--RPKK  129



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query  433  VLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCI  254
            V + +AEA +SC  + + ++PC  Y+  GGAVP ACC  +K++ +  KT  DRQ+AC C+
Sbjct  4    VAANYAEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCL  62

Query  253  KDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K      +      A  LP  C V  P+KI P  DCS V
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + ++PC  YV+SGGAVP ACC  ++T+    +T  DRQ+AC C+K+     + 
Sbjct  1    ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG  60

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A GLP  C V  P+KI    +C+ V
Sbjct  61   VNPNNAAGLPGKCGVNVPYKISTSTNCATV  90



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 65/127 (51%), Gaps = 3/127 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G L +L  L+ + +   AV  P A A VSC  + N ++PC  YV + G +  +CC 
Sbjct  1    MASSGQLLKLVCLVAV-MCCMAVGVPKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCT  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
             +K++ +  +T  DRQS C C+K  V     T      A GLP  C V  P+KI P  DC
Sbjct  60   GVKSLYSMAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDC  119

Query  145  SAVPKEY  125
             A  + +
Sbjct  120  KASSERF  126



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +  AV    A   ++C  + + ++PC  YV++GGAVP ACC  ++T+ +  
Sbjct  6    VTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRNGGAVPPACCNGIRTINSLA  62

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K+     +      A GLP  C V  P+KI    +C+ V
Sbjct  63   RTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = -3

Query  421  WAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGV  242
            +AEA ++C+D+  ++SPC +Y+K GG VPA CC  +K + +  KT  DRQ+AC C+K   
Sbjct  22   YAEAALTCSDVSTKISPCLNYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASF  81

Query  241  AKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                  +   A  LPS C +  P+K+  + DC+ V
Sbjct  82   KSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 7/126 (6%)
 Frame = -3

Query  514  ITRYIMAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVP  335
            + R IMA   ++K    LL++CII    ++P AEA ++C  +   ++PC  Y+K G    
Sbjct  53   LQRNIMA---SMKVACVLLMMCII----VAPMAEAAITCGTVTGSLAPCIGYLKGGSGPS  105

Query  334  AACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPD  155
            AACC  +K + +   T  DRQ+AC C+K      +      A GLP  C V  P+KI   
Sbjct  106  AACCGGVKRLNSAATTTPDRQAACNCLKSAAGAISGLNPNIAAGLPGKCGVNIPYKISTS  165

Query  154  VDCSAV  137
             +C+ +
Sbjct  166  TNCATI  171



>ref|XP_008792224.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C+D+Y  + PC +YV++GGAV   CC  +++++   +T  DR++AC+C+K   AK + 
Sbjct  29   MTCSDVYGDLLPCVEYVQAGGAVAPECCSGVRSLLAAARTADDRRTACRCLKTVAAKFS-  87

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              + RA  +P  C V  PFK+ P +DCS +
Sbjct  88   GYVSRANSIPGKCGVSIPFKLSPSMDCSKI  117



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 4/121 (3%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G   +L  ++ LC++   V  P A+A ++C  +++ ++PC  YV+ GGAVP ACC 
Sbjct  1    MANSGAPMKLALVVALCMV---VSVPIAQA-ITCGQLFSNLAPCIPYVRGGGAVPPACCN  56

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSA  140
             ++ + N  KT  DRQ+AC C+K   A         A  LP  C V  P+KI    +C  
Sbjct  57   GIRNVNNLAKTTPDRQAACNCLKQLSASIPGVNPNNAAALPGKCGVSIPYKISASTNCKT  116

Query  139  V  137
            V
Sbjct  117  V  117



>gb|AEN70933.1| lipid transfer protein [Gossypium davidsonii]
 gb|AEN70934.1| lipid transfer protein [Gossypium klotzschianum]
Length=120

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            +L  +++LC++  A   P A+  V+C  + + ++PC  Y+   GA  VP  CC  +K++ 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTSSLAPCIAYLTGNGAGVVPPRCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASMSGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>gb|KHL91133.1| hypothetical protein QW71_36410 [Paenibacillus sp. IHB B 3415]
Length=115

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++  L +LC++   V++P+AEA V+C  +   ++ C  Y++ GGAVP  CC  ++ M + 
Sbjct  5    KIACLAVLCMVV--VVAPYAEA-VTCGQVQGNLAQCLGYLRKGGAVPGPCCNGVRAMNSA  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             KT  DR+  C C++      T    + A  LP  C V  P+KI P  DCS V
Sbjct  62   AKTSADRKQTCVCLQQASKSITGINPEAAASLPGKCGVNVPYKISPSTDCSKV  114



>gb|AEI70826.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=118

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -3

Query  466  SLLLLCIIT--FAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            ++++LC +     V +P+AEA +SC  + + ++PC  Y+  GG VP ACC  +K++ +  
Sbjct  5    AMMVLCAVVTCMVVAAPYAEA-LSCGQVSSSLAPCIGYLTKGGVVPPACCSGVKSLNSAA  63

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPD--VDCSAV  137
            KT  DRQ+AC C+K   +  +      A  LP  C V  P+KI P    DCS V
Sbjct  64   KTTPDRQAACGCLKSAYSSISGINSGNAASLPGKCGVNIPYKISPGTRTDCSKV  117



>ref|XP_009146980.1| PREDICTED: non-specific lipid-transfer protein 6 [Brassica rapa]
Length=113

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  +   + PC  YV  GG VPA CC  ++T+ +  +T +DRQ  C+CIK+ + 
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  238  KA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +   +  AQ LP+ C V  P+ I P  +C ++
Sbjct  77   GVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNCDSI  112



>sp|Q39794.1|NLTP_GERHY RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gerbera hybrid cultivar]
 emb|CAA83459.1| lipid transfer protein [Gerbera hybrid cultivar]
Length=116

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = -3

Query  457  LLCI-ITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKL  281
            +LC+ +   V S      +SC  + + + PC  Y+ +GG VP ACC  ++ + N  KT  
Sbjct  8    VLCVAVACMVFSASYADAISCGQVTSGLVPCFGYLAAGGPVPPACCNGVRGLNNAAKTTP  67

Query  280  DRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            DRQ+AC C+K  +A  T   L  A  LP  C +   +KI P++DCS +
Sbjct  68   DRQTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI  115



>ref|XP_002884695.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60954.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = -3

Query  421  WAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGV  242
            + EA VSC  +   + PC  YV  GG VP+ CC  L T+ +  +T  DRQ  C+CIK  +
Sbjct  16   FGEAAVSCNTVIADLYPCLSYVTQGGPVPSLCCNGLTTLNSQAQTSADRQGVCRCIKSAI  75

Query  241  AKAT--PEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               T  P  +  A  LPS C +  P+K  P  +C ++
Sbjct  76   GGLTLSPGTIDNALSLPSKCGINLPYKFSPSTNCESI  112



>ref|NP_001235162.1| uncharacterized protein LOC100499726 precursor [Glycine max]
 gb|ACU13384.1| unknown [Glycine max]
Length=122

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  469  TSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA-VPAACCQALKTMVNNL  293
            T +  +  +    L P A+ +++C  + + ++PC  YV  GG  VP  CC  ++ +    
Sbjct  6    TRIFFIMSLVCLALGPMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGIRNLYGMA  65

Query  292  KTKLDRQSACQCIKDGVAKA----TPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +TK DRQ+ C CIK+GV  +    +   L  A  LP  C V  P++I P+ DC+ V
Sbjct  66   QTKPDRQAVCNCIKNGVRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDCTRV  121



>ref|XP_006362359.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=115

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + ++   + LC++   V++P AEA +SC+ + + ++PC  Y++  G +   CC  +K++V
Sbjct  4    VSKIVCFVFLCMV---VVAPHAEA-MSCSQVSSSLAPCVPYLQGRGPL-GGCCGGVKSLV  58

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
              +KT  DR++AC CIK            RA GLPS C V  P+ I P VDCS
Sbjct  59   GAIKTPADRRTACTCIKSVANAVKGLDTGRAAGLPSTCGVNIPYDISPSVDCS  111



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C  + + +S C +Y++ GGAVP  CC  +K++ +  KT  DRQ+AC+C+K   +  + 
Sbjct  29   ITCGQVASSLSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISG  88

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A GLP  C V  P+KI P  DCS V
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|KFK36763.1| lipid transfer protein [Arabis alpina]
Length=119

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 61/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L  L+L C+I    ++  + A + C  + N ++PC  Y+  GGA+ + CC  ++ + N 
Sbjct  6    KLACLVLTCMIVAGPIT--SNAALGCGQVNNAVAPCIGYILQGGAITSGCCNGVRGLNNA  63

Query  295  LKTKLDRQSACQCIKDGVAKATPE-QLKRAQGLPSYCKVPFPFKIGPDVDCS  143
             +T  DR++ACQC+K+  A   P     RA GLP  C V  PF I    +C+
Sbjct  64   ARTTPDRKAACQCLKNAAAALGPGLNAGRAAGLPRACGVSVPFPISTSTNCN  115



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            ++   ++LC++   V +P AEA ++C  + + ++PC  Y+++ G +   CC  +K ++N 
Sbjct  6    KIACFVVLCML---VAAPHAEA-LTCGQVTSNLAPCLPYLRNKGPL-GRCCSGVKGLLNA  60

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ+AC C+K      +   L++A GLPS C V  P+ I P  DCS V
Sbjct  61   ARTTQDRQTACTCLKSAAGAISGINLRKAAGLPSTCGVNIPYNISPSTDCSKV  113



>ref|XP_006429567.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 ref|XP_006481182.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42807.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=115

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L S L+LC++   V  P +   ++C  +   ++PC  Y++SGG +P  CC  ++++   
Sbjct  5    KLVSALVLCML---VTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAA  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ+AC C+K             A GLP  C V  P+KI    DCS V
Sbjct  62   ARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV  114



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNN  296
            +L   L+ C++   V +P  EA ++C  + + +SPC  Y+++GG+ P ACC  ++ + N 
Sbjct  5    KLVCALVACML---VAAPLTEAAIACGTVVSALSPCIGYLRAGGSPPLACCNGVRALNNA  61

Query  295  LKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             +T  DRQ AC+C+++            A  LP  C V  P+KI    +CS V
Sbjct  62   ARTTPDRQEACRCLQNAARSMGGLNEANAGSLPGKCGVNIPYKISTSTNCSTV  114



>emb|CDY27974.1| BnaC05g43760D [Brassica napus]
Length=111

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = -3

Query  418  AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVA  239
             EA VSC  +   + PC  YV  GG VPA CC  ++T+ +  +T +DRQ  C+CIK+ + 
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  238  KA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
                +   L  AQ LP+ C V  P+ I P  +C
Sbjct  77   GVSFSSNNLNNAQSLPAKCGVNLPYSISPSTNC  109



>ref|NP_001234074.1| non-specific lipid-transfer protein 1 precursor [Solanum lycopersicum]
 sp|P27056.1|NLTP1_SOLLC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA39512.1| TSW12 [Solanum lycopersicum]
Length=114

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + ++   +LLC++   V++P AEA ++C  +   ++PC  Y++  G +   CC  +K ++
Sbjct  4    VSKIACFVLLCMV---VVAPHAEA-LTCGQVTAGLAPCLPYLQGRGPL-GGCCGGVKNLL  58

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             + KT  DR++AC C+K          L +A G+PS CKV  P+KI P  DCS V
Sbjct  59   GSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTV  113



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSSLAPCIAYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P+KI    +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = -3

Query  424  PWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDG  245
            P+    ++C  + + ++PC  Y +SGG VPA CC  +K +V   +T  DR++AC C+K+ 
Sbjct  22   PYTAHAITCGQVVSYLTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKNT  81

Query  244  VAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             A  +  +     G+P  C V  P+ I P  DCS V
Sbjct  82   AAGLSGLKPGLISGIPGKCGVRVPYAISPSTDCSRV  117



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTKLDRQSACQCIKDGVAKATP  227
            ++C+ +   ++PC +YV+SGGAVP ACC  +KT+    KT  DRQ+AC C+K+     + 
Sbjct  25   ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG  84

Query  226  EQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                 A+ LP  C V  P+KI    +C+ V
Sbjct  85   VNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>sp|O24038.1|NLTP2_SOLPN RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; AltName: Full=LpLTP2; Flags: Precursor [Solanum pennellii]
 gb|AAB07487.1| lipid transfer protein 2 [Solanum pennellii]
Length=114

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMV  302
            + ++   +LLC++   V++P AEA ++C  + + ++PC  Y+ + G +   CC  +K ++
Sbjct  4    VNKIACFVLLCMV---VVAPHAEA-LTCGQVTSTLAPCLPYLMNRGPL-GGCCGGVKGLL  58

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
               +T +DRQ+AC C+K   +  T   L +A  LPS C V  P+KI P  DCS V
Sbjct  59   GQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKV  113



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + N ++PC  YV  GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSNSVAPCIPYVIGGGAVPPACCNGIRNVENLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            KT  DRQ+AC C+K             A  LP  C V  P+KI    +C+AV
Sbjct  65   KTTADRQAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISISTNCAAV  116



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  472  LTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNL  293
            +T L L+  +   V  P A+A ++C  + + ++PC  YV+ GGAVP ACC  ++ + N  
Sbjct  6    MTKLALVVALCMVVSVPIAQA-ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLA  64

Query  292  KTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            +T  DRQ+AC C+K   A         A  LP  C V  P+KI    +C+ V
Sbjct  65   RTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_008388345.1| PREDICTED: non-specific lipid-transfer protein 1-like [Malus 
domestica]
Length=119

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVS-CADIYNQMSPCADYVKSGGAVPAACCQALKTMVN  299
            +L  + L+CI+   V +P+A+A +S C  + N ++PC  Y+K+GG VP  CCQ ++ + +
Sbjct  8    KLAFVALVCIV---VGAPFAQATISSCGQVTNYVAPCIPYLKTGGKVPPTCCQGIQKLND  64

Query  298  NLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
              +T  DR++AC C+ +   K    +     GLP  C V  P+ IGP+  C+++
Sbjct  65   AAQTAPDRRTACTCLVNTATKVQGIKPNLIYGLPGACGVRLPYPIGPNTKCNSI  118



>gb|AGH32496.1| non-specific lipid transfer protein [Papaver somniferum]
Length=117

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = -3

Query  481  LKQLTSLLLLCIITFAVLSPW-AEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTM  305
            L +L  ++L C++   V+ P+ AE  +SC  + +++SPC  Y+   G++PA CC  +K++
Sbjct  4    LFKLACVVLACMV---VIVPFVAEGAISCGTVVSKLSPCVGYLTGLGSLPANCCTGVKSL  60

Query  304  VNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                +T  DRQ+ C C+K+     T  ++  A  LP  C V  P+     +DCS V
Sbjct  61   YQAAQTTSDRQTVCGCLKNAAKSMTNIKMSNAASLPGKCGVSIPYTFSTSIDCSKV  116



>ref|NP_195807.1| pathogenesis-related lipid transfer protein  [Arabidopsis thaliana]
 sp|Q9LZV9.1|NLTPA_ARATH RecName: Full=Non-specific lipid-transfer protein 10; Short=LTP 
10; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82757.1| lipid-transfer protein-like [Arabidopsis thaliana]
 gb|AAO44017.1| At5g01870 [Arabidopsis thaliana]
 dbj|BAE99954.1| lipid-transfer protein-like [Arabidopsis thaliana]
 gb|AED90403.1| pathogenesis-related lipid transfer protein [Arabidopsis thaliana]
Length=116

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -3

Query  463  LLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQALKTMVNNLKTK  284
            +L LC++  ++ +  +EA +SC  +   + PC  YV  GGA+P +CC  ++ +     + 
Sbjct  5    VLPLCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGAIPYSCCNGIRMLSKQATSA  64

Query  283  LDRQSACQCIKDGVAKATPEQ--LKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
             D+Q  C+CIK  V + +     LK+A  LP  C V  P+KI P  +C+++
Sbjct  65   SDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSI  115



>gb|AEN70915.1| lipid transfer protein [Gossypium thurberi]
 gb|AEN70938.1| lipid transfer protein [Gossypium trilobum]
Length=120

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = -3

Query  475  QLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGA--VPAACCQALKTMV  302
            +L  +++LC++   V +P A+  V+C  + + ++PC  Y+   GA  VP  CC  +K++ 
Sbjct  8    KLACVVVLCMV---VGAPLAQGAVTCGQVTSSLAPCFAYLTGNGAGSVPPRCCGGIKSLN  64

Query  301  NNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCS  143
            +  +T  DRQ+AC+CIK   A  +      A GLP  C V  P+KI P  DC+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = -3

Query  499  MAVVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQ  320
            MA  G L +L  L+ + +   AV  P A A VSC  + N ++PC  YV + G +  +CC 
Sbjct  1    MASSGQLLKLVCLVAV-MCCMAVGVPKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCT  59

Query  319  ALKTMVNNLKTKLDRQSACQCIKDGVAKA--TPEQLKRAQGLPSYCKVPFPFKIGPDVDC  146
             +K++ +  +T  DRQS C C+K  V     T      A GLP  C V  P+KI P  DC
Sbjct  60   GVKSLYSMAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDC  119

Query  145  SAV  137
             ++
Sbjct  120  KSI  122



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 2/119 (2%)
 Frame = -3

Query  493  VVGNLKQLTSLLLLCIITFAVLSPWAEAQVSCADIYNQMSPCADYVKSGGAVPAACCQAL  314
            + G +K L+  L+  ++  AV +P +EA ++C  + + +  C  Y+ + G +  +CC  +
Sbjct  1    MAGIIKPLSIFLIAAVLAMAV-APRSEAAITCGTVVSDLDSCLSYLTNKGPL-GSCCSGV  58

Query  313  KTMVNNLKTKLDRQSACQCIKDGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
            K +    KT  DRQS C C+K      T   L +A GLP  C V  P+KI P  DCS V
Sbjct  59   KGLYGAAKTTQDRQSVCNCLKSLADSYTDVDLSKAAGLPGQCGVNIPYKISPSTDCSTV  117



>ref|XP_007033546.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04472.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
Length=137

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -3

Query  427  SPWAEAQVSCADIYNQMSPCADYVK-SGGAVPAACCQALKTMVNNLKTKLDRQSACQCIK  251
            +P A+  +SC  +   ++PC  Y++ SGGAVP++CC  +K + +  +T  DR++AC CIK
Sbjct  21   APLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIK  80

Query  250  DGVAKATPEQLKRAQGLPSYCKVPFPFKIGPDVDCSAV  137
                  +      A  +PS C V  P++I P++DC++ 
Sbjct  81   SAAGSISGINYALASQMPSKCGVSIPYQISPNIDCTST  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672942001784