BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21311_g2_i2 len=590 path=[3811:0-101 3913:102-412 4224:413-463
4274:464-589]

Length=590
                                                                      Score     E

ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    2e-19   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    3e-19   
ref|NP_001055844.2|  Os05g0477900                                     89.7    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  89.4    9e-19   
gb|AAT01364.1|  unknown protein                                       88.2    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    4e-18   
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    2e-17   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    5e-17   
gb|AAY84146.1|  lipid transfer protein                                83.6    6e-17   Catharanthus roseus [chatas]
gb|AAL27855.1|  lipid transfer protein precursor                      83.2    7e-17   Davidia involucrata
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
gb|ABY21307.1|  pollen allergen Pla o 3                               82.8    1e-16   Platanus orientalis
gb|AEI70829.1|  non-specific lipid-transfer protein                   82.8    1e-16   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    1e-16   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_003566138.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    2e-16   
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           82.4    2e-16   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    2e-16   
gb|ACQ42221.1|  lipid transfer protein                                81.3    4e-16   Chimonanthus praecox [wintersweet]
emb|CAL07989.1|  lipid transfer protein                               81.3    4e-16   Platanus x hispanica [London plane tree]
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    7e-16   
gb|AEI70827.1|  non-specific lipid-transfer protein                   80.5    7e-16   
dbj|BAP11219.1|  hypothetical protein                                 79.7    1e-15   
emb|CDP15101.1|  unnamed protein product                              80.1    1e-15   
gb|AEI70828.1|  non-specific lipid-transfer protein                   80.1    1e-15   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           79.7    2e-15   
gb|AEI70830.1|  non-specific lipid-transfer protein                   79.3    2e-15   
dbj|BAP11226.1|  hypothetical protein                                 79.0    2e-15   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  79.3    2e-15   
gb|AAT68263.1|  lipid transfer protein                                79.0    3e-15   Nicotiana glauca [glaucous tobacco]
ref|XP_009631015.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    3e-15   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   
dbj|BAP11220.1|  hypothetical protein                                 78.2    4e-15   
dbj|BAP11221.1|  hypothetical protein                                 78.2    4e-15   
ref|XP_009594799.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    7e-15   
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  77.8    7e-15   Leonurus japonicus [Chinese motherwort]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    7e-15   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    8e-15   Vitis vinifera
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          77.4    9e-15   Lactuca sativa [cultivated lettuce]
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    9e-15   
gb|ACP43542.1|  lipid transfer protein                                77.4    1e-14   Chimonanthus praecox [wintersweet]
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
emb|CBW38497.1|  lipid transfer protein                               76.6    1e-14   
ref|XP_002872988.1|  predicted protein                                77.0    1e-14   
gb|AAT68262.1|  lipid transfer protein                                77.0    1e-14   Nicotiana glauca [glaucous tobacco]
emb|CBW38499.1|  lipid transfer protein                               76.6    1e-14   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       77.0    2e-14   Artemisia vulgaris [common wormwood]
dbj|BAP11218.1|  hypothetical protein                                 76.6    2e-14   
emb|CDP14198.1|  unnamed protein product                              76.6    2e-14   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            76.6    2e-14   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    3e-14   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  75.9    3e-14   Helianthus annuus
gb|KHG10481.1|  Non-specific lipid-transfer 3                         76.6    3e-14   
gb|AFM35695.1|  nonspecific lipid transfer protein                    75.9    3e-14   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      75.9    4e-14   Nicotiana glauca [glaucous tobacco]
gb|AAY83345.1|  non-specific lipid transfer protein precursor         75.9    4e-14   Fragaria x ananassa
gb|AAS13435.1|  lipid-transfer protein                                75.5    4e-14   Nicotiana attenuata
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    75.5    5e-14   Nicotiana tabacum [American tobacco]
gb|ACE07187.1|  Art v 3 allergen precursor                            75.5    5e-14   Artemisia vulgaris [common wormwood]
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   75.5    5e-14   
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       75.5    6e-14   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    7e-14   
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            75.1    7e-14   Corylus avellana [European hazelnut]
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    7e-14   
emb|CBW38498.1|  lipid transfer protein                               74.3    8e-14   
gb|ACE07189.1|  Art v 3 allergen precursor                            74.7    1e-13   Artemisia vulgaris [common wormwood]
gb|AEN70936.1|  lipid transfer protein                                74.7    1e-13   
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-13   
emb|CAC86258.1|  lipid transfer protein                               74.7    1e-13   Fragaria x ananassa
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  74.3    1e-13   Ricinus communis
ref|XP_009148874.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         74.3    1e-13   Fragaria x ananassa
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    74.3    1e-13   Gossypium hirsutum [American cotton]
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
gb|AEI70826.1|  non-specific lipid-transfer protein                   74.3    1e-13   
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    1e-13   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
gb|ADV02773.1|  lipid transfer protein 1b                             73.2    2e-13   
emb|CBW38503.1|  lipid transfer protein                               73.6    2e-13   
ref|NP_001044654.1|  Os01g0822900                                     73.9    2e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CBW38504.1|  lipid transfer protein                               73.6    2e-13   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       73.6    2e-13   Solanum tuberosum [potatoes]
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
gb|KHG30577.1|  Non-specific lipid-transfer                           73.9    2e-13   
ref|XP_009146980.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       73.6    2e-13   Solanum tuberosum [potatoes]
gb|AGH13363.1|  lipid transfer protein                                73.2    2e-13   
emb|CDP12680.1|  unnamed protein product                              73.6    3e-13   
emb|CBW38501.1|  lipid transfer protein                               73.2    3e-13   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              73.2    3e-13   
gb|AFI61838.1|  harmalin                                              73.2    3e-13   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           73.2    3e-13   
gb|AEN70935.1|  lipid transfer protein                                73.2    3e-13   
gb|AEC04836.1|  lipid transfer protein                                73.2    3e-13   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  73.2    3e-13   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    4e-13   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
gb|ABU49731.1|  putative non-specific lipid transfer protein a1       72.8    4e-13   Solanum tuberosum [potatoes]
gb|AAY43800.1|  FSLTP2                                                73.2    4e-13   Gossypium hirsutum [American cotton]
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
gb|ABR08655.1|  lipid transfer protein                                72.8    4e-13   Populus alba x Populus glandulosa
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
emb|CDY33268.1|  BnaA01g19350D                                        73.6    4e-13   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    4e-13   
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           72.8    5e-13   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           73.2    5e-13   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   72.8    5e-13   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  72.8    5e-13   Lens culinaris
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    5e-13   
emb|CDP07650.1|  unnamed protein product                              72.4    5e-13   
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       72.4    6e-13   Artemisia vulgaris [common wormwood]
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    6e-13   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
ref|XP_009115846.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
emb|CDP14199.1|  unnamed protein product                              72.4    6e-13   
gb|AEN70917.1|  lipid transfer protein                                72.4    6e-13   
gb|AAT68264.1|  lipid transfer protein                                72.4    6e-13   Nicotiana glauca [glaucous tobacco]
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            72.4    6e-13   Gossypium hirsutum [American cotton]
gb|ABK96515.1|  unknown                                               72.4    6e-13   Populus trichocarpa x Populus deltoides
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           72.0    7e-13   
emb|CDY36007.1|  BnaA05g29430D                                        72.0    7e-13   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           72.0    7e-13   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   72.4    8e-13   
gb|KHG21711.1|  Non-specific lipid-transfer                           72.0    8e-13   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           72.0    8e-13   
gb|ABK94706.1|  unknown                                               72.0    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008388345.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    8e-13   
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   Vitis vinifera
emb|CBI18043.3|  unnamed protein product                              72.4    1e-12   
gb|ADY68820.1|  lipid transfer protein 3                              72.0    1e-12   
gb|AAC63372.1|  lipid transfer protein                                71.6    1e-12   Brassica oleracea
gb|AFR43276.1|  lipid transfer protein precursor                      72.0    1e-12   
ref|XP_006403900.1|  hypothetical protein EUTSA_v10010829mg           71.6    1e-12   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        71.6    1e-12   
gb|AAY43801.1|  FSLTP3                                                71.6    1e-12   Gossypium hirsutum [American cotton]
emb|CCK33472.1|  lipid transfer protein precursor                     70.9    1e-12   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
gb|AEN70918.1|  lipid transfer protein                                71.6    1e-12   
ref|XP_006407744.1|  hypothetical protein EUTSA_v10021759mg           71.6    1e-12   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  71.2    1e-12   Prunus avium [gean]
gb|ADR66943.1|  non-specific lipid transfer protein                   71.2    1e-12   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             71.2    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           71.2    2e-12   
gb|ADR66942.1|  non-specific lipid transfer protein                   71.2    2e-12   
emb|CDY16295.1|  BnaC01g23300D                                        71.2    2e-12   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
ref|XP_009778826.1|  PREDICTED: uncharacterized protein LOC104228120  72.8    2e-12   
gb|ABH03042.1|  non-specific lipid transfer protein                   71.2    2e-12   Solanum sogarandinum
ref|XP_007033549.1|  Lipid transfer protein 3, putative               71.2    2e-12   
gb|AGH32497.1|  non-specific lipid transfer protein                   71.2    2e-12   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
ref|XP_002877813.1|  hypothetical protein ARALYDRAFT_485512           71.2    2e-12   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
gb|AAT68265.1|  lipid transfer protein precursor                      70.9    2e-12   Nicotiana glauca [glaucous tobacco]
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            71.2    2e-12   Gossypium hirsutum [American cotton]
gb|KHG13955.1|  Non-specific lipid-transfer 1                         70.9    2e-12   
ref|XP_002305878.2|  lipid transfer family protein                    70.9    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
emb|CAN70512.1|  hypothetical protein VITISV_005630                   70.9    2e-12   Vitis vinifera
emb|CDY27974.1|  BnaC05g43760D                                        70.9    2e-12   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  70.9    2e-12   
gb|AGC08426.1|  lipid transfer protein                                70.9    2e-12   
ref|XP_002884695.1|  hypothetical protein ARALYDRAFT_478179           70.9    2e-12   
emb|CDX78016.1|  BnaA09g32110D                                        70.9    2e-12   
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  70.9    2e-12   Lens culinaris
gb|ACZ06858.1|  lipid transfer protein                                70.9    2e-12   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            70.9    2e-12   Gossypium hirsutum [American cotton]
emb|CBW38502.1|  lipid transfer protein                               70.5    2e-12   
ref|XP_010043259.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   70.9    2e-12   
sp|O24037.1|NLTP1_SOLPN  RecName: Full=Non-specific lipid-transfe...  70.5    2e-12   Solanum pennellii
gb|AEN70919.1|  lipid transfer protein                                70.9    3e-12   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    70.5    3e-12   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              70.5    3e-12   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|ADR66953.1|  non-specific lipid transfer protein                   70.5    3e-12   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  70.5    3e-12   Prunus dulcis [sweet almond]
ref|NP_190728.1|  pathogenesis-related protein LTP5                   70.5    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|AGW21333.1|  lipid transfer protein                                70.5    3e-12   
gb|AGH27864.1|  lipid transfer protein precursor                      70.5    3e-12   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   70.5    3e-12   
ref|NP_001236518.1|  uncharacterized protein LOC100306032 precursor   70.5    3e-12   
ref|XP_006292062.1|  hypothetical protein CARUB_v10018257mg           70.5    3e-12   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|XP_009618455.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  70.1    4e-12   Solanum pennellii
ref|XP_006842466.1|  hypothetical protein AMTR_s00077p00068900        70.1    4e-12   
gb|AGH13362.1|  lipid transfer protein                                69.7    4e-12   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               70.1    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    70.1    4e-12   
ref|XP_010503855.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
emb|CDX93316.1|  BnaC04g45800D                                        70.1    4e-12   
gb|ADR66945.1|  non-specific lipid transfer protein                   70.1    4e-12   
gb|ADR66950.1|  non-specific lipid transfer protein                   70.1    4e-12   
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           70.1    5e-12   
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
ref|XP_010451927.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|NP_001268074.1|  lipid transfer protein precursor                 70.1    5e-12   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         69.7    5e-12   Fragaria x ananassa
ref|XP_006369492.1|  hypothetical protein POPTR_0001s23940g           69.7    5e-12   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   70.1    5e-12   
ref|XP_009136622.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  69.7    5e-12   Solanum chilense
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|XP_006438990.1|  hypothetical protein CICLE_v10033098mg           69.7    5e-12   
ref|XP_007140089.1|  hypothetical protein PHAVU_008G083400g           69.7    5e-12   
ref|XP_010426733.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
dbj|BAO51648.1|  lipid transfer protein                               69.7    6e-12   
gb|KEH29195.1|  Lipid transfer protein                                70.5    6e-12   
gb|AEN70933.1|  lipid transfer protein                                69.7    6e-12   
gb|AAQ96338.1|  lipid transfer protein                                69.7    6e-12   Vitis aestivalis
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         69.7    6e-12   Retama raetam [retem]
ref|XP_006411067.1|  hypothetical protein EUTSA_v10017425mg           69.7    6e-12   
ref|XP_004249706.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    6e-12   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    7e-12   
gb|AFK45186.1|  unknown                                               69.3    7e-12   
gb|AET05731.1|  lipid transfer protein isoform b                      68.9    7e-12   
gb|AGC08428.1|  lipid transfer protein                                69.3    8e-12   
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              69.3    8e-12   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   
gb|ADR66949.1|  non-specific lipid transfer protein                   69.3    8e-12   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
gb|AGC08425.1|  lipid transfer protein                                69.3    9e-12   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  68.9    9e-12   Lens culinaris
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
sp|Q42616.1|NLTP3_BRANA  RecName: Full=Non-specific lipid-transfe...  68.9    9e-12   Brassica napus [oilseed rape]
gb|AEN70916.1|  lipid transfer protein                                69.3    9e-12   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         68.9    9e-12   Fragaria x ananassa
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  68.9    9e-12   Lens culinaris
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  68.9    9e-12   Pyrus communis
emb|CDY18379.1|  BnaA04g22080D                                        68.9    9e-12   
gb|AHG99490.1|  lipid-transfer protein                                68.9    9e-12   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  68.9    9e-12   Lens culinaris
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|EPS73763.1|  non-specific lipid-transfer protein                   68.9    1e-11   
gb|AEN70915.1|  lipid transfer protein                                68.9    1e-11   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|KDP20367.1|  hypothetical protein JCGZ_05250                       68.6    1e-11   
ref|XP_010257636.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|AAX20049.1|  putative non-specific lipid transfer protein          68.6    1e-11   Capsicum annuum
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           68.9    1e-11   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
gb|KFK34404.1|  hypothetical protein AALP_AA5G140700                  68.6    1e-11   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 68.2    1e-11   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
emb|CDO96795.1|  unnamed protein product                              68.6    1e-11   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           68.6    2e-11   
ref|NP_001275802.1|  lipid-transfer protein precursor                 68.6    2e-11   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  68.9    2e-11   
gb|ABG54494.1|  putative allergen Rub i 3                             68.2    2e-11   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|EYU42018.1|  hypothetical protein MIMGU_mgv1a016520mg              68.2    2e-11   
gb|AFR43292.1|  lipid transfer protein precursor                      68.2    2e-11   
ref|XP_010091032.1|  Non-specific lipid-transfer protein              68.9    2e-11   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 68.2    2e-11   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    68.6    2e-11   
ref|XP_007033548.1|  Non-specific lipid-transfer protein, putative    69.3    2e-11   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_006411068.1|  hypothetical protein EUTSA_v10017425mg           68.2    2e-11   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  67.4    2e-11   
emb|CDX90642.1|  BnaA03g41390D                                        68.6    2e-11   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             68.6    2e-11   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 68.6    2e-11   
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  68.2    2e-11   
gb|AET05730.1|  lipid transfer protein isoform a                      67.4    2e-11   
gb|KHL91133.1|  hypothetical protein QW71_36410                       67.8    2e-11   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 68.2    2e-11   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
sp|Q42615.1|NLTP2_BRANA  RecName: Full=Non-specific lipid-transfe...  67.8    2e-11   
gb|AES87466.2|  Lipid transfer protein                                68.6    2e-11   
gb|AAT80649.1|  lipid transfer protein precursor                      67.8    2e-11   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         67.8    2e-11   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 71.6    2e-11   
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
ref|XP_003623615.1|  Non-specific lipid-transfer protein              67.8    2e-11   
gb|AGH32496.1|  non-specific lipid transfer protein                   67.8    2e-11   
emb|CAN76145.1|  hypothetical protein VITISV_034315                   68.6    2e-11   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    67.8    2e-11   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
gb|AGH27866.1|  lipid transfer protein precursor                      67.8    3e-11   
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  67.8    3e-11   
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    3e-11   
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  67.8    3e-11   
emb|CAB96874.1|  mal d 3                                              67.0    3e-11   
gb|ACU24604.1|  unknown                                               68.2    3e-11   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  68.2    3e-11   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           67.8    3e-11   
ref|XP_010414245.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
ref|XP_010515587.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
gb|AFR43293.1|  lipid transfer protein precursor                      67.8    3e-11   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
gb|ADK60918.1|  lipid transfer protein                                67.8    3e-11   
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 67.8    3e-11   
ref|XP_010467649.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  67.4    3e-11   
gb|AAR22488.1|  allergen Mal d 3                                      67.4    3e-11   
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 67.4    3e-11   
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-11   
ref|NP_187489.1|  lipid-transfer protein 6                            67.4    4e-11   
prf||2115353B  lipid transfer protein                                 67.4    4e-11
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             67.4    4e-11   
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  66.6    4e-11   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       67.0    4e-11   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   67.0    4e-11   
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    4e-11   
gb|AAM22768.1|  lipid transfer protein                                66.6    5e-11   
emb|CDY00655.1|  BnaC03g36390D                                        67.0    5e-11   
gb|AGW21344.1|  lipid transfer protein                                67.0    5e-11   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              67.0    5e-11   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    67.0    5e-11   
gb|KHG09723.1|  Non-specific lipid-transfer                           67.0    5e-11   
gb|AFK44274.1|  unknown                                               67.0    5e-11   
gb|AFR43285.1|  lipid transfer protein precursor                      67.0    5e-11   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        67.0    5e-11   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           67.0    5e-11   
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
gb|KCW88359.1|  hypothetical protein EUGRSUZ_A00745                   67.8    5e-11   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  67.0    5e-11   
gb|ADR66946.1|  non-specific lipid transfer protein                   67.0    5e-11   
gb|AAF14232.1|AF109195_1  lipid transfer protein                      67.0    6e-11   
emb|CAA85484.1|  lipid transfer protein precursor                     66.6    6e-11   
gb|ABP01769.1|  lipid transfer protein 2                              66.6    6e-11   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  66.6    6e-11   
gb|ABA29446.1|  non-specific lipid transfer protein                   66.6    6e-11   
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    6e-11   
gb|AFK35133.1|  unknown                                               66.6    6e-11   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    6e-11   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           66.6    7e-11   
gb|KHG09722.1|  Non-specific lipid-transfer                           66.6    7e-11   
emb|CDY60751.1|  BnaA05g34760D                                        67.0    7e-11   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  66.6    7e-11   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    7e-11   
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    8e-11   
gb|AAL25839.1|  lipid transfer precursor protein                      66.2    8e-11   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  66.6    8e-11   
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              66.2    8e-11   
gb|AAT80665.1|  lipid transfer protein precursor                      66.2    8e-11   
ref|XP_002532868.1|  Nonspecific lipid-transfer protein precursor...  66.2    9e-11   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  66.2    9e-11   
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    9e-11   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  66.2    9e-11   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           66.2    9e-11   
gb|EYU23196.1|  hypothetical protein MIMGU_mgv1a016221mg              66.6    9e-11   
ref|XP_002323667.1|  putative lipid transfer family protein           66.2    9e-11   
gb|ACL01093.1|  lipid transfer protein                                66.2    9e-11   
ref|XP_008359045.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
emb|CDX73941.1|  BnaA03g31060D                                        65.9    1e-10   
gb|AAX08122.1|  lipid transfer protein III                            65.9    1e-10   
gb|AAT80652.1|  lipid transfer protein precursor                      65.9    1e-10   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    66.2    1e-10   
gb|KHN40623.1|  Non-specific lipid-transfer protein                   66.2    1e-10   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AAT80650.1|  lipid transfer protein precursor                      65.9    1e-10   
dbj|BAJ85137.1|  predicted protein                                    66.6    1e-10   
gb|ACB05670.1|  putative non-specific lipid transfer protein          65.9    1e-10   
gb|KFK24679.1|  hypothetical protein AALP_AA8G011100                  65.9    1e-10   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|ADR66948.1|  non-specific lipid transfer protein                   65.9    1e-10   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  65.5    1e-10   
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              65.9    1e-10   
emb|CAB96876.2|  pru p 1                                              65.1    1e-10   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               65.9    1e-10   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AGH27863.1|  lipid transfer protein precursor                      65.9    1e-10   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|XP_008792224.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|XP_009372012.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|NP_001268120.1|  lipid transfer protein precursor                 65.9    1e-10   
gb|KFK36763.1|  lipid transfer protein                                65.9    1e-10   
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              69.7    1e-10   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              65.5    1e-10   
gb|AHB19226.1|  non specific lipid transfer protein 1B                65.5    2e-10   
ref|XP_008366278.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    2e-10   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_003605269.1|  Non-specific lipid-transfer protein              66.2    2e-10   
gb|ABG27026.1|  phosophlipid protein                                  65.5    2e-10   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  65.5    2e-10   
ref|XP_010558406.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
gb|AAM66937.1|  non-specific lipid transfer protein                   65.1    2e-10   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 66.2    2e-10   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           65.5    2e-10   
dbj|BAC77694.1|  lipid transfer protein                               65.5    2e-10   
gb|ADR66947.1|  non-specific lipid transfer protein                   65.5    2e-10   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   65.5    2e-10   
ref|XP_008384664.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
emb|CAH69198.1|  type 1 non specific lipid transfer protein precu...  65.5    2e-10   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              65.1    2e-10   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  65.5    2e-10   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  64.7    2e-10   
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              65.1    2e-10   
ref|XP_010505480.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_011091598.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_008358923.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_009141746.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   65.1    2e-10   
gb|ABE11609.1|  lipid-transfer protein precursor                      65.1    2e-10   
ref|XP_007207088.1|  hypothetical protein PRUPE_ppa023836mg           65.1    2e-10   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 65.1    2e-10   
gb|AES79797.2|  Lipid transfer protein                                65.9    2e-10   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
gb|ABX56711.1|  LTP isoallergen 1 precursor                           65.1    3e-10   
gb|AGC08424.1|  lipid transfer protein                                65.9    3e-10   
ref|XP_009141748.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              65.1    3e-10   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
sp|Q42614.1|NLTP1_BRANA  RecName: Full=Non-specific lipid-transfe...  64.7    3e-10   
gb|AET05732.1|  lipid transfer protein isoform c                      64.3    3e-10   
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
dbj|BAB09777.1|  lipid transfer protein-like                          64.7    3e-10   
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|WP_039311159.1|  hypothetical protein                             64.3    3e-10   
gb|KFK40228.1|  hypothetical protein AALP_AA3G347300                  64.7    3e-10   
emb|CDY29026.1|  BnaC07g32320D                                        65.1    3e-10   
sp|Q42642.1|NLTPB_BRAOT  RecName: Full=Non-specific lipid-transfe...  64.7    3e-10   
ref|XP_010931359.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
gb|AGC08421.1|  lipid transfer protein                                65.5    3e-10   
gb|ADD13588.1|  non-specific lipid transfer protein 1                 64.7    3e-10   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           64.7    3e-10   
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  63.9    3e-10   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            64.7    3e-10   
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
prf||2115353A  lipid transfer protein                                 64.3    4e-10
ref|XP_010109650.1|  Non-specific lipid-transfer protein              64.7    4e-10   
sp|Q43304.1|NLTPD_BRAOT  RecName: Full=Non-specific lipid-transfe...  64.3    4e-10   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         64.3    4e-10   
gb|AHB19225.1|  non specific lipid transfer protein 1C                64.3    4e-10   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
ref|NP_001189842.1|  lipid-transfer protein 6                         64.3    4e-10   
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           64.3    5e-10   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              64.3    5e-10   
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    5e-10   
ref|XP_002314213.2|  hypothetical protein POPTR_0009s03020g           63.9    5e-10   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    5e-10   
gb|AFR43291.1|  lipid transfer protein precursor                      63.9    6e-10   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  63.5    6e-10   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           63.9    6e-10   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               63.9    6e-10   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  63.9    6e-10   
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    6e-10   
gb|ACE80968.1|  putative allergen Pru du 3.03                         63.9    6e-10   
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    63.9    6e-10   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  63.2    6e-10   
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  63.9    6e-10   
gb|KFK34405.1|  non-specific lipid transfer protein                   63.9    7e-10   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      63.9    7e-10   
gb|AAA86694.1|  phospholipid transfer protein precursor               63.5    7e-10   
ref|XP_003623613.1|  Non-specific lipid-transfer protein              63.9    7e-10   
gb|ABF06565.1|  non-specific lipid transfer-like protein              63.5    7e-10   
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    7e-10   



>ref|XP_009778825.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=115

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKL  304
            ++  + +S L +C++ +A   P A+A+ +C  +   + PCL Y+  G  +P  CC G+K 
Sbjct  1    MLSMKFLSFLFICMMVAA---PPAKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKS  57

Query  303  VVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            ++    T  DRQSAC C+K    RAT D++ R  G+P  C    PF+ISP V+CS V 
Sbjct  58   LISTATTTADRQSACSCVKSLASRATGDELSRAAGIPGKCGANVPFDISPNVDCSKVN  115



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGL  289
            L+S LL+C++ S   PP   A  +C  +   + PCL Y+ +GG +P  CC GLK ++   
Sbjct  10   LLSFLLICLVLS---PPQTRAVITCDTVFSDLKPCLSYVLVGGNVPTECCNGLKSLITNA  66

Query  288  KTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             T +DRQ AC C+K     AT +QV R   LP  C V  PF+IS  V+C+ V+
Sbjct  67   TTTEDRQMACSCVKNLATAATDEQVDRAASLPGKCGVNVPFKISRDVDCTKVK  119



>ref|NP_001055844.2| Os05g0477900 [Oryza sativa Japonica Group]
 dbj|BAF17758.2| Os05g0477900 [Oryza sativa Japonica Group]
Length=129

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK-VGC  238
            A A  SCS +  T+ PCL Y+  GG +P ACCGG++ VV   +T  DR++AC C+K V  
Sbjct  34   ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAA  93

Query  237  LRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              A    + R  GLP  C V  PF+ISP VNC+AV 
Sbjct  94   GAAGGPYISRAAGLPGRCGVSVPFKISPNVNCNAVN  129



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (58%), Gaps = 5/123 (4%)
 Frame = -3

Query  492  TMAII--GKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACC  319
            TMA +   K L+S LL+C++ S   PP A A  +C  +   + PCL+Y+ +GG +P  CC
Sbjct  39   TMANVLSKKFLLSFLLICLVLS---PPQARAVITCDTVFNDLKPCLNYVLVGGNVPAECC  95

Query  318  GGLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
             GLK ++    T  DRQS C C+K     AT +QV R   LP  C V  PF+IS  V+C+
Sbjct  96   NGLKSLIVKAITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGVKVPFKISRDVDCT  155

Query  138  AVQ  130
             V+
Sbjct  156  KVK  158



>gb|AAT01364.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY98428.1| hypothetical protein OsI_20343 [Oryza sativa Indica Group]
 gb|EEE64096.1| hypothetical protein OsJ_18927 [Oryza sativa Japonica Group]
Length=138

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK-VGC  238
            A A  SCS +  T+ PCL Y+  GG +P ACCGG++ VV   +T  DR++AC C+K V  
Sbjct  34   ARAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAA  93

Query  237  LRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQK  127
              A    + R  GLP  C V  PF+ISP VNC+A  K
Sbjct  94   GAAGGPYISRAAGLPGRCGVSVPFKISPNVNCNAYVK  130



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 63/111 (57%), Gaps = 0/111 (0%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +LM L  + +I   V PP A+A  +C  +   + PCL+Y+  GG +P  CC GL+ ++  
Sbjct  6    RLMLLSFILIIYMVVAPPPAKAVITCDTVYDGVKPCLNYVLFGGSVPIDCCNGLESLIAS  65

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
              T  DRQSAC C+K     AT +++ R   +P  C    PFEISP V+CS
Sbjct  66   ATTTADRQSACSCVKSLASHATDEELSRAASIPGQCGASVPFEISPNVDCS  116



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            ++M LL + +I     PP A+A  +C  +   + PCL+Y+  GG +   CC GL+ V+  
Sbjct  6    RVMLLLFILIIYMVAAPPPAKAVITCDTVYDGVKPCLNYVLFGGIVSTDCCNGLESVIAS  65

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              T  D QS C CIK    +AT D++ R   +P  C    PFEISP V+CS V+
Sbjct  66   ATTIADHQSTCSCIKSLASQATDDELSRAASIPGQCGATIPFEISPNVDCSKVK  119



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQE---SCSDLVKTISPCLDYISIGGKIPQACCGG  313
            ++ KQL   L +C++ +A     A A +   +C+ +  ++ PCL Y+  G  +P  CC G
Sbjct  1    MLNKQLFPFLFICIVATATNTAAATAADETVTCNTVYDSLEPCLGYVLGGASVPPECCSG  60

Query  312  LKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
            LK ++   +T+ DRQSAC C+K     AT DQ+ R   +P  CK   PF+IS  V+CS +
Sbjct  61   LKSLLGAARTRTDRQSACQCVKSVASSATGDQISRAASIPGICKAKLPFKISANVDCSKI  120

Query  132  Q  130
            +
Sbjct  121  K  121



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKL  304
             + KQL+ L++L +   A  P  +EA  +C D+   +  CL Y++ GGK+P +CC G+K 
Sbjct  7    FMQKQLLGLVIL-IWMLAYNPRPSEAL-TCDDVNNNLISCLSYVAGGGKVPTSCCSGVKN  64

Query  303  VVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            ++   KT+ DRQ+AC C+K   + A  DQ+ R Q +P  C +  PF IS  V+CS V+
Sbjct  65   LLSLAKTRNDRQTACSCLKSLAVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKVK  122



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -3

Query  456  LLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQ  277
            +L+C++ SA   P AEA  +C  +  +++PCL+Y+  GG +P ACC G+K +    KT  
Sbjct  15   VLMCMVVSA---PHAEAAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTA  71

Query  276  DRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            DRQ+AC C+K          +     LP  C V  P++ISP  +CS VQ
Sbjct  72   DRQAACNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKVQ  120



>ref|XP_009608993.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGL  289
            L+ ++ +   TS ++ P A+A  SC  +V  +SPC++Y+  GG +P  CC G+K + +  
Sbjct  6    LLVVMCIAAATSVMLTPHADAAISCGQVVTRLSPCINYVRQGGALPAPCCSGIKALNNQA  65

Query  288  KTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             T  DRQ+AC CIK      +         LP  C V  P++ISP ++CS VQ
Sbjct  66   TTTPDRQAACNCIKSAAASISGINFNLAGSLPSKCGVNLPYKISPSIDCSTVQ  118



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  LLL C++ +A   P AEA  +C  +V  ++PCL Y+  GG +  ACC G+K + + 
Sbjct  8    KLACLLLACMVATA---PHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +  Q+     L   C V  P++ISP ++CS V+
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK  118



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 3/114 (3%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC + +   V+ P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K + + 
Sbjct  4    MAMMVLCAVVTCMVVVAPYAEAL-SCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGVSIPYKISPGTDCSKVQ  116



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 62/112 (55%), Gaps = 0/112 (0%)
 Frame = -3

Query  465  MSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLK  286
            +S++ +  +  A++   AEA  +C  +   +SPCLDY+ +GG IP  CC G++ +     
Sbjct  7    LSVMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGIRNLFSAAS  66

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            T QDRQ+ C C+K      +   +     LP  C V  P++ISP ++C+ VQ
Sbjct  67   TTQDRQTVCNCMKSAARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKVQ  118



>ref|XP_004963700.1| PREDICTED: non-specific lipid-transfer protein 2A-like, partial 
[Setaria italica]
Length=127

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK-VGC  238
            A A  SCS +  T+ PCL Y+  GG +P+ACC G++ +V G +T  DR++ C C+K V  
Sbjct  23   AGAALSCSTVYNTLMPCLGYVQSGGTVPRACCSGIQRLVSGARTTPDRRAICTCLKNVAA  82

Query  237  LRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSA  136
              A    + R  GLP  C VP P+++SP +NC++
Sbjct  83   GAAGGPYISRAAGLPGRCGVPLPYKLSPNMNCNS  116



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = -3

Query  471  QLMSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            ++ SL ++C+     A++   AEA  +C  +   +SPCLDY+ +GG IP  CC G++ + 
Sbjct  3    KVASLAVVCIAAMLIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRSLF  62

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                T QDRQ+ C C+K      +   +     LP+ C V  P++ISP ++C+ VQ
Sbjct  63   SAASTTQDRQTVCNCMKSAAGAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKVQ  118



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAV----------IPPWAEAQESCSDLVKTISPCLDYISIGGKI  334
            ++ KQL  LL +C++ S                A+A  +C+ +  ++ PCL Y+  G  +
Sbjct  1    MLNKQLFPLLFICIVVSVASITATATNTAAATAADATVTCNTVYDSLEPCLGYVLGGASV  60

Query  333  PQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISP  154
            P  CC GLK ++   +T+ DRQSAC C+K     AT DQ+ R   +P  CK   PF+IS 
Sbjct  61   PPECCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQISRAASIPGICKAKVPFKISA  120

Query  153  IVNCSAVQ  130
             V+CS ++
Sbjct  121  NVDCSKIK  128



>ref|XP_003566138.1| PREDICTED: non-specific lipid-transfer protein P5-like [Brachypodium 
distachyon]
Length=130

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 58/99 (59%), Gaps = 1/99 (1%)
 Frame = -3

Query  423  PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK-  247
            P  A A  SCS +  T+ PCL Y+  GG +P+ACC G+K +V G ++ QDR++ C+C+K 
Sbjct  32   PGGARAALSCSTVYNTLMPCLGYVQSGGTVPRACCTGIKRLVSGARSTQDRRTVCVCLKN  91

Query  246  VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            V         + R  GLP  C VP P++  P  +CS++ 
Sbjct  92   VSSGAKGGPYLTRAAGLPARCGVPLPYKTGPNDSCSSIH  130



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGG-KIPQACCGG  313
            MA +  ++  L ++C++  A   P A+AQ +C  +V  +SPC+ Y+  GG  +P  CC G
Sbjct  1    MATMVTRVSFLAIVCLVLGATTSPKAQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCNG  60

Query  312  LKLVVDGLKTKQDRQSACLCIKVGCLRATVD----QVIRFQGLPDYCKVPFPFEISPIVN  145
            +K +    +TK DRQ+ C CIK     +  +     +     LP  C V  P++ISP  +
Sbjct  61   IKNLYGQAQTKTDRQAICSCIKNAVSNSGFNYSRSNLNNAANLPKKCGVNIPYQISPNTD  120

Query  144  CSAVQ  130
            C++VQ
Sbjct  121  CNSVQ  125



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -3

Query  441  ITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSA  262
            I+  V PP A A  +C  +   + PCL Y+ +GG +P+ CC GLK ++    T  DRQSA
Sbjct  20   ISMVVAPPPAMAGITCDTVYNDLQPCLSYVLVGGSVPEECCSGLKSLLANATTTPDRQSA  79

Query  261  CLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            C C+K     AT ++V R   +   C    PF+ISP V+CS V 
Sbjct  80   CSCVKNLASAATGEEVSRAASITGQCGANVPFKISPDVDCSKVN  123



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = -3

Query  480  IGKQLMSLLLLCVITSA--VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLK  307
            +G+ ++S+L   V+ +   ++ P+ EA  +C  +   +SPC+ Y+  GG +P +CC G+ 
Sbjct  1    MGRSMISVLAFVVMVTGALMVTPYVEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVA  60

Query  306  LVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +    KT  DRQ+AC C+K      +  Q      LP  C V  P++ISP  +CS V+
Sbjct  61   ALNSAAKTTADRQAACSCLKSALSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKVK  119



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  LLL C++ +A   P AEA  +C  +V  ++PCL ++  GG +  ACC G+K + + 
Sbjct  8    KLACLLLACMVATA---PHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNND  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +  Q+     L   C V  P++ISP ++CS V+
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK  118



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 1/113 (1%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGL  289
            L  L+ L  IT  V+ P A    +C  ++  + PCL Y+  GG IP  CCGG+K +    
Sbjct  7    LTKLVGLIFITMLVVAPHAAQALTCGQVLNMVMPCLGYLKNGGSIPATCCGGVKNLASSA  66

Query  288  KTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            KTK DRQ AC C+K       ++   R   LP  C V +   ISP ++CS V+
Sbjct  67   KTKPDRQQACKCLKPAAKSYGIN-YDRANKLPSACGVDYKINISPTIDCSTVK  118



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 3/114 (3%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC + +   V  P+AEA  +C  +  +++PC+ Y++ GG +P ACC G+K + + 
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEAL-TCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGVNAGNAASLPGKCGVSIPYKISPGTDCSKVQ  116



>dbj|BAP11219.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11225.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 4/110 (4%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            LLC++ +A +     AQ +CS +V  +SPC+ Y+S GG +P  CC G++ + +  +T  D
Sbjct  1    LLCLMANAFM--GTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  273  RQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            RQ+ C C+K  V  +  T   +    GLPD C +  P++ISP  +C  VQ
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCL  235
             +AQ SC  +   +SPC+ +I  GGK+P ACC GL  ++   KT+ DRQSAC C+K    
Sbjct  32   GQAQISCDTVKNDLSPCIGFIMNGGKVPPACCSGLNTLLSLAKTRTDRQSACSCLKSVAE  91

Query  234  RATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
             AT DQ+     +P  C V  PF+IS  V+CS
Sbjct  92   SATDDQLKNAAQIPHSCGVNLPFKISRDVDCS  123



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 3/114 (3%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC + +   V+ P+AEA  +C  +  +++PC+ Y++ GG +P ACC G+K +   
Sbjct  4    MAMMVLCAVVTCMVVVAPYAEAL-TCGQVSSSLAPCIGYLTKGGAVPPACCNGVKSLNSA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYSSISGINEGNAASLPGKCGVNIPYKISPGTDCSKVQ  116



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 66/112 (59%), Gaps = 4/112 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            L+L+C++ SA +    +AQ +C  +V  +SPC+ Y+S GG +   CC G++ + +  ++ 
Sbjct  16   LVLVCLMGSAFVS--TKAQVTCRTVVNDLSPCISYVSYGGAVTTNCCNGVRTLYNAARST  73

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+ C C+K  V  +  T  Q+    GLP  C +  P++ISP  +CS VQ
Sbjct  74   ADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ  125



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC + +   V  P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K +   
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNCA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  116



>dbj|BAP11226.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 4/110 (4%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            LLC++ +A +     AQ +CS +V  +SPC+ Y+S GG +P  CC G++ + +  +T  D
Sbjct  1    LLCLMANAFM--GTRAQVTCSVVVNDLSPCISYVSGGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  273  RQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            RQ+ C C+K  V  +  T   +    GLPD C +  P++ISP  +C  VQ
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 64/112 (57%), Gaps = 4/112 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            +L++C++ SA +   A A  +C D+V+T++PC+ Y+  GG +P  CC G+K +    +T 
Sbjct  13   MLVVCMVVSATL--QARAAVTCGDVVRTLTPCISYVQYGGPLPDNCCNGVKTLYGEAQTS  70

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+ C CIK  V     +   +    GLP  C +  P+ ISP  +C+ VQ
Sbjct  71   ADRQNVCKCIKSAVNGFSYSNFNLGLAAGLPGKCGLHLPYTISPSTDCNKVQ  122



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V +++PC++Y+  GG IP ACC G+K +     +  DRQ+AC CIK  
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                +         LP  C V  P++ISP ++CS VQ
Sbjct  81   ARSISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_009631015.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=102

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = -3

Query  432  AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLC  253
            A  PP  +A+ +C  +   + PCL Y+  G  +P  CC G+K ++    T  DRQ AC C
Sbjct  3    AAAPP-VKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIASATTTADRQIACSC  61

Query  252  IKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +K    RAT D++ R  G+P  C    PF+ISP V+CS V 
Sbjct  62   VKSLASRATGDELSRAAGIPGKCGANVPFDISPDVDCSKVN  102



>ref|XP_009608991.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608992.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=106

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            ++ P A+A  SC  +V ++SPC+ Y+  GG +P  CC G+K +     T  DRQ+AC+CI
Sbjct  7    MLTPQADAAISCRQVVTSLSPCISYVRQGGALPAPCCSGIKALNSQATTTPDRQAACICI  66

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      +         LP  C V  P++ISP ++CS VQ
Sbjct  67   KSAAAGVSGINFSLAGSLPSKCGVNLPYKISPSIDCSTVQ  106



>dbj|BAP11220.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            LLC++ +A +     AQ +C  +V  +SPC+ Y+S GG +P  CC G++ + +  +T  D
Sbjct  1    LLCLMANAFM--GTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  273  RQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            RQ+ C C+K  V  +  T   +    GLPD C +  P++ISP  +C  VQ
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>dbj|BAP11221.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11224.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 4/110 (4%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            LLC++ +A +     AQ +CS +V  +SPC+ Y+S GG +P  CC G++ + +  +T  D
Sbjct  1    LLCLMANAFM--GTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  273  RQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            RQ+ C C+K  V  +  T   +    GLP+ C +  P++ISP  +C  VQ
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKVQ  108



>ref|XP_009594799.1| PREDICTED: non-specific lipid-transfer protein 4-like [Nicotiana 
tomentosiformis]
Length=123

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V PP A A  +C  +   + PCL Y+ IGG +   CC GLK ++    T  D QSAC C+
Sbjct  24   VAPPPAMAAITCDTVYNDLQPCLSYVLIGGSVSTECCSGLKSLLASATTTPDHQSACSCV  83

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K     AT ++V R   +P  C    PF+ISP V+CS V 
Sbjct  84   KNLASAATGEEVSRAARIPGQCGANVPFKISPDVDCSKVN  123



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = -3

Query  483  IIGKQLMSLLLLC---VITSAVIPPWAEAQESCSDLVKTISPCLDYISIGG-KIPQACCG  316
            ++ KQ   +LL+C   V+ +       +A  +C+ +  T+ PCL Y+  GG  +P  CC 
Sbjct  7    MLNKQPFPMLLICIAVVMATITATTSQDATLTCNTVFTTLEPCLSYVLGGGLSVPSECCN  66

Query  315  GLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSA  136
            G+K +++G  T  DRQSAC CIK     A    V R   +P  CK   PF+ISP V+CS 
Sbjct  67   GIKSMLNGAYTIADRQSACKCIKSVVSSAAPGPVSRAAKVPGICKANVPFKISPHVDCSK  126

Query  135  VQ  130
             +
Sbjct  127  TK  128



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 3/114 (3%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIP-QACCGGLKLVVDG  292
            L+ L+   +I +AV+ P AEA   C+ +   ++PCL Y++  GK P   CCGG+K ++D 
Sbjct  4    LIKLMCTMLIVAAVVAPLAEAAIGCNTVASKMAPCLPYVT--GKGPLGGCCGGVKGLIDA  61

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+ C C+K      +   +    GLP  C V  P++ISP  +CS V 
Sbjct  62   ARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH  115



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V  P AEA  +C  +   ++PC++Y+  GG +P ACC G+K +    KT  DRQ+ C C+
Sbjct  21   VAAPNAEAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAKTTPDRQTTCSCM  80

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K    +    +V     LP  C +  P++ISP  +CS V+
Sbjct  81   KSAATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKVK  120



>ref|XP_002276372.1| PREDICTED: non-specific lipid-transfer protein 1 [Vitis vinifera]
 emb|CBI15816.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = -3

Query  462  SLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKT  283
            +++L+C++ +A   P A+A  +CS + + ++PC++Y+  GG IP +CC G+K V    KT
Sbjct  12   TVVLVCLLVTA---PQADATVTCSQVTQLLNPCVNYLIYGGAIPSSCCAGVKQVKAASKT  68

Query  282  KQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +DR++AC CI+ G              LP  C V  P++ISP  +CS + 
Sbjct  69   GEDRRTACSCIQDGAAMIPGIDYNLVASLPSQCGVSLPYKISPSTDCSRIN  119



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M+ ++ CV+ +   V  P+AEA  +C  +V ++S C  Y+  GG +P ACC G+K +   
Sbjct  4    MATMVFCVVVTCMVVAAPYAEAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSLNSA  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD-QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+ C C+K    RA+          LP  C V  P++ISP  +CS VQ
Sbjct  64   ARTTPDRQTVCGCLK----RASGGVNASNAASLPGKCGVNIPYKISPSTDCSKVQ  114



>ref|XP_011095136.1| PREDICTED: non-specific lipid-transfer protein-like [Sesamum 
indicum]
Length=118

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 8/117 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L++LC++ +A   P AEA  SC+ ++  +SPCL YI  GG +P ACC G K + D 
Sbjct  8    KLACLIILCLVVTA---PHAEAAISCASVMTKLSPCLSYIKSGGGLPPACCSGAKSLNDA  64

Query  291  LKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQK  127
              T  D Q+ C CIK  V  LRA    +     +P  C V  P++ SP ++CS V +
Sbjct  65   ASTTPDLQAVCGCIKILVPSLRANPAYI---NSIPAKCGVNLPYKYSPSLDCSKVVR  118



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  465  MSLLLLCVITSAVIPP--WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +S++++C++ S+++     AEA  SC  +V +++PCL Y+  GG +P  CC G+K +   
Sbjct  6    VSIVVVCLMFSSILLSSLQAEAAFSCGTVVSSLTPCLTYLKSGGSVPTTCCSGVKSLNAA  65

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      T  ++     LP  C V  P++ISP  +CS V 
Sbjct  66   AKTTPDRQTACNCMKNAAAGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKVN  119



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  489  MAIIGKQLMS--LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGK---IPQA  325
            MAI   Q +S  L LLC++  +   P AEA  SCS +   ++PCL Y+ IGG    +P  
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYL-IGGSKQAVPAG  59

Query  324  CCGGLKLVVDGLKTKQDRQSACLCIKVGC--LRATVDQVIRFQGLPDYCKVPFPFEISPI  151
            CC G++ +     T  DRQS C C+K G   L +++D   +   L + C V  P++ISP 
Sbjct  60   CCSGIQSLYTAASTTVDRQSVCSCLKAGAASLGSSID-ANKAATLLNKCGVTVPYKISPN  118

Query  150  VNCSAVQ  130
            ++CS VQ
Sbjct  119  IDCSKVQ  125



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V  P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K + +  KT  DRQ+AC C+
Sbjct  4    VAAPYAEAL-SCGQVSNSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 65/112 (58%), Gaps = 2/112 (2%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            +L LC++ +++    +EA  SC+ +   + PCL Y+  GG IPQ+CC G+K++    K+ 
Sbjct  5    VLPLCLLLASMFARGSEAAVSCNAVQADLYPCLAYVVQGGNIPQSCCTGIKMLKQQAKSA  64

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+ C CIK  VG +  +   +     LP  C V  P++I P  NC++++
Sbjct  65   SDRQAVCRCIKSAVGRVSYSSTYLKNAATLPGKCGVKLPYKIDPSTNCNSIK  116



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = -3

Query  459  LLLLCVIT-SAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKT  283
            L+++C+   S ++ P A+A  SC  +V +++PC+ Y++ GG IP  CC G++ + +   +
Sbjct  7    LVVVCMAAVSVMLTPHADAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESLNNQATS  66

Query  282  KQDRQSACLCIKVGCLRATVDQVIRFQ---GLPDYCKVPFPFEISPIVNCSAVQ  130
              DRQ+AC CIK     A   + I F     LP  C V  P++ISP ++CS VQ
Sbjct  67   TPDRQTACNCIKSA---AASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V  P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K + +  KT  DRQ+AC C+
Sbjct  4    VAAPYAEAL-SCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = -3

Query  423  PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            PP AEA  +CS +V ++ PCL Y+  GGK+P  CC G+K +    KT  DR+S C C+K 
Sbjct  25   PPRAEAAITCSTVVNSLIPCLSYVMNGGKVPPTCCQGIKSLYGAAKTAADRRSVCSCLKT  84

Query  243  GCLRATVDQVIRFQGLPDYCKVP-FPFEISPIVNCSAVQ  130
                 +         LP  C V   PF+ISP  +CS V+
Sbjct  85   AASSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKVK  123



>gb|ACE07188.1| Art v 3.0301 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MAI   ++  ++++C++ S     +AE+  +CSD+   ISPCL Y+  GG++P  CC G+
Sbjct  1    MAIKMMKVFCIMVVCMVVST---SYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGV  57

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQ-GLPDYCKVPFPFEISPIVNCSAV  133
            K + D  KT  DRQ+AC C+K    ++  D    F   LP  C +  P+++S   +C+ V
Sbjct  58   KGLNDATKTTPDRQTACNCLKAS-FKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116

Query  132  Q  130
            +
Sbjct  117  K  117



>dbj|BAP11218.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11222.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11223.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            LLC++ +A +     AQ +C  +V  +SPC+ Y+S GG +P  CC G++ + +  +T  D
Sbjct  1    LLCLMANAFM--GTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTAD  58

Query  273  RQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            RQ+ C C+K  V  +  T   +    GLP+ C +  P++ISP  +C  VQ
Sbjct  59   RQNVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKVQ  108



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 3/116 (3%)
 Frame = -3

Query  477  GKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            G    +L++LC+  + ++ P AEA  +C  +   ++PC++Y+  GG +P +CCGG++ +V
Sbjct  6    GLACFALVILCM--AVLVVPHAEAI-TCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLV  62

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               KT  DR++AC C+K    R    +     GLP  C V  PF IS  VNC+ V 
Sbjct  63   GAAKTTADRRTACNCLKSAAGRIPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTVT  118



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P AEA  +C  +  +++PC++Y+ +GG +P ACC G++ +    KT  DRQ+AC C+K  
Sbjct  20   PLAEAI-TCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTADRQAACNCLKTA  78

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
                    +    GLP  C V  P++ISP  NC+
Sbjct  79   SASIKGINLSLAAGLPGKCGVSVPYKISPSTNCN  112



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MA  G   ++ L++ V+  A  P    A  +C  +V +I+PCL+Y+  GG +P ACC G+
Sbjct  1    MASSGVVKVACLVVAVMVIAA-PHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGV  59

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K +    KT  DRQ+AC C+K   +     Q      LP  C V  P++ISP  +CS V+
Sbjct  60   KSLNSAAKTTPDRQTACNCLKSAAVSNPSIQAGLASSLPAKCGVNVPYKISPSTDCSKVK  119



>ref|XP_006367395.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M I GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEIFGK-IACFVLLCMV---VVAPHAEAL-SCGEVTSGLAPCLPYLQGSGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 3/114 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC   + ++   P+ EA  SC  +  +++PC+ Y++ GG +P ACC G+K +   
Sbjct  4    MAMMVLCAGVTCMVVGAPYTEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K      +          P  C V  P++ISP  +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ  116



>gb|KHG10481.1| Non-specific lipid-transfer 3 [Gossypium arboreum]
Length=140

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 68/125 (54%), Gaps = 2/125 (2%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+S++L+  +T    P  A+A  +CSD+V  + PCL Y+  GG    ACC G+K +   
Sbjct  8    KLVSMILIVCMTVMSAPKAAKAAITCSDVVNHLIPCLSYVQNGGTPAAACCSGVKALYGE  67

Query  291  LKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQKWID  118
             +T  DRQ+ C CIK  V  +  T + +    GLP  C +  P+ ISP  +C+      D
Sbjct  68   AQTSPDRQNVCKCIKSAVNGIPYTSNNLNLAAGLPAKCGLQLPYSISPSTDCNNEVDDDD  127

Query  117  *KKGI  103
             ++G+
Sbjct  128  MEEGV  132



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++++C++ +  +P   EA  +C  +  ++SPCL+Y+  GG +P  CC G+K +   
Sbjct  8    KLACVMVICMVVA--VPASVEAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNSA  65

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIR--FQGLPDYCKVPFPFEISPIVNCSAV  133
             +T  DRQ+AC C+K   L  ++  +      GLP  C V  P++ISP  +CS V
Sbjct  66   AQTTADRQTACKCLKS--LSGSIPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V +++PC+ Y++ GG IP  CC G+K + +   +  DRQ+AC CIK  
Sbjct  21   PQADAAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                +         LP  C V  P++ISP ++CS VQ
Sbjct  81   VGSISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = -3

Query  489  MAIIGKQLMSLL-LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGG  313
            MAI     +SL+ LLC++   V  P A+A  +C  +  +ISPC++Y+  GG +P ACC G
Sbjct  1    MAISTAMKLSLVALLCIV---VALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNG  56

Query  312  LKLVVDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
            ++ +    KT  DRQ+ C C+K   G ++     +    GLP  C V  P++IS   NC+
Sbjct  57   IRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNL--AAGLPGKCGVNVPYKISTSTNCA  114

Query  138  AVQ  130
            AV+
Sbjct  115  AVK  117



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V ++SPC+ Y+  GG IP  CC G+K + +   +  DRQ+AC CIK  
Sbjct  21   PHADAAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                          LP  C V  P++ISP ++CS V 
Sbjct  81   AAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTVH  117



>ref|XP_009800887.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
 dbj|BAK19152.1| lipid transfer protein [Nicotiana tabacum]
Length=117

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V ++SPC+ Y+  GG IP  CC G+  + +   +  DRQ+AC CIK  
Sbjct  21   PHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                +         LP  C V  P++ISP ++CS VQ
Sbjct  81   AAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTVQ  117



>gb|AAT45202.1| lipid transfer protein 1 precursor [Nicotiana tabacum]
Length=124

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V ++SPC+ Y+  GG IP  CC G+  + +   +  DRQ+AC CIK  
Sbjct  28   PHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSA  87

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                +         LP  C V  P++ISP ++CS VQ
Sbjct  88   AAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTVQ  124



>gb|ACE07187.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=116

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MA+   +    +++C++ S+    +AEA  +CSD+   I+PCL+Y+  GG++P  CC G+
Sbjct  1    MAMKMMKFFCAMVVCMVLSS---SYAEAL-TCSDVSNKITPCLNYLKQGGEVPADCCTGV  56

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQG-LPDYCKVPFPFEISPIVNCSAV  133
            K + D  KT  DRQ+AC C+K    ++  D    F   LP  C V  P++IS   +C+ V
Sbjct  57   KGLNDAAKTTPDRQTACNCLKTS-FKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV  115

Query  132  Q  130
            +
Sbjct  116  K  116



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 5/113 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            + ++C++ +  + P A+A  +C  +   +SPCL Y+  GGK   ACC G+K +    KT 
Sbjct  11   VAMMCMVVAMSVTPMAQAAITCGQVAGDVSPCLSYLRSGGKPSDACCNGVKSLSGAAKTT  70

Query  279  QDRQSACLCIKVGCLRATVDQVI---RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+AC C+K   L   + Q +       LP  C V  P++IS   NC+ ++
Sbjct  71   ADRQAACNCLKN--LANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>gb|KDP21874.1| hypothetical protein JCGZ_00661 [Jatropha curcas]
Length=119

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = -3

Query  468  LMSLLLLCVITSAVI----PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLV  301
            + S+ L+ +++ AV+    P  A A  +C D+V+ ++PC+ Y+  GG++P  CC G++ +
Sbjct  1    MASVKLVMIVSLAVMMMFAPMAARAAITCGDVVRELTPCVGYLQSGGQVPGNCCNGIRTL  60

Query  300  VDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  +T  DRQ+ C C++  V   R +   +   Q LP  C V  P++I P  NC  V+
Sbjct  61   YNAAQTTPDRQAVCQCLESAVSNFRYSSYNLGLAQSLPAKCNVNIPYKIDPSTNCKNVK  119



>ref|XP_006367394.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPHAEAL-SCGEVTSGLAPCLPYLQGSGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>ref|XP_006355283.1| PREDICTED: non-specific lipid-transfer protein 2 isoform X2 [Solanum 
tuberosum]
Length=114

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPHAEAL-SCGEVTSGLAPCLPYLQGSGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (55%), Gaps = 13/119 (11%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+  +LLC++ +A   P A A  +C  +   ++PC+ Y+  GG +P +CC G++ V D 
Sbjct  5    KLVCAVLLCMMVAA---PVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDA  61

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQ-----GLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQSAC      CL+ T   +         GLP  C V  P++ISP  NC+ V+
Sbjct  62   SRTTSDRQSAC-----NCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK  115



>ref|XP_010464489.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SCS  V  + PC+ YI  GG +P++CC G+K +    +T  DRQS C CIK  +G
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGNVPESCCNGIKALNSQAQTAADRQSVCRCIKSAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  T + +     LP  C +  P++ SP  NC ++ 
Sbjct  77   GVSYTSNNLNNALSLPSKCGLNLPYKFSPSTNCDSIN  113



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V  P+ EA  SC  +  +++PC+ Y++ GG +P ACC G+K +    KT  DRQ+AC C+
Sbjct  4    VAAPYTEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCL  62

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   KSAYNSISGVNAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -3

Query  417  WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGC  238
            +AEA  +CSD+   ISPCL+Y+  GG++P  CC G+K + D  KT  DRQ+AC C+K   
Sbjct  22   YAEAALTCSDVSTKISPCLNYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKAS-  80

Query  237  LRATVDQVIRFQ-GLPDYCKVPFPFEISPIVNCSAVQ  130
             ++  D    F   LP  C +  P+++S   +C+ V+
Sbjct  81   FKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK  117



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGGLKLVVD  295
            MSL L CV+   ++   P A+   +C  +  +++PC+ Y+   GG +PQ CCGG+K +  
Sbjct  5    MSLKLACVVVLCMVLGAPLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNS  64

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
              +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   AAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  116



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 63/115 (55%), Gaps = 4/115 (3%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGG-KIPQACCGGLKLVV  298
            KQL  LLL+C+  +A      +A  SC+ +   + PCL ++  GG  +P ACC GLK ++
Sbjct  4    KQLFPLLLICIALAAT---ATDAAVSCNTVYSNLEPCLGFVLNGGPTVPSACCSGLKSLL  60

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
                T  DRQSAC CIK     A   Q+ R   LP  C    P++ISP V+CS +
Sbjct  61   VAAGTTADRQSACKCIKSLASSANGVQIGRASQLPGICNAHIPYQISPNVDCSKI  115



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 65/116 (56%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  + LLC++   V  P A+A  +C  +   ISPCL Y+  GG +P ACC G++ +   
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGM  63

Query  291  LKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K   G ++     +    GLP  C V  P++IS   NC+AV+
Sbjct  64   AKTTADRQAACNCLKQAAGGIKGLNPNL--AAGLPGKCGVSVPYKISTTTNCAAVK  117



>ref|XP_002528683.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF33672.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=114

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MA I  +L+S L+LC++   V  P      +C  +V  +S CL Y+  GG +P ACC G+
Sbjct  1    MATITVKLISFLVLCLV---VAMPMTTEAITCGQVVSGLSSCLSYLRSGGAVPPACCNGV  57

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            + +    KT  DRQ  C C+K     A    +     LP  C V  P++ISP  +C +++
Sbjct  58   RGLNSAAKTTADRQQVCECLKSA---AAGINLSNASSLPGKCNVNIPYKISPSTDCKSIK  114



>ref|XP_009148874.1| PREDICTED: non-specific lipid-transfer protein 5-like [Brassica 
rapa]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +LL++C++ SA   P AEA  SC  +   +  C++Y++ GG +P+ CC G++ +   
Sbjct  6    KLSTLLIVCMLVSA---PMAEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLHSM  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ ++
Sbjct  63   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRISYPISARTNCNNIR  117



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = -3

Query  489  MAIIGKQLMSLL-LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGG  313
            MAI     +SL+ LLC++   V  P A+A  +C  +  +I+PC++Y+  GG +P ACC G
Sbjct  1    MAISTAMKLSLVALLCIV---VALPIAQA-ITCGQVASSIAPCVNYVKSGGAVPAACCNG  56

Query  312  LKLVVDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
            ++ +    KT  DRQ+ C C+K   G ++     +    GLP  C V  P++IS   NC+
Sbjct  57   VRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNL--AAGLPGKCGVNVPYKISTSTNCA  114

Query  138  AVQ  130
            AV+
Sbjct  115  AVK  117



>ref|XP_010464583.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SCS  V  + PC+ YI  GG +P++CC G+K +    +T  DRQS C CIK  +G
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGTVPESCCNGIKALNSQAQTSADRQSVCRCIKSAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  T + +     LP  C +  P+  SP  NC ++ 
Sbjct  77   GVSYTSNNLNNALSLPSKCGLNLPYRFSPSTNCDSIN  113



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 2/114 (2%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            MSL L C +  A++   P AEA  +C  +  +++ C+ Y+  GG +P ACC GLK +   
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSA  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ  C C+K    + +        GLP  C V  P++ISP  +C  V+
Sbjct  65   AKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTVK  118



>ref|XP_010486423.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SCS  V  + PC+ Y+  GG +P++CC G+K +    +T  DRQS C CIK  +G
Sbjct  17   GEAAVSCSTTVAELYPCVSYVVQGGAVPESCCNGIKALNSQAQTAADRQSVCRCIKSAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  T + +     LP  C +  P++ SP  NC ++ 
Sbjct  77   GVSYTSNNLNNALSLPSKCGLSLPYKFSPSTNCDSIN  113



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  S  G +P  CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK      T        GLP  C V  P++ISP  +C++V+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  + LLC++   V  P A+A  +C  +  +ISPC++Y+  GG +P ACC G++ +   
Sbjct  8    KLSLVALLCIV---VALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSA  63

Query  291  LKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+ C C+K   G ++     +    GLP  C V  P++IS   NC+AV+
Sbjct  64   AKTTADRQATCNCLKQASGAIKGLNPSL--AAGLPGKCGVSVPYKISTSTNCAAVK  117



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 3/116 (3%)
 Frame = -3

Query  468  LMSLLLLC---VITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            ++SL L+C   V+   V  P  E+  +C  +   ++PCL Y+  GGKIP ACC G++ + 
Sbjct  1    MVSLKLVCLALVVGLVVAMPLTESAITCGQVRSWVAPCLGYLRAGGKIPSACCSGIRSLN  60

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +  +T  DR++ C C++          +     LP  C V  P++ISP  +CS V+
Sbjct  61   NAARTTHDRRTTCRCVQSAAGNIQGLNLGLVSALPGKCGVRIPYKISPSTDCSRVK  116



>gb|AEI70826.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 5/116 (4%)
 Frame = -3

Query  465  MSLLLLCVITS--AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            M++++LC + +   V  P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K +   
Sbjct  4    MAMMVLCAVVTCMVVAAPYAEAL-SCGQVSSSLAPCIGYLTKGGVVPPACCSGVKSLNSA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISP--IVNCSAVQ  130
             KT  DRQ+AC C+K      +         LP  C V  P++ISP    +CS VQ
Sbjct  63   AKTTPDRQAACGCLKSAYSSISGINSGNAASLPGKCGVNIPYKISPGTRTDCSKVQ  118



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGG-KIPQACCGGLKLVV  298
            KQL  LLLL  I  AV     +A  +C+ +   + PCL ++  GG  +P ACCGGLK ++
Sbjct  4    KQLFPLLLL--ICVAVAATATDAAVTCNTVYTDLEPCLGFVLNGGLTVPSACCGGLKSLL  61

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
                T  DRQSAC CIK     A   Q+ R   LP  CKV  P++ISP V+CS +
Sbjct  62   VAAGTTADRQSACKCIKSLASSANGVQIGRATQLPRICKVNVPYQISPNVDCSKI  116



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M I GK +   ++LC++ +A   P AEA  +C  +   ++PCL Y+   G + + CCGG+
Sbjct  1    MEIAGK-IACFVVLCMVVAA---PCAEAI-TCGQVTSNLAPCLAYLRNTGPLGR-CCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K +V+  +T +DRQ AC C+K      +   + +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  114



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            SCS +V  + PCLDY+  GG +P  CC G++ +     T  DRQ+ C C+K      T  
Sbjct  4    SCSTVVTDLYPCLDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVTGL  63

Query  219  QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +    GLP  C V  P++ISP V+C+ V 
Sbjct  64   NLDLAAGLPQKCGVSIPYQISPSVDCATVH  93



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 60/106 (57%), Gaps = 4/106 (4%)
 Frame = -3

Query  447  CVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQ  268
            C++ +A    +AEA  SC  +  +++PC+ Y++ GG +P ACC G+K + +  KT  DRQ
Sbjct  1    CMVVAAT---YAEAL-SCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQ  56

Query  267  SACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +AC C+K      +         LP  C V  P++ISP  +CS VQ
Sbjct  57   AACGCLKSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|NP_001044654.1| Os01g0822900 [Oryza sativa Japonica Group]
 dbj|BAD73499.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAD87070.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF06568.1| Os01g0822900 [Oryza sativa Japonica Group]
 gb|EAY76313.1| hypothetical protein OsI_04247 [Oryza sativa Indica Group]
 gb|EAZ13979.1| hypothetical protein OsJ_03904 [Oryza sativa Japonica Group]
 dbj|BAG96400.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99603.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99771.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99850.1| unnamed protein product [Oryza sativa Japonica Group]
Length=120

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = -3

Query  423  PPWA-EAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK  247
            PP A  A  SCS +  T+ PCL Y+  GG +P+ACCGG++ ++       DR++ C C+K
Sbjct  21   PPTAVRAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLK  80

Query  246  -VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             V    +    + R   LP  C V  P++IS  VNC+A+ 
Sbjct  81   NVANGASGGPYITRAAALPSKCNVSLPYKISTSVNCNAIN  120



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V   +AEA  SC  +  +++PC+ Y++ GG +P ACC G+K + +  KT  DRQ+AC C+
Sbjct  4    VAAHYAEAL-SCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCL  62

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      +         LP  C V  P++ISP  +CS VQ
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>gb|ABU49732.1| putative non-specific lipid transfer protein b3 [Solanum tuberosum]
 gb|AFW90593.1| putative non-specific lipid transfer protein b3 mRNA [Solanum 
tuberosum]
 gb|AFX66993.1| non-specific lipid transfer protein 2 [Solanum tuberosum]
Length=114

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPRAEAL-SCGEVTSGLAPCLPYLQGRGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = -3

Query  444  VITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQS  265
            V T A  PP    + SC  +  T++PC +Y+  GGK+P +CC G+K +     T  DR+ 
Sbjct  21   VSTEAAAPP--PPKISCGKVTSTLAPCFEYVLNGGKVPNSCCDGVKSLYKEASTTADRRE  78

Query  264  ACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             C+C+K     A+   +   + LP  C V  P+EI+P ++C+ V+
Sbjct  79   VCVCLKSVTSSASPGVINNAKSLPGKCGVSIPYEITPAIDCNKVK  123



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  S  G +P  CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK      T        GLP  C V  P++ISP  +C++V+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_009146980.1| PREDICTED: non-specific lipid-transfer protein 6 [Brassica rapa]
Length=113

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SC+ +V  + PCL Y+  GG +P  CC G++ +    +T  DRQ  C CIK  +G
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  + + V   Q LP  C V  P+ ISP  NC ++ 
Sbjct  77   GVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNCDSIN  113



>gb|ABU49730.1| putative non-specific lipid transfer protein b1 [Solanum tuberosum]
Length=114

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPRAEAL-SCGEVTSGLAPCLPYLQGRGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -3

Query  417  WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGC  238
            +AEA  SC  +  +++PC+ Y++ GG +P ACC G+K +    KT  DRQ+AC C+K   
Sbjct  8    YAEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAY  66

Query  237  LRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +         LP  C V  P++ISP  +CS VQ
Sbjct  67   NSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWA---EAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            L+ L  L +  S +I  ++   +AQ SC  +   + PCL ++  GGK+  ACC G+K ++
Sbjct  7    LLKLGTLVIFVSMLIMSFSHGGQAQISCDTVDNDLLPCLSFVLNGGKVAPACCSGIKTLL  66

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               KT+ DRQS C C+K     AT  Q+     +P  C V  PF+IS  ++CS V+
Sbjct  67   SLAKTQTDRQSVCSCLKSVAQSATNGQLKNAAQIPHLCGVNVPFQISRNIDCSKVK  122



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -3

Query  417  WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGC  238
            +AEA  SC  +  +++PC+ Y++ GG +P ACC G+K +    KT  DRQ+AC C+K   
Sbjct  8    YAEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAY  66

Query  237  LRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +         LP  C V  P++ISP  +CS VQ
Sbjct  67   NSISGINAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = -3

Query  423  PPWAEAQESCSDLVKTISPCLDYISIGGKIP-QACCGGLKLVVDGLKTKQDRQSACLCIK  247
            PP AEA  SC  +  T+SPC++++  GG  P  +CC G+K + +      DRQ+ C C+K
Sbjct  16   PPQAEAAISCGTVASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLK  75

Query  246  VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                 AT   +     LP  C V  P++ISP  +CS+V 
Sbjct  76   SVASSATPAIISNAAALPGKCGVSIPYKISPSTDCSSVH  114



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 5/120 (4%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MA I  +L+  L+ C++ +A   P  EA  +C  +V  +SPC+ Y+  GG  P ACC G+
Sbjct  1    MATI--KLVCALVACMLVAA---PLTEAAIACGTVVSALSPCIGYLRAGGSPPLACCNGV  55

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            + + +  +T  DRQ AC C++                LP  C V  P++IS   NCS V+
Sbjct  56   RALNNAARTTPDRQEACRCLQNAARSMGGLNEANAGSLPGKCGVNIPYKISTSTNCSTVK  115



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P  A+A  +C  +   ++ C+ YI+ GG +P ACC G+K +   
Sbjct  6    KLAFLVLACMIVAG--PITAKAALTCGTVTSNVAACIGYITQGGPVPGACCSGIKNLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD-QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C+K        +    R  GLP  C V  PF IS   NC++V+
Sbjct  64   ARTTPDRQQACRCLKTAANALGPNLNAGRAAGLPKACGVNVPFPISTSTNCNSVK  118



>gb|AEN70935.1| lipid transfer protein [Gossypium aridum]
 gb|AEN70937.1| lipid transfer protein [Gossypium lobatum]
Length=120

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 62/113 (55%), Gaps = 5/113 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            +L  +L+LC++  A   P A+   +C  +  +++PC+ Y+  +  G +PQ CCGG+K + 
Sbjct  8    KLACVLVLCMVVGA---PLAQGAVTCGQVTTSLAPCIGYLRGNGAGTVPQGCCGGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPSKCGVNIPYKISPSTDCN  117



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (54%), Gaps = 2/115 (2%)
 Frame = -3

Query  468  LMSLLLLCVITSA--VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
            + +L L+C + +   V+ P A+A  +C  +  +++PC+ Y+  GG +P  CC G+K + +
Sbjct  1    MAALKLVCALVACMLVVSPVAQAAITCGQVTSSVAPCIQYLRSGGSVPPPCCNGIKSLNN  60

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              +T  DRQ AC C++               GLP  C V  P++IS   NC++V+
Sbjct  61   AARTTPDRQQACRCLQNAAKAIPGINTNLAAGLPGKCGVNIPYKISTSTNCASVK  115



>ref|NP_001275027.1| non-specific lipid transfer protein a7 precursor [Solanum tuberosum]
 gb|ABU49727.1| non-specific lipid transfer protein a7 [Solanum tuberosum]
 gb|ABU49729.1| putative non-specific lipid transfer protein f10 [Solanum tuberosum]
Length=114

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC  +   ++PCL Y+   G +   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPHAEAL-SCGQVTSGLAPCLPYLQGSGPL-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>ref|XP_011005034.1| PREDICTED: non-specific lipid-transfer protein 8-like [Populus 
euphratica]
Length=108

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDG  292
            + +L++  ++T     P ++A  SCSD++K + PC++Y+  G GK P ACC G+  +   
Sbjct  1    MAALMMFLLVT-----PPSDAAISCSDVIKDLRPCVNYLMNGTGKPPAACCSGISSIQAA  55

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
              T  D+QSAC CIK    +      +  Q LP  C +  PF +SP V+CS +
Sbjct  56   ASTTADKQSACNCIKSASKQMNPKPQLA-QALPANCGITLPFTVSPNVDCSKI  107



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 63/112 (56%), Gaps = 5/112 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            +++ C++  A   P AEA  +C  +V ++ PCL Y++ GG +  ACC G+K + +  +T 
Sbjct  15   VVMFCMVAGA---PKAEAAVTCGQVVNSLVPCLSYVTNGGALNPACCNGVKTLYNLAQTT  71

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+ C C+K  +  +  T        GLP  C V  P++ISP  +C +V+
Sbjct  72   PDRQNVCNCLKQAINGIPYTNTNAGLAAGLPARCGVNIPYKISPSTDCKSVK  123



>ref|XP_006355279.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            ++  L++LC+I   V+ P AEA  SCS +   ++PCL Y+   G +   CCGG+K ++  
Sbjct  6    KIACLVVLCMI---VVAPHAEAL-SCSQVTSGLAPCLPYLQGRGPL-GGCCGGVKGLLGA  60

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DR++AC C+K          V +  G+P  C V  P++ISP  +CS VQ
Sbjct  61   AKTPADRKTACTCLKSAATAIKGIDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  114



>gb|ABU49731.1| putative non-specific lipid transfer protein a1 [Solanum tuberosum]
Length=114

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  SC ++   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPRAEAL-SCGEVTSGLAPCLPYLQGRGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT +DR++AC C+K            +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAVGLPGVCGVSIPYKISPSTDCSKVQ  114



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  S  G +P  CC G+K + 
Sbjct  5    MSLKLACVVVLGMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      T        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPNTDCN  117



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGK--IPQACCGGLKLVVDGLK  286
            +L + ++  A+ PP AEA  SC  +   +SPC++Y+  GG    P  CC G+K + +   
Sbjct  8    VLAVTMVVVALAPPQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIKTLYNQAS  67

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +  DRQ+ C C+K    +A+   +     LP  C V  P+EISP  +CS V 
Sbjct  68   STADRQAVCGCLKSVAGQASPAIIGTAAALPGKCGVSIPYEISPSTDCSKVH  119



>gb|ABR08655.1| lipid transfer protein [Populus alba x Populus glandulosa]
Length=116

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKL  304
            + G + + +LLLC++ SA  P       +C  +   ++PC+ Y+  GGK+P  CC G+  
Sbjct  1    MAGAKSVCVLLLCMVLSA--PMLNVEALTCGVVASNLAPCIGYLRNGGKVPDPCCKGVGA  58

Query  303  VVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            + +  KT +DR+ AC CIK    +           LP +C+V  P++IS   NC++++
Sbjct  59   LNNAAKTTKDRRDACNCIKTTATQIGGVNAANAAALPGFCRVNIPYKISTSTNCASIK  116



>ref|XP_006644921.1| PREDICTED: non-specific lipid-transfer protein 6-like [Oryza 
brachyantha]
Length=120

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = -3

Query  423  PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK-  247
            P    A  SCS +  T+ PCL Y+  GG +P+ACCGG++ ++       DR++ C C+K 
Sbjct  22   PGGVRAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKS  81

Query  246  VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            V    +    + R   LP  C V  P++IS  VNC+A+ 
Sbjct  82   VANGASGGPYITRAAALPSKCNVSLPYKISTSVNCNAIN  120



>emb|CDY33268.1| BnaA01g19350D [Brassica napus]
Length=146

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +LL++C++ SA   P AEA  SC  +   +  C++Y++ GG +P+ CC G++ +   
Sbjct  6    KLSTLLIVCMLVSA---PMAEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLHSM  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAV  133
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ +
Sbjct  63   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRISYPISARTNCNKI  116



>ref|XP_011011316.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=116

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKL  304
            + G + + +LLLC++ SA  P       SC  +   ++ CL Y+  GGK+P  CC G++ 
Sbjct  1    MAGAKTVCVLLLCMVLSA--PMLNVEALSCGVVAGNLAQCLGYLRNGGKVPAVCCKGVEA  58

Query  303  VVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            + +  KT QDR+ AC CIK    +           LP  C V  P++IS   NC++++
Sbjct  59   LNNAAKTTQDRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVNIPYKISTSTNCASIK  116



>ref|XP_006407743.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49196.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=113

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SC+ +V  + PC+ Y+  GG +P +CC G++ +    +T  DRQS C CIK  +G
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +  + + +     LP  C V  P+ ISP  NC ++ 
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDSIN  113



>ref|XP_006281297.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
 gb|EOA14195.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
Length=137

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 71/135 (53%), Gaps = 7/135 (5%)
 Frame = -3

Query  531  ITFLLYKSNEDCYTMAIIGKQLMSLLL-LCVITSAVIPPWAEAQESCSDLVKTISPCLDY  355
            + F  ++  +   TMA+  + L  L+L +C++ SA      +A  SC  +  +++PC +Y
Sbjct  9    LQFCYHQKKKRANTMALALRFLTCLVLTVCIVASA------DAAISCGTVATSLAPCANY  62

Query  354  ISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVP  175
            +S GG++P  CCGG+K ++   +T  DRQ AC C++      +        GLP  C V 
Sbjct  63   LSKGGEVPVPCCGGVKSLISMAQTTPDRQQACRCLQSTAKGMSGLDPSLASGLPGKCGVS  122

Query  174  FPFEISPIVNCSAVQ  130
             P+ IS   NC  V+
Sbjct  123  IPYPISMSTNCDNVK  137



>ref|NP_001238176.1| uncharacterized protein LOC100305883 precursor [Glycine max]
 gb|ACU13784.1| unknown [Glycine max]
Length=125

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAV-IPPWAEAQESCSDLVKTISPCLDYISIGGK-IPQACCGGLKLV  301
            ++L+ + ++C++   + I P A+A  +C+ +V  ++PC+ Y+  GGK +P  CC G+K +
Sbjct  7    EKLLWMAIVCLVLGVISITPKAQAAVTCNQVVSNLTPCISYVLNGGKTVPGPCCNGIKTL  66

Query  300  VDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +   +  DRQ+ C CIK  V         V R   LP  C V  P +ISP  +C+ VQ
Sbjct  67   FNLAHSTPDRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGVNIPCQISPSTDCTRVQ  125



>sp|A0AT29.1|NLTP2_LENCU RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
7; Short=LTP7; Flags: Precursor [Lens culinaris]
 gb|AAX35807.1| lipid transfer protein 2 precursor [Lens culinaris]
Length=118

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 5/111 (5%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKT  283
            +L++C++   VI P AE   SC  +   +SPCL Y++ G G  PQ CCGG+K ++    T
Sbjct  11   VLVICMV---VIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQ-CCGGVKKLLAAANT  66

Query  282  KQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              DRQ+AC C+K      T         LP  C V  P++IS   NC+ V+
Sbjct  67   TPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK  117



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (57%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   ++LC++ +A   P AEA  +C  +   ++PCL Y+   G + + CC G+
Sbjct  1    MEMAGK-IACFVVLCMLVAA---PHAEAL-TCGQVTSNLAPCLPYLRNKGPLGR-CCSGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K +++  +T QDRQ+AC C+K      +   + +  GLP  C V  P+ ISP  +CS VQ
Sbjct  55   KGLLNAARTTQDRQTACTCLKSAAGAISGINLRKAAGLPSTCGVNIPYNISPSTDCSKVQ  114



>emb|CDP07650.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 61/115 (53%), Gaps = 2/115 (2%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVD  295
            Q +  L+   +   +I P ++A  +C D+ K I+PC+DY+  G G  P  CCGG+K +  
Sbjct  6    QAIIFLMAAFLVLFLIAPASDAAVTCGDVAKKIAPCVDYLRSGSGAPPPPCCGGVKALAA  65

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               T  D+Q+AC C+K       +   +  Q LP  C V  P+ ISP  +C+ ++
Sbjct  66   SATTTPDKQAACACLKTQSKNLNIKPELA-QALPGNCGVSLPYPISPNFDCTTIR  119



>gb|ACE07186.1| Art v 3.0201 allergen precursor [Artemisia vulgaris]
Length=114

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            ++M      V+   V   +AEA + CSD+   IS CL Y+  GG++P  CC G+K + D 
Sbjct  2    KMMKFFCAMVVCMVVSSSYAEALK-CSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDA  60

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQG-LPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K    ++  D    F   LP  C V  P++IS   +C+ V+
Sbjct  61   AKTTPDRQTACNCLKTT-FKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK  114



>ref|XP_009615065.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=125

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 7/126 (6%)
 Frame = -3

Query  489  MAIIGKQLMS--LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGK--IPQAC  322
            MAI   Q +S  L LLC++  +   P AEA  SCS +   ++PCL Y+    K   P  C
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLMGSSKQAAPAGC  60

Query  321  CGGLKLVVDGLKTKQDRQSACLCIKVGC--LRATVDQVIRFQGLPDYCKVPFPFEISPIV  148
            C G++ +     T  DRQS C C+K G   L +++D   +   L   C V  P++ISP +
Sbjct  61   CSGIQSLYTAASTTADRQSVCSCLKAGAASLGSSID-TNKAATLLSKCGVTVPYKISPNI  119

Query  147  NCSAVQ  130
            +CS V 
Sbjct  120  DCSKVH  125



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  465  MSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLK  286
            M +LL+  + +  + P  EA   C  +V  ++PCL Y++  G +  +CCGG+K +    +
Sbjct  8    MCILLIAAVLAMAVAPRGEAAIGCGTVVSYLNPCLPYVTNKGPL-GSCCGGVKGLYGAAQ  66

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            T QDRQS C C+K          + +  GLP  C V  P++ISP  +CS V 
Sbjct  67   TAQDRQSVCSCLKSLAGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|XP_009115846.1| PREDICTED: non-specific lipid-transfer protein 5 [Brassica rapa]
 emb|CDX73711.1| BnaC08g22920D [Brassica napus]
Length=118

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ SA  P  +EA  SC  +   +  C++Y++ GG +P+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVSA--PMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVRRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRIAYPISARTNCNKVR  118



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            L+L+C++ +  + P AEA  +C+ +   +  CL Y+  GG +P  CC G++ +    KT 
Sbjct  10   LVLMCMLVAVSLAPHAEA-ITCNTVAGDLGACLGYLQKGGAVPAGCCTGIRSLNSQAKTT  68

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DR++AC C+K    R  V+Q +   GLP  C V   + IS   NC++VQ
Sbjct  69   VDRRTACSCLKSLAGRVRVNQGL-AAGLPGKCGVNVGYPISTSTNCNSVQ  117



>gb|AEN70917.1| lipid transfer protein [Gossypium schwendimanii]
Length=120

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISI--GGKIPQACCGGLKLVVDGLK  286
            +L+LC++  A   P A+   +C  +  +++PC+ Y++    G +PQ CCGG+K +    +
Sbjct  12   VLVLCMVVGA---PLAQGAVTCGQVTTSLAPCIGYLTGNGAGTVPQGCCGGIKSLNSAAQ  68

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
            T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  69   TTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A   C  +V ++ PC++Y+  GG IP  CC G+K + +   +  DRQ+AC CIK  
Sbjct  21   PHADAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                          LP  C V  P++ISP ++CS VQ
Sbjct  81   AASIKGINFSHAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_006362359.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=115

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
             +++  + LC++   V+ P AEA  SCS +  +++PC+ Y+   G +   CCGG+K +V 
Sbjct  5    SKIVCFVFLCMV---VVAPHAEAM-SCSQVSSSLAPCVPYLQGRGPL-GGCCGGVKSLVG  59

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
             +KT  DR++AC CIK            R  GLP  C V  P++ISP V+CS
Sbjct  60   AIKTPADRRTACTCIKSVANAVKGLDTGRAAGLPSTCGVNIPYDISPSVDCS  111



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  +  G +PQ CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK               GLP  C V  P++ISP  +CS V+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDCSRVK  120



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            MSL L C +  A++   P AEA  SC  +  +++ C+ Y+  GG +P ACC GLK +   
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSA  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              T  DRQ  C C+K    + +        GLP  C V   ++ISP  +C +V+
Sbjct  65   ATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_006296741.1| hypothetical protein CARUB_v10014964mg [Capsella rubella]
 gb|EOA29639.1| hypothetical protein CARUB_v10014964mg [Capsella rubella]
Length=113

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = -3

Query  417  WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--V  244
            + EA  SC+  V  + PC+ Y+  GG  P +CC GL+ +    +T  DRQS C CIK  +
Sbjct  16   FGEAAVSCNTAVAELYPCISYVLQGGNPPDSCCSGLRTLSSQAQTPPDRQSVCRCIKSAI  75

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            G +  T + +     LP  C +  P++ SP  NC ++ 
Sbjct  76   GGVSYTSNNLNNALALPSKCGINLPYKFSPSTNCDSIH  113



>emb|CDY36007.1| BnaA05g29430D [Brassica napus]
Length=111

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SC+ +V  + PCL Y+  GG +P  CC G++ +    +T  DRQ  C CIK  +G
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNC  142
             +  + + V   Q LP  C V  P+ ISP  NC
Sbjct  77   GVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNC  109



>ref|XP_006369490.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
 gb|ERP66059.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
Length=108

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 7/113 (6%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDG  292
            + +L++  ++T     P +EA  SCSD++K + PC+ Y+  G GK P ACC G+  +   
Sbjct  1    MAALMMFLLLT-----PPSEAAISCSDVIKDLRPCVSYLMNGTGKPPAACCSGISAIQAS  55

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
              T  D+Q+AC CIK    +      +  Q LP  C +  PF +SP V+CS +
Sbjct  56   ASTTADKQAACNCIKSASKQINPSPQLA-QALPANCGITLPFTVSPNVDCSKI  107



>ref|NP_001236948.1| uncharacterized protein LOC100306062 precursor [Glycine max]
 gb|ACU14054.1| unknown [Glycine max]
Length=125

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (54%), Gaps = 1/99 (1%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P AEA+  C  +  T++PC+ Y+   GG +P ACC G++ +    KT  DRQ  C C+K 
Sbjct  27   PLAEAEIPCGRVQITVAPCIGYLRGPGGGVPAACCNGVRSINKEAKTTPDRQGVCRCLKT  86

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQK  127
              L      +     LP  C V  P++ISP ++C+ V+ 
Sbjct  87   TALSLPGLNLATLAALPSKCGVNLPYKISPTIDCNTVKH  125



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC+ Y+  +  G IP  CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRF---QGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK     AT  + I F    GLP  C V  P++ISP  +C++V+
Sbjct  65   SAAQTTPDRQAACKCIKS---AATGIRGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_002879751.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56010.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P  + A  SC  +   ++PC+ Y+  GG IP  CC G++ + + 
Sbjct  6    KLACLVLACMIVAG--PITSNAALSCGSVNSNLAPCIGYVLQGGTIPAGCCSGVRNLNNI  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD--QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ AC CI+ G  RA        R  G+P  C V  P++IS   NC  V+
Sbjct  64   AKTTPDRQQACNCIQ-GAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR  118



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            MSL L C +  A++   P AEA  SC  +  +++ C+ Y+  GG +P ACC GLK +   
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSA  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              T  DRQ  C C+K    + +        GLP  C V   ++ISP  +C +V+
Sbjct  65   ATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_008388345.1| PREDICTED: non-specific lipid-transfer protein 1-like [Malus 
domestica]
Length=119

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (54%), Gaps = 4/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQ-ESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
            +L  + L+C++  A   P+A+A   SC  +   ++PC+ Y+  GGK+P  CC G++ + D
Sbjct  8    KLAFVALVCIVVGA---PFAQATISSCGQVTNYVAPCIPYLKTGGKVPPTCCQGIQKLND  64

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              +T  DR++AC C+     +    +     GLP  C V  P+ I P   C+++Q
Sbjct  65   AAQTAPDRRTACTCLVNTATKVQGIKPNLIYGLPGACGVRLPYPIGPNTKCNSIQ  119



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            L+L+C++   V  P A    SC D+   ++PC++Y+   G +P ACC G+K + +   T 
Sbjct  12   LVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATT  68

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            QDR++AC C+       +        GLP  C V  P++ISP  NC  V 
Sbjct  69   QDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  118



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            L+L+C++   V  P A    SC D+   ++PC++Y+   G +P ACC G+K + +   T 
Sbjct  33   LVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATT  89

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            QDR++AC C+       +        GLP  C V  P++ISP  NC  V 
Sbjct  90   QDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  139



>gb|ADY68820.1| lipid transfer protein 3 [Gossypium herbaceum subsp. africanum]
 gb|ADY68822.1| lipid transfer protein 3 [Gossypium barbadense]
 gb|ADY68824.1| lipid transfer protein 3 [Gossypium hirsutum]
 gb|AEN70921.1| lipid transfer protein [Gossypium darwinii]
 gb|AEN70923.1| lipid transfer protein [Gossypium tomentosum]
 gb|AEN70925.1| lipid transfer protein [Gossypium barbadense var. brasiliense]
 gb|AEN70927.1| lipid transfer protein [Gossypium barbadense var. peruvianum]
 gb|AEN70929.1| lipid transfer protein [Gossypium hirsutum subsp. latifolium]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  S  G +P  CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      T        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCN  117



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P  A A  +C  +   ++PC+ YI+ GG +P+ACC G+  +   
Sbjct  6    KLACLVLACMIVAG--PITANAALTCGTVNSNVAPCIGYITQGGPLPRACCTGVSKLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD-QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C+K        +    R  G+P  C V  PF IS   NC+ V+
Sbjct  64   ARTTPDRQQACRCLKTAASALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK  118



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  +  G IP  CC G+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK               GLP  C V  P++ISP  +CS+V+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>ref|XP_006403900.1| hypothetical protein EUTSA_v10010829mg [Eutrema salsugineum]
 gb|AGC11819.1| putative lipid transfer protein 5 [Eutrema halophilum]
 gb|ESQ45353.1| hypothetical protein EUTSA_v10010829mg [Eutrema salsugineum]
Length=118

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ SA  P  +EA  SC  +   +  C++Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVSA--PLASEAAISCGAVASNLGQCINYLTRGGFIPRGCCSGVQRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRISYPISARTNCNRVR  118



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
            K +  L+LLC++   V+ P A    +C  +      C+ Y+  GG  P ACC G++ +  
Sbjct  5    KLICGLVLLCML---VLEPMATTALTCGQVASQTGSCIRYLQRGGNPPAACCNGVRNLNR  61

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              +T +DRQ+AC C++      +        GLP  C V  P++ISP  NC+ V+
Sbjct  62   QARTTRDRQTACRCLQTAARTISGINAKLAAGLPAKCGVKIPYKISPSTNCNRVR  116



>gb|AAY43801.1| FSLTP3 [Gossypium hirsutum]
Length=116

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  S  G +P  CC G+K + 
Sbjct  1    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLN  60

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      T        GLP  C V  P++ISP  +C+
Sbjct  61   SAAQTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCN  113



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            +C  +  +++PCL Y+ +GG +P  CC  +K +    KT  DRQ+AC C+K     A+  
Sbjct  2    TCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSA---ASSI  58

Query  219  QVIRFQ---GLPDYCKVPFPFEISPIVNCSAVQ  130
            + + F    GLP  C V  P++ISP  +CS+V+
Sbjct  59   KGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK  91



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A    +C  +  ++S C+ Y+  GG IP +CC G++ +    KT  DR++ C C+K  
Sbjct  22   PHAANAITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKST  81

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
              R +  +     GLP  C V  PF ISP  +CS V
Sbjct  82   AARISGIKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC++Y+  +  G +P  CCGG+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASISGINFGIASGLPGKCGVNIPYKISPSTDCN  117



>ref|XP_006407744.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49197.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=129

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SC+ +V  + PC+ Y+  GG +P +CC G++ +    +T  DRQS C CIK  +G
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNC  142
             +  + + +     LP  C V  P+ ISP  NC
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNC  109



>ref|XP_009797053.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M ++GK +   L+LCV+   VI P AEA  SC  +   ++PCL Y+   G +   CCGG+
Sbjct  1    MEMVGK-IACFLVLCVV---VIAPHAEAL-SCGQVQSGLAPCLPYLQGRGPL-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   K+  DR++AC C+K          + +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKSPADRKTACTCLKSAANAIKGIDMGKAAGLPSACGVNIPYKISPSTDCSKVQ  114



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  465  MSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLK  286
            +S+ L+  + +  + P +EA  +C  +V  +  CL Y++  G +  +CC G+K +    K
Sbjct  8    LSIFLIAAVLAMAVAPRSEAAITCGTVVSDLDSCLSYLTNKGPL-GSCCSGVKGLYGAAK  66

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            T QDRQS C C+K      T   + +  GLP  C V  P++ISP  +CS V 
Sbjct  67   TTQDRQSVCNCLKSLADSYTDVDLSKAAGLPGQCGVNIPYKISPSTDCSTVH  118



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+ L+L C+I +   P  A A  +C  +   ++PC+ YI+ GG +P ACC G+  +   
Sbjct  6    KLVCLVLACMIVAG--PITANAALTCGTVNSNVAPCIGYITQGGPLPGACCTGVSKLNSM  63

Query  291  LKTKQDRQSACLCIKVG--CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C+K     L  +++   R  G+P  C V  PF IS   NC++V+
Sbjct  64   ARTTPDRQQACRCLKTAASALGPSLNAG-RAAGIPKACGVSVPFPISTNTNCNSVK  118



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ + + 
Sbjct  8    KLALVVALCMVVSV---PIAQAL-TCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   AKTTADRQTACNCLKQ--LSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK  117



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ + + 
Sbjct  8    KLALVVALCMVVSV---PIAQAL-TCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNINNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   AKTTADRQTACNCLKQ--LSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK  117



>ref|XP_002323069.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
 gb|ABK95798.1| unknown [Populus trichocarpa]
 gb|EEF04830.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
Length=116

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            +LLLC++ SA  P       SCS +   ++ CL Y+  GG +P ACC G+  + +  KT 
Sbjct  9    VLLLCMVLSA--PMLNVEALSCSVVASNLAQCLTYLRNGGAVPPACCKGVGTLNNAAKTT  66

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            QDR+ AC CIK    +           LP  C V  P++IS   NC++++
Sbjct  67   QDRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVNIPYKISTSTNCASIK  116



>ref|XP_006429570.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
 ref|XP_006481183.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42810.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 61/113 (54%), Gaps = 5/113 (4%)
 Frame = -3

Query  462  SLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISI--GGKIPQACCGGLKLVVDGL  289
            ++LL+C++  A   P A+A  +C  +  ++  C+ Y++   GG +P ACC G+K +    
Sbjct  8    AVLLMCMVMGA---PIAQAAVTCGQVTSSLQACMPYVTGPGGGAVPPACCSGIKSLNSAA  64

Query  288  KTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             T  DRQS C C+K          +    GLP  C V  P++ISP V+CS V+
Sbjct  65   TTTPDRQSVCNCLKTAAGSIRNLNLNLASGLPRQCGVNIPYQISPSVDCSRVR  117



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ + + 
Sbjct  8    KLALVVALCMVVSV---PIAQAL-TCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   AKTTADRQTACNCLKQ--LSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK  117



>emb|CDY16295.1| BnaC01g23300D [Brassica napus]
Length=116

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +LL++C++ SA  P  +EA  SC  +   +  C++Y++ GG +P+ CC G++ +   
Sbjct  6    KLSTLLIVCMLVSA--PMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVQRLHSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCS  139
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRISYPISARTNCN  115



>ref|XP_008388344.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIP--PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            QL+ L  L V+   ++   P AEA  +C  +V  ++PC+ Y+  GG +  ACC G++ + 
Sbjct  6    QLLKLACLVVVMFCMVACVPKAEAAVTCGQMVSDLTPCISYVKXGGALAPACCNGVRTLF  65

Query  297  DGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQS C C+K  +  +  T        GLP  C V  P++ISP  +C +V+
Sbjct  66   TLAQTXPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCSVNIPYKISPSTDCKSVK  123



>ref|XP_009778826.1| PREDICTED: uncharacterized protein LOC104228120 [Nicotiana sylvestris]
Length=226

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = -3

Query  411  EAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLR  232
            EA  S   +  ++ PC+ Y+  GG +P  CC GLK ++   KT+ DRQS C C K     
Sbjct  50   EALLSSDTVYSSLQPCIGYVLGGGTLPPECCSGLKSLISIAKTRPDRQSFCSCAKGAASS  109

Query  231  ATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQK  127
             T +++ R  GL   C    PF+ISP ++CS  Q+
Sbjct  110  TTPEELARANGLAGRCHARVPFKISPDMDCSKAQQ  144



>gb|ABH03042.1| non-specific lipid transfer protein [Solanum sogarandinum]
Length=114

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
             +LLC++   V+ P AEA  +C  +  +++PC  Y+   G +   CCGG+K ++   +T 
Sbjct  10   FVLLCMV---VVAPHAEAL-TCGQVTSSLAPCFPYLMNRGPL-GGCCGGVKSLLGQAQTT  64

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+AC C+K      T   + +  GLP  C V  P++ISP  +CS VQ
Sbjct  65   ADRQTACTCLKSAASSFTGLDLGKAAGLPSACSVNIPYKISPSTDCSKVQ  114



>ref|XP_007033549.1| Lipid transfer protein 3, putative [Theobroma cacao]
 gb|EOY04475.1| Lipid transfer protein 3, putative [Theobroma cacao]
Length=115

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+  L+LC++   V+ P A +  SC+++   +S C+ Y+  GG +P  CC GLK +   
Sbjct  5    KLVCALVLCML---VVEPMATSAISCANVAGMLSSCIKYLRNGGSLPSNCCAGLKSLNTQ  61

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             + K  RQ+ C C++      T  +    +GLP  C V  P++IS   NC+ V+
Sbjct  62   ARNKGIRQAVCRCLQNAAKTITGLKTNLVEGLPRRCGVKIPYKISTSTNCNRVK  115



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++L C++  AV P  AE   SC  +   ++PCL Y++ GG +P  CC G+K ++  
Sbjct  6    KLACVVLACMV--AVAPYAAEGAISCGMVTSKMAPCLGYLT-GGTLPATCCAGVKSLLAS  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K                LP  C V  P++ISP  +C+ VQ
Sbjct  63   AQTTPDRQAACSCLKSASGGIAGLNYGNAASLPSKCGVNIPYKISPSTDCTKVQ  116



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -3

Query  489  MAIIGKQLMSLLL--LCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCG  316
            MA  G   +SL +  L +I S+      +A  SC  L   +SPC++Y   GG +P ACC 
Sbjct  1    MASYGVMKLSLTVAVLSMIISSGPYVHVDAAISCGQLASLLSPCVNYFVKGGPLPPACCS  60

Query  315  GLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSA  136
            G++ +    KT  DRQ+ C C+K          +     +P  C V FP++ISP  +CS 
Sbjct  61   GVRTLNSAAKTTADRQATCQCLKSAAASIPGLNLGLANSIPGKCGVNFPYKISPSTDCSR  120

Query  135  VQ  130
            V+
Sbjct  121  VR  122



>ref|XP_002877813.1| hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54072.1| hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ +A  P  +EA  SC  +  ++  C +Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVAA--PMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLHSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR  118



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = -3

Query  480  IGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLV  301
            +   +M L L+ +I   V  P A+A  +C  + + ++PC +Y+  GG +P ACC G++ +
Sbjct  1    MASAVMKLALVALICIVVAVPVAQA-ITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSL  59

Query  300  VDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                KT  DR+  C C+K               GLP  C V  P++IS   NC+ V+
Sbjct  60   NSAAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK  116



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  SC  +V +++PC++Y+  GG IP ACC G+K +     +  DRQ+AC CIK  
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVN  145
                +         LP  C V  P++ISP ++
Sbjct  81   AGSISGINFGLASSLPGKCGVNLPYKISPSID  112



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 63/116 (54%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            +L  +++LC++  A   P A+   +C  +  +++PC++Y+  +  G IP  CC G+K + 
Sbjct  8    KLACVVVLCMVVGA---PLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQ+AC CIK               GLP  C V  P++ISP  +CS+V+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>gb|KHG13955.1| Non-specific lipid-transfer 1 [Gossypium arboreum]
Length=114

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 66/119 (55%), Gaps = 14/119 (12%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+  L+LC++   V+ P A    +C D+   ++ CL Y+  GG +P+ACC G++ + + 
Sbjct  5    KLVCALVLCML---VVEPIATTAITCGDVTSKVAGCLSYLQNGGNVPKACCDGIRSLNNM  61

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQG-----LPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+ C     GCL+A   + ++ +G     LP  C V  P++IS   NC  V+
Sbjct  62   ARTTPDRQTVC-----GCLQAAA-KAVKIKGNLAETLPAKCSVNIPYKISTSTNCKNVK  114



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 3/117 (3%)
 Frame = -3

Query  480  IGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLV  301
            +G +L   +L+ ++ SA   P AEA  SC  +  +++ C+ Y+  GG +P ACC GLK +
Sbjct  5    MGLKLTYAMLIAMVVSA---PLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGL  61

Query  300  VDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                 T  DRQ  C C+K    + +        GLP  C V   ++ISP  +C +V+
Sbjct  62   NSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 6/123 (5%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQE----SCSDLVKTISPCLDYISIGG-KIPQACC  319
            ++ KQL SLLL+C I  A  P  A        +CS +   + PCL Y+  GG  +P  CC
Sbjct  1    MLNKQLFSLLLIC-IAVATTPSIAAEDAITVVTCSTVYSRLEPCLGYVLGGGLSVPSECC  59

Query  318  GGLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
             G+K +    +T  DRQ  C C+K     AT  ++ R   L   CKV   F+I P  +CS
Sbjct  60   NGIKSLHRAARTTADRQRFCRCLKNVRSNATNTRISRASQLTGICKVNALFKIRPDFDCS  119

Query  138  AVQ  130
             V+
Sbjct  120  KVK  122



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            L+L+C++   V  P A    SC D+   ++PC++Y+   G +P ACC G+K + +   T 
Sbjct  12   LVLMCML---VASPMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATT  68

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNC  142
            QDR++AC C+       +        GLP  C V  P++ISP  NC
Sbjct  69   QDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNC  114



>emb|CDY27974.1| BnaC05g43760D [Brassica napus]
Length=111

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = -3

Query  414  AEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--VG  241
             EA  SC+ +V  + PCL Y+  GG +P  CC G++ +    +T  DRQ  C CIK  +G
Sbjct  17   GEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAIG  76

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNC  142
             +  + + +   Q LP  C V  P+ ISP  NC
Sbjct  77   GVSFSSNNLNNAQSLPAKCGVNLPYSISPSTNC  109



>ref|NP_001234074.1| non-specific lipid-transfer protein 1 precursor [Solanum lycopersicum]
 sp|P27056.1|NLTP1_SOLLC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA39512.1| TSW12 [Solanum lycopersicum]
Length=114

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            ++   +LLC++   V+ P AEA  +C  +   ++PCL Y+   G +   CCGG+K ++  
Sbjct  6    KIACFVLLCMV---VVAPHAEAL-TCGQVTAGLAPCLPYLQGRGPL-GGCCGGVKNLLGS  60

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DR++AC C+K          + +  G+P  CKV  P++ISP  +CS VQ
Sbjct  61   AKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ  114



>gb|AGC08426.1| lipid transfer protein [Gossypium hirsutum]
Length=120

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 5/112 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVVDGLK  286
            +++LC++  A   P A+   +C  +  +++PC++Y+  +  G +PQ CC G+K +    +
Sbjct  12   VVVLCMVVGA---PLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSAAQ  68

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            T  DRQ+AC CIK               GLP  C V  P++ISP  +C+ VQ
Sbjct  69   TTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDCNKVQ  120



>ref|XP_002884695.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60954.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = -3

Query  417  WAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK--V  244
            + EA  SC+ ++  + PCL Y++ GG +P  CC GL  +    +T  DRQ  C CIK  +
Sbjct  16   FGEAAVSCNTVIADLYPCLSYVTQGGPVPSLCCNGLTTLNSQAQTSADRQGVCRCIKSAI  75

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            G L  +   +     LP  C +  P++ SP  NC +++
Sbjct  76   GGLTLSPGTIDNALSLPSKCGINLPYKFSPSTNCESIK  113



>emb|CDX78016.1| BnaA09g32110D [Brassica napus]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ SA  P  +EA  SC  +   +  C++Y++ GG +P+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVSA--PMASEAAISCGAVASNLGQCINYLTRGGFVPRGCCSGVRRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCS  139
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNPGRAARLPGACRVRIAYPISARTNCN  115



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 2/122 (2%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            MA  G Q +  L++  + +A+    AEA  +C  +V  ++PC  YI  GG     CCGG+
Sbjct  1    MAFSGVQKVVFLVMLSMAAALSFGGAEAALTCGQVVNKLTPCASYIQNGGTPAANCCGGI  60

Query  309  KLVVDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSA  136
            + +    +T  DRQS C C+K  +  +  T  +     GLP  C V  P++I+P  +C +
Sbjct  61   RALYGMAQTTPDRQSVCNCLKQAIAGIPYTGAKAGLAAGLPGKCGVNIPYKINPSTDCKS  120

Query  135  VQ  130
            ++
Sbjct  121  IK  122



>sp|A0AT31.1|NLTP5_LENCU RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP5; 
Flags: Precursor [Lens culinaris]
 gb|AAX35809.1| lipid transfer protein 5 precursor [Lens culinaris subsp. culinaris]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKT  283
            +L++C+I    + P AE   SC  +   +SPCL Y++ G G  PQ CCGG+K ++    T
Sbjct  11   VLVMCMI----VAPMAEGAISCGAVTGDLSPCLTYLTGGPGPSPQ-CCGGVKKLLAAANT  65

Query  282  KQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              DRQ+AC C+K      T         LP  C V  P++IS   NC+ V+
Sbjct  66   TPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK  116



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  +C  +   +SPC  Y+  GGK  QACC G+K +    KT  DRQ AC C+K  
Sbjct  24   PMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKN-  82

Query  240  CLRATVDQVI---RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             L   + Q +       LP  C V  P++IS   NC+ ++
Sbjct  83   -LANNMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATIK  121



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 60/116 (52%), Gaps = 4/116 (3%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   SC  +   ++PC+ Y+  +  G  P ACC G++ + 
Sbjct  5    MSLKLTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               KT  DRQ+AC CIK      +        GLP  C +  P++ISP  +C +++
Sbjct  65   SAAKTTPDRQAACSCIKSAATGISGINYSTAAGLPGKCGINIPYKISPSTDCKSIK  120



>emb|CBW38502.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            SC  +  +++PC+ Y++ GG +P ACC G+K +    KT  DRQ+AC C+K      +  
Sbjct  13   SCGQVSFSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGI  72

Query  219  QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                   LP  C V  P++ISP  +CS VQ
Sbjct  73   NAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>ref|XP_010043259.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010043269.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Eucalyptus grandis]
Length=124

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 2/103 (2%)
 Frame = -3

Query  432  AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLC  253
            A +PP      SC+ +V  + PC  Y+  GG +P ACC G++ +    KT  DRQ  C C
Sbjct  22   ANVPPATPQMSSCNQVVNRLMPCASYVVNGGGVPPACCSGIQSLNSTAKTTADRQGVCNC  81

Query  252  IK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +K  +  + +    +    GLP  C V  P++ISP  +C +V+
Sbjct  82   LKSVLNGIPSNAYNISLATGLPATCGVDIPYKISPSTDCKSVK  124



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P A+A  +C  +   +SPC  Y+  GGK  QACC G+K +    KT  DRQ AC C+K  
Sbjct  24   PMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKN-  82

Query  240  CLRATVDQVI---RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             L   + Q +       LP  C V  P++IS   NC+ ++
Sbjct  83   -LANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>sp|O24037.1|NLTP1_SOLPN RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=LpLTP1; Flags: Precursor [Solanum pennellii]
 gb|AAB07486.1| lipid transfer protein 1 [Solanum pennellii]
Length=114

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            ++   +LLC++   V+ P AEA  +C  +   ++PCL Y+   G +   CCGG+K ++  
Sbjct  6    KIACFVLLCMV---VVAPHAEAL-TCGQVTAGLAPCLPYLQGRGPL-GGCCGGVKGLLGS  60

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DR++AC C+K          + +  G+P  CKV  P++ISP  +CS VQ
Sbjct  61   AKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ  114



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGK--IPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC+ Y++  G   +P +CCGG+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L L C+I +   P  A A  SC  +   ++PC+ Y+  GG IP ACC G++ +   
Sbjct  6    KLACLFLACMIVAG--PITANAALSCGAVSSNLAPCIGYVMQGGAIPPACCNGVRNLNSM  63

Query  291  LKTKQDRQSACLCIK-VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC CI+ V     +     R  G+P  C V  P++IS   NC  V+
Sbjct  64   ARTTPDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTVR  118



>ref|NP_001234735.1| non-specific lipid transfer protein precursor [Solanum lycopersicum]
 emb|CAJ19705.1| non-specific lipid transfer protein [Solanum lycopersicum]
Length=114

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 5/115 (4%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
             ++   +LLC++   V+ P AEA  +C  +  T++PCL Y+   G + + CC G+K ++ 
Sbjct  5    NKIACFVLLCMV---VVAPHAEAL-TCGQVTSTLAPCLPYLMNRGPL-RNCCDGVKGLLG  59

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              KT  DRQ+AC C+K      T   + +   LP+ C V  P++ISP  +CS VQ
Sbjct  60   QAKTTVDRQAACTCLKSAASSFTGLNLGKAAALPNTCSVNIPYKISPSTDCSKVQ  114



>gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Erythranthe guttata]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = -3

Query  483  IIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKL  304
            +I K  M  +   ++T   + P  EA   C  +V  I PCL Y++  G +   CCGG+K 
Sbjct  4    MIKKTCMLFIAAVLVTMVAVVPLGEAAIGCGTVVSYIKPCLPYVTGSGPL-GGCCGGIKG  62

Query  303  VVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            +    KT  DRQSAC C+K   L   V+ + +   LP  C V  P++ISP  +CS V+
Sbjct  63   LNSAAKTTPDRQSACSCLKS--LAGGVN-LGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>ref|XP_006362360.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M + GK +   +LLC++   V+ P AEA  +C  +   ++PCL Y+   G I   CCGG+
Sbjct  1    MEMFGK-IACFVLLCMV---VVAPHAEAL-TCGQVTSGLAPCLPYLQGRGPI-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   KT  DR++AC C+K            +  GLP  C V  P++ISP  +CS +Q
Sbjct  55   KGLLGAAKTPADRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKIQ  114



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSNLAPCIPYVKGGGAVPPACCNGIRNVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK  117



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK  117



>ref|NP_190728.1| pathogenesis-related protein LTP5 [Arabidopsis thaliana]
 sp|Q9XFS7.1|NLTP5_ARATH RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP 
5; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB43522.1| non-specific lipid transfer protein [Arabidopsis thaliana]
 emb|CAB63024.1| non-specific lipid transfer protein [Arabidopsis thaliana]
 gb|AAF76931.1| lipid transfer protein 5 [Arabidopsis thaliana]
 gb|AAL25528.1| AT3g51600/F26O13_240 [Arabidopsis thaliana]
 gb|AAM16208.1| AT3g51600/F26O13_240 [Arabidopsis thaliana]
 gb|AEE78811.1| pathogenesis-related protein LTP5 [Arabidopsis thaliana]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ +A  P  +EA  SC  +  ++  C +Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVTA--PMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR  118



>ref|XP_010922738.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -3

Query  423  PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            PP      +CSD+   + PC+ YI  GG +   CC GL+ +V   +T  DR++AC C+K 
Sbjct  21   PPCRVTAITCSDVYGDLLPCVQYIQSGGAVAPQCCSGLRTLVAAARTGDDRRTACTCLKT  80

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                 + D V R   LP  C V  P+++SP  +CS ++
Sbjct  81   AAASFSGD-VSRASKLPGKCGVSIPYKLSPSTDCSKIK  117



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +  +++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANVK  117



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 67/116 (58%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +  +++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANVK  117



>ref|NP_001235162.1| uncharacterized protein LOC100499726 precursor [Glycine max]
 gb|ACU13384.1| unknown [Glycine max]
Length=122

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 13/119 (11%)
 Frame = -3

Query  468  LMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGG-KIPQACCGGLKLVVDG  292
            +MSL+ L       + P A+ + +C  +V  ++PC+ Y+  GG  +P+ CC G++ +   
Sbjct  11   IMSLVCL------ALGPMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGIRNLYGM  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQ-----GLPDYCKVPFPFEISPIVNCSAVQ  130
             +TK DRQ+ C CIK G +R +      F       LP  C V  P++ISP  +C+ VQ
Sbjct  65   AQTKPDRQAVCNCIKNG-VRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDCTRVQ  122



>ref|NP_001236518.1| uncharacterized protein LOC100306032 precursor [Glycine max]
 gb|ACU14011.1| unknown [Glycine max]
Length=124

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P AEA+  C  +  T++PC+ Y+   GG +P  CC G+K + +  KT  DRQ  C C+K 
Sbjct  26   PLAEAETPCGRVQITVAPCIGYLRGPGGGVPAPCCNGVKSINNQAKTTPDRQGVCRCLKS  85

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              L      +     LP  C +  P++I+P ++C+ V+
Sbjct  86   TVLSLAGLNLATLSALPSKCGINLPYKITPTIDCNTVK  123



>ref|XP_006292062.1| hypothetical protein CARUB_v10018257mg [Capsella rubella]
 gb|EOA24960.1| hypothetical protein CARUB_v10018257mg [Capsella rubella]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ +A  P  +EA  SC  +  ++  C +Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLMIVCMLVTA--PMASEAAISCGAVTGSLGQCYNYLTRGGIIPRGCCSGVQRLNRL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS   NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGPRLNARRAAHLPGACRVRIAYPISARTNCNTVR  118



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 5/112 (4%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            +++ C++  A   P AEA  +C  +V ++ PC+ Y+  GG +  ACC G++ + +  +T 
Sbjct  15   VVMFCMVAGA---PKAEAAVTCGQVVNSLVPCISYVGNGGALDPACCNGVRTLYNLAQTT  71

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+ C C+K  +  +  T        GLP  C V  P++ISP  +C +V+
Sbjct  72   PDRQNVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDCKSVK  123



>ref|XP_009618455.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
 gb|AHB86570.1| non-specific lipid-transfer protein LTP1.1 [Nicotiana tabacum]
Length=129

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 11/129 (9%)
 Frame = -3

Query  483  IIGKQLMSLLLLCV-----------ITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGK  337
            ++ KQL+S L +C+           IT+   P  A+   +C  ++ ++  CL Y+  GG 
Sbjct  1    MLNKQLLSFLFICIPLVVVAVITATITTTAAPIAADETVTCDTVINSLRSCLGYVIGGGI  60

Query  336  IPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEIS  157
            +P  CC GLK ++   +T  D QSAC C+K      T ++  R   +P  CK   PF+IS
Sbjct  61   VPSECCNGLKSLLIVARTTADHQSACKCLKSIDSGVTREEFSRVASIPRICKAKVPFKIS  120

Query  156  PIVNCSAVQ  130
            P V+CS ++
Sbjct  121  PDVDCSKIK  129



>sp|O24038.1|NLTP2_SOLPN RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; AltName: Full=LpLTP2; Flags: Precursor [Solanum pennellii]
 gb|AAB07487.1| lipid transfer protein 2 [Solanum pennellii]
Length=114

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 5/115 (4%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
             ++   +LLC++   V+ P AEA  +C  +  T++PCL Y+   G +   CCGG+K ++ 
Sbjct  5    NKIACFVLLCMV---VVAPHAEAL-TCGQVTSTLAPCLPYLMNRGPL-GGCCGGVKGLLG  59

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              +T  DRQ+AC C+K      T   + +   LP  C V  P++ISP  +CS VQ
Sbjct  60   QAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ  114



>ref|XP_006842466.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
 gb|ERN04141.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
Length=114

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = -3

Query  411  EAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLR  232
            +   SC+ +   + PC+ Y+  GGK+P ACCGG+K V    KT  DR++ C C+K     
Sbjct  21   DGAVSCNSVFSYLGPCVPYLRGGGKVPTACCGGIKSVNGMAKTTPDRRAVCGCLKQAVAG  80

Query  231  ATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +       QGLP  C V  P+ +SP  +CS ++
Sbjct  81   ISGINYSLAQGLPKACGVSIPYTLSPSTDCSKIK  114



>gb|AGH13362.1| lipid transfer protein, partial [Helianthus annuus]
Length=99

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -3

Query  429  VIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            V  P+AEA  SC  +  +++PC+ Y++ GG +P ACC G+K +    KT  DRQ+AC C+
Sbjct  4    VAAPYAEAL-SCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCL  62

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISP  154
            K      +         LP  C V  P++ISP
Sbjct  63   KSAYNSISGINAGNAASLPGKCGVSIPYKISP  94



>ref|NP_181388.1| non-specific lipid-transfer protein 1 [Arabidopsis thaliana]
 sp|Q42589.1|NLTP1_ARATH RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA86765.1| non-specific lipid transfer protein, partial [Arabidopsis thaliana]
 gb|AAC67364.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAF76927.1| lipid transfer protein 1 [Arabidopsis thaliana]
 gb|AAK83638.1| At2g38540/T6A23.26 [Arabidopsis thaliana]
 gb|AAM10276.1| At2g38540/T6A23.26 [Arabidopsis thaliana]
 gb|AEC09547.1| non-specific lipid-transfer protein 1 [Arabidopsis thaliana]
Length=118

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  LLL C+I +   P  + A  SC  +   ++ C+ Y+  GG IP ACC G+K +   
Sbjct  6    KLACLLLACMIVAG--PITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSI  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD--QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             KT  DRQ AC CI+ G  RA        R  G+P  C V  P++IS   NC  V+
Sbjct  64   AKTTPDRQQACNCIQ-GAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR  118



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            MSL L C +  A++   P AEA  +C  +  +++ C+ Y+  GG +P ACC GLK +   
Sbjct  5    MSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAVPAACCSGLKSLNSA  64

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              T  DRQ  C C+K    + +        GLP  C V   ++ISP  +C  V+
Sbjct  65   AATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTVK  118



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P A+   SC  +   ++PC+ Y+   GG +P +CC G+K +    +T QDR++AC CIK 
Sbjct  22   PLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIKS  81

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
                 +         +P  C V  P++ISP ++CS+V 
Sbjct  82   AAGSISGINYALASQMPSKCGVSIPYQISPNIDCSSVN  119



>ref|XP_010503855.1| PREDICTED: non-specific lipid-transfer protein 5-like [Camelina 
sativa]
Length=118

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ +A  P  ++A  SC  +   +  C +Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVAA--PMASDAAISCGAVTGNLGQCYNYLTRGGFIPRGCCSGVQRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS  +NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNAGRAARLPGACRVRISYPISARINCNTVR  118



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P  A A  +C  +   ++PC+ YI+ GG +P ACC G+  +   
Sbjct  6    KLACLVLACMIVAG--PITANAALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD-QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C++        +    R  G+P  C V  PF IS   NC+ V+
Sbjct  64   ARTTPDRQQACRCLETAARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK  118



>gb|ADR66945.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=119

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQE-SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
            +L  ++ LC++ S    P A+AQ  +C  +V T++PC++Y+  GG +P ACC G++ +  
Sbjct  8    KLALVVALCMVVSV---PIAQAQAITCGQVVSTLAPCINYVKSGGAVPPACCNGIRTLNG  64

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              KT  DRQ+AC  +K   L  ++  V       LP  C V  P++IS   NC+AV+
Sbjct  65   LAKTTADRQAACNRLKQ--LSGSIPGVNPNNAAALPGKCGVNVPYKISISTNCAAVK  119



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQG--LPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_006295252.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
 gb|EOA28150.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
Length=118

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L L C+I +   P  A+A  SC  +   ++PC+ Y+  GG IP  CC G++ + + 
Sbjct  6    KLACLFLACMIVAG--PITADAALSCGAVTSNLAPCIGYVMQGGVIPAGCCTGVRNLNNM  63

Query  291  LKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C++     L A ++   R  G+P  C V  P++IS   NC  V+
Sbjct  64   ARTTPDRQQACTCLQNTARSLGAGLN-AGRAAGIPKACGVNIPYKISTSTNCKTVR  118



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGG-KIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATV  223
            +C+ +  ++ PCL Y+  GG  +P  CCGG K ++    T  DRQSAC CIK     A  
Sbjct  30   TCNMVYSSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNANE  89

Query  222  DQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             Q+ R   LP  CK   PF+ISP V+CS V 
Sbjct  90   AQLSRAATLPRICKTNVPFKISPHVDCSKVN  120



>ref|XP_010451927.1| PREDICTED: non-specific lipid-transfer protein 10 [Camelina sativa]
Length=116

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = -3

Query  432  AVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLC  253
            +++   +EA  SC+ +V  + PC  Y++ GG IP +CC G++++    K+  DRQ  C C
Sbjct  14   SILSRGSEAAVSCNAVVANLYPCAVYVAQGGTIPGSCCTGIRMLNGQAKSASDRQGVCRC  73

Query  252  IK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            IK  +G +  +   +     LP  C V  P++I P  NC++++
Sbjct  74   IKSALGGVSYSSKNLKNAATLPAKCGVKLPYKIDPSTNCNSIK  116



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            +C  +   +SPC+ Y+  GG +P  CC G+K +    KT  DRQ+AC C+K      +  
Sbjct  30   TCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGI  89

Query  219  QVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
                  GLP  C V  P++ISP  +CS V
Sbjct  90   NYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = -3

Query  489  MAIIGKQLMSLL-LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGG  313
            MAI     +SL+ LLC++   V  P A+A  +C  +  +I+PC++Y+  GG +P  CC G
Sbjct  1    MAISTAMKLSLVALLCIV---VALPIAQA-ITCGQVASSIAPCVNYVKSGGAVPAGCCNG  56

Query  312  LKLVVDGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
            ++ +    KT  DRQ+ C C+K   G ++     +    GLP    V  P++IS   NC+
Sbjct  57   IRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNL--AAGLPGKXGVNVPYKISTSTNCA  114

Query  138  AVQ  130
            AV+
Sbjct  115  AVK  117



>ref|XP_006369492.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
 gb|ERP66061.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
Length=118

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P ++A  SCSD++K + PC+ Y+  G GK P ACC G+  +     T  D+Q+AC CIK 
Sbjct  22   PPSDAAISCSDVIKDLRPCVKYLMNGTGKPPAACCSGISAIQATASTTADKQAACNCIKS  81

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
               +   +  +  Q LP  C +  PF +SP V+CS +
Sbjct  82   ASKQINPNPQLA-QALPANCGITLPFAVSPNVDCSKI  117



>gb|KHN29511.1| Non-specific lipid-transfer protein [Glycine soja]
Length=122

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 1/95 (1%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P AEA+  C  +  T++PC+ Y+   GG +P ACC G++ +    KT  DRQ  C C+K 
Sbjct  27   PLAEAEIPCGRVQITVAPCIGYLRGPGGGVPAACCNGVRSINKEAKTTPDRQGVCRCLKT  86

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
              L      +     LP  C V  P++ISP ++C+
Sbjct  87   TALSLPGLNLATLAALPSKCGVNLPYKISPTIDCN  121



>ref|XP_009136622.1| PREDICTED: non-specific lipid-transfer protein 5-like [Brassica 
rapa]
Length=118

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ SA  P   EA  SC  +   +  C++Y++ GG I   CC G++ +   
Sbjct  6    KLSTLVIVCMLVSA--PMATEAAISCGAVASNLGQCINYLTKGGYISPGCCSGVRTLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQV--IRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC CI+ G  +A   ++   R  GLP  C+V   + IS   NC+ V+
Sbjct  64   ARTTTDRQQACRCIQ-GAAKALGSRLNARRAAGLPGACRVRISYPISARTNCNNVR  118



>sp|Q3YMR2.1|NLTP2_SOLCI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Solanum chilense]
 gb|AAZ22829.1| lipid transfer protein [Solanum chilense]
Length=114

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 5/115 (4%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
             ++   +LLC++   V+ P AEA  +C  +  T++PCL Y+   G +   CCGG+K ++ 
Sbjct  5    NKIACFVLLCMV---VVAPHAEAL-TCGQVTSTLAPCLPYLMNRGPL-GGCCGGVKGLLG  59

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
              +T  DRQ+AC C+K      T   + +   LP  C V  P++ISP  +CS VQ
Sbjct  60   QAQTTVDRQAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKVQ  114



>ref|XP_010509136.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010509137.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Camelina sativa]
Length=118

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L L C+I +   P  A A  SC  +   ++PC+ Y+  GG IP ACC G++ +   
Sbjct  6    KLACLFLACMIVAG--PITANAALSCGAVSSNLAPCIGYVMQGGVIPPACCNGVRNLNSM  63

Query  291  LKTKQDRQSACLCIK-VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC CI+ V     +     R  G+P  C V  P++IS   NC  V+
Sbjct  64   ARTTPDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTVR  118



>ref|XP_006438990.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|ESR52230.1| hypothetical protein CICLE_v10033098mg [Citrus clementina]
 gb|KDO46019.1| hypothetical protein CISIN_1g043898mg [Citrus sinensis]
Length=118

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P +EA  SCSD++K + PC++Y+  G GK P ACC G   +     +  D+++AC CIK 
Sbjct  22   PKSEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKKTACGCIKT  81

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +   +  +  Q LP  C +  P  +SP V+CS + 
Sbjct  82   AAQKMNPNSQLA-QALPTNCGITLPVPVSPNVDCSKIN  118



>ref|XP_007140089.1| hypothetical protein PHAVU_008G083400g [Phaseolus vulgaris]
 gb|ESW12083.1| hypothetical protein PHAVU_008G083400g [Phaseolus vulgaris]
Length=123

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYIS--IGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIK  247
            P AEA   C  +   ++PC+ Y++   G K+P  CC G+K V D  KT  DRQ+ C C+K
Sbjct  25   PSAEAAIPCGSVQLAVAPCISYLTGPAGTKVPAPCCNGVKRVNDQSKTTPDRQAVCSCLK  84

Query  246  VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
               LR     V R   L   C V  P++++P ++C+ V
Sbjct  85   NTALRIPGINVPRLAALAGACGVNLPYKVTPSIDCNTV  122



>ref|XP_010426733.1| PREDICTED: non-specific lipid-transfer protein 5 [Camelina sativa]
Length=118

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L +L+++C++ +A  P  ++A  SC  +   +  C +Y++ GG IP+ CC G++ +   
Sbjct  6    KLSTLVIVCMLVAA--PMASDAAISCGAVTGNLGQCYNYLTRGGFIPRGCCSGVQRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T +DRQ AC CI+ G  RA   ++   R   LP  C+V   + IS  +NC+ V+
Sbjct  64   ARTTRDRQQACRCIQ-GAARALGSRLNAGRAARLPGACRVRISYPISARINCNTVR  118



>ref|XP_006482792.1| PREDICTED: non-specific lipid-transfer protein 8-like [Citrus 
sinensis]
Length=127

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKTKQDRQSACLCIKV  244
            P +EA  SCSD++K + PC++Y+  G GK P ACC G   +     +  D+++AC CIK 
Sbjct  31   PKSEAAISCSDVLKDLRPCVNYLKSGSGKPPAACCSGASALASTATSTADKKTACGCIKT  90

Query  243  GCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +   +  +  Q LP  C +  P  +SP V+CS + 
Sbjct  91   AAQKMNPNSQLA-QALPTNCGITLPVPVSPNVDCSKIN  127



>ref|XP_011019013.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=116

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L+  LLLC++ SA  P       SC  +   ++PCL Y+  GG++P ACC G+  +   
Sbjct  5    KLVCALLLCIVLSA--PMLNVDALSCGVVAGDLAPCLTYLKKGGRVPLACCKGVVALKSA  62

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQ-----GLPDYCKVPFPFEISPIVNCSAVQ  130
             KT QDR+ AC      CL+ T  QV          LP  C+V  P++I    NC++++
Sbjct  63   AKTTQDRRDAC-----NCLKQTASQVGGVNAGFAAALPRMCRVNIPYKIGTSTNCASIK  116



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 3/108 (3%)
 Frame = -3

Query  453  LLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQD  274
            L+C++   V  P+AEA  +C  +   ++PC+ Y+  GG    ACCGG+K +     T  D
Sbjct  14   LMCML---VATPFAEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPAD  70

Query  273  RQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            R++AC C+K      +         LP  C V  P+ IS  V+C+ V 
Sbjct  71   RKAACGCLKSAAASISGMNTAAASSLPSKCGVSIPYPISTSVDCAKVN  118



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 8/112 (7%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            LL++C+I    + P AEA  +C  +  +++PC+ Y+  G     ACCGG+K +     T 
Sbjct  67   LLMMCII----VAPMAEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTT  122

Query  279  QDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             DRQ+AC C+K   G +      +    GLP  C V  P++IS   NC+ ++
Sbjct  123  PDRQAACNCLKSAAGAISGLNPNIA--AGLPGKCGVNIPYKISTSTNCATIR  172



>gb|AEN70933.1| lipid transfer protein [Gossypium davidsonii]
 gb|AEN70934.1| lipid transfer protein [Gossypium klotzschianum]
Length=120

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGK--IPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC+ Y++  G   +P  CCGG+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGVVPPRCCGGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACKCIKSAAASMSGINYGIASGLPGKCGVNIPYKISPSTDCN  117



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            +C  +   +SPC+ Y+  GG +P ACC G+K +    KT  DRQ+AC C+K      +  
Sbjct  30   TCGQVASALSPCISYLQKGGAVPPACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVSGI  89

Query  219  QVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
             +    GLP  C V  P++ISP  +C+ V
Sbjct  90   NLSLASGLPGKCGVSVPYKISPSTDCTKV  118



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  459  LLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTK  280
            ++L+C++      P A+A  +C  +V  ++PC+ Y+  GG +P  CC G+K +V   +T 
Sbjct  9    VVLICMVMVGA-APIAQA-ITCGQVVSNLTPCITYLQRGGAVPGQCCNGVKTLVSSAQTT  66

Query  279  QDRQSACLCIKVGCLRATVDQVIRFQG---LPDYCKVPFPFEISPIVNCSAVQ  130
             D+Q+AC C+K     AT+   I F     LP  C V  P++ISP  NC++++
Sbjct  67   ADKQTACNCLKS--TAATIPN-INFGNAGSLPGKCGVNLPYKISPSTNCASIK  116



>ref|XP_006411067.1| hypothetical protein EUTSA_v10017425mg [Eutrema salsugineum]
 gb|ACF23025.1| ST20 [Eutrema halophilum]
 gb|ESQ52520.1| hypothetical protein EUTSA_v10017425mg [Eutrema salsugineum]
Length=118

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P  A+A  SC  +  +++PC+ Y++ G  +P ACC G+K +   
Sbjct  6    KLACLVLACMIVAG--PITAKAALSCGTVSSSLAPCIGYLTQGTPLPLACCAGVKRLNSM  63

Query  291  LKTKQDRQSACLCIKVGCLRATVD--QVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C+ VG   A        R  GLP  C V  P+ IS   NC+ V+
Sbjct  64   ARTTPDRQQACRCL-VGAANALGSGLNTGRASGLPKACGVNIPYAISKNTNCAIVR  118



>ref|XP_004249706.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=116

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +++  ++LC++   ++ P AEA  SC  +  +++PC+ Y+   G +   CCGG+K ++  
Sbjct  6    KIVCFVVLCMV---IVAPHAEAI-SCGQVSSSLAPCIPYLQGRGPL-GGCCGGVKSLLGA  60

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
             KT  DR++AC CIK            R  GLP  C V  P++ISP V CS
Sbjct  61   TKTPADRRTACTCIKSAANAVKGLDTTRASGLPRACGVNIPYDISPSVGCS  111



>ref|XP_009797052.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGL  310
            M I+GK +   ++LC++   V+ P AEA  SC  +   ++PCL Y+   G +   CCGG+
Sbjct  1    MEIVGK-IACFVVLCMV---VVAPHAEAL-SCGQVQSGLAPCLPYLQGRGPL-GGCCGGV  54

Query  309  KLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K ++   K+  DR++AC C+K          + +  GLP  C V  P++ISP  +CS VQ
Sbjct  55   KGLLGAAKSPADRKTACTCLKSAANAIKGIDMGKAAGLPSACGVNIPYKISPSTDCSKVQ  114



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 61/121 (50%), Gaps = 11/121 (9%)
 Frame = -3

Query  489  MAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYI-SIGGKIPQACCGG  313
            MA+I   L+ LLL          P +E+  +C  ++ TI PCL Y+   GGK PQ CC  
Sbjct  1    MALISFMLLILLLA---------PASESAITCGTVISTIRPCLSYLQGTGGKPPQPCCTA  51

Query  312  LKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
             + +     T  DRQ+AC C+K    +  ++  +  QGLP  C +   F IS  V+C+ +
Sbjct  52   CQSLASATSTTPDRQAACTCLKNAAQKININAQLA-QGLPQSCGISLSFPISTSVDCTKI  110

Query  132  Q  130
             
Sbjct  111  N  111



>gb|AFK45186.1| unknown [Lotus japonicus]
Length=114

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 7/111 (6%)
 Frame = -3

Query  462  SLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLK  286
            +L+LL ++ SA     +EA  SCSD++K + PC+ Y+  G GK P ACC G K +   + 
Sbjct  9    ALVLLMLLVSA-----SEAAISCSDVIKDLKPCVSYLVSGSGKPPGACCSGAKALASAVS  63

Query  285  TKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
            T +D+++AC CIK       ++  +  + LP  C +  P  +SP  +CS V
Sbjct  64   TSEDKKAACNCIKSTAKSIKMNSQLA-KALPGNCGINVPINVSPDADCSKV  113



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 4/92 (4%)
 Frame = -3

Query  399  SCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVGCLRATVD  220
            +CS +   ++PC++Y+  GG +P ACC G+K +    KT  DRQ+AC C+K   L  +V 
Sbjct  5    TCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKN--LAGSVS  62

Query  219  QVI--RFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             V     + LP  C V  P++IS   NC+ V+
Sbjct  63   GVNPGNAESLPGKCGVNVPYKISTSTNCATVK  94



>gb|AGC08428.1| lipid transfer protein [Gossypium hirsutum]
Length=124

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 4/112 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYI--SIGGKIPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   SC  +   ++PC+ Y+  +  G  P ACC G++ + 
Sbjct  5    MSLKLTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNC  142
               KT  DRQ+AC CIK      +        GLP  C +  P++ISP  +C
Sbjct  65   SAAKTTPDRQAACSCIKSAATGISGINYSTAAGLPGKCGINIPYKISPSTDC  116



>gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Erythranthe guttata]
Length=117

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = -3

Query  486  AIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLK  307
            A+I K  M  +   ++T   + P  EA   C  +V  + PCL Y++  G +   CCGG+K
Sbjct  3    AMIKKTCMLFVAAVLVTMVAVVPRGEAAIGCGTVVSYMKPCLPYVTGSGPL-GGCCGGIK  61

Query  306  LVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +    KT  DRQS C C+K   L   V+ + +   LP  C V  P++ISP  +CS V+
Sbjct  62   GLNSAAKTTPDRQSVCACLKS--LAGGVN-LGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>ref|XP_010253093.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=123

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -3

Query  492  TMAIIGKQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGG  313
            ++ ++ K+   +L+L  +  A  P    A  SC  +V  +SPC+ Y+  GG +P  CC G
Sbjct  4    SLGVVNKRASLVLVLGFMVIAAAPNEVAAI-SCGQVVSNLSPCIVYLRTGGPLPPKCCSG  62

Query  312  LKLVVDGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAV  133
            ++ +    +T  DRQ+ C+C+K         +      L D C V  P++ISP  +CS V
Sbjct  63   VRTLSRAARTTADRQTTCICLKSSAAGVPGIKPALASSLADKCGVNLPYKISPSTDCSRV  122

Query  132  Q  130
            +
Sbjct  123  K  123



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  ++ LC++ S    P A+A  +C  +   ++PC+ Y+  GG +P ACC G++ V + 
Sbjct  8    KLALVVALCMVVSV---PIAQA-ITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRDVNNL  63

Query  291  LKTKQDRQSACLCIKVGCLRATVDQVIRFQG--LPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ+AC C+K   L A+V  V       LP  C V  P++ISP  NC+ V+
Sbjct  64   ARTTPDRQAACNCLKQ--LSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_009372010.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIP--PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVV  298
            QL+ L  L V+   ++   P A+A  +C  +V  ++PC+ Y+  GG +  ACC G++ + 
Sbjct  6    QLLKLACLVVVMFCMVACVPKADAAMTCGQVVSDLTPCISYVRAGGALAPACCNGVRTLF  65

Query  297  DGLKTKQDRQSACLCIK--VGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
               +T  DRQS C C+K  +  +  T        GLP  C V  P++ISP  +C +V+
Sbjct  66   TLAQTTPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDCKSVK  123



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (51%), Gaps = 3/112 (3%)
 Frame = -3

Query  474  KQLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVD  295
            K +  L+LLC++   V+ P A    +C  +      C+ Y+  GG  P ACC G++ +  
Sbjct  5    KLICGLVLLCML---VLEPMATTALTCGQVASQTGSCIRYLQRGGNPPAACCNGVRNLNR  61

Query  294  GLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
              +T +DRQ+AC C++      +        GLP  C V  P++ISP  NC+
Sbjct  62   QARTTRDRQTACRCLQTAARTISGINTKLAAGLPAKCGVKIPYKISPSTNCN  113



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 2/100 (2%)
 Frame = -3

Query  426  IPPWAEAQESCSDLVKTISPCLDYISIG-GKIPQACCGGLKLVVDGLKTKQDRQSACLCI  250
            I P AE   SC  +   +SPCL Y++ G G  PQ CCGG+K ++    T  DRQ+AC C+
Sbjct  11   IAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQ-CCGGVKKLLAAANTTPDRQAACNCL  69

Query  249  KVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
            K      T         LP  C V  P++IS   NC+ V+
Sbjct  70   KSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK  109



>ref|XP_008798559.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = -3

Query  420  PWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDGLKTKQDRQSACLCIKVG  241
            P      +C  +V  ++PC++Y+  GG+IP ACC G++ +    KT  DR++AC C+K  
Sbjct  22   PHTADAITCGQVVSYLTPCINYVRNGGQIPGACCSGVRGLAAAAKTTPDRRTACTCLKNA  81

Query  240  CLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
                +  +     G+P  C V  P+ ISP  +CS
Sbjct  82   AAGISGLKTGLIAGIPGKCGVRVPYAISPSTDCS  115



>sp|Q42616.1|NLTP3_BRANA RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Brassica napus]
 gb|AAA64311.1| germination-specific lipid transfer protein 3 [Brassica napus]
Length=117

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 6/116 (5%)
 Frame = -3

Query  471  QLMSLLLLCVITSAVIPPWAEAQESCSDLVKTISPCLDYISIGGKIPQACCGGLKLVVDG  292
            +L  L+L C+I +   P    A  SC  +   ++ C+ Y++  G +P ACC G+  + + 
Sbjct  6    KLSCLVLACMIVAG--PIATNAALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNM  63

Query  291  LKTKQDRQSACLCIKVGCLRA--TVDQVIRFQGLPDYCKVPFPFEISPIVNCSAVQ  130
             +T  DRQ AC C+ VG   A  T++ V R  GLP  C V  P++IS   NC++V+
Sbjct  64   ARTTPDRQQACRCL-VGAANALPTIN-VARAAGLPKACGVNIPYKISKTTNCNSVK  117



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  465  MSLLLLCVITSAVI--PPWAEAQESCSDLVKTISPCLDYISIGGK--IPQACCGGLKLVV  298
            MSL L CV+   ++   P A+   +C  +  +++PC+ Y+   G   +P  CCGG+K + 
Sbjct  5    MSLKLACVVVLCMVVGAPLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLN  64

Query  297  DGLKTKQDRQSACLCIKVGCLRATVDQVIRFQGLPDYCKVPFPFEISPIVNCS  139
               +T  DRQ+AC CIK      +        GLP  C V  P++ISP  +C+
Sbjct  65   SAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCN  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 692065518870