BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21296_g2_i1 len=1772 path=[1750:0-349 2100:350-989 2740:990-1015
2766:1016-1277 3028:1278-1343 3094:1344-1349 3100:1350-1415
3166:1416-1771]

Length=1772
                                                                      Score     E

ref|XP_009792204.1|  PREDICTED: amino acid permease 6-like              591   0.0      
ref|XP_009627462.1|  PREDICTED: amino acid permease 6-like              591   0.0      
ref|NP_001233983.1|  amino acid transporter                             588   0.0      
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              587   0.0      
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              580   0.0      
ref|NP_001242816.1|  uncharacterized protein LOC100777963               579   0.0      
gb|KHN08198.1|  Amino acid permease 6                                   578   0.0      
gb|KHN37208.1|  Amino acid permease 6                                   576   0.0      
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              576   0.0      
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              575   0.0      
gb|EEC81471.1|  hypothetical protein OsI_24794                          576   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             575   0.0      
gb|EYU39084.1|  hypothetical protein MIMGU_mgv1a018317mg                574   0.0      
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   574   0.0      
ref|XP_010943299.1|  PREDICTED: amino acid permease 6                   571   0.0      
ref|XP_007018375.1|  Amino acid permease 6                              572   0.0      
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              571   0.0      
gb|EEE66520.1|  hypothetical protein OsJ_22995                          571   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058839.1|  Os07g0134000                                       571   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657428.1|  PREDICTED: amino acid permease 6-like              571   0.0      
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              571   0.0      
ref|XP_002510013.1|  amino acid transporter, putative                   571   0.0      Ricinus communis
gb|EYU39082.1|  hypothetical protein MIMGU_mgv1a020135mg                569   0.0      
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              569   0.0      
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              567   0.0      
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              566   0.0      
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   566   0.0      
ref|XP_003588450.1|  Amino acid transporter                             565   0.0      
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   565   0.0      Vitis vinifera
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              565   0.0      
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         565   0.0      
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              565   0.0      
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              564   0.0      
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                563   0.0      
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              563   0.0      
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   563   0.0      
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             563   0.0      
dbj|BAJ85485.1|  predicted protein                                      563   0.0      
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             562   0.0      
ref|XP_009397328.1|  PREDICTED: amino acid permease 6                   561   0.0      
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   561   0.0      
emb|CAD92450.1|  amino acid permease 6                                  560   0.0      Brassica napus [oilseed rape]
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    559   0.0      
gb|ADB92670.1|  amino acid permease 6                                   558   0.0      
ref|XP_008801682.1|  PREDICTED: amino acid permease 6                   558   0.0      
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                558   0.0      
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                558   0.0      
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              557   0.0      
ref|NP_199774.1|  amino acid permease 6                                 557   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             556   0.0      
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              556   0.0      
gb|EMS56484.1|  hypothetical protein TRIUR3_26560                       565   0.0      
ref|XP_003603665.1|  Amino acid permease                                555   0.0      
ref|XP_002461426.1|  hypothetical protein SORBIDRAFT_02g002440          555   0.0      Sorghum bicolor [broomcorn]
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              554   0.0      
gb|AFK42490.1|  unknown                                                 554   0.0      
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   553   0.0      
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              552   0.0      
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   551   0.0      
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   551   0.0      
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             551   0.0      
ref|NP_176132.1|  amino acid permease 1                                 550   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             550   0.0      
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              550   0.0      
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   549   0.0      
ref|XP_010475859.1|  PREDICTED: amino acid permease 8-like              548   0.0      
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             548   0.0      
emb|CAD92449.1|  amino acid permease 1                                  548   0.0      Brassica napus [oilseed rape]
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   548   0.0      
gb|AAB87674.1|  neutral amino acid transport system II                  548   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG24473.1|  Amino acid permease 6 -like protein                     548   0.0      
ref|XP_007143143.1|  hypothetical protein PHAVU_007G047400g             547   0.0      
ref|XP_006307429.1|  hypothetical protein CARUB_v10009053mg             545   0.0      
dbj|BAC82953.1|  putative amino acid permease                           545   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDP00979.1|  unnamed protein product                                545   0.0      
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              545   0.0      
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    545   0.0      
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             544   0.0      
ref|XP_002889784.1|  hypothetical protein ARALYDRAFT_888258             544   0.0      
ref|XP_003557617.1|  PREDICTED: amino acid permease 6                   543   0.0      
ref|XP_009118278.1|  PREDICTED: amino acid permease 8-like              543   0.0      
emb|CDY46779.1|  BnaCnng14480D                                          541   0.0      
emb|CDY04349.1|  BnaC04g18440D                                          541   0.0      
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             540   0.0      
emb|CDP00978.1|  unnamed protein product                                540   0.0      
ref|XP_002301129.2|  amino acid transport protein AAP2                  540   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              539   0.0      
gb|KEH43993.1|  transmembrane amino acid transporter family protein     538   0.0      
ref|NP_172472.1|  amino acid permease 8                                 537   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010104540.1|  hypothetical protein L484_025514                   537   0.0      
ref|XP_010268968.1|  PREDICTED: amino acid permease 6-like isofor...    536   0.0      
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             536   0.0      
emb|CDY04448.1|  BnaA03g59400D                                          538   0.0      
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   536   0.0      
ref|XP_009148319.1|  PREDICTED: amino acid permease 8-like              536   0.0      
ref|XP_010268971.1|  PREDICTED: amino acid permease 6-like              536   0.0      
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             536   0.0      
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              535   0.0      
emb|CDY44564.1|  BnaA01g21750D                                          536   0.0      
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              535   0.0      
emb|CDY53793.1|  BnaCnng25620D                                          534   0.0      
ref|XP_002313926.2|  hypothetical protein POPTR_0009s08840g             534   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY48843.1|  BnaA09g14700D                                          532   0.0      
ref|XP_010490547.1|  PREDICTED: amino acid permease 8-like isofor...    532   0.0      
ref|XP_006417505.1|  hypothetical protein EUTSA_v10009701mg             531   0.0      
emb|CDY60248.1|  BnaC01g42990D                                          531   2e-180   
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   530   4e-180   
ref|XP_011002369.1|  PREDICTED: amino acid permease 6-like              529   8e-180   
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   530   1e-179   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              528   1e-179   
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              529   1e-179   
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              529   2e-179   
emb|CDY22607.1|  BnaC08g42410D                                          528   3e-179   
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             528   4e-179   
gb|KEH43994.1|  transmembrane amino acid transporter family protein     526   7e-179   
ref|XP_004515440.1|  PREDICTED: amino acid permease 6-like              526   1e-178   
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   526   1e-178   
ref|XP_010243490.1|  PREDICTED: amino acid permease 6-like              525   2e-178   
emb|CDY22608.1|  BnaC08g42420D                                          526   2e-178   
ref|XP_010475860.1|  PREDICTED: amino acid permease 8-like              525   4e-178   
ref|XP_002522103.1|  amino acid transporter, putative                   524   5e-178   Ricinus communis
emb|CDY57932.1|  BnaA06g38010D                                          524   6e-178   
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    523   1e-177   
ref|XP_004497265.1|  PREDICTED: amino acid permease 6-like              522   3e-177   
emb|CAA70968.2|  amino acid transporter                                 522   4e-177   Solanum tuberosum [potatoes]
ref|XP_004496860.1|  PREDICTED: amino acid permease 6-like              521   7e-177   
tpg|DAA59488.1|  TPA: hypothetical protein ZEAMMB73_156584              522   8e-177   
emb|CDY62728.1|  BnaC05g49210D                                          521   2e-176   
ref|XP_009118276.1|  PREDICTED: amino acid permease 8-like isofor...    520   3e-176   
ref|NP_001136620.1|  uncharacterized protein LOC100216745               520   4e-176   Zea mays [maize]
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    518   2e-175   
gb|KEH43995.1|  transmembrane amino acid transporter family protein     516   6e-175   
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                517   1e-174   
ref|XP_010095743.1|  hypothetical protein L484_003355                   516   2e-174   
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              516   3e-174   
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             515   3e-174   
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    515   4e-174   
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    516   5e-174   
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              515   5e-174   
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              513   9e-174   
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        513   3e-173   
ref|XP_003535676.1|  PREDICTED: amino acid permease 6-like              512   3e-173   
ref|XP_010490563.1|  PREDICTED: amino acid permease 8-like isofor...    512   3e-173   
gb|ABR18002.1|  unknown                                                 513   4e-173   Picea sitchensis
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              511   6e-173   
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              512   7e-173   
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             511   2e-172   
ref|XP_009118279.1|  PREDICTED: amino acid permease 8-like              511   2e-172   
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        510   2e-172   
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        509   5e-172   
ref|NP_001057853.1|  Os06g0556000                                       509   5e-172   Oryza sativa Japonica Group [Japonica rice]
emb|CDY22609.1|  BnaC08g42430D                                          509   1e-171   
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              508   2e-171   
ref|XP_006382883.1|  amino acid permease AAP1 family protein            508   3e-171   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              510   3e-171   
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             508   4e-171   Populus trichocarpa [western balsam poplar]
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    508   4e-171   
dbj|BAJ86012.1|  predicted protein                                      506   7e-171   
ref|XP_007042690.1|  Amino acid permease 1                              506   8e-171   
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   506   1e-170   
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              505   4e-170   
emb|CDY53832.1|  BnaA09g57240D                                          523   4e-170   
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              504   7e-170   
ref|XP_010314596.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    503   7e-170   
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        504   7e-170   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          504   7e-170   Sorghum bicolor [broomcorn]
ref|NP_196484.1|  amino acid permease 2                                 504   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              504   1e-169   
gb|KEH43996.1|  transmembrane amino acid transporter family protein     503   1e-169   
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              503   2e-169   
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             503   2e-169   
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              503   2e-169   
emb|CDY57931.1|  BnaA06g38000D                                          502   2e-169   
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    503   3e-169   
emb|CDP08191.1|  unnamed protein product                                502   3e-169   
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              502   5e-169   
gb|KHG12273.1|  Amino acid permease 6 -like protein                     501   5e-169   
emb|CDY53831.1|  BnaA09g57230D                                          502   5e-169   
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              503   5e-169   
emb|CDY36017.1|  BnaA08g04440D                                          501   6e-169   
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              502   9e-169   
ref|XP_003630316.1|  Amino acid permease                                501   1e-168   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    501   1e-168   
gb|KHG13110.1|  Amino acid permease 6 -like protein                     499   1e-168   
ref|XP_010691537.1|  PREDICTED: amino acid permease 6-like              502   1e-168   
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    501   1e-168   
ref|XP_009148320.1|  PREDICTED: amino acid permease 8-like              500   1e-168   
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           500   2e-168   
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   500   2e-168   
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    500   2e-168   
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              500   2e-168   
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              500   3e-168   
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             500   3e-168   
gb|AAM61227.1|  amino acid transport protein AAP2                       499   5e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118275.1|  PREDICTED: amino acid permease 8-like isofor...    499   5e-168   
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              499   5e-168   
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   499   6e-168   
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              498   1e-167   
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    498   2e-167   
dbj|BAJ93107.1|  predicted protein                                      499   2e-167   
gb|KHN19623.1|  Amino acid permease 3                                   498   2e-167   
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    498   2e-167   
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              497   2e-167   
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    498   2e-167   
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             498   2e-167   
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              497   2e-167   
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              497   3e-167   
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   497   3e-167   
ref|NP_001149036.1|  amino acid carrier                                 497   3e-167   Zea mays [maize]
gb|ADE75660.1|  unknown                                                 498   3e-167   
ref|NP_001140430.1|  hypothetical protein                               497   3e-167   Zea mays [maize]
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              498   3e-167   
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              496   4e-167   
gb|EEC68963.1|  hypothetical protein OsI_37697                          497   5e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    496   7e-167   
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   497   9e-167   Vitis vinifera
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              497   9e-167   
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             495   1e-166   
ref|XP_006852748.1|  hypothetical protein AMTR_s00033p00114390          496   1e-166   
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   496   1e-166   
ref|XP_004289864.1|  PREDICTED: amino acid permease 2-like              497   1e-166   
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              496   1e-166   
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    495   2e-166   
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    495   2e-166   
ref|NP_001066317.1|  Os12g0181600                                       495   2e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              494   2e-166   
gb|EMT26484.1|  hypothetical protein F775_32730                         495   2e-166   
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              495   2e-166   
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             495   3e-166   
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          495   3e-166   Sorghum bicolor [broomcorn]
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              495   3e-166   
gb|AII99817.1|  amino acid transporter                                  494   4e-166   
emb|CAF22024.1|  amino acid permease                                    494   4e-166   Brassica napus [oilseed rape]
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             494   4e-166   
gb|EAY82481.1|  hypothetical protein OsI_37698                          494   5e-166   Oryza sativa Indica Group [Indian rice]
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             494   6e-166   
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              493   6e-166   
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              494   8e-166   
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              493   9e-166   
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              493   9e-166   
ref|NP_001066316.1|  Os12g0181500                                       493   9e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              494   1e-165   
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    493   1e-165   
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         494   1e-165   
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        493   1e-165   
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             493   1e-165   
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    493   1e-165   
emb|CDX78353.1|  BnaA03g02650D                                          493   2e-165   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              494   2e-165   
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    493   2e-165   
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              494   2e-165   
emb|CDY21569.1|  BnaC09g47230D                                          493   2e-165   
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          493   3e-165   
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   492   3e-165   
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    493   3e-165   
ref|XP_002534252.1|  amino acid transporter, putative                   492   3e-165   Ricinus communis
gb|KHN25477.1|  Amino acid permease 2                                   493   3e-165   
gb|AIS71894.1|  amino acid transporter                                  492   4e-165   
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like              492   5e-165   
ref|NP_201190.1|  amino acid permease 4                                 491   5e-165   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91439.1|  predicted protein                                      492   5e-165   
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             493   6e-165   
emb|CDX69918.1|  BnaA10g22670D                                          491   6e-165   
ref|XP_002309530.2|  hypothetical protein POPTR_0006s25230g             491   6e-165   Populus trichocarpa [western balsam poplar]
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             491   6e-165   
gb|KEH35328.1|  transmembrane amino acid transporter family protein     491   6e-165   
gb|AIL30502.1|  amino acid transporter                                  491   6e-165   
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              491   7e-165   
ref|XP_010095435.1|  hypothetical protein L484_013392                   491   9e-165   
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              492   9e-165   
gb|KHG20963.1|  Amino acid permease 3 -like protein                     491   1e-164   
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    492   1e-164   
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              491   1e-164   
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             490   1e-164   
ref|NP_001055592.1|  Os05g0424000                                       491   2e-164   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        490   2e-164   Vitis vinifera
emb|CAA54631.1|  amino acid transporter                                 489   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        490   2e-164   
gb|AAX56951.1|  amino acid transporter                                  490   2e-164   Pisum sativum [garden pea]
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   490   2e-164   
gb|AAK33098.1|  amino acid transporter                                  491   2e-164   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              489   3e-164   
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   490   3e-164   
emb|CDO96925.1|  unnamed protein product                                491   3e-164   
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              489   3e-164   
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       489   4e-164   
dbj|BAO45885.1|  amino acid permease                                    489   4e-164   
emb|CDX81121.1|  BnaC03g03750D                                          489   5e-164   
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              490   6e-164   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              488   6e-164   
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   490   6e-164   
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   489   7e-164   
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    488   7e-164   
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              488   7e-164   
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              488   8e-164   
gb|AAM61320.1|  amino acid transporter AAP4                             488   8e-164   
gb|AAM13223.1|  amino acid transporter AAP4                             488   9e-164   
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              489   9e-164   
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              489   9e-164   
gb|KEH30492.1|  transmembrane amino acid transporter family protein     489   9e-164   
gb|KEH30491.1|  transmembrane amino acid transporter family protein     489   1e-163   
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             489   1e-163   
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   488   1e-163   
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   489   1e-163   
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    488   1e-163   
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             487   1e-163   
ref|XP_002520323.1|  amino acid transporter, putative                   488   1e-163   
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   488   2e-163   
gb|AAX56952.1|  amino acid transporter                                  487   2e-163   
emb|CDX88364.1|  BnaC06g38080D                                          487   2e-163   
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          487   2e-163   
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             488   2e-163   
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              488   2e-163   
ref|NP_001067425.1|  Os11g0195600                                       487   3e-163   
emb|CDY47793.1|  BnaC06g00580D                                          487   3e-163   
gb|AFK37021.1|  unknown                                                 488   3e-163   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              486   4e-163   
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              487   4e-163   
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             486   4e-163   
dbj|BAK07020.1|  predicted protein                                      486   5e-163   
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              486   6e-163   
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    485   8e-163   
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          486   1e-162   
ref|NP_001234606.1|  amino acid transporter                             485   1e-162   
ref|XP_004965607.1|  PREDICTED: amino acid permease 3-like              485   1e-162   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    486   1e-162   
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              486   1e-162   
emb|CAC51425.1|  amino acid permease AAP4                               485   1e-162   
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    486   1e-162   
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          486   2e-162   
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              485   2e-162   
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    485   2e-162   
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             484   2e-162   
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             484   2e-162   
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              484   2e-162   
emb|CAA70778.1|  amino acid transporter                                 486   2e-162   
gb|KHG16478.1|  Amino acid permease 2 -like protein                     484   3e-162   
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   484   3e-162   
emb|CDX87522.1|  BnaA07g33510D                                          484   3e-162   
ref|XP_002516531.1|  amino acid transporter, putative                   484   3e-162   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          484   3e-162   
gb|KEH35330.1|  transmembrane amino acid transporter family protein     484   3e-162   
emb|CAN61092.1|  hypothetical protein VITISV_005276                     484   4e-162   
ref|XP_011019567.1|  PREDICTED: amino acid permease 8-like              484   4e-162   
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             484   4e-162   
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              484   4e-162   
ref|XP_006386355.1|  amino acid permease which transports basic a...    484   4e-162   
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             484   4e-162   
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              484   4e-162   
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   484   5e-162   
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              484   5e-162   
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             484   5e-162   
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        484   6e-162   
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              484   7e-162   
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              484   8e-162   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             484   8e-162   
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        484   9e-162   
ref|XP_009118277.1|  PREDICTED: amino acid permease 8-like isofor...    483   1e-161   
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              483   1e-161   
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              483   1e-161   
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              483   1e-161   
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              483   1e-161   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             483   1e-161   
ref|XP_011081743.1|  PREDICTED: amino acid permease 8-like isofor...    483   2e-161   
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    482   2e-161   
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   482   2e-161   
emb|CDX88365.1|  BnaC06g38090D                                          482   2e-161   
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              482   2e-161   
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             482   2e-161   
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              482   2e-161   
dbj|BAK03497.1|  predicted protein                                      482   3e-161   
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    482   3e-161   
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              482   3e-161   
ref|XP_011081742.1|  PREDICTED: amino acid permease 8-like isofor...    483   3e-161   
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    481   3e-161   
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              481   4e-161   
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             482   4e-161   
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    482   4e-161   
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              481   5e-161   
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   481   5e-161   
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             481   6e-161   
emb|CDY31348.1|  BnaA02g33930D                                          481   6e-161   
ref|XP_010090330.1|  hypothetical protein L484_024995                   482   6e-161   
gb|AAM62803.1|  amino acid carrier, putative                            481   7e-161   
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              481   8e-161   
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              481   9e-161   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        480   9e-161   
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       480   1e-160   
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          480   1e-160   
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         480   2e-160   
ref|XP_010668697.1|  PREDICTED: amino acid permease 8-like isofor...    480   2e-160   
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                479   2e-160   
ref|NP_001142349.1|  hypothetical protein                               480   2e-160   
ref|NP_177862.1|  amino acid permease 3                                 479   3e-160   
emb|CDY39844.1|  BnaC02g42740D                                          478   4e-160   
ref|XP_007019168.1|  Amino acid permease isoform 2                      479   4e-160   
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              478   5e-160   
ref|NP_001233979.1|  amino acid transporter                             478   5e-160   
emb|CAA54632.1|  amino acid permease                                    479   5e-160   
ref|XP_007019167.1|  Amino acid permease isoform 1                      479   5e-160   
emb|CAC51423.1|  amino acid permease AAP1                               478   6e-160   
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              478   6e-160   
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    478   7e-160   
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              478   7e-160   
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              478   7e-160   
emb|CDY62727.1|  BnaC05g49200D                                          478   8e-160   
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              478   1e-159   
ref|NP_175076.2|  amino acid permease 5                                 478   1e-159   
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              478   2e-159   
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              477   2e-159   
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             477   3e-159   
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    478   3e-159   
ref|XP_002520322.1|  amino acid transporter, putative                   476   5e-159   
ref|NP_001149517.1|  amino acid permease 1                              476   6e-159   
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    475   9e-159   
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    476   1e-158   
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         475   1e-158   
dbj|BAK02045.1|  predicted protein                                      474   2e-158   
gb|ABR16450.1|  unknown                                                 475   2e-158   
ref|XP_004965606.1|  PREDICTED: amino acid permease 1-like              474   2e-158   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              475   2e-158   
gb|EYU20407.1|  hypothetical protein MIMGU_mgv1a018639mg                474   3e-158   
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             474   3e-158   
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              474   3e-158   
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              474   3e-158   
emb|CDP10973.1|  unnamed protein product                                474   3e-158   
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   474   4e-158   
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   474   4e-158   
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             473   4e-158   
gb|KHN23179.1|  Amino acid permease 6                                   472   4e-158   
gb|KHN44307.1|  Amino acid permease 3                                   474   4e-158   
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              474   4e-158   
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                474   6e-158   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          473   6e-158   
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                474   6e-158   
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             473   6e-158   
dbj|BAD53557.1|  putative amino acid carrier                            472   9e-158   
ref|XP_006476126.1|  PREDICTED: amino acid permease 8-like              473   9e-158   
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              473   9e-158   
gb|EEC80807.1|  hypothetical protein OsI_23357                          473   1e-157   
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              473   1e-157   
ref|XP_003602666.1|  Amino acid permease                                473   1e-157   
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              473   2e-157   
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             473   2e-157   
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    472   2e-157   
emb|CDM85443.1|  unnamed protein product                                472   2e-157   
ref|XP_003560665.1|  PREDICTED: amino acid permease 1-like              472   2e-157   
dbj|BAJ95327.1|  predicted protein                                      472   2e-157   
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              472   4e-157   
ref|XP_002437148.1|  hypothetical protein SORBIDRAFT_10g022010          471   4e-157   
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             471   5e-157   
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   471   5e-157   
dbj|BAK03421.1|  predicted protein                                      471   6e-157   
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             471   6e-157   
emb|CDM85442.1|  unnamed protein product                                471   7e-157   
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    470   1e-156   
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              470   1e-156   
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              469   1e-156   
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             470   1e-156   
gb|KDO79909.1|  hypothetical protein CISIN_1g038741mg                   469   1e-156   
ref|XP_006450730.1|  hypothetical protein CICLE_v10010168mg             469   1e-156   
emb|CAN77083.1|  hypothetical protein VITISV_003992                     472   2e-156   
gb|EMT07264.1|  hypothetical protein F775_06597                         469   2e-156   
emb|CDX84450.1|  BnaC03g50500D                                          469   2e-156   
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              469   2e-156   
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              469   4e-156   
gb|AAG50558.1|AC074228_13  amino acid permease, putative                468   6e-156   
emb|CDY43761.1|  BnaA06g22970D                                          467   8e-156   
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              467   9e-156   
ref|XP_001784036.1|  predicted protein                                  467   1e-155   
ref|XP_002533728.1|  amino acid transporter, putative                   466   1e-155   
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             468   1e-155   
ref|XP_006476001.1|  PREDICTED: amino acid permease 8-like isofor...    467   2e-155   
ref|XP_008647596.1|  PREDICTED: uncharacterized protein LOC100274...    466   2e-155   
ref|XP_003602671.1|  Amino acid permease                                466   3e-155   
ref|XP_006450729.1|  hypothetical protein CICLE_v10010799mg             466   4e-155   
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    466   5e-155   
ref|XP_003602670.1|  Amino acid permease                                466   6e-155   
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              464   2e-154   
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    465   2e-154   
ref|XP_003526505.1|  PREDICTED: amino acid permease 6-like isofor...    463   3e-154   
ref|XP_004501094.1|  PREDICTED: amino acid permease 8-like              463   3e-154   
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    464   3e-154   
ref|NP_001045595.1|  Os02g0102200                                       465   4e-154   
gb|EAY84081.1|  hypothetical protein OsI_05462                          464   4e-154   
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              463   7e-154   
ref|XP_004290905.1|  PREDICTED: amino acid permease 2-like              462   1e-153   
gb|KEH40510.1|  transmembrane amino acid transporter family protein     462   1e-153   
ref|XP_004290906.1|  PREDICTED: amino acid permease 2-like              462   1e-153   
ref|XP_006476002.1|  PREDICTED: amino acid permease 8-like isofor...    461   2e-153   
emb|CDP02900.1|  unnamed protein product                                462   2e-153   
gb|EAY82539.1|  hypothetical protein OsI_37761                          461   2e-153   
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              462   3e-153   
ref|NP_001045010.1|  Os01g0882800                                       462   3e-153   
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          463   3e-153   
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             461   4e-153   
ref|XP_003638241.1|  Amino acid permease                                464   5e-153   
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              462   6e-153   
gb|KHN09641.1|  Amino acid permease 2                                   461   6e-153   
ref|XP_010644646.1|  PREDICTED: probable amino acid permease 7 is...    459   8e-153   



>ref|XP_009792204.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=472

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/470 (62%), Positives = 370/470 (79%), Gaps = 3/470 (1%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             M++SLS+++  G  D  K+D+DGR KRTGTVLT SAHIITA+IGSGVLSLAWA AQLG +
Sbjct  1     MERSLSVSMGGGFDDTSKFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWI  60

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
             AGP+A+VAFSVIT +T+ LLADCYR+PDG RNY+YMDAVR++LGG++V+ CG+AQY+ LV
Sbjct  61    AGPVALVAFSVITWFTSLLLADCYRAPDGSRNYTYMDAVRSHLGGMKVQLCGIAQYSNLV  120

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G +IGY IT ++S+ AI R+NC+HKHG    GC  S    I+IFG  +++LSQIPNFH+L
Sbjct  121   GITIGYAITTSISMVAIKRSNCFHKHGHAA-GCHESNNPFIIIFGIFQIILSQIPNFHKL  179

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALG  810
              FLS++AA+MSF YS IG+ LS  KIA  GV   TS+TG  +G   S  DKM++TFSALG
Sbjct  180   SFLSLIAAVMSFAYSFIGLGLSIAKIANDGVSGNTSLTGTRIGKELSGTDKMWNTFSALG  239

Query  811   NIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             +IA A+ FS +LI+IQDTLKS PRE + MK+AS IGI  +T FY+LCG++GY AFGN AP
Sbjct  240   DIAFAYAFSTVLIEIQDTLKSHPRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAP  299

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
             GN LT   GFYEPFWLVD ANVCI+VHLVGAYQV  QP+FAFVE WS+ +W    FIT E
Sbjct  300   GNFLTG-FGFYEPFWLVDFANVCIVVHLVGAYQVFCQPIFAFVEGWSKQKWPESKFITRE  358

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             + I    LG F  S +RLVWRT +V+FTT++AM+FPFFN  +GLLG+ +FWPLT+YFP++
Sbjct  359   YMINLSPLGLFPFSFYRLVWRTAYVIFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQ  418

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             MYI+QA+IP+ SFTWIWL+ILS  C ++S+LAA GS+  L KS+  F+ F
Sbjct  419   MYIAQARIPKYSFTWIWLKILSLVCLIISLLAAAGSVQGLIKSLQKFQLF  468



>ref|XP_009627462.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=472

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/470 (62%), Positives = 371/470 (79%), Gaps = 3/470 (1%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             M++SLS+++  G  D  K+D+DGR KRTGTVLT SAHIITA+IGSGVLSLAWA AQLG +
Sbjct  1     MERSLSVSMGGGFDDTSKFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWI  60

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
             AGP+A+VAFSVIT +T+ LLADCYR+PDG RNY+YMDAVR++LGG++V+ CG+AQY+ LV
Sbjct  61    AGPVALVAFSVITWFTSLLLADCYRAPDGSRNYTYMDAVRSHLGGMKVQLCGIAQYSNLV  120

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G +IGY IT ++S+ AI R+NC+HKHG    GC  S    I+IFG  +++LSQIPNFH+L
Sbjct  121   GITIGYAITTSISMVAIKRSNCFHKHGHAA-GCHESNNPFIIIFGIFQIILSQIPNFHKL  179

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALG  810
              FLS++AA+MSF YS IG+ LS  KIA  GV+ +TS+TG  +    S  DKM++TFSALG
Sbjct  180   SFLSLIAAVMSFAYSFIGLGLSIAKIANDGVNGDTSLTGTRIEKELSGTDKMWNTFSALG  239

Query  811   NIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             +IA A+ FS +LI+IQDTLKS PRE + MK+AS IGI  +T FY+LCG++GY AFGN AP
Sbjct  240   DIAFAYAFSTVLIEIQDTLKSHPRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAP  299

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
             GN LT   GFYEPFWLVD ANVCI+VHLVGAYQV  QP+FAFVE WS+ +W    FIT E
Sbjct  300   GNFLTG-FGFYEPFWLVDFANVCIVVHLVGAYQVFCQPIFAFVEGWSKQKWPESKFITRE  358

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             + I    LG F  S +RLVWRT +V+FTT++AM+FPFFN  +GLLG+ +FWPLT+YFP++
Sbjct  359   YMINLSPLGLFPFSFYRLVWRTAYVIFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQ  418

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             MYI+QAKIP+ SFTWIWL+ILS  C ++S+LAA GS+  L KS+  F+ F
Sbjct  419   MYIAQAKIPKYSFTWIWLKILSLVCLIISLLAAAGSVQGLIKSLQKFQLF  468



>ref|NP_001233983.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13688.1|AF013279_1 amino acid transporter [Solanum lycopersicum]
Length=465

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/456 (62%), Positives = 358/456 (79%), Gaps = 3/456 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D  K+D+DGR KRTGTVLT SAHIITA+IGSGVLSLAWA AQLG +AGP+A++AFS IT 
Sbjct  8     DSSKFDDDGRPKRTGTVLTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALIAFSAITW  67

Query  316   YTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSL  495
             + + LLADCYR+PDG R+Y+YMDAVRA+LGG +V+ CG+AQY+ L G +IGY IT ++S+
Sbjct  68    FASILLADCYRAPDGSRSYTYMDAVRAHLGGRKVQLCGLAQYSNLFGVTIGYAITTSISM  127

Query  496   QAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGY  675
              AI R+NC+H+ G    GC  S    I+IFG +++LLSQIPNFH+L FLSI+AA MSF Y
Sbjct  128   VAIKRSNCFHRKGHDA-GCHESNNPFIIIFGVMQILLSQIPNFHKLSFLSIIAAAMSFAY  186

Query  676   SSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILID  852
             S IG+ LS  KIA  GV   TS+TG  VG + S++DKM++TFSALG+IA A+ FS++LI+
Sbjct  187   SFIGLGLSIAKIAKDGVSANTSLTGTIVGKDVSSRDKMWNTFSALGDIAFAYAFSIVLIE  246

Query  853   IQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPF  1032
             IQDTLKS P E ++MK+A+  GI  +T FYLLCG+LGY AFGN APGN LT   GFYEPF
Sbjct  247   IQDTLKSHPPENKSMKKATFTGISVSTIFYLLCGLLGYAAFGNKAPGNFLTG-FGFYEPF  305

Query  1033  WLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVS  1212
             WL+D ANVCI++HLVGAYQV  QP+F FVE WSR +W    FIT E+ I    LG F+ +
Sbjct  306   WLIDFANVCIVIHLVGAYQVFCQPIFGFVEGWSRQKWPESKFITKEYMINLSHLGLFNFN  365

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
              +RLVWRT +VVFTT++AM+FPFFN  +G +G+ +FWPLT+YFP++MYI+QAKIP+ SFT
Sbjct  366   FYRLVWRTLYVVFTTILAMLFPFFNDFVGFIGAASFWPLTVYFPIQMYIAQAKIPKYSFT  425

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WIWL ILSF C ++S+LAA GS+  L KS+  F+PF
Sbjct  426   WIWLNILSFVCLIISLLAAAGSVRGLIKSLQEFEPF  461



>ref|XP_006346279.1| PREDICTED: amino acid permease 6-like [Solanum tuberosum]
Length=464

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 357/456 (78%), Gaps = 3/456 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D  K+D+DGR KRTGTV+T SAHIITA+IGSGVLSLAWA AQLG +AGP+A++AFS IT 
Sbjct  7     DSSKFDDDGRPKRTGTVMTTSAHIITAVIGSGVLSLAWATAQLGWIAGPVALIAFSAITW  66

Query  316   YTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSL  495
             +T+ LLADCYR+PDG R+Y+YMDAVRA+LGG +V+ CG+AQY+ L G +IGY IT ++S+
Sbjct  67    FTSLLLADCYRAPDGSRSYTYMDAVRAHLGGRKVQLCGLAQYSNLFGVTIGYAITTSISM  126

Query  496   QAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGY  675
              AI R+NC+H+ G    GC  S    I++FG +++LL QIPNFH+L FLSI+AA+MSF Y
Sbjct  127   VAIKRSNCFHRKGH-DAGCHESNNPFIILFGIMQILLCQIPNFHKLSFLSIIAAVMSFAY  185

Query  676   SSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILID  852
             S IG+ LS  KIA  GV   TS+TG  VG + S  DKM++TFSALG+IA A+ FS +LI+
Sbjct  186   SFIGLGLSIAKIAKDGVSANTSLTGTSVGKDVSGTDKMWNTFSALGDIAFAYAFSTVLIE  245

Query  853   IQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPF  1032
             IQDTLKS P E ++MK+A+ +GI  +T FY LCG+LGY AFGN APGN LT   GFYEPF
Sbjct  246   IQDTLKSHPPENKSMKKAALVGISVSTIFYTLCGLLGYAAFGNKAPGNFLTG-FGFYEPF  304

Query  1033  WLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVS  1212
             WLVD ANVCI+VHLVGAYQV  QP+F FVE WS+ +W    FIT E+ I    LG F+ +
Sbjct  305   WLVDFANVCIVVHLVGAYQVFCQPLFGFVEGWSKQKWPQSKFITKEYMINLSPLGLFNFN  364

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
              +RLVWRT +VVFTT++AM+FPFFN  +GLLG+ +FWPLT+YFP++MYI+QAKIP+ SFT
Sbjct  365   FYRLVWRTSYVVFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQMYIAQAKIPKNSFT  424

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WIWL ILSF C ++S+LAA GS+  L KS+  FKPF
Sbjct  425   WIWLNILSFVCLIISLLAAAGSVQGLIKSLREFKPF  460



>ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=479

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/484 (57%), Positives = 366/484 (76%), Gaps = 16/484 (3%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             D++++   F E         E+GG +   +D+DGR KRTGT +TASAHIITA+IGSGVLS
Sbjct  4     DQFQKNSMFVETP-------EDGGKN---FDDDGRVKRTGTWITASAHIITAVIGSGVLS  53

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQ+G VAGP  + AFS IT +T+ LLADCYRSPD   GKRNY+Y D VR+ LGG 
Sbjct  54    LAWAIAQMGWVAGPAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGR  113

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             + + CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HKHG   + C  S    +++F  
Sbjct  114   KFQLCGLAQYINLVGVTIGYTITASISMVAVKRSNCFHKHGH-HDKCYTSNNPFMILFAC  172

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNH  768
             ++++LSQIPNFH+LW+LSIVAA+MSF YSSIG+ LS  K+AGG + V T++TGV VGV+ 
Sbjct  173   IQIVLSQIPNFHKLWWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDV  232

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +  +K++ TF A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+L
Sbjct  233   TGSEKVWRTFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVL  292

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG LGY AFGN APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE W
Sbjct  293   CGCLGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFCQPIFGFVENW  351

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
              + RW    F+ GEH ++FP  G F V+ FR+VWRT +V+ T ++AM+FPFFN  LGL+G
Sbjct  352   GKERWPNSHFVNGEHALKFPLFGTFPVNFFRVVWRTTYVIITALIAMMFPFFNDFLGLIG  411

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             S++FWPLT+YFP+EMYI Q+K+ + SFTW WL+ILS+ C +VS+++A GSI  LA+ +  
Sbjct  412   SLSFWPLTVYFPIEMYIKQSKMQKFSFTWTWLKILSWACLIVSIISAAGSIQGLAQDLKK  471

Query  1489  FKPF  1500
             ++PF
Sbjct  472   YQPF  475



>ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycine max]
 gb|ACU21356.1| unknown [Glycine max]
Length=479

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/484 (57%), Positives = 365/484 (75%), Gaps = 16/484 (3%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             D++++   F E         E+GG +   +D+DGR +RTGT +TASAHIITA+IGSGVLS
Sbjct  4     DQFQKNSMFVETP-------EDGGKN---FDDDGRVRRTGTWITASAHIITAVIGSGVLS  53

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQ+G VAGP  + AFS IT +T+ LLADCYRSPD   GKRNY+Y D VR+ LGG 
Sbjct  54    LAWAIAQMGWVAGPAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGR  113

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             + + CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HKHG   + C  S    +++F  
Sbjct  114   KFQLCGLAQYINLVGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CYTSNNPFMILFAC  172

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNH  768
             ++++LSQIPNFH+LW+LSIVAA+MSF YSSIG+ LS  K+AGG + V T++TGV VGV+ 
Sbjct  173   IQIVLSQIPNFHKLWWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDV  232

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +  +K++ TF A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+L
Sbjct  233   TGSEKVWRTFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVL  292

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG LGY AFGN APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE W
Sbjct  293   CGCLGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFCQPIFGFVENW  351

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
              R RW    F+ GEH + FP  G F V+ FR+VWRT +V+ T ++AM+FPFFN  LGL+G
Sbjct  352   GRERWPNSQFVNGEHALNFPLCGTFPVNFFRVVWRTTYVIITALIAMMFPFFNDFLGLIG  411

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             S++FWPLT+YFP+EMYI Q+K+ R SFTW WL+ILS+ C +VS+++A GSI  LA+ +  
Sbjct  412   SLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSWACLIVSIISAAGSIQGLAQDLKK  471

Query  1489  FKPF  1500
             ++PF
Sbjct  472   YQPF  475



>gb|KHN08198.1| Amino acid permease 6 [Glycine soja]
Length=479

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/484 (57%), Positives = 365/484 (75%), Gaps = 16/484 (3%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             D++++   F E         E+GG +   +D+DGR +RTGT +TASAHIITA+IGSGVLS
Sbjct  4     DQFQKNSMFVETP-------EDGGKN---FDDDGRVRRTGTWITASAHIITAVIGSGVLS  53

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQ+G VAGP  + AFS IT +T+ LLADCYRSPD   GKRNY+Y D VR+ LGG 
Sbjct  54    LAWAIAQMGWVAGPAVLFAFSFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGR  113

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             + + CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HKHG   + C  S    +++F  
Sbjct  114   KFQLCGLAQYINLVGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CYTSNNPFMILFAC  172

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNH  768
             ++++LSQIPNFH+LW+LSIVAA+MSF YSSIG+ LS  K+AGG + V T++TGV VGV+ 
Sbjct  173   IQIVLSQIPNFHKLWWLSIVAAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDV  232

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +  +K++ TF A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+L
Sbjct  233   TGSEKVWRTFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVL  292

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG LGY AFGN APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE W
Sbjct  293   CGCLGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFCQPIFGFVENW  351

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
              + RW    F+ GEH + FP  G F V+ FR+VWRT +V+ T ++AM+FPFFN  LGL+G
Sbjct  352   GKERWPNSQFVNGEHALNFPLCGTFPVNFFRVVWRTTYVIITALIAMMFPFFNDFLGLIG  411

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             S++FWPLT+YFP+EMYI Q+K+ R SFTW WL+ILS+ C +VS+++A GSI  LA+ +  
Sbjct  412   SLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSWACLIVSIISAAGSIQGLAQDLKK  471

Query  1489  FKPF  1500
             ++PF
Sbjct  472   YQPF  475



>gb|KHN37208.1| Amino acid permease 6 [Glycine soja]
Length=469

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/464 (59%), Positives = 359/464 (77%), Gaps = 9/464 (2%)
 Frame = +1

Query  121   EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAF  300
             E+GG +   +D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQ+G VAGP  + AF
Sbjct  7     EDGGKN---FDDDGRVKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLFAF  63

Query  301   SVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
             S IT +T+ LLADCYRSPD   GKRNY+Y D VR+ LGG + + CG+AQY  LVG +IGY
Sbjct  64    SFITYFTSTLLADCYRSPDPVHGKRNYTYSDVVRSVLGGRKFQLCGLAQYINLVGVTIGY  123

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              ITA++S+ A+ R+NC+HKHG   + C  S    +++F  ++++LSQIPNFH+LW+LSIV
Sbjct  124   TITASISMVAVKRSNCFHKHGH-HDKCYTSNNPFMILFACIQIVLSQIPNFHKLWWLSIV  182

Query  652   AALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             AA+MSF YSSIG+ LS  K+AGG + V T++TGV VGV+ +  +K++ TF A+G+IA A+
Sbjct  183   AAVMSFAYSSIGLGLSVAKVAGGGEPVRTTLTGVQVGVDVTGSEKVWRTFQAIGDIAFAY  242

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+LCG LGY AFGN APGN LT 
Sbjct  243   AYSNVLIEIQDTLKSSPPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTG  302

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE W + RW    F+ GEH ++FP
Sbjct  303   -FGFYEPFWLIDFANICIAVHLVGAYQVFCQPIFGFVENWGKERWPNSHFVNGEHALKFP  361

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
               G F V+ FR+VWRT +V+ T ++AM+FPFFN  LGL+GS++FWPLT+YFP+EMYI Q+
Sbjct  362   LFGTFPVNFFRVVWRTTYVIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQS  421

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             K+ + SFTW WL+ILS+ C +VS+++A GSI  LA+ +  ++PF
Sbjct  422   KMQKFSFTWTWLKILSWACLIVSIISAAGSIQGLAQDLKKYQPF  465



>ref|XP_004136237.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
 ref|XP_004168126.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
Length=477

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/468 (59%), Positives = 362/468 (77%), Gaps = 6/468 (1%)
 Frame = +1

Query  109   SLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             S+ +++     LK +D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQLG VAGP 
Sbjct  10    SMYLDQNPEAALKNFDDDGRQKRTGTWVTASAHIITAVIGSGVLSLAWAIAQLGWVAGPA  69

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              +VAFS+IT  TA LLADCYRSPD   GKRNY+YMD V+A+LGG  VKFCG+AQY  LVG
Sbjct  70    VLVAFSMITYLTATLLADCYRSPDPVTGKRNYTYMDVVKAHLGGNNVKFCGLAQYGNLVG  129

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              SIGY ITA++S+ A+ R+NC+HK+G   + C PS+   ++I+ A++++LSQIPNFH+L 
Sbjct  130   VSIGYTITASISMVAVKRSNCFHKYGHEAD-CNPSQYPFMIIYAAIQLILSQIPNFHKLS  188

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             FLSI+AA+MSF Y++IG+ LS  ++ G     T++TG  +GV+ + ++K+F  F ALG+I
Sbjct  189   FLSIIAAVMSFAYAAIGVGLSIARVVGDGHARTTLTGATIGVDVTGQEKIFKAFQALGDI  248

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ +S++L++IQDTL+SSP E +AMK+AS +GI + + FY+LCG +GY AFGN APGN
Sbjct  249   AFAYSYSMVLVEIQDTLRSSPAENKAMKKASFVGITTTSLFYILCGCVGYAAFGNDAPGN  308

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
              LT   GFYEPFWL+D ANVCI+VHL+GAYQV  QP + FVE W   +W    FIT EHT
Sbjct  309   FLTG-FGFYEPFWLIDFANVCIVVHLIGAYQVFCQPFYGFVEKWCNKKWPESTFITTEHT  367

Query  1177  IRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMY  1356
             I  PF G + ++ FRL+WRT +V+ T VVAMIFPFFN  LGL+G+ +FWPLT+YFPVEMY
Sbjct  368   INLPFNGEYQLNYFRLIWRTIYVILTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPVEMY  427

Query  1357  ISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             I++ K+PR S TWIWL+ LS+ C V+S++AAVGS+  LA+ V  ++PF
Sbjct  428   IARTKLPRFSSTWIWLKTLSWACLVISLIAAVGSLQGLAQDVKTYRPF  475



>ref|XP_004498452.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=471

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/465 (59%), Positives = 357/465 (77%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A E  GG+D  +DEDGR+KRTGT LTASAHIITA+IGSGVLSLAWAIAQ+G VAGP  + 
Sbjct  5     AQEHYGGEDKNFDEDGRTKRTGTWLTASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLF  64

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS IT +T+ LLADCYRSPD   GKRNY+Y + VRA LGG + + CG+AQY  LVG +I
Sbjct  65    AFSFITYFTSTLLADCYRSPDPVHGKRNYTYSEVVRANLGGRKFQLCGLAQYINLVGVTI  124

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++L QIPNFH L +LS
Sbjct  125   GYTITASISMVAVKRSNCFHKHGHA-DKCHVSNNPFMIIFACIQIVLCQIPNFHELSWLS  183

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             IVAA+MSF YSSIG+ LS  K+AGG  V TS+TGV +GV+ +  +K++  F A+G+IA A
Sbjct  184   IVAAVMSFTYSSIGLGLSIAKVAGGGHVRTSITGVEIGVDVTATEKVWRMFQAIGDIAFA  243

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + FS +LI+IQDTLKSSP E R MK+AS IGIL+ T FY+LCG LGY AFGN APGN LT
Sbjct  244   YAFSNVLIEIQDTLKSSPPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFLT  303

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWL+D ANVCI VHL+GAYQV VQP+F FVE  S+ +W    F+ GEH +  
Sbjct  304   G-FGFYEPFWLIDFANVCIAVHLIGAYQVFVQPIFGFVEGQSKQKWPDSKFVNGEHPMNL  362

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P  G+++V+ FR++WR+ +V+ T ++AM+FPFFN  LGL+GS++FWPLT+YFP+EMYI +
Sbjct  363   PLYGSYNVNFFRVIWRSSYVIITAIIAMLFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKK  422

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + SFTW WL+ILS+ C V+S+++A GSI  LA+S+  ++PF
Sbjct  423   TKMQKFSFTWTWLKILSWACLVISIISAAGSIQGLAQSLKKYQPF  467



>gb|EEC81471.1| hypothetical protein OsI_24794 [Oryza sativa Indica Group]
Length=485

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/482 (58%), Positives = 356/482 (74%), Gaps = 6/482 (1%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             R +E+ A    +     E G  D    D+DGR KRTGT++TASAHIITA+IGSGVLSLAW
Sbjct  3     RPQEKVATTTTAAFNLAESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP  +VAFSVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + +
Sbjct  63    AIAQLGWVIGPAVLVAFSVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYR  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              C VAQY  LVG +IGY IT A+S+ AI R+NC+H++G     C+ S  ++++IF  +++
Sbjct  123   LCSVAQYVNLVGVTIGYTITTAISMGAIKRSNCFHRNGHDA-ACLASDTTNMIIFAGIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQ+PNFH++W+LSIVAA+MS  YS+IG+ LS  KIAGG   E ++TGV VGV+ S  +
Sbjct  182   LLSQLPNFHKIWWLSIVAAVMSLAYSTIGLGLSIAKIAGGAHPEATLTGVTVGVDVSASE  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+L
Sbjct  242   KIWRTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVL  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWLVD+ NVCI+VHLVGAYQV  QP++ F E W+R+R
Sbjct  302   GYAAFGNRAPGNFLT-GFGFYEPFWLVDVGNVCIVVHLVGAYQVFCQPIYQFAEAWARSR  360

Query  1141  WGGVWFITGEHTIRFPF-LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIA  1317
             W    F+ GE  +R P   G+F VS  RLVWRT +VV T V AM FPFFN  LGL+G+++
Sbjct  361   WPDSAFVNGERVLRLPLGAGDFPVSALRLVWRTAYVVLTAVAAMAFPFFNDFLGLIGAVS  420

Query  1318  FWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKP  1497
             FWPLT+YFPV+MY+SQAK+ R S TW W+ +LS  C VVS+LAA GSI  L KSV H+KP
Sbjct  421   FWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLSLACLVVSLLAAAGSIQGLIKSVAHYKP  480

Query  1498  FA  1503
             F+
Sbjct  481   FS  482



>ref|XP_007137276.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
 gb|ESW09270.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
Length=482

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 365/484 (75%), Gaps = 13/484 (3%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             D++++   + E  +    A  EGG +   +D+DGR KRTGT +TASAHIITA+IGSGVLS
Sbjct  4     DQFQKNNMYVETPE----AFGEGGKN---FDDDGRVKRTGTWITASAHIITAVIGSGVLS  56

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQ+G VAGP  ++AFS IT +T+ LLADCYR+PD   GKRNY+Y   V++ LGG 
Sbjct  57    LAWAIAQMGWVAGPAVLLAFSCITYFTSTLLADCYRTPDPVHGKRNYTYSAVVKSVLGGR  116

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             + + CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++ F  
Sbjct  117   KFQLCGLAQYINLVGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CFTSNNPFMIFFAC  175

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNH  768
             ++++LSQIPNF +LW+LSIVAA+MSF YSSIG+ LS  K+AGG D V TS+TGV VGV+ 
Sbjct  176   IQIVLSQIPNFSKLWWLSIVAAVMSFAYSSIGLGLSFAKVAGGGDPVRTSLTGVQVGVDV  235

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +  +K++ TF A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGI++ T FY+L
Sbjct  236   TGSEKVWRTFQAIGDIAFAYAYSNVLIEIQDTLKSSPAENKVMKRASLIGIMTTTLFYML  295

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG LGY AFGN APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE W
Sbjct  296   CGCLGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFCQPIFGFVENW  354

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
             S+ RW    F+ GEH + FP  G FSV+ FR+VWRT +VV T ++AM+FPFFN  LGL+G
Sbjct  355   SKERWPNSQFVNGEHAVNFPLCGTFSVNFFRVVWRTTYVVITALIAMLFPFFNDFLGLIG  414

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             S++FWPLT+YFP+EMYI Q+ + + SFTW WL+ILS+ C +VS+++A GSI  LA+ +  
Sbjct  415   SLSFWPLTVYFPIEMYIKQSNMQKFSFTWTWLKILSWVCLIVSIISAAGSIQGLAQDLKK  474

Query  1489  FKPF  1500
             ++PF
Sbjct  475   YQPF  478



>gb|EYU39084.1| hypothetical protein MIMGU_mgv1a018317mg [Erythranthe guttata]
Length=466

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/467 (60%), Positives = 363/467 (78%), Gaps = 8/467 (2%)
 Frame = +1

Query  103   SLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
              +SL+++ G     K+D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AGP
Sbjct  3     QISLSIDSGNESSSKFDDDGRVKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWIAGP  62

Query  283   IAMVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGAS  462
             IA++AFS IT +T+ LLADCYRS DG RNY+Y D VR++LGG++V+ CG+AQ + LVG+S
Sbjct  63    IALMAFSFITWFTSILLADCYRSNDGSRNYTYKDVVRSHLGGLKVQLCGIAQSSNLVGSS  122

Query  463   IGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFL  642
             IGY ITA++S+ A++R+NC+HKHG    GC  S    I+ FGA+++++SQIPNFH+L +L
Sbjct  123   IGYSITASISMVAMIRSNCFHKHGH-EAGCHMSNNPYIIGFGAMQIIISQIPNFHKLSWL  181

Query  643   SIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIA  819
             S VAA MSF YSSIG+ L+  KIAG G  +E+S+TG+P+G N S+ DKM++T++ALGNIA
Sbjct  182   SFVAAAMSFAYSSIGLGLAIAKIAGTGGKIESSLTGIPIGPNMSSMDKMWNTYNALGNIA  241

Query  820   LAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNL  999
              A+ FS +L++IQDT+KS   E + MK+A+  GI  +T FY+LCG+LGY AFGN APGN 
Sbjct  242   FAYVFSSVLVEIQDTIKSGVPENKVMKKATLAGISISTVFYMLCGVLGYAAFGNDAPGNF  301

Query  1000  LTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTI  1179
             LT   GFYEPFWLV  AN+CI++HLVGAYQV  QP+F FVE WS+ +W    FIT E++I
Sbjct  302   LT-GFGFYEPFWLVSFANLCIVIHLVGAYQVFCQPIFGFVEDWSKGKWPENKFITEEYSI  360

Query  1180  RFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYI  1359
                    F V+  RLVWRT +V+FTT +AM+FPFFN  +G LG+I FWPLT+YFP+EMYI
Sbjct  361   W-----GFKVNFLRLVWRTCYVIFTTALAMLFPFFNDFVGFLGAITFWPLTVYFPIEMYI  415

Query  1360  SQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             ++ KIPR SFTWIW++IL+  C V+S+LAA GSI  L KS+  FKPF
Sbjct  416   ARRKIPRFSFTWIWMEILNGICLVISLLAAAGSIHGLVKSLRLFKPF  462



>ref|XP_010245602.1| PREDICTED: amino acid permease 6 [Nelumbo nucifera]
Length=487

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/480 (59%), Positives = 365/480 (76%), Gaps = 12/480 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGG------DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             E+QK  +  + E  G       +   D+DGR+KRTGT++TASAHIITA+IGSGVLSLAWA
Sbjct  4     ELQKKGNFYMGEAPGMMEMGISNKNLDDDGRAKRTGTLITASAHIITAVIGSGVLSLAWA  63

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG VAGP  ++AFS IT +T+ LLADCYRSPD   GKRNY+YMD VRA+LGG++++ 
Sbjct  64    IAQLGWVAGPSVLIAFSGITYFTSTLLADCYRSPDPVTGKRNYTYMDVVRAHLGGIKIQL  123

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  LVG +IGY ITA++S+ A+ R+NC+H HG  T+ C  +    I+IF +++++
Sbjct  124   CGLAQYVNLVGITIGYTITASISMAAVKRSNCFHTHGHHTK-CNVADYPFIIIFASIQIV  182

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGV-DVETSVTGVPVGVNHSTKD  780
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+A G  DV TS+TGV VGV+ +  +
Sbjct  183   LSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSVAKVAEGSGDVRTSLTGVLVGVDVTGTE  242

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IG+ + T FY+LCG +
Sbjct  243   KVWKTFQAIGDIAFAYAYSTVLIEIQDTLKSSPPENKVMKKASFIGVSTTTLFYVLCGCV  302

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D ANVCI +HL+GAYQV  QPV+ FVE W   R
Sbjct  303   GYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLIGAYQVFCQPVYGFVEKWCNHR  361

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FI+ E+ I  P  G ++++ FR+VWRT +V+ T VVAMIFPFFN  LGLLG+ +F
Sbjct  362   WPENGFISTEYAINIPAYGAYNINFFRVVWRTVYVIVTAVVAMIFPFFNDFLGLLGAASF  421

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EMYI+QAKIPR SFTW WL+ILS+ C VVS++AA GS+  LA  V  +KPF
Sbjct  422   WPLTVYFPIEMYIAQAKIPRFSFTWTWLKILSWACLVVSIVAAAGSVQGLATDVKAYKPF  481



>ref|XP_010943299.1| PREDICTED: amino acid permease 6 [Elaeis guineensis]
Length=473

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/472 (58%), Positives = 356/472 (75%), Gaps = 5/472 (1%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             M+  L   V +G    + +D+DGR KRTGT+LTASAHIITA+IGSGVLSLAW++AQLG V
Sbjct  1     MEAGLGFEVAKGSEAMVDFDDDGRVKRTGTLLTASAHIITAVIGSGVLSLAWSVAQLGWV  60

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
             AGP  ++AFS+IT + A LL DCYRSP+   GKRNY+Y DAVR+YLGG+  K CGVAQYA
Sbjct  61    AGPTVLLAFSLITWFCARLLVDCYRSPNPTYGKRNYTYRDAVRSYLGGMNYKLCGVAQYA  120

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              LVGA+IGY IT A+S+ AI R+NC+HKHG     C  S   +++IF +++++LSQIPNF
Sbjct  121   NLVGAAIGYTITTAISMGAIKRSNCFHKHGHDAI-CEASNNKNMIIFASIQIILSQIPNF  179

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSA  804
             H++W+LSI+AA+MSF YSSIG+ LS  KIA G+   T++TGV VGV+ S  +K++  F A
Sbjct  180   HKIWWLSILAAIMSFAYSSIGLGLSIAKIAEGIAARTTLTGVTVGVDVSASEKVWRAFQA  239

Query  805   LGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
             LGNIA AF +S +LI+I+DTLKS P E + MK+AS+IG+   T FY+LCG+LGY AFGN 
Sbjct  240   LGNIAFAFTYSNVLIEIEDTLKSDPPENQVMKKASNIGVSITTVFYMLCGVLGYAAFGND  299

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFIT  1164
             APGN LT   GFYEPFWLVD+ N+C+ +HL+GAYQV  QPVF  VE W   RW     +T
Sbjct  300   APGNFLTG-FGFYEPFWLVDVGNICVAIHLIGAYQVFTQPVFQVVENWWHGRWSRRHLLT  358

Query  1165  GEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFP  1344
              EH +  PFLG++  S FRL+WR  +V+ TTV+AMIFPFFN  +GL+G++++WPLT+YFP
Sbjct  359   IEHVVSIPFLGDYPFSFFRLIWRILYVILTTVIAMIFPFFNDFVGLIGAVSYWPLTVYFP  418

Query  1345  VEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +EM+I+QAKI R S TW WL++LSF C +V++L   GS+  L  SV  +KPF
Sbjct  419   IEMFIAQAKIGRFSATWTWLKVLSFGCLLVALLGTCGSLQGLIHSVRGYKPF  470



>ref|XP_007018375.1| Amino acid permease 6 [Theobroma cacao]
 gb|EOY15600.1| Amino acid permease 6 [Theobroma cacao]
Length=483

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 363/479 (76%), Gaps = 12/479 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGD------DLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             EMQK+ S+ +E+  GD          D+DGR KRTGT LTASAHIITA+IGSGVLSLAWA
Sbjct  4     EMQKT-SMFIEQNPGDYENGDFQKNLDDDGRVKRTGTWLTASAHIITAVIGSGVLSLAWA  62

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG VAGP  ++AFS IT +T+ LL DCYR+PD   GKRNY+YMD VRAYLGG +V+ 
Sbjct  63    IAQLGWVAGPAVLMAFSFITYFTSTLLVDCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQL  122

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  L+G +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++
Sbjct  123   CGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CQTSNYPFMVIFACIQIV  181

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS   +AGG  V TS+TGV VGV+ S  +K
Sbjct  182   LSQIPNFHKLSWLSILAAIMSFAYSSIGLGLSIATVAGGGHVRTSLTGVTVGVDVSGSEK  241

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ TF A+G+IA A+ +S +LI+IQDT+KSSP E ++MK+A+SIG+ + T FY+LCG++G
Sbjct  242   VWRTFQAIGDIAFAYAYSTVLIEIQDTIKSSPPENKSMKRATSIGVSTTTLFYVLCGLVG  301

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFW++D ANVCI VHL+GAYQV  QP+F FVE W    W
Sbjct  302   YAAFGNDAPGNFLTG-FGFYEPFWMIDFANVCIAVHLIGAYQVFCQPLFGFVEGWCAGHW  360

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FIT EH +  P  G + ++ FRLVWRT +V+ T V AMIFPFFN  LGL+G+ +FW
Sbjct  361   PDNKFITSEHAVDVPLYGIYYINFFRLVWRTAYVIVTAVAAMIFPFFNDFLGLIGAASFW  420

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+Q K+P+ SF W+WL+ILS+ C +VS++AA GSI  LA+S+  ++PF
Sbjct  421   PLTVYFPIEMHIAQTKMPKYSFRWMWLKILSWACLIVSLIAAAGSIQGLAQSLKAYRPF  479



>ref|XP_010269102.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/463 (60%), Positives = 356/463 (77%), Gaps = 6/463 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
             E G  D+ +D+DGR KRTGT++TAS+HIITA+IGSGVLSL W IAQLG VAGP A++ FS
Sbjct  2     EMGVQDMDFDDDGRIKRTGTLITASSHIITAVIGSGVLSLPWVIAQLGWVAGPAALMVFS  61

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              IT +T+ LLADCYRSPD   GKRNY+Y DAVR  LGG++V+ CG+AQY   +GASIGY 
Sbjct  62    FITWFTSTLLADCYRSPDPVSGKRNYTYRDAVRTSLGGLKVQLCGLAQYGNFIGASIGYT  121

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             ITA++S+ A++R+NC+HK+G   + C  S    ++IF  ++++LSQIPNFH+L +LSI+A
Sbjct  122   ITASISMAAVIRSNCFHKNGHHVK-CHVSNNPFMIIFACIQIVLSQIPNFHKLSWLSILA  180

Query  655   ALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             ALMSF YS IGI LSA K+A    DV TS+TGV VGV+ +  +K++ TF A+G+IA AF 
Sbjct  181   ALMSFSYSLIGIGLSAAKVAERNHDVRTSLTGVQVGVDVTATEKVWRTFQAIGDIAFAFT  240

Query  832   FSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDD  1011
             FS +LI+IQDTLKSS  E + MK+AS IG+L+   FY+LCG +GY AFGN APGN LT  
Sbjct  241   FSPVLIEIQDTLKSSIPENQVMKKASFIGVLTTALFYVLCGCVGYAAFGNKAPGNFLTG-  299

Query  1012  HGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF  1191
              G YEPFWL+D ANVCI++HL+GAYQV  QP+FAFVE W   RW    FIT EH +  P 
Sbjct  300   FGLYEPFWLIDFANVCIVIHLIGAYQVFCQPLFAFVEKWCSKRWRDNGFITKEHAVTIPL  359

Query  1192  LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAK  1371
              G +S++ FRLVWRT +V+ T V+AM FPFFN  LGL+G++++WPL++YFP+EMYISQ++
Sbjct  360   YGAYSINFFRLVWRTVYVILTAVIAMTFPFFNDFLGLIGAVSYWPLSVYFPIEMYISQSR  419

Query  1372  IPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             IPR SFTWIWL+IL + C VVS++A VGS+  LAK V  +KPF
Sbjct  420   IPRFSFTWIWLKILCWVCLVVSIIAEVGSVQGLAKDVKTYKPF  462



>gb|EEE66520.1| hypothetical protein OsJ_22995 [Oryza sativa Japonica Group]
Length=485

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 355/482 (74%), Gaps = 6/482 (1%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             R +E+ A    +     E G  D    D+DGR KRTGT++TASAHIITA+IGSGVLSLAW
Sbjct  3     RPQEKVATTTTAAFNLAESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP  +VAFSVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + +
Sbjct  63    AIAQLGWVIGPAVLVAFSVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYR  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              C VAQY  LVG +IGY IT A+S+ AI R+N +H++G     C+ S  ++++IF  +++
Sbjct  123   LCSVAQYVNLVGVTIGYTITTAISMGAIKRSNWFHRNGHDA-ACLASDTTNMIIFAGIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQ+PNFH++W+LSIVAA+MS  YS+IG+ LS  KIAGG   E ++TGV VGV+ S  +
Sbjct  182   LLSQLPNFHKIWWLSIVAAVMSLAYSTIGLGLSIAKIAGGAHPEATLTGVTVGVDVSASE  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+L
Sbjct  242   KIWRTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVL  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWLVD+ NVCI+VHLVGAYQV  QP++ F E W+R+R
Sbjct  302   GYAAFGNRAPGNFLT-GFGFYEPFWLVDVGNVCIVVHLVGAYQVFCQPIYQFAEAWARSR  360

Query  1141  WGGVWFITGEHTIRFPF-LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIA  1317
             W    F+ GE  +R P   G+F VS  RLVWRT +VV T V AM FPFFN  LGL+G+++
Sbjct  361   WPDSAFVNGERVLRLPLGAGDFPVSALRLVWRTAYVVLTAVAAMAFPFFNDFLGLIGAVS  420

Query  1318  FWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKP  1497
             FWPLT+YFPV+MY+SQAK+ R S TW W+ +LS  C VVS+LAA GSI  L KSV H+KP
Sbjct  421   FWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLSLACLVVSLLAAAGSIQGLIKSVAHYKP  480

Query  1498  FA  1503
             F+
Sbjct  481   FS  482



>ref|NP_001058839.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAC82952.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30612.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAF20753.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAG97575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99938.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 355/482 (74%), Gaps = 6/482 (1%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             R +E+ A    +     E G  D    D+DGR KRTGT++TASAHIITA+IGSGVLSLAW
Sbjct  5     RPQEKVATTTTAAFNLAESGYADRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAW  64

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP  +VAFSVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + +
Sbjct  65    AIAQLGWVIGPAVLVAFSVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYR  124

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              C VAQY  LVG +IGY IT A+S+ AI R+N +H++G     C+ S  ++++IF  +++
Sbjct  125   LCSVAQYVNLVGVTIGYTITTAISMGAIKRSNWFHRNGHDA-ACLASDTTNMIIFAGIQI  183

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQ+PNFH++W+LSIVAA+MS  YS+IG+ LS  KIAGG   E ++TGV VGV+ S  +
Sbjct  184   LLSQLPNFHKIWWLSIVAAVMSLAYSTIGLGLSIAKIAGGAHPEATLTGVTVGVDVSASE  243

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+L
Sbjct  244   KIWRTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVL  303

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWLVD+ NVCI+VHLVGAYQV  QP++ F E W+R+R
Sbjct  304   GYAAFGNRAPGNFLT-GFGFYEPFWLVDVGNVCIVVHLVGAYQVFCQPIYQFAEAWARSR  362

Query  1141  WGGVWFITGEHTIRFPF-LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIA  1317
             W    F+ GE  +R P   G+F VS  RLVWRT +VV T V AM FPFFN  LGL+G+++
Sbjct  363   WPDSAFVNGERVLRLPLGAGDFPVSALRLVWRTAYVVLTAVAAMAFPFFNDFLGLIGAVS  422

Query  1318  FWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKP  1497
             FWPLT+YFPV+MY+SQAK+ R S TW W+ +LS  C VVS+LAA GSI  L KSV H+KP
Sbjct  423   FWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLSLACLVVSLLAAAGSIQGLIKSVAHYKP  482

Query  1498  FA  1503
             F+
Sbjct  483   FS  484



>ref|XP_006657428.1| PREDICTED: amino acid permease 6-like [Oryza brachyantha]
Length=484

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/465 (60%), Positives = 354/465 (76%), Gaps = 6/465 (1%)
 Frame = +1

Query  121   EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAF  300
             E G GD    D+DGR KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG V GP  +VAF
Sbjct  19    ESGYGDRPDLDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  78

Query  301   SVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
             SVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + + C +AQY  LVG +IGY
Sbjct  79    SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVAKYRLCSLAQYINLVGVTIGY  138

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              IT A+S+ AI R+NC+H++G     C+ S  ++++IF  +++LLSQ+PNFH++W+LSIV
Sbjct  139   TITTAISMGAIKRSNCFHQNGH-DAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIV  197

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             AA+MS  YS+IG+ LS  KIAGG   +T++TGV VGV+ S  +K++ TF +LG+IA A+ 
Sbjct  198   AAVMSLAYSTIGLGLSIAKIAGGAHAKTTLTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  257

Query  832   FSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDD  1011
             +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+LGY AFGN APGN LT  
Sbjct  258   YSNVLIEIQDTLRSSPAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLT-G  316

Query  1012  HGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF  1191
              GFYEPFWLVD+ NVCI+VHLVGAYQV  QP++ FVE W+ +RW    F+  E  +R P 
Sbjct  317   FGFYEPFWLVDVGNVCIVVHLVGAYQVFCQPIYQFVEGWAHSRWPDSGFLNAERVLRLPL  376

Query  1192  -LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
               G+F VS FRL+WRT +VV T VVAM FPFFN  LGL+G+++FWPLT+YFPV+MY+SQA
Sbjct  377   GAGDFPVSPFRLLWRTLYVVLTAVVAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQA  436

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             K+ R S TW W+ +LSF C VVS+LAA GSI  L KSV H+KPF+
Sbjct  437   KVRRFSPTWTWMNVLSFACLVVSLLAAAGSIQGLIKSVAHYKPFS  481



>ref|XP_004955421.1| PREDICTED: amino acid permease 6-like [Setaria italica]
Length=483

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/480 (58%), Positives = 360/480 (75%), Gaps = 6/480 (1%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              + E+ A    + +LA E G GD    D+DGR +RTGT++TASAHIITA+IGSGVLSLAW
Sbjct  4     EKHEQAAGKVSAFNLA-EAGYGDRPDLDDDGRERRTGTLVTASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP+ +VAFSVIT + + LLADCYR+PD   GKRNY+Y  AVRAYLG  + +
Sbjct  63    AIAQLGWVIGPVVLVAFSVITWFCSSLLADCYRAPDPVHGKRNYTYGQAVRAYLGVSKYR  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              C +AQY  LVG +IGY IT A+S+ AI R+NC+H++G   + C  S  ++++IF  +++
Sbjct  123   LCSLAQYINLVGVTIGYTITTAISMGAIKRSNCFHRNGHSAD-CEASNTTNMIIFAGIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQ+PNFH+LW+LSIVAA+MS  YSSIG+ LS  KIAGGV  +T++TG  VGV+ S  +
Sbjct  182   LLSQLPNFHKLWWLSIVAAVMSLAYSSIGLGLSIAKIAGGVHAKTTLTGATVGVDVSATE  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+L
Sbjct  242   KIWKTFQSLGDIAFAYSYSNVLIEIQDTLRSSPPENVVMKKASFIGVSTTTMFYMLCGVL  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFY+PFWL+D+ NVCI +HL+GAYQV  QP+FAFVE W+R R
Sbjct  302   GYAAFGNQAPGNFLTG-FGFYDPFWLIDVGNVCIAIHLIGAYQVFCQPIFAFVEAWARDR  360

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    F+  E  +R P  G+F +S FRLVWRT +VV T +VAMIFPFFN  LGL+G+++F
Sbjct  361   WPDSGFLNAERVVRVPLAGDFPLSPFRLVWRTAYVVITALVAMIFPFFNDFLGLIGAVSF  420

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFPV+MY++QAK  R S TW W+ +LSF C VVS+LAA GS+  L   +  +KPF
Sbjct  421   WPLTVYFPVQMYMAQAKTRRFSPTWTWMNVLSFSCLVVSLLAAAGSVQGLITDLKGYKPF  480



>ref|XP_002510013.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52200.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/480 (58%), Positives = 363/480 (76%), Gaps = 13/480 (3%)
 Frame = +1

Query  91    EMQKSLSLAVE-------EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             EMQ S S+ +E       E GG     D+DGR KRTGT LTASAHIITA+IGSGVLSLAW
Sbjct  4     EMQPS-SMYLEQVDVEGYENGGVRKNVDDDGRPKRTGTWLTASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGP+ ++AFS IT +T+ LLAD YRSPD   GKRNY+YMDAVRA LGG +V 
Sbjct  63    AIAQLGWVAGPVILMAFSFITFFTSTLLADSYRSPDPVTGKRNYTYMDAVRANLGGWKVT  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
             FCG++QYA LVG ++GY ITA++S+ A+ R+NC+H+HG   + C  S    ++IF  +++
Sbjct  123   FCGISQYANLVGITVGYTITASISMVAVKRSNCFHRHGHAAK-CHTSNNPYMIIFACIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             +LSQIPNFH+L +LS++AA+MSF YSSIG+ LS  K+AGG  V TS+TG  VGV+ +   
Sbjct  182   ILSQIPNFHKLSWLSVLAAVMSFAYSSIGLGLSIAKVAGGEHVRTSITGTTVGVDVTAAQ  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++  F ++G+IA A+ +S +LI+IQDT+KS P E +AMK+AS +GI++ T FY+LCG +
Sbjct  242   KIWRAFQSIGDIAFAYAYSTVLIEIQDTIKSGPPENKAMKKASFVGIVTTTMFYILCGCI  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D+ANVCI +HL+GAYQV  QP+F+F+E  SR R
Sbjct  302   GYAAFGNDAPGNFLTG-FGFYEPFWLIDIANVCIAIHLIGAYQVFCQPIFSFMEKNSRQR  360

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FIT E+ I  PFLG + +S FRLVWRT +V+ T +VAMI PFFN  LGL+G+ AF
Sbjct  361   WPENKFITTEYAINIPFLGVYYLSTFRLVWRTLYVIVTAIVAMILPFFNDFLGLIGAAAF  420

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EMYI++ +IP+ S TWIWL+IL+  C VVS+LAA GS+  L  S+  +KPF
Sbjct  421   WPLTVYFPIEMYITRTRIPKFSSTWIWLKILTLACLVVSLLAAAGSVEGLINSLKTYKPF  480



>gb|EYU39082.1| hypothetical protein MIMGU_mgv1a020135mg [Erythranthe guttata]
Length=466

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/467 (60%), Positives = 363/467 (78%), Gaps = 6/467 (1%)
 Frame = +1

Query  100   KSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             + +SL +E    +  K+D+DG+ KRTGT+ TA+AHIITA+IGSGVLSLAWAIAQLG +AG
Sbjct  2     RDISLNIEAENQESSKFDDDGQVKRTGTMFTATAHIITAVIGSGVLSLAWAIAQLGWIAG  61

Query  280   PIAMVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGA  459
             PIA++AF+VIT +T+ LLADCYRS DG RNY+Y++ VR++LGG++ + CG+AQ++ LVG+
Sbjct  62    PIALLAFAVITWFTSILLADCYRSTDGTRNYTYIEVVRSHLGGLKFQLCGIAQHSNLVGS  121

Query  460   SIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWF  639
              IGY ITA++S+ A+ R+ C+HK+G    GC  S    I+ FGA++++LSQIPNFH+L  
Sbjct  122   CIGYSITASISMVAMGRSYCFHKYGH-EAGCHRSNNPYIMSFGAMQLVLSQIPNFHKLTM  180

Query  640   LSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIA  819
             LSIVAA+MSF YSSIGI LS  KIA G  +E+ +TGVP+G + S+ DKM++T++ALGNIA
Sbjct  181   LSIVAAVMSFAYSSIGIGLSIGKIAEGGQIESGLTGVPIGKDMSSTDKMWNTYNALGNIA  240

Query  820   LAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNL  999
              A+ FS +L++IQDT+KS   E R MK A+  GI  +T FY+LCG+LGY AFGN APGN 
Sbjct  241   FAYAFSNVLVEIQDTVKSGASENRTMKNATLAGISISTIFYMLCGVLGYAAFGNDAPGNF  300

Query  1000  LTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTI  1179
             LT   GFYEPFWLV LAN+ I++HLVGAYQV  QP FAFVE   R +W    F+T E++I
Sbjct  301   LT-GFGFYEPFWLVGLANLFIVIHLVGAYQVYCQPTFAFVEELGRKKWPESKFVTREYSI  359

Query  1180  RFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYI  1359
                  G F ++LFRLVWR+ FV+ TTVVAM+FPFFN  +GLLG+ +FWPLT+YFP+EMYI
Sbjct  360   ----YGRFDLNLFRLVWRSSFVILTTVVAMLFPFFNDFMGLLGAASFWPLTVYFPIEMYI  415

Query  1360  SQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             ++AKIPR SFTWIW+QILS  C V+S+LAA G+I  L KS+  FKPF
Sbjct  416   ARAKIPRFSFTWIWMQILSGICLVISLLAAAGAIQGLIKSLGTFKPF  462



>ref|XP_010553668.1| PREDICTED: amino acid permease 1-like [Tarenaya hassleriana]
Length=488

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/453 (60%), Positives = 352/453 (78%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG VAGP+ ++ FSVIT +T+ +
Sbjct  33    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWVAGPVILMIFSVITYFTSTM  92

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ CG+AQY  L+G +IGY ITA++SL A
Sbjct  93    LADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGMAQYGNLIGITIGYTITASISLVA  152

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I R+NCYH  G   + C  S    + +FG +++LLSQIPNFH+L FLSI+AA+MSF Y+S
Sbjct  153   IQRSNCYHDKGHKAD-CSTSHYPYMAVFGCIQILLSQIPNFHKLSFLSILAAIMSFAYAS  211

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IG+ LS   +AGG   +TS+TGV VG   +  +K++ TF A+G+IA A+ FS +LI+IQD
Sbjct  212   IGVGLSIAAVAGGQTGKTSLTGVQVGEGITASEKVWKTFQAVGDIAFAYAFSTVLIEIQD  271

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + T FY+LCG +GY AFGN APG+ LTD  GFYEPFWL+
Sbjct  272   TLRSSPAENKAMKRASLVGVSTTTLFYVLCGCVGYAAFGNEAPGDFLTD-FGFYEPFWLI  330

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F+FVE     +W    FIT EH +  P LG F ++ FR
Sbjct  331   DFANACIAFHLIGAYQVFCQPIFSFVEKKCGRKWPESKFITAEHGLNVPLLGKFHINFFR  390

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +V+ TT++AMIFPFFNAILGL+G+ +FWPLT+YFP+EM+I+Q+KI + SF W W
Sbjct  391   LVWRTAYVIVTTILAMIFPFFNAILGLIGAASFWPLTVYFPIEMHIAQSKIKKFSFRWTW  450

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+IL++ CFVVS++AAVGSI  L +SV  +KPF
Sbjct  451   LKILNWLCFVVSIVAAVGSIQGLIQSVRTYKPF  483



>ref|XP_011078457.1| PREDICTED: amino acid permease 6-like [Sesamum indicum]
Length=485

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/482 (57%), Positives = 361/482 (75%), Gaps = 13/482 (3%)
 Frame = +1

Query  88    AEMQKSLSLAVE--------EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSL  243
             AE+QK  S+ +E        E G     +DEDGR+KRTGT+LTASAHI+TA+IGSGVLSL
Sbjct  3     AELQKRRSMYIEPATTRDELESGEASKNFDEDGRAKRTGTMLTASAHIVTAVIGSGVLSL  62

Query  244   AWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQ  414
             AWA+AQLG VAGP  ++ FS IT +T+ LLAD YR P    G RNY+YMD VR++LGG +
Sbjct  63    AWALAQLGWVAGPAVLLTFSFITYFTSTLLADTYRFPGPVHGTRNYTYMDVVRSHLGGYK  122

Query  415   VKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAV  594
             V+ CG+AQY  LVG  IGY ITAA+S+ A++R+NC+HKHG   + C+ S   S+ IF  +
Sbjct  123   VQLCGLAQYGNLVGVGIGYTITAAISMVAVLRSNCFHKHGHHVK-CLKSNYPSMAIFAGI  181

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHST  774
             +++LSQIPNFH L +LSIVAA+MSF YS IG+ LS  K+ G    +TS+TG  VGV+ + 
Sbjct  182   QIVLSQIPNFHELSWLSIVAAIMSFTYSFIGLGLSIAKLIGDGHAKTSLTGTTVGVDVTG  241

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCG  954
              +K++ +F A+G+IA A+ +S +LI+IQDTLKS+P E + MK+AS +G+++ T FY+LCG
Sbjct  242   SEKLWRSFQAIGDIAFAYAYSTVLIEIQDTLKSAPPENKVMKKASLVGVVTTTVFYVLCG  301

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFGN APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE  S 
Sbjct  302   CIGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFTQPIFGFVESRSS  360

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
              +W    FIT EH +R P  G  SV+LFR+VWRT +V+ TT++AMIFPFFN  LGL+G+ 
Sbjct  361   QKWPENKFITAEHAVRIPLCGVLSVNLFRMVWRTIYVIVTTIIAMIFPFFNDFLGLIGAA  420

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             +F+PLT+YFP+EM+I+QAKIP+ SFTW+WL+I+S+ C +VS++AA GSI  LA  V  FK
Sbjct  421   SFYPLTVYFPIEMHIAQAKIPKFSFTWMWLKIISWTCMIVSLIAAAGSIQGLAHDVRRFK  480

Query  1495  PF  1500
             PF
Sbjct  481   PF  482



>ref|XP_004501076.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=481

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/483 (57%), Positives = 363/483 (75%), Gaps = 12/483 (2%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             D++++   + E  +S      +GG +   +DEDGR KRTGT +TASAHIITA+IGSGVLS
Sbjct  4     DQFQKNSMYIETPESFV----DGGKN---FDEDGRPKRTGTWVTASAHIITAVIGSGVLS  56

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQ+G VAGP  ++AFS IT +T+ LLAD YRSPD   GKRNY+Y + VR+ LGG 
Sbjct  57    LAWAIAQMGWVAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGR  116

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             + + CG+AQY  L+G +IGY ITA++S+ A+ R+NCYHKHG   + C  S    ++IF  
Sbjct  117   KFQLCGLAQYINLIGVTIGYTITASISMVAVKRSNCYHKHGHHAK-CYISNNPFMIIFAC  175

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHS  771
             ++++LSQIPNFH+L +LSIVAA+MSF YSSIG+ LS  K+AGG  V TS+TGV VGV+ +
Sbjct  176   IQIVLSQIPNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGPVRTSLTGVQVGVDVT  235

Query  772   TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLC  951
               +K++  F A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+LC
Sbjct  236   ATEKVWRMFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLC  295

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G LGY AFGN APGN LT   GFYEP+WL+D+AN+CI VHL+GAYQV  QP+F FVE  S
Sbjct  296   GCLGYAAFGNDAPGNFLTG-FGFYEPYWLIDVANICIAVHLIGAYQVFCQPIFGFVESKS  354

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
             + +W    F+ GEH +  P  G + V+ FR+VWRT +VV T ++AM+FPFFN  LGL+GS
Sbjct  355   KEKWSNSQFVNGEHAVTIPLCGTYYVNFFRVVWRTTYVVVTALIAMLFPFFNDFLGLIGS  414

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
             ++FWPLT+YFP+EMYI Q+K+ R SFTW WL+ILS+ C +VS+++AVGSI  LA  +  +
Sbjct  415   LSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSWACLIVSIISAVGSIQGLAHDLKKY  474

Query  1492  KPF  1500
             +PF
Sbjct  475   QPF  477



>ref|XP_010556498.1| PREDICTED: amino acid permease 6 [Tarenaya hassleriana]
Length=478

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/465 (58%), Positives = 355/465 (76%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A E G  +    D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA AQLG +AGP  ++
Sbjct  12    AYESGDVNKSFVDDDGREKRTGTWMTASAHIITAVIGSGVLSLAWANAQLGWIAGPAVLM  71

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS+IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ CG+AQY  L+G +I
Sbjct  72    AFSIITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGLAQYGNLIGITI  131

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++LSQIPNFH+L +LS
Sbjct  132   GYTITASISMVAVKRSNCFHKHGHHVK-CQTSNNPFMIIFACIQIVLSQIPNFHKLSWLS  190

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF Y+SIG+ LS  K+ GG    T++TGV +GV+ ++ +K++ TF A+G+IA A
Sbjct  191   ILAAVMSFAYASIGVGLSIAKVVGGAHSRTALTGVTIGVDVTSSEKVWRTFQAIGDIAFA  250

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + +S +LI+IQDTLKSSP E +AMK+AS +G+ + T FY+LCG +GY AFGN APGN LT
Sbjct  251   YAYSTVLIEIQDTLKSSPAENKAMKRASLVGVSTTTMFYMLCGCVGYAAFGNDAPGNFLT  310

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWL+D ANVCI +HL+GAYQV  QP+F FVE  S  RW    FITGE+TI  
Sbjct  311   G-FGFYEPFWLIDFANVCIAIHLIGAYQVFCQPIFQFVESQSAKRWPDNRFITGEYTINI  369

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             PF G   VS FRLVWRT +VV T VVAMIFPFFN  LGL+G+ +FWPLT+YFP+EM+I+Q
Sbjct  370   PFCGEIYVSFFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQ  429

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + S TW WL+ILS+ C +VS++AA GS+  L +S+  +KPF
Sbjct  430   RKMKKFSSTWTWLKILSWACLIVSLVAAAGSVQGLIQSLKTYKPF  474



>ref|XP_003588450.1| Amino acid transporter [Medicago truncatula]
 gb|AES58701.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/466 (58%), Positives = 356/466 (76%), Gaps = 6/466 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A E  G +D  +D+DGR+KRTGT LTASAHIITA+IGSGVLSLAWAIAQ+G VAGP  + 
Sbjct  5     APENYGPEDKNFDDDGRAKRTGTWLTASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLF  64

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS IT +T+ LLADCYRSPD   GKRNY+Y + VRA LGG + + CG+AQY  LVG +I
Sbjct  65    AFSFITYFTSTLLADCYRSPDPVHGKRNYTYTEVVRANLGGRKFQLCGLAQYINLVGVTI  124

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++L QIPNFH L +LS
Sbjct  125   GYTITASISMVAVQRSNCFHKHGH-QDKCYVSNNPFMIIFACIQIVLCQIPNFHELSWLS  183

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDKMFSTFSALGNIAL  822
             IVAA+MSF YSSIG+ LS  K+AGG + V TS+TGV +GV+ +  +K++  F A+G+IA 
Sbjct  184   IVAAVMSFAYSSIGLGLSVAKVAGGGNHVTTSLTGVQIGVDVTATEKVWRMFQAIGDIAF  243

Query  823   AFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             A+ FS +LI+IQDTLKSSP E R MK+AS IGIL+ T FY+LCG LGY AFGN APGN L
Sbjct  244   AYAFSNVLIEIQDTLKSSPPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFL  303

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T   GFYEPFWL+D ANVCI VHL+GAYQV VQP+F FVE  S+ +W    F+ GEH + 
Sbjct  304   TG-FGFYEPFWLIDFANVCIAVHLIGAYQVFVQPIFGFVEGQSKQKWPDSKFVNGEHAMN  362

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
              P  G+++V+ FR++WR+ +V+ T ++AM+FPFFN  LGL+GS++F+PLT+YFP+EMYI 
Sbjct  363   IPLYGSYNVNYFRVIWRSCYVIITAIIAMLFPFFNDFLGLIGSLSFYPLTVYFPIEMYIK  422

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +  +P+ SFTW WL+ILS+ C V+S+++A GSI  LA S+  +KPF
Sbjct  423   KTNMPKYSFTWTWLKILSWLCLVISIISAAGSIQGLATSLKTYKPF  468



>ref|XP_002285557.1| PREDICTED: amino acid permease 6 [Vitis vinifera]
 emb|CBI19332.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 353/462 (76%), Gaps = 5/462 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
             E G      D+DGR KRTGT+LTASAHIITA+IGSGVLSLAW+I+QLG +AGP+ +V FS
Sbjct  20    EKGDIGKNLDDDGRFKRTGTLLTASAHIITAVIGSGVLSLAWSISQLGWIAGPVVLVVFS  79

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              IT +T+ LLADCYRSPD   GKRNY+YMD VRA LGG++V+ CG+AQY  L+G +IGY 
Sbjct  80    FITYFTSTLLADCYRSPDPITGKRNYTYMDVVRANLGGMKVQLCGIAQYGNLIGVTIGYT  139

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             ITA++S+ A+ R+NCYHKHG   + C PS    ++IF  ++++LSQIPNFH+L +LSI+A
Sbjct  140   ITASISMVAVRRSNCYHKHGHQAK-CNPSDYPYMIIFACIQIVLSQIPNFHKLSWLSILA  198

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF Y+SIGI LS  ++AGG    T++TG  VGV+ S+ +K++ TF ++GNIA A+ +
Sbjct  199   AVMSFSYASIGIGLSIARVAGGAHARTTLTGRTVGVDLSSSEKVWRTFESIGNIAFAYAY  258

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             S +L++IQDTLKSSP E + MK+A+  GI + + FY+LCG +GY AFGN APGN LT   
Sbjct  259   STVLVEIQDTLKSSPPENKVMKKATFAGISTTSLFYVLCGCVGYAAFGNDAPGNFLTG-F  317

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GF+EPFWL+DLANV I +HL+GAYQV  QPVF FVE W   RW    FIT EH I  P  
Sbjct  318   GFFEPFWLIDLANVFIAIHLIGAYQVFCQPVFGFVEKWCNKRWPESKFITTEHCIDVPLY  377

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
             G + ++LFRLVWRT +V+ T V+AM+FPFFN ++G LG+ +FWPLT+YFP+EM+I++ KI
Sbjct  378   GIYYLNLFRLVWRTVYVIVTAVLAMLFPFFNEVMGFLGAASFWPLTVYFPIEMHIARTKI  437

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ SFTW WL+ILS+ C +VSV+AA GSI  L K +  +KPF
Sbjct  438   PKFSFTWTWLKILSWTCLMVSVVAAAGSIQGLIKEIEKYKPF  479



>ref|XP_009793584.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=481

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 363/477 (76%), Gaps = 8/477 (2%)
 Frame = +1

Query  91    EMQK-SLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQL  264
             E QK ++ ++ E   GD  K +D+DGR KRTGT+LTASAHIITA+IGSGVLSLAWAIAQL
Sbjct  4     EFQKNTMYVSTELERGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQL  63

Query  265   GSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKFCGVA  435
             G VAGP  + AFS IT +T+ LLADCYRSP    GKRNY+YMD VR++LGGV+V  CG+A
Sbjct  64    GWVAGPAVLFAFSFITYFTSTLLADCYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGLA  123

Query  436   QYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQI  615
             QYA LVG +IGY ITA++S+ A+ R+NC+HKHG     C  S    ++IF  ++V+LSQI
Sbjct  124   QYANLVGVTIGYTITASISMVAVKRSNCFHKHGH-EASCSISSYPYMIIFAVIQVVLSQI  182

Query  616   PNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFS  792
             PNFH+L +LSI+AA+MSF Y+SIG+ LS  K AG G  V+TS+TG  VGV+ S  +K++ 
Sbjct  183   PNFHKLSWLSILAAVMSFTYASIGLGLSIAKAAGVGHHVKTSLTGTTVGVDVSGSEKIWK  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
             +F A+G+IA A+ +S +LI+IQDTL+S P E + MK+AS  G+ + T FY+LCG +GY A
Sbjct  243   SFQAIGDIAFAYAYSTVLIEIQDTLRSQPPESKVMKRASLAGVSTTTLFYILCGTIGYAA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP++ FVE     RW   
Sbjct  303   FGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPLYGFVEARCNERWSDS  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT E+ ++ P  G ++V+LFRLVWRT +VV T V+AMIFPFFN  LGL+G+ +F+PLT
Sbjct  362   KFITSEYAVQVPCCGVYNVNLFRLVWRTAYVVVTAVIAMIFPFFNDFLGLIGAASFYPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             +YFP+EM+I+Q KIP+ SFTW+WL+ILS+ C VVS++AA GSI  L  S+ H+KPF+
Sbjct  422   VYFPIEMHIAQRKIPKYSFTWVWLKILSWTCLVVSLVAAAGSIQGLVTSLKHYKPFS  478



>gb|KDP41551.1| hypothetical protein JCGZ_15958 [Jatropha curcas]
Length=484

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 358/480 (75%), Gaps = 5/480 (1%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             +E +  +   + + +   E GG     D+DGR+KRTGT +TASAHIITA+IGSGVLSLAW
Sbjct  3     KEMQHSSMYLEQVDIEGYENGGIRKNLDDDGRAKRTGTWITASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGP+ ++AFS IT +T+ LLADCYRSPD   GKRNY+YMDAVRA LGG +V 
Sbjct  63    AIAQLGWVAGPVILMAFSFITFFTSTLLADCYRSPDPVTGKRNYTYMDAVRANLGGWKVT  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQYA LVG ++GY ITA++S+ A+ R+NC+H HG   + C  S    ++IF  +++
Sbjct  123   MCGLAQYANLVGITVGYTITASISMVAVKRSNCFHNHGHHVK-CNTSNNPYMIIFACIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             +LSQIPNFH+L +LS+VAA+MSF YSSIG+ LS  K+AGG    TS+TG  V V+ +   
Sbjct  182   VLSQIPNFHKLSWLSLVAAVMSFAYSSIGLGLSIAKVAGGGHARTSLTGTTVRVDVTPAQ  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++  F A+G+IA A+ FS +LI+IQDT++SSP E +AMK+AS IGIL+ T FY+LCG L
Sbjct  242   KVWRAFQAIGDIAFAYAFSTVLIEIQDTVRSSPPENKAMKRASFIGILTTTLFYVLCGCL  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+DLANVCI +HL+GAYQV  QP+F+FVE +   R
Sbjct  302   GYAAFGNDAPGNFLTG-FGFYEPFWLIDLANVCIAIHLIGAYQVFCQPIFSFVERYCHQR  360

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FIT EH I  P+ G + ++ FRLVWRT +V+ T V+AMI PFFN  LGL+G+ AF
Sbjct  361   WSENKFITSEHAINIPYYGVYYLNSFRLVWRTIYVIVTAVLAMILPFFNDFLGLIGAAAF  420

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EMYI++ ++P+ S TW WL+ILS  C +VS++AA GSI  L  S+  +KPF
Sbjct  421   WPLTVYFPIEMYIARTRMPKFSVTWTWLKILSLACLIVSLVAAAGSIEGLINSLKTYKPF  480



>ref|XP_009335480.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/465 (59%), Positives = 349/465 (75%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A+ E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQLG VAGP  ++
Sbjct  17    AIIENGDFRKNVDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVLM  76

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS IT +TA LLADCYRSPD   GKRNY+YMD VRA LGG +V+ CG+AQY+ LVG +I
Sbjct  77    AFSFITYFTATLLADCYRSPDPVSGKRNYTYMDVVRANLGGRKVQLCGLAQYSNLVGVTI  136

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++ LSQI NFH+LW+LS
Sbjct  137   GYTITASISMVAVKRSNCFHKHGHHVK-CHTSNNPFMIIFACIQLFLSQIQNFHKLWWLS  195

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             IVAA+MSF YSSIG+ LS  K+  G    TS+TG  VG++ S  +K++ TF A+G+IA A
Sbjct  196   IVAAIMSFAYSSIGLGLSLAKVISGPHARTSLTGGTVGIDVSASEKVWKTFQAIGDIAFA  255

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + +S +L++IQDTLKS P E +AMK+A+SIGI + T FY+LCG +GY AFGN APGN LT
Sbjct  256   YAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGNDAPGNFLT  315

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWLVD+AN+CI +HL+GAYQV  QP+F FVE     RW    FI GE+ I  
Sbjct  316   G-FGFYEPFWLVDVANICIAIHLIGAYQVFCQPIFGFVESSCAQRWPESEFINGEYPINI  374

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             PF G F V+ FRLVWRT +VV T ++AM+FPFFN  LGLLG+ +FWPLT+YFP+EMYI++
Sbjct  375   PFCGQFCVNSFRLVWRTAYVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIAR  434

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + +FTW W++ILS+ C V+S++AA  SI  LA  V  +KPF
Sbjct  435   TKMAKFTFTWTWMKILSWVCLVISLIAAAASIQGLATDVKKYKPF  479



>ref|XP_010440833.1| PREDICTED: amino acid permease 6-like [Camelina sativa]
Length=481

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 362/480 (75%), Gaps = 13/480 (3%)
 Frame = +1

Query  94    MQKSLSLAVEEG------GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAI  255
             M+K  ++ VE+G      G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAWAI
Sbjct  1     MEKKKTMFVEQGITDHEIGNTNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAI  60

Query  256   AQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFC  426
             AQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ C
Sbjct  61    AQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLC  120

Query  427   GVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLL  606
             G+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    +++F  ++++L
Sbjct  121   GLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVK-CATSNTPFMIVFAIIQIIL  179

Query  607   SQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDK  783
             SQIPNFH L +LSI+AA+MSF Y+SIGI LS  K AGG + V T++TGV VGV+ S  +K
Sbjct  180   SQIPNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTALTGVTVGVDVSDSEK  239

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLK-SSPRERRAMKQASSIGILSATFFYLLCGIL  960
             ++ TF A+G+IA A+ +S +LI+IQDTLK   P E +AMK+AS +G+ + TFFY+LCG +
Sbjct  240   VWRTFQAIGDIAFAYAYSTVLIEIQDTLKVGPPSENKAMKRASLVGVSTTTFFYMLCGCV  299

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S  R
Sbjct  300   GYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSAKR  358

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FIT E+ +  P  G FS++LFRLVWRT +VV T VVAMIFPFFN  LGL+G+ +F
Sbjct  359   WPDNKFITREYKVHVPCCGEFSINLFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASF  418

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EM+I+Q KI + SFTW WL+ILS+ CF+VS++AA GS+  L  S+  FKPF
Sbjct  419   WPLTVYFPIEMHIAQKKINKFSFTWTWLKILSWACFIVSLVAAAGSVQGLITSLKDFKPF  478



>gb|EYU39081.1| hypothetical protein MIMGU_mgv1a023099mg [Erythranthe guttata]
Length=465

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/464 (59%), Positives = 352/464 (76%), Gaps = 7/464 (2%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             + ++E G     K+D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG VAGPIA
Sbjct  5     NFSIEGGDPSSHKFDDDGRPKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWVAGPIA  64

Query  289   MVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             + +FS+IT +T+ LLADCYRS  G RNY+Y D V++YLGG +   CG+AQY  LVG +IG
Sbjct  65    LASFSIITWFTSTLLADCYRSTTGTRNYTYRDVVKSYLGGTKQTLCGIAQYTNLVGVTIG  124

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y IT ++S+ AI R++C+HK+G    GC  S    I+ FG +++++SQIPNFH L  LSI
Sbjct  125   YSITTSISMVAIKRSHCFHKYGH-EAGCHMSNNPYIMGFGVLQIIISQIPNFHELSILSI  183

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +AA+MSF YSSIGI LS  KIA G  VETS+TG+P+G N S   KM++T+SALGNIA A+
Sbjct  184   IAAVMSFAYSSIGIGLSIGKIAEGGHVETSLTGIPIGPNMSKIQKMWNTYSALGNIAFAY  243

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              FS +L++IQDT+KS   E   MK+A+  GI  +T FY+LCGILGY AFGN APGN LT 
Sbjct  244   AFSNVLVEIQDTIKSGQPENVVMKKATLAGISVSTMFYMLCGILGYAAFGNNAPGNFLT-  302

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFYEPFWLVD+ANVCI+VHL+GAYQV  QP++AFVE WS  +W    FIT E+++   
Sbjct  303   GFGFYEPFWLVDIANVCIVVHLIGAYQVFCQPIYAFVEKWSNEKWPENKFITWEYSV---  359

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
                   +S FRL+WRT +V+FTTV+AM+FPFFN  +GLLG+ +FWPLT+YFP+EMYI++ 
Sbjct  360   --CGLKLSFFRLIWRTLYVIFTTVLAMLFPFFNDFVGLLGAASFWPLTVYFPIEMYIARR  417

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             KIPR SF WIW+QILS  C V+++L+A GSI  L +S+  FKPF
Sbjct  418   KIPRFSFMWIWMQILSGICLVITLLSAAGSIEGLIRSLKTFKPF  461



>ref|XP_008219153.1| PREDICTED: amino acid permease 6-like [Prunus mume]
Length=483

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/474 (57%), Positives = 350/474 (74%), Gaps = 5/474 (1%)
 Frame = +1

Query  88    AEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             + M    +  + E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  8     SSMYMEHNPGIVENGDFRKNLDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLG  67

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              VAGP  ++AFS IT +T+ LLADCYRSPD   GKRNY+YMD VRA LGG +V+ CG+AQ
Sbjct  68    WVAGPAVLMAFSFITYFTSTLLADCYRSPDPVHGKRNYTYMDVVRANLGGRKVQLCGLAQ  127

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             Y  L+G +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++LLSQIP
Sbjct  128   YGNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CRTSNNPFMIIFACIQILLSQIP  186

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             NFH+L +LSI+AA+MSF YSSIG+ LS  K+  G    T++TG  VG++ S  +K++ TF
Sbjct  187   NFHKLSWLSIIAAVMSFAYSSIGLGLSVAKVIAGPHARTTLTGATVGIDVSASEKVWKTF  246

Query  799   SALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
              A+G+IA A+ +S +L++IQDTLKS P E +AMK+A+SIGI + T FY+LCG +GY AFG
Sbjct  247   QAIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVGYAAFG  306

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             N APGN LT   GFYEPFWLVDLAN+CI +HL+GAYQV  QP+F FVE     RW    F
Sbjct  307   NDAPGNFLTG-FGFYEPFWLVDLANICIAIHLIGAYQVFCQPIFGFVESQCAKRWPESKF  365

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             I  EH +  PF G +  + FRLVWRT +VV T V+AM+FPFFN  LGLLG+ +FWPLT+Y
Sbjct  366   INSEHAVNLPFHGAYCFNSFRLVWRTAYVVMTAVLAMLFPFFNDFLGLLGAASFWPLTVY  425

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FP+EMYI++ K+PR SFTW W++ILS+ C V+S+++A  +I  LA  V  +KPF
Sbjct  426   FPIEMYIARTKMPRFSFTWTWMKILSWACLVISLVSAAAAIQGLATDVKKYKPF  479



>ref|XP_009127448.1| PREDICTED: amino acid permease 6 [Brassica rapa]
Length=481

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/482 (58%), Positives = 362/482 (75%), Gaps = 11/482 (2%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              ++  F E     S    + G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAW
Sbjct  2     EKKSMFIEQ----SFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAW  57

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V 
Sbjct  58    AIAQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVM  117

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    ++IF  +++
Sbjct  118   LCGLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK-CSTSNTPFMIIFACIQI  176

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGG-VDVETSVTGVPVGVNHSTK  777
             +LSQIPNFH L +LSI+AA+MSF Y+SIG+ LS  K+AGG V   T++TGV VGV+ +  
Sbjct  177   VLSQIPNFHNLSWLSILAAVMSFSYASIGVGLSIAKVAGGGVHARTALTGVTVGVDVTGS  236

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCG  954
             DK++ TF A+G+IA A+ +S +LI+IQDTLK+SP  E +AMK+AS +G+ + TFFY+LCG
Sbjct  237   DKVWRTFQAVGDIAFAYAYSTVLIEIQDTLKASPPSENKAMKRASLVGVSTTTFFYMLCG  296

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S 
Sbjct  297   CVGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSA  355

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
              RW    FITGE+ +  P  G+F +SLFRLVWRT +VV T VVAMIFPFFN  LGL+G+ 
Sbjct  356   KRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAA  415

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             +FWPLT+YFP+EM+I+Q K+ + SFTW WL+ILS+ CF+VS++AA GS+  L +S+  FK
Sbjct  416   SFWPLTVYFPIEMHIAQKKMKKFSFTWTWLKILSWACFLVSLVAAAGSVQGLIQSLKDFK  475

Query  1495  PF  1500
             PF
Sbjct  476   PF  477



>ref|XP_007222665.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
 gb|EMJ23864.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
Length=483

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/474 (57%), Positives = 350/474 (74%), Gaps = 5/474 (1%)
 Frame = +1

Query  88    AEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             + M    +  + E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  8     SSMYMEHNPGIVENGDFRKNLDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLG  67

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              VAGP  ++AFS IT +T+ LLADCYRSPD   GKRNY+YMD VRA LGG +V+ CG+AQ
Sbjct  68    WVAGPAVLMAFSFITYFTSTLLADCYRSPDPVHGKRNYTYMDVVRANLGGRKVQLCGLAQ  127

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             Y  L+G +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++LLSQIP
Sbjct  128   YGNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CRTSNNPFMIIFACIQILLSQIP  186

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             NFH+L +LSI+AA+MSF YSSIG+ LS  K+  G    T++TG  VG++ S  DK++ TF
Sbjct  187   NFHKLSWLSIIAAVMSFAYSSIGLGLSVAKVIAGPHARTTLTGGTVGIDVSASDKVWKTF  246

Query  799   SALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
              A+G+IA A+ +S +L++IQDTLKS P E +AMK+A+SIGI + T FY+LCG +GY AFG
Sbjct  247   QAIGDIAFAYAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTVFYVLCGCVGYAAFG  306

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             N APGN LT   GFYEPFWLVDLAN+CI +HL+GAYQV  QP+F FVE     RW    F
Sbjct  307   NDAPGNFLTG-FGFYEPFWLVDLANICIAIHLIGAYQVFCQPIFGFVESQCAKRWPESKF  365

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             I  EH +  PF G +  + FRLVWRT +VV T ++AM+FPFFN  LGLLG+ +FWPLT+Y
Sbjct  366   INSEHAVNLPFHGAYCFNSFRLVWRTAYVVMTAILAMLFPFFNDFLGLLGAASFWPLTVY  425

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FP+EMYI++ K+PR SFTW W++ILS+ C V+S+++A  +I  LA  V  +KPF
Sbjct  426   FPIEMYIARTKMPRFSFTWAWMKILSWACLVISLVSAAAAIQGLATDVKKYKPF  479



>dbj|BAJ85485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 358/480 (75%), Gaps = 9/480 (2%)
 Frame = +1

Query  79    ERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIA  258
             E+      + S+A E G GD    D+DGR +RTGT++TASAHIITA+IGSGVLSLAWAIA
Sbjct  4     EKSKANPAAFSIA-EAGFGDRTDIDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIA  62

Query  259   QLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCG  429
             QLG V GP  +VAFSVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + + C 
Sbjct  63    QLGWVIGPAVLVAFSVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVSKYRLCS  122

Query  430   VAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLS  609
             +AQY  LVG +IGY IT A+S+ AI R+NC+H++G     C  S  ++++IF A+++LLS
Sbjct  123   LAQYLNLVGVTIGYTITTAISMGAIGRSNCFHRNGH-NAACEASNTTNMIIFAAIQILLS  181

Query  610   QIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMF  789
             Q+PNFH++W+LSIVAA+MS  YSSIG+ LS  KIAGGV  +T++TGV VGV+ S  +K++
Sbjct  182   QLPNFHKVWWLSIVAAVMSLAYSSIGLGLSIAKIAGGVHAKTTLTGVTVGVDVSASEKIW  241

Query  790   STFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYL  969
              TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+LGY 
Sbjct  242   RTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAENTVMKKASLIGVSTTTTFYMLCGVLGYA  301

Query  970   AFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGG  1149
             AFG++APGN LT   GFYEPFWLVD+ NVCI+VHLVGAYQV  QP + FVE W+R+RW  
Sbjct  302   AFGSSAPGNFLT-GFGFYEPFWLVDVGNVCIVVHLVGAYQVFCQPFYQFVEGWARSRWPD  360

Query  1150  VWFITGEHTIRFPFL---GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
               F+  E  ++ P +   G F VS FRLVWRT +V  T VVAM+FPFFN  LGL+G+++F
Sbjct  361   SAFLHAERVVQLPAIVGGGEFPVSPFRLVWRTAYVALTAVVAMLFPFFNDFLGLIGAVSF  420

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFPVEMY++QAK+ R S TW W+ +LS  C VVSVLAA GS+  L K V  +KPF
Sbjct  421   WPLTVYFPVEMYMAQAKVRRFSPTWTWMNVLSIACLVVSVLAAAGSVQGLVKDVAGYKPF  480



>ref|XP_006280391.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
 gb|EOA13289.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
Length=481

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/480 (58%), Positives = 363/480 (76%), Gaps = 13/480 (3%)
 Frame = +1

Query  94    MQKSLSLAVEEG------GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAI  255
             M+K  +++VE+       G  +  +DEDGR KR+GT +T SAHIITA+IGSGVLSLAWAI
Sbjct  1     MEKKKTMSVEQSFTDHEIGDTNKNFDEDGREKRSGTWVTGSAHIITAVIGSGVLSLAWAI  60

Query  256   AQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFC  426
             AQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ C
Sbjct  61    AQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLC  120

Query  427   GVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLL  606
             G+AQY  LVG +IGY ITA++S+ A+ R+NC+HK+G   + C  S    +++F  ++++L
Sbjct  121   GLAQYGNLVGITIGYTITASISMVAVKRSNCFHKNGHHVK-CATSNTPFMIVFAIIQIIL  179

Query  607   SQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDK  783
             SQIPNFH L +LSI+AA+MSF Y+SIGI LS  K AGG + V TS+TGV VG++ S  +K
Sbjct  180   SQIPNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTSLTGVTVGIDVSGSEK  239

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGIL  960
             ++ TF A+G+IA A+ +S +LI+IQDTLK+ P  E +AMK+AS +G+ + TFFY+LCG +
Sbjct  240   VWRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCV  299

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S  R
Sbjct  300   GYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSAKR  358

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FITGE+ ++ P  G FS++ FRLVWRT +VV T VVAMIFPFFN  LGL+G+ +F
Sbjct  359   WPDNKFITGEYKLQVPCCGEFSINFFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASF  418

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EM+I+Q KI + SFTW WL+ILS+ CF+VS++A  GS+  L  S+  FKPF
Sbjct  419   WPLTVYFPIEMHIAQKKIRKFSFTWTWLKILSWACFIVSLVALAGSVQGLITSLKDFKPF  478



>ref|XP_009397328.1| PREDICTED: amino acid permease 6 [Musa acuminata subsp. malaccensis]
Length=481

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 354/468 (76%), Gaps = 3/468 (1%)
 Frame = +1

Query  97    QKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVA  276
             + S  +A   G   D  +D+DGR KRTGT++TASAHIITA+IGSGVLSLAWA+AQLG +A
Sbjct  14    EASFEIASGRGRARD-DFDDDGRVKRTGTLVTASAHIITAVIGSGVLSLAWALAQLGWIA  72

Query  277   GPIAMVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
             GP  ++ FS+IT + + LLADCYRSP GKRNY Y DAVR +LGGV  K C +AQY  LVG
Sbjct  73    GPTVLLIFSLITWFCSSLLADCYRSPQGKRNYRYKDAVRTHLGGVSSKLCALAQYVNLVG  132

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              +IGY IT A+S+ A+ R+NC+H++G     C  S  +++ IF  ++++LSQIPNFH++W
Sbjct  133   VTIGYTITTAISMGAVKRSNCFHRNGHDA-ACGESNTTNMTIFACIQIVLSQIPNFHKIW  191

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             +LSIVAA+MS  YSSIG+ LS  KIA G    TS+TGV VGV+ S  +K++ TF ALG+I
Sbjct  192   WLSIVAAIMSVAYSSIGLGLSIAKIAEGPHARTSLTGVTVGVDVSGSEKVWRTFQALGDI  251

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ +S +LI+IQDTL+SSP E + MK+A++IG+L+ T FY+LCG+LGY AFGN APGN
Sbjct  252   AFAYAYSNVLIEIQDTLRSSPPENQVMKKATTIGVLTTTTFYMLCGVLGYAAFGNTAPGN  311

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
              LT   GFY+PFWLVD+ N+CI+VHL+GA+QV  QP+F F+E WSR RW    F+T EH 
Sbjct  312   FLTG-FGFYDPFWLVDIGNICIVVHLIGAFQVFAQPIFQFIETWSRNRWPDNRFVTTEHV  370

Query  1177  IRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMY  1356
             I  P LG+   SLFR++WR+ FV+ T VVAMIFPFFN  LGL+G+++FWPLT+YFPVEMY
Sbjct  371   INIPLLGDCPFSLFRMIWRSLFVIITAVVAMIFPFFNDFLGLIGAVSFWPLTVYFPVEMY  430

Query  1357  ISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             I QAKI R S TW WL+ILS  C +VS++AA GS+  L  S+  +KPF
Sbjct  431   IVQAKIRRFSATWTWLKILSIVCLIVSLVAACGSVQGLIHSLQDYKPF  478



>ref|XP_010442428.1| PREDICTED: amino acid permease 6 [Camelina sativa]
Length=481

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 358/479 (75%), Gaps = 7/479 (1%)
 Frame = +1

Query  79    ERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIA  258
             E+   M    SL   E G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAWAIA
Sbjct  2     EKKKTMFVEQSLTDHEIGDTNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAIA  61

Query  259   QLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCG  429
             QLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ CG
Sbjct  62    QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCG  121

Query  430   VAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLS  609
             +AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    +++F  ++++LS
Sbjct  122   LAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVK-CATSNTPFMIVFAIIQIILS  180

Query  610   QIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDKM  786
             QIPNFH L +LSI+AA+MSF Y+SIGI LS  K AGG +   T++TGV VGV+ S  +K+
Sbjct  181   QIPNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHARTALTGVTVGVDVSGSEKV  240

Query  787   FSTFSALGNIALAFGFSLILIDIQDTLK-SSPRERRAMKQASSIGILSATFFYLLCGILG  963
             + TF A+G+IA A+ +S +LI+IQDTLK   P E +AMK+AS +G+ + TFFY+LCG +G
Sbjct  241   WRTFQAIGDIAFAYAYSTVLIEIQDTLKVGPPSENKAMKRASLVGVSTTTFFYMLCGCVG  300

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S  RW
Sbjct  301   YAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSAKRW  359

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FIT E+ I  P  G FS++LFRLVWRT +VV T VVAMIFPFFN  LGL+G+ +FW
Sbjct  360   PDNKFITREYKIHVPCCGEFSINLFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASFW  419

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+Q KI + SFTW WL+ILS+ CF+VS++AA GS+  L  S+  FKPF
Sbjct  420   PLTVYFPIEMHIAQKKINKFSFTWTWLKILSWACFIVSLVAAAGSVQGLITSLKDFKPF  478



>emb|CAD92450.1| amino acid permease 6 [Brassica napus]
Length=481

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/482 (57%), Positives = 361/482 (75%), Gaps = 11/482 (2%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              ++  F E     S    + G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAW
Sbjct  2     EKKSMFIEQ----SFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAW  57

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V 
Sbjct  58    AIAQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVM  117

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    ++IF  +++
Sbjct  118   LCGLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK-CSTSNTPFMIIFACIQI  176

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGG-VDVETSVTGVPVGVNHSTK  777
             +LSQIPNFH L +LSI+AA+MSF Y+SIGI LS  K+AGG V   T++TGV VGV+ +  
Sbjct  177   VLSQIPNFHNLSWLSILAAVMSFSYASIGIGLSIAKVAGGGVHARTALTGVTVGVDVTGS  236

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCG  954
             +K++ TF A+G+IA A+ +S +LI+IQDTLK+SP  E +AMK+AS +G+ + TFFY+LCG
Sbjct  237   EKVWRTFQAVGDIAFAYAYSTVLIEIQDTLKASPPSENKAMKRASLVGVSTTTFFYMLCG  296

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S 
Sbjct  297   CVGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSA  355

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
              RW    FITGE+ +  P  G+F +SLFRLVWRT +VV T VVAMIFPFFN  LGL+G+ 
Sbjct  356   KRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAA  415

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             +FWPLT+YFP+EM+I+Q  + + SFTW WL+ILS+ CF+VS++AA GS+  L +S+  FK
Sbjct  416   SFWPLTVYFPIEMHIAQKNMKKFSFTWTWLKILSWACFLVSLVAAAGSVQGLIQSLKDFK  475

Query  1495  PF  1500
             PF
Sbjct  476   PF  477



>ref|XP_010482241.1| PREDICTED: amino acid permease 6-like isoform X1 [Camelina sativa]
 ref|XP_010482242.1| PREDICTED: amino acid permease 6-like isoform X2 [Camelina sativa]
Length=481

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 359/479 (75%), Gaps = 7/479 (1%)
 Frame = +1

Query  79    ERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIA  258
             E+   M    S+   E G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAWAIA
Sbjct  2     EKKKTMFVEQSITDHEIGDSNKNFDDDGREKRTGTWMTGSAHIITAVIGSGVLSLAWAIA  61

Query  259   QLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCG  429
             QLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ CG
Sbjct  62    QLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCG  121

Query  430   VAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLS  609
             +AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    +++F  ++++LS
Sbjct  122   LAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHKVK-CATSNTPFMIVFAIIQIILS  180

Query  610   QIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDKM  786
             QIPNFH L +LSI+AA+MSF Y+SIGI LS  K AGG + V T++TGV VGV+ S  +K+
Sbjct  181   QIPNFHNLSWLSILAAVMSFCYASIGIGLSIAKAAGGGEHVRTALTGVTVGVDVSGSEKV  240

Query  787   FSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILG  963
             + TF A+G+IA A+ +S +LI+IQDTLK+ P  E +AMK+AS +G+ + TFFY+LCG +G
Sbjct  241   WRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVG  300

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S  RW
Sbjct  301   YAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSAKRW  359

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FIT E+ +  P  G FS++ FRLVWRT +VV T VVAMIFPFFN  LGL+G+ +FW
Sbjct  360   PDNKFITREYKVHVPCGGEFSINFFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASFW  419

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+Q KI + SFTW WL+ILS+ CF+VS++AA GS+  L  S+  FKPF
Sbjct  420   PLTVYFPIEMHIAQKKINKFSFTWTWLKILSWACFIVSLVAAAGSVQGLITSLKDFKPF  478



>gb|ADB92670.1| amino acid permease 6 [Populus tremula x Populus alba]
Length=483

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/479 (57%), Positives = 358/479 (75%), Gaps = 12/479 (3%)
 Frame = +1

Query  91    EMQKSLSLAV------EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             EMQ S SL +       E GG     D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA
Sbjct  4     EMQNS-SLHIARGPEGSESGGMSKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAWA  62

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG V GP+ ++ FS IT +T+ LLAD YRSPD   G RNY+YMDAVRA+LGG +V+ 
Sbjct  63    IAQLGWVVGPLVLMVFSFITFFTSTLLADSYRSPDPITGNRNYTYMDAVRAHLGGRKVQL  122

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  L+G ++GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++
Sbjct  123   CGLAQYVNLIGITVGYTITASISMVAVRRSNCFHKHGHAVK-CQTSNNPYMIIFACIQIM  181

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+ GG    TS+TGV VGV+ S + K
Sbjct  182   LSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSLAKVIGGAHARTSLTGVTVGVDVSAEQK  241

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ TF ALG+IA A+ +S +LI+IQDTLKSSP E +AMK+AS +GIL+ T FY+LCG LG
Sbjct  242   VWRTFQALGDIAFAYAYSTVLIEIQDTLKSSPPENKAMKRASFVGILTTTTFYILCGCLG  301

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+DLAN CI +HL+GAYQV  QP+F+FVE     RW
Sbjct  302   YAAFGNDAPGNFLTG-FGFYEPFWLIDLANACIAIHLIGAYQVFCQPIFSFVESRCHRRW  360

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 F+T EH I  PF G + ++LFRLVWRT +V+ T V+AMI PFFN  L LLG+I+FW
Sbjct  361   PDSKFMTREHAINIPFYGVYYLNLFRLVWRTLYVIVTAVLAMILPFFNDFLALLGAISFW  420

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EMY++++K+P+ SF W  L++LS+ C  VS+++A GS+  L +++  +KPF
Sbjct  421   PLTVYFPIEMYMARSKMPKFSFRWTSLKMLSWACLAVSLVSAAGSVEGLIQALKTYKPF  479



>ref|XP_008801682.1| PREDICTED: amino acid permease 6 [Phoenix dactylifera]
Length=480

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/473 (57%), Positives = 355/473 (75%), Gaps = 5/473 (1%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
              ++  L   V +G    + +D+DGR+KRTGT+LTAS+HIITA+IGSGVLSLAW++AQLG 
Sbjct  7     SIEAGLGFEVAKGSEALVDFDDDGRAKRTGTLLTASSHIITAVIGSGVLSLAWSVAQLGW  66

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             VAGP  + AFS+IT + A LL DCYRSP+   GKRNY+Y DAV +YLGGV  K CG AQY
Sbjct  67    VAGPAVLFAFSLITWFCARLLVDCYRSPNPTYGKRNYTYRDAVGSYLGGVNYKLCGAAQY  126

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
             A LVG +IGY IT A+S+ AI R++C+HK+G     C  S  ++++IF +++++LS IPN
Sbjct  127   ANLVGTAIGYTITTAISMGAIKRSDCFHKNGHDLI-CEASNNTNMIIFASIQIILSLIPN  185

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             FH++W+LSI+AA+MSF YSSIG+ LS  KIA GV V T++TGV VGV+ S  +K++ TF 
Sbjct  186   FHKIWWLSILAAIMSFTYSSIGLGLSIAKIAVGVQVRTTLTGVTVGVDVSATEKVWRTFQ  245

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             ALGNIA AF +S +LI+I+DTLKS+P E + MK+AS+IG+   T FY LCG+LGY AFGN
Sbjct  246   ALGNIAFAFTYSNVLIEIEDTLKSNPPENQVMKKASNIGVSITTVFYALCGVLGYAAFGN  305

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGN LT   GFYEPFWLVD+ N+C+ +HL+GAYQV  QPVF  VE W  +RW G  F+
Sbjct  306   DAPGNFLTG-FGFYEPFWLVDVGNICVTIHLIGAYQVFAQPVFQVVENWWHSRWTGKHFL  364

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T EH +  P LG++  S  RL+WRT +V+ TTV+AMIFPFFN  +GL+G+I++WPLT+YF
Sbjct  365   TIEHVVSIPLLGDYPFSFLRLIWRTLYVILTTVIAMIFPFFNEFIGLIGAISYWPLTVYF  424

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+EM+I+QAKI R S  W WL++LS  C +V++L   GSI  L  S+  +KPF
Sbjct  425   PIEMFIAQAKIGRFSAAWTWLKVLSIGCLLVALLGGCGSIQGLIHSIKGYKPF  477



>gb|EYU36417.1| hypothetical protein MIMGU_mgv1a005426mg [Erythranthe guttata]
Length=484

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 357/475 (75%), Gaps = 12/475 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             E ++SL     E GG    +D+DGR KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG 
Sbjct  15    ETKESL-----ENGGASKTFDDDGRLKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGW  69

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             VAGP  + AFS IT +T+ LLAD YRSP    G RNY+YMD VR++LGG +V+ CG+AQY
Sbjct  70    VAGPAVLAAFSFITYFTSTLLADSYRSPGPLHGTRNYTYMDVVRSHLGGYKVQLCGIAQY  129

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
               LVG +IGY ITA++S+ A+ R+NC+H HG   + C  S    ++IF A++++LSQIPN
Sbjct  130   GNLVGVTIGYTITASISMVAVKRSNCFHIHGH-EDKCSISNIPFMIIFAAIQIILSQIPN  188

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             FH+L +LSIVAA+MSF YSSIG+ LS  K+AGG    TS+TG  VGV+ S  DK++ +F 
Sbjct  189   FHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGHARTSLTGTTVGVDVSGSDKVWRSFQ  248

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             ++G+IA A+ +S +LI+IQDTLKS+P E + MK+AS +G+ + T FY+LCG +GY AFGN
Sbjct  249   SIGDIAFAYAYSTVLIEIQDTLKSNPSESKVMKKASLVGVSTTTVFYVLCGCVGYAAFGN  308

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGN LT   GFYEPFWL+D AN+CI VHLVGAYQV  QP+F FVE     +W G  FI
Sbjct  309   DAPGNFLT-GFGFYEPFWLIDFANICIAVHLVGAYQVFAQPIFGFVEKRCTEKWPGSRFI  367

Query  1162  TGEHTIRFPFLGN--FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             TGEH+I  P +    F+++ FRL WRT +V+ T+++AMIFPFFN  LGL+G+ +F+PLT+
Sbjct  368   TGEHSINLPLIDKPAFTINFFRLAWRTAYVILTSLIAMIFPFFNGFLGLIGAASFYPLTV  427

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YFP+EM+I+QAKI + SFTW WL+ILS+ C VVS++AA GSI  LA  V  +KPF
Sbjct  428   YFPIEMHIAQAKIRKYSFTWTWLKILSWACLVVSLIAAAGSIQGLAYDVKKYKPF  482



>gb|EYU34219.1| hypothetical protein MIMGU_mgv1a005305mg [Erythranthe guttata]
Length=489

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/483 (58%), Positives = 358/483 (74%), Gaps = 8/483 (2%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLA  246
             +E   + E + +    +E G     K +D+DGR +RTGT+LTASAHIITA+IGSGVLSLA
Sbjct  6     KESSMYIEPKPTTEARLENGEEAASKNFDDDGRVRRTGTLLTASAHIITAVIGSGVLSLA  65

Query  247   WAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQV  417
             WAIAQLG V GP  + AFSVIT +T+ LLAD YRSP    G RNY+YMD VR++LGG +V
Sbjct  66    WAIAQLGWVVGPSVLFAFSVITYFTSTLLADSYRSPGPVHGSRNYTYMDVVRSHLGGYKV  125

Query  418   KFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVE  597
               CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HK G G + C  S    + IF A++
Sbjct  126   GLCGLAQYGNLVGVTIGYTITASISMVAVKRSNCFHKEGHGAK-CSVSNYPFMAIFAAIQ  184

Query  598   VLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHST  774
             ++LSQIPNFH L +LSIVAA+MSF YSSIG+ALS  K+AGG + V TS+TG  VGV+ + 
Sbjct  185   IILSQIPNFHELSWLSIVAAVMSFAYSSIGLALSIAKLAGGGNHVRTSLTGTTVGVDVTG  244

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCG  954
              +K++ +F A+G+IA A+ +S +LI+IQDTLKS P E R MK+AS +G+ + T FY+LCG
Sbjct  245   PEKVWRSFQAIGDIAFAYAYSTVLIEIQDTLKSPPPENRVMKKASFVGVSTTTIFYVLCG  304

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              LGY AFGN APGN LT   GFYEPFWL+D ANVCI +HLVGAYQV  QP+F FVE   R
Sbjct  305   CLGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLVGAYQVFAQPIFGFVEKLCR  363

Query  1135  ARWGGVWFITGEHTIRFPFLG-NFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
              +W    FIT EH  + P  G N  ++LFRLVWRT +V+ T VVAMIFPFFN  LGL+G+
Sbjct  364   RKWPENKFITKEHAAKIPLCGPNCKINLFRLVWRTSYVIVTAVVAMIFPFFNDFLGLIGA  423

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
              +F+PLT+YFP+EM+I+Q KIP+ SFTWIWL+ILS+ C VVS++AA GSI  LA  V  +
Sbjct  424   ASFYPLTVYFPIEMHIAQTKIPKYSFTWIWLKILSWACLVVSLVAAAGSIQGLAHDVKAY  483

Query  1492  KPF  1500
             KPF
Sbjct  484   KPF  486



>ref|XP_009629042.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=491

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/484 (57%), Positives = 362/484 (75%), Gaps = 15/484 (3%)
 Frame = +1

Query  88    AEMQKSLSLAVE--------EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSL  243
             +E QK+ ++ VE        E G      D+DGR KRTGTVLTASAHIITA+IGSGVLSL
Sbjct  4     SEFQKNTNMYVEHSAQGGVLESGEVHKNIDDDGREKRTGTVLTASAHIITAVIGSGVLSL  63

Query  244   AWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQ  414
             AWA+AQLG VAGP+ +  FS IT +T+ LLADCYRSP    GKRNYSYM+ VR++LGG++
Sbjct  64    AWAMAQLGWVAGPVILFVFSFITYFTSTLLADCYRSPGPVSGKRNYSYMEVVRSHLGGIK  123

Query  415   VKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAV  594
             V+ CG+AQY  LVG +IGY ITA++S+ A+VR+NC+HK G     C  S    ++IF A+
Sbjct  124   VQLCGIAQYGNLVGITIGYTITASISMVAVVRSNCFHKKGH-QASCSVSNYPYMIIFAAI  182

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHS  771
             +++LSQIPNFH+L +LSI+AA+MSF YS IG+ LS  K+AG G  V+TS+TGV VGV+ S
Sbjct  183   QIVLSQIPNFHKLSWLSILAAVMSFAYSLIGLGLSIAKVAGAGHHVKTSLTGVQVGVDVS  242

Query  772   TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLC  951
               +K++ +F ++G+IA A+ F+ ILI+IQDTL+S P E + MK+AS +G+ + T FY+LC
Sbjct  243   GSEKLWRSFQSIGDIAFAYAFATILIEIQDTLRSPPEENKVMKRASLVGVFTTTLFYVLC  302

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G +GY AFGN APGN LT   GFYEPFWL+D ANVCI +HLVGAYQV  QP++ FVE   
Sbjct  303   GTIGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAIHLVGAYQVFCQPIYGFVEGRC  361

Query  1132  RARWGGVWFITGEHTIRFPFLGN-FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
               RW    FIT +H I  PF G+ + V+ FRL+WRT +V+ T V+AMIFPFFN  LGL+G
Sbjct  362   SERWPDNKFITSQHAINIPFSGHVYYVNFFRLLWRTAYVIVTAVIAMIFPFFNHFLGLIG  421

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             + +F+PLT+Y P+EM+I+Q KIP+ SFTWIWLQILS+ C +VS++AA GSI  L++ +  
Sbjct  422   AASFYPLTVYLPIEMHIAQRKIPKYSFTWIWLQILSWGCLIVSLVAAAGSIQGLSQDLKA  481

Query  1489  FKPF  1500
             +KPF
Sbjct  482   YKPF  485



>ref|NP_199774.1| amino acid permease 6 [Arabidopsis thaliana]
 sp|P92934.1|AAP6_ARATH RecName: Full=Amino acid permease 6; AltName: Full=Amino acid 
transporter AAP6 [Arabidopsis thaliana]
 emb|CAA65051.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAA97227.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAF00980.1| amino acid permease 6 [Arabidopsis thaliana]
 gb|AED95838.1| amino acid permease 6 [Arabidopsis thaliana]
Length=481

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 364/480 (76%), Gaps = 13/480 (3%)
 Frame = +1

Query  94    MQKSLSLAVEEG------GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAI  255
             M+K  S+ VE+       G  +  +DEDGR KRTGT +T SAHIITA+IGSGVLSLAWAI
Sbjct  1     MEKKKSMFVEQSFPEHEIGDTNKNFDEDGRDKRTGTWMTGSAHIITAVIGSGVLSLAWAI  60

Query  256   AQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFC  426
             AQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ C
Sbjct  61    AQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLC  120

Query  427   GVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLL  606
             G+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    ++IF  ++++L
Sbjct  121   GLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK-CATSNTPFMIIFAIIQIIL  179

Query  607   SQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDK  783
             SQIPNFH L +LSI+AA+MSF Y+SIG+ LS  K AGG + V T++TGV VG++ S  +K
Sbjct  180   SQIPNFHNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGAEK  239

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKS-SPRERRAMKQASSIGILSATFFYLLCGIL  960
             ++ TF A+G+IA A+ +S +LI+IQDTLK+  P E +AMK+AS +G+ + TFFY+LCG +
Sbjct  240   IWRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCV  299

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D ANVCI VHL+GAYQV  QP+F FVE  S  R
Sbjct  300   GYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLIGAYQVFCQPIFQFVESQSAKR  358

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FITGE+ I  P  G+FS++  RLVWRT +VV T VVAMIFPFFN  LGL+G+ +F
Sbjct  359   WPDNKFITGEYKIHVPCCGDFSINFLRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASF  418

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EM+I+Q KIP+ SFTW WL+ILS+ CF+VS++AA GS+  L +S+  FKPF
Sbjct  419   WPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSWTCFIVSLVAAAGSVQGLIQSLKDFKPF  478



>ref|XP_007161529.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
 gb|ESW33523.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
Length=474

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 351/470 (75%), Gaps = 6/470 (1%)
 Frame = +1

Query  103   SLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             S+ +   E   D  K +DEDGR+KRTGT +TASAHIITA+IGSGVLSLAWAIAQ+G VAG
Sbjct  3     SMHIETPETLADGNKNFDEDGRAKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAG  62

Query  280   PIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATL  450
             P  + AFS IT +T+ LLAD YRSPD   GKRNY+Y + V+A LGG + + CG+AQY  L
Sbjct  63    PAVLFAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVKANLGGRKFQLCGLAQYINL  122

Query  451   VGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHR  630
             VG +IGY ITA++S+ A+ R+NC+HKHG   + C  +    +++F  ++++LSQIPNFH+
Sbjct  123   VGVTIGYTITASISMVAVKRSNCFHKHGHEAK-CNINNYPYMIVFACIQIVLSQIPNFHK  181

Query  631   LWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALG  810
             L +LSIVAA+MSF YSSIG+ LS  K+ GG    TS+TGV VGV+ +  +K++  F A+G
Sbjct  182   LSWLSIVAAVMSFAYSSIGLGLSLAKVIGGAHARTSITGVQVGVDVTGTEKVWRMFQAIG  241

Query  811   NIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             +IA A+ FS +LI+IQDTLKS P E R MK+AS IGI++ T FY+LCG LGY AFGN AP
Sbjct  242   DIAFAYAFSNVLIEIQDTLKSGPPENRMMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAP  301

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
             GN LT   GFYEPFWL+D AN+CI VHLVGAYQV VQP+F FVE WS+ +W    FI GE
Sbjct  302   GNFLTG-FGFYEPFWLIDFANICIAVHLVGAYQVFVQPIFGFVEKWSKEKWPESQFINGE  360

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             H +  P     +++ FR+ WRT +V+ T V+AM+FPFFN  LGL+GS++FWPLT+YFPVE
Sbjct  361   HGVNVPLCEGITLNFFRMFWRTTYVIITAVLAMLFPFFNDFLGLIGSLSFWPLTVYFPVE  420

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             MYI ++ +   SFTWIWL+ILS+ C ++S+++AVGSI  LA  +  +KPF
Sbjct  421   MYIKRSNMKSFSFTWIWLKILSWVCLIISIISAVGSIQGLAHDLKKYKPF  470



>ref|XP_011017028.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=483

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 357/479 (75%), Gaps = 12/479 (3%)
 Frame = +1

Query  91    EMQKSLSLAV------EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             EMQ S SL +       EG G     D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA
Sbjct  4     EMQNS-SLYIARGPEGSEGSGISKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAWA  62

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG + GP+ +V FS IT +T+ LLAD YRSPD   G RNY+YMDAVRA LGG +V+ 
Sbjct  63    IAQLGWLVGPLVLVVFSFITFFTSTLLADSYRSPDPITGSRNYTYMDAVRANLGGRKVQL  122

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  L+G ++GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++
Sbjct  123   CGLAQYVNLIGITVGYTITASISMVAVRRSNCFHKHGHAVK-CQTSNNPYMIIFACIQIM  181

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+ GG    TS+TGV VGV+ S + K
Sbjct  182   LSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSLAKVIGGAHARTSLTGVTVGVDVSAEQK  241

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ TF ALG+IA A+ +S +LI+IQDTL+SSP E +AMK+AS +GIL+ T FY+LCG LG
Sbjct  242   VWRTFQALGDIAFAYAYSTVLIEIQDTLRSSPPENKAMKRASFVGILTTTTFYILCGCLG  301

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPF L+DLANVCI +HL+GAYQV  QP+F+FVE     RW
Sbjct  302   YAAFGNDAPGNFLTG-FGFYEPFVLIDLANVCIAIHLIGAYQVFCQPIFSFVESRCHRRW  360

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FIT EHTI  PF G + ++LFRLVWRT +V+ T V+AMI PFFN  L LLG+I+FW
Sbjct  361   PDSKFITSEHTINIPFYGVYYLNLFRLVWRTLYVIVTAVLAMILPFFNDFLALLGAISFW  420

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFPVEMY+++ K+P+ S+ W  L++LS+ C  VS+++A GS+  L +++  +KPF
Sbjct  421   PLTVYFPVEMYMARTKVPKFSYRWTSLKMLSWACLAVSLVSAAGSVQGLIQALKTYKPF  479



>gb|EMS56484.1| hypothetical protein TRIUR3_26560 [Triticum urartu]
Length=737

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/466 (60%), Positives = 354/466 (76%), Gaps = 8/466 (2%)
 Frame = +1

Query  121   EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAF  300
             E G GD    D+DGR +RTGT++TASAHIITA+IGSGVLSLAWAIAQLG V GP  +VAF
Sbjct  271   EAGFGDRTDIDDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAF  330

Query  301   SVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
             SVIT + + LLADCYRSPD   GKRNY+Y  AVRA LG  + + C +AQY  LVG +IGY
Sbjct  331   SVITWFCSSLLADCYRSPDPVHGKRNYTYGQAVRANLGVSKYRLCSLAQYVNLVGVTIGY  390

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              IT A+S+ AI R+NC+H++G     C  S  ++++IF A+++LLSQ+PNFH++W+LSIV
Sbjct  391   TITTAISMGAIGRSNCFHRNGH-NAACEASNTTNMIIFAAIQILLSQLPNFHKIWWLSIV  449

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             AA+MS  YSSIG+ LS  KIAGGV  +T++TGV VGV+ S  +K++ TF +LG+IA A+ 
Sbjct  450   AAVMSLAYSSIGLGLSIAKIAGGVHAKTALTGVTVGVDVSASEKIWRTFQSLGDIAFAYS  509

Query  832   FSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDD  1011
             +S +LI+IQDTL+SSP E + MK+AS IG+ + T FY+LCG+LGY AFG++APGN LT  
Sbjct  510   YSNVLIEIQDTLRSSPAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLT-G  568

Query  1012  HGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF  1191
              GFYEPFWLVD+ NVCIIVHLVGAYQV  QP++ FVE W+R+RW    F+  E  +R P 
Sbjct  569   FGFYEPFWLVDIGNVCIIVHLVGAYQVFCQPIYQFVEGWARSRWPDSAFLHAERVLRLPA  628

Query  1192  L---GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
             +   G F VS  RLVWRT +VV T VVAM+FPFFN  LGL+G+++FWPLT+YFPVEMY++
Sbjct  629   VLGGGEFPVSPLRLVWRTAYVVLTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMA  688

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             QAK+ R S TW W+ +LS  C VVSVLAA GS+  L K V  +KPF
Sbjct  689   QAKVRRFSPTWTWMNVLSVACLVVSVLAAAGSVQGLIKDVAGYKPF  734



>ref|XP_003603665.1| Amino acid permease [Medicago truncatula]
 gb|AES73916.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=482

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 358/481 (74%), Gaps = 9/481 (2%)
 Frame = +1

Query  73    ERERFAEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              R++F   + S+ +   E   D  K +D+DGR+KRTGT +TASAHIITA+IGSGVLSLAW
Sbjct  2     SRDQF--QKNSMYIETPEAFTDGSKNFDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAW  59

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQ+G +AGP  ++AFS IT +T+ LLAD YRSPD   GKRNY+Y + VR+ LGG + +
Sbjct  60    AIAQMGWIAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQ  119

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NCYHK G   + C  S    ++IF  +++
Sbjct  120   LCGLAQYINLIGVTIGYTITASISMVAVKRSNCYHKQGHDAK-CYISNNPFMIIFACIQI  178

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTK  777
             +LSQIPNFH+L +LSIVAA+MSF YSSIG+ LS  K+AG G  V TS+TGV VGV+ +  
Sbjct  179   VLSQIPNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGRGPAVRTSLTGVQVGVDVTGT  238

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGI  957
             +K++  F A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+LCG 
Sbjct  239   EKVWRMFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGC  298

Query  958   LGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRA  1137
             LGY AFGN APGN LT   GFYEPFWL+DLAN+ I VHL+GAYQV  QP+F FVE  S+ 
Sbjct  299   LGYAAFGNDAPGNFLTG-FGFYEPFWLIDLANIFIAVHLIGAYQVFCQPIFGFVESKSKE  357

Query  1138  RWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIA  1317
             +W    F+ GEH +  P  G   V+ FR+VWRT +VV T ++AMIFPFFN  LGL+GS++
Sbjct  358   KWSNSQFVNGEHAVNIPLCGTLHVNFFRVVWRTAYVVITALIAMIFPFFNDFLGLIGSLS  417

Query  1318  FWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKP  1497
             FWPLT+YFP+EMYI Q+K+ R SFTW W++ILS+ C +VS+++A GSI  LA  +  ++P
Sbjct  418   FWPLTVYFPIEMYIKQSKMQRFSFTWTWMKILSWACLIVSIISAAGSIQGLAHDLKKYQP  477

Query  1498  F  1500
             F
Sbjct  478   F  478



>ref|XP_002461426.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
 gb|EER97947.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
Length=480

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 357/480 (74%), Gaps = 10/480 (2%)
 Frame = +1

Query  73    ERERFAEMQKSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             ER++      + +LA E G GD     D+DGR +RTGT++TASAHIITA+IGSGVLSLAW
Sbjct  4     ERQQQQGKVAAFNLA-ESGFGDQADLLDDDGRERRTGTLVTASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP+ ++AFS IT + + LLADCYR+PD   GKRNY+Y  AVRAYLG  + +
Sbjct  63    AIAQLGWVIGPVVLLAFSAITWFCSSLLADCYRAPDPVHGKRNYTYGQAVRAYLGVSKYR  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              C +AQY  LVG +IGY IT A+S+ AI R+NC+H  G   + C  S  ++++IF  +++
Sbjct  123   LCSLAQYINLVGVTIGYTITTAISMGAINRSNCFHSKGHSAD-CEASNTTNMIIFAGIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQ+PNFH+LW+LSIVAA+MS  YSSIG+ LS  KIAGGV V+TS+TG  VGV+ +  +
Sbjct  182   LLSQLPNFHKLWWLSIVAAVMSLAYSSIGLGLSIAKIAGGVHVKTSLTGATVGVDVTATE  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E   MK+AS IG+ + T FY+LCG+L
Sbjct  242   KIWKTFQSLGDIAFAYSYSNVLIEIQDTLRSSPPENVVMKKASFIGVSTTTMFYMLCGVL  301

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFY+PFWL+D+ NVCI VHL+GAYQV  QP++ FVE W+R+R
Sbjct  302   GYAAFGNDAPGNFLT-GFGFYDPFWLIDVGNVCIAVHLIGAYQVFCQPIYQFVEAWARSR  360

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    F+  EHT+     G FSVS FRLVWRT +VV T +VAM+FPFFN  LGL+G+++F
Sbjct  361   WPDSVFLNAEHTVAG---GLFSVSPFRLVWRTAYVVVTALVAMVFPFFNDFLGLIGAVSF  417

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP++MY++QAK  R S  W W+ +LS+ C  VS+LAA GS+  L K +  +KPF
Sbjct  418   WPLTVYFPIQMYMAQAKTRRFSPAWTWMNVLSYACLFVSLLAAAGSVQGLVKDLKGYKPF  477



>ref|XP_009357221.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/465 (57%), Positives = 345/465 (74%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A+ E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAW IAQLG VAGP  ++
Sbjct  17    AIIENGDFRKNVDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAWTIAQLGWVAGPAILI  76

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS IT +T+ LLADCYRSPD   GKRNY+YMD V+A LGG +V+ CG+AQY  L+G +I
Sbjct  77    AFSFITFFTSTLLADCYRSPDPVSGKRNYTYMDVVQANLGGRKVQLCGLAQYGNLIGVTI  136

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++ LSQI NFH+L +LS
Sbjct  137   GYTITASISMVAVKRSNCFHKHGHHVK-CHTSNNPFMIIFACIQLFLSQIQNFHKLSWLS  195

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF YSSIG+ LS  K+ GG    T++TG  VG++ S  +K++ TF A+G+IA A
Sbjct  196   ILAAVMSFAYSSIGLGLSVAKVIGGPHARTTLTGTTVGIDVSASEKVWKTFQAIGDIAFA  255

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + +S +L++IQDTLKS P E +AMK+A+S+GI + T FY+LCG +GY AFGN APGN LT
Sbjct  256   YAYSTVLVEIQDTLKSPPAENKAMKRATSVGIATTTLFYVLCGSVGYAAFGNDAPGNFLT  315

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWLVD+AN+CI +HL+GAYQV  QP+F FVE     RW    FI  E+ I  
Sbjct  316   G-FGFYEPFWLVDIANICIAIHLIGAYQVFCQPIFGFVESKCAKRWPDSKFINSEYPINI  374

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             PF G F V+ FRLVWRT +VV T ++AM+FPFFN  L LLG+ +FWPLT+YFP+EMY+++
Sbjct  375   PFCGQFCVNSFRLVWRTAYVVMTAILAMLFPFFNDFLALLGAASFWPLTVYFPIEMYMAR  434

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              KIP+ SFTW W++ILS+ C V+S++AA  SI  L   V  +KPF
Sbjct  435   TKIPKFSFTWTWMKILSWVCLVISLVAAAASIQGLTTDVKKYKPF  479



>gb|AFK42490.1| unknown [Medicago truncatula]
Length=482

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 357/481 (74%), Gaps = 9/481 (2%)
 Frame = +1

Query  73    ERERFAEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              R++F   + S+ +   E   D  K +D+DGR+KRTGT +TASAHIITA+IGSGVLSLAW
Sbjct  2     SRDQF--QKNSMYIETPEAFTDGSKNFDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAW  59

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQ+G +AGP  ++AFS IT +T+ LLAD YRSPD   GKRNY+Y + VR+ LGG + +
Sbjct  60    AIAQMGWIAGPAVLLAFSFITYFTSTLLADSYRSPDPVHGKRNYTYSEVVRSVLGGRKFQ  119

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NCYHK G   + C  S    ++IF  +++
Sbjct  120   LCGLAQYINLIGVTIGYTITASISMVAVKRSNCYHKQGHDAK-CYISNNPFMIIFACIQI  178

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTK  777
             +LSQIPNFH+L +LSIVAA+MSF YSSIG+ LS  K+AG G  V TS+TGV VGV+ +  
Sbjct  179   VLSQIPNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGRGPAVRTSLTGVQVGVDVTGT  238

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGI  957
             +K++  F A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS IGIL+ T FY+LCG 
Sbjct  239   EKVWRMFQAIGDIAFAYAYSNVLIEIQDTLKSSPPENQVMKRASLIGILTTTMFYMLCGC  298

Query  958   LGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRA  1137
             LGY AFGN APGN LT   GFYEPFWL+DLAN+ I VHL+GAYQV  QP+F FVE  S+ 
Sbjct  299   LGYAAFGNDAPGNFLTG-FGFYEPFWLIDLANIFIAVHLIGAYQVFCQPIFGFVESKSKE  357

Query  1138  RWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIA  1317
             +W    F+ GEH +  P  G   V+ FR VWRT +VV T ++AMIFPFFN  LGL+GS++
Sbjct  358   KWSNSQFVNGEHAVNIPLCGTLHVNFFRAVWRTAYVVITALIAMIFPFFNDFLGLIGSLS  417

Query  1318  FWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKP  1497
             FWPLT+YFP+EMYI Q+K+ R SFTW W++ILS+ C +VS+++A GSI  LA  +  ++P
Sbjct  418   FWPLTVYFPIEMYIKQSKMQRFSFTWTWMKILSWACLIVSIISAAGSIQGLAHDLKKYQP  477

Query  1498  F  1500
             F
Sbjct  478   F  478



>ref|XP_003550117.1| PREDICTED: amino acid permease 6 [Glycine max]
Length=470

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 350/470 (74%), Gaps = 10/470 (2%)
 Frame = +1

Query  103   SLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             S+ +   E   D  K +D+DGR+KRTGT +TASAHIITA+IGSGVLSLAWAIAQ+G VAG
Sbjct  3     SMHIETPETFADGSKNFDDDGRAKRTGTWITASAHIITAVIGSGVLSLAWAIAQMGWVAG  62

Query  280   PIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATL  450
             P  +  FS+IT +T+ LLADCYRSPD   GKRNY+Y + V+A LGG + + CG+AQY  L
Sbjct  63    PAVLFVFSLITYFTSTLLADCYRSPDPVHGKRNYTYSEVVKANLGGRKFQLCGLAQYINL  122

Query  451   VGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHR  630
             VG +IGY ITA++S+ A+ ++NC HKHG   E C     + ++ F  +++LLSQIPNFH+
Sbjct  123   VGVTIGYTITASLSMGAVKKSNCLHKHGHQDE-CKVKDNAFMIAFACIQILLSQIPNFHK  181

Query  631   LWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALG  810
             L +LSIVAA+MSF YSSIG+ LS  KI GG  V T++TGV V    S  +K++  F A+G
Sbjct  182   LSWLSIVAAVMSFAYSSIGLGLSIAKIIGGGHVRTTLTGVEV----SGTEKVWKMFQAIG  237

Query  811   NIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             +IA A+ FS +LI+IQDTLKSSP E + MK+AS IGI++ T FY+LCG LGY AFGN AP
Sbjct  238   DIAFAYAFSNVLIEIQDTLKSSPPENKVMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAP  297

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
              N LT   GFYEPFWL+D ANVCI VHLVGAYQV VQP+F FVE WS+  W    FI GE
Sbjct  298   SNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFVQPIFGFVEKWSKENWTESQFINGE  356

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             HT+  P  G+++V+ FR+VWRT +V+ T VVAM+ PFFN  L L+G+++FWPLT+YFP+E
Sbjct  357   HTLNIPLCGSYNVNFFRVVWRTAYVIITAVVAMLLPFFNDFLALIGALSFWPLTVYFPIE  416

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             MYI ++ + R SFTW WL+ILS+ C ++S+++ VGSI  L+ S+  +KPF
Sbjct  417   MYIKKSNMQRFSFTWTWLKILSWVCLIISIISLVGSIQGLSVSIKKYKPF  466



>ref|XP_006487060.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=475

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/474 (57%), Positives = 360/474 (76%), Gaps = 6/474 (1%)
 Frame = +1

Query  88    AEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             +E+ K  +LA+E    D  K+D+DGR KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  3     SELHKR-NLALETAISDS-KFDDDGRPKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLG  60

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYR-SPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
              +AGP+A++ FS IT +T+ LLADCYR S  G+RNY+YM+ V++ LG ++ K CG+AQY 
Sbjct  61    WIAGPMALMIFSFITGFTSSLLADCYRCSTTGRRNYTYMEVVKSNLGEMKCKLCGLAQYV  120

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              LVG +IGY ITA++S+ AI R+NC+HK G    GC  S    ++IF   E++LSQIPNF
Sbjct  121   NLVGTTIGYTITASLSMVAIKRSNCFHKEGHDA-GCHTSNNMYMIIFAIAEIILSQIPNF  179

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             H L  LSI+AA+MSF YSSIG+ L+  KI   G  V TS+TGV +GV+ ++ +K++S+  
Sbjct  180   HELSGLSILAAVMSFAYSSIGLGLAIAKITERGNHVTTSLTGVAIGVDVTSTEKIWSSLQ  239

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             A+GNIA A+ +S++L++IQDTL+SSP E + MK+AS +G+   T FY+LCG LGY AFG+
Sbjct  240   AIGNIAFAYAYSIVLVEIQDTLRSSPPENKVMKRASFVGVSITTIFYMLCGTLGYAAFGD  299

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGN LT   GFYEPFWLVD AN+CI+VHLVGAYQV  QP+F  VE W   +W    F+
Sbjct  300   KAPGNFLTG-FGFYEPFWLVDFANMCIVVHLVGAYQVFCQPIFTTVENWCCHKWPESGFV  358

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T  H I FP  G   V++FR++WRT +V+ T V+AM+FPFFN+++GLLG+IAFWPLT+YF
Sbjct  359   TKRHPITFPSCGVCYVNMFRVIWRTVYVILTAVIAMLFPFFNSVIGLLGAIAFWPLTVYF  418

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             PVEMYIS+AKI + S TW+WLQ+LS+ CF+V++LAA GSI  L K +  +KPF+
Sbjct  419   PVEMYISRAKIRKFSVTWMWLQVLSWTCFIVTLLAAAGSIQGLVKDLQTYKPFS  472



>ref|XP_008339056.1| PREDICTED: amino acid permease 6 [Malus domestica]
Length=483

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/465 (57%), Positives = 343/465 (74%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             A+ E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAWAIAQLG VAGP  ++
Sbjct  17    AIIENGDFRKNVDDDGRPKRTGTWMTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVLM  76

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AFS IT +T+ LLADCYRSPD   GKRNY+YMD VRA LGG +V  CG+AQY  L+G +I
Sbjct  77    AFSFITYFTSTLLADCYRSPDPVSGKRNYTYMDVVRANLGGXKVLLCGLAQYGNLIGVTI  136

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++ LSQI NFH+L +LS
Sbjct  137   GYTITASISMVAVKRSNCFHKHGHHVK-CHTSNNPFMIIFACIQLFLSQIQNFHKLSWLS  195

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF YS IG+ LS  K+ GG    T++TG  VG++ S  +K++ TF A+G+IA A
Sbjct  196   ILAAVMSFAYSLIGLGLSIAKVIGGPHARTTLTGTTVGIDVSASEKVWKTFQAIGDIAFA  255

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + +S +L++IQDTLKS P E +AMK+A+SIGI + T FY+LCG +GY AFGN APGN LT
Sbjct  256   YAYSTVLVEIQDTLKSPPAENKAMKRATSIGIATTTLFYVLCGCVGYAAFGNXAPGNFLT  315

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWLVD+AN+CI +HL+ AYQV  QP+F FVE     RW    FI  E+ I  
Sbjct  316   G-FGFYEPFWLVDIANICIAIHLIXAYQVFCQPIFGFVESXCAKRWPDSXFINSEYPINI  374

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             PF G   V+ FRLVWRT +VV T ++AM+FPFFN  LGLLG+ +FWPLT+YFP+EMY+++
Sbjct  375   PFCGQLCVNSFRLVWRTAYVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYMAR  434

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K P+ +FTW W++ILS+ C V+S++AA  SI  LA  V  +KPF
Sbjct  435   TKXPKFTFTWTWMKILSWVCLVISLVAAAASIQGLATDVKKYKPF  479



>ref|XP_009148321.1| PREDICTED: amino acid permease 8 [Brassica rapa]
Length=486

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/469 (58%), Positives = 345/469 (74%), Gaps = 5/469 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE G       D+DGR KRTGT LTASAHIITA+IGSGVLSLAWA+AQLG VAG + +V
Sbjct  20    AVESGNAAVKNVDDDGREKRTGTFLTASAHIITAVIGSGVLSLAWALAQLGWVAGTMILV  79

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
              F++IT YT+ LLADCYR+PD   G RNY+YM  VRAYLGG +V+ CG AQY  LVG SI
Sbjct  80    IFAIITYYTSTLLADCYRAPDPITGTRNYTYMGVVRAYLGGKKVQLCGRAQYGNLVGVSI  139

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI R NC+H  G G + C  S    ++ FG +++LLSQIPNFH+L FLS
Sbjct  140   GYTITASISLVAIGRANCFHDKGHGAK-CTASNYPYMVAFGGLQILLSQIPNFHKLSFLS  198

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF Y+SIGI L+  K+A G   +T++TG  +GV+ S  DK++  F A+G+IA +
Sbjct  199   IIAAVMSFSYASIGIGLAIAKVASGKVGKTTLTGTVIGVDVSASDKVWKAFQAVGDIAFS  258

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + ++ ILI+IQDTL+SSP E + MK+AS IG+ + T FYLLCG +GY AFGN +PG+ LT
Sbjct  259   YAYTTILIEIQDTLRSSPPENKVMKKASLIGVSTTTVFYLLCGCIGYAAFGNLSPGDFLT  318

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
             D  GFYEPFWLV  ANVCI VHLVGAYQV VQP F FVE     +W    FI  E++++ 
Sbjct  319   D-FGFYEPFWLVIFANVCIAVHLVGAYQVYVQPFFQFVESKCNKKWPESNFINKEYSLKI  377

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P LG F V+ FRLVWRT +V+ TT +AMIFPFFN+ILGLLG++AFWPLT+YFPV M+I+Q
Sbjct  378   PLLGKFRVNFFRLVWRTNYVILTTFIAMIFPFFNSILGLLGALAFWPLTVYFPVAMHIAQ  437

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA*IE  1512
              K+ + S  W+ L +L   C +VS LAAVGSI  L  +V  +KPF  I+
Sbjct  438   TKVKKYSGRWLALNLLVLVCLIVSALAAVGSIVGLINNVKKYKPFESID  486



>ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42005.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 363/506 (72%), Gaps = 39/506 (8%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGD------DLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAI  255
             M+K  S++VE+   D      +  +D+DGR KR+GT +T SAHIITA+IGSGVLSLAWAI
Sbjct  1     MEKKKSMSVEQSYTDHEIGDINKNFDDDGREKRSGTWMTGSAHIITAVIGSGVLSLAWAI  60

Query  256   AQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFC  426
             AQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V+ C
Sbjct  61    AQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLC  120

Query  427   GVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLL  606
             G+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    +++F  ++++L
Sbjct  121   GLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK-CATSNTPFMIVFAIIQIIL  179

Query  607   SQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDK  783
             SQIPNFH L +LSI+AA+MSF Y+SIG+ LS  K AGG + V T++TGV VG++ S  +K
Sbjct  180   SQIPNFHNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGSEK  239

Query  784   MFSTFSALGNIALAFGFSLILIDIQ--------------------------DTLKS-SPR  882
             ++ TF A+G+IA A+ +S +LI+IQ                          DTLK+  P 
Sbjct  240   VWRTFQAIGDIAFAYAYSTVLIEIQATTLIFLSNIQIFVRSYKLIIFCKTFDTLKAGPPS  299

Query  883   ERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCI  1062
             E +AMK+AS +G+ + TFFY+LCG +GY AFGN APGN LT   GFYEPFWL+D ANVCI
Sbjct  300   ENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCI  358

Query  1063  IVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGF  1242
              VHLVGAYQV  QP+F FVE  S  RW    FITGE+ I  P  G FS++  RLVWRT +
Sbjct  359   AVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGEFSINFLRLVWRTSY  418

Query  1243  VVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFF  1422
             VV T VVAMIFPFFN  LGL+G+ +FWPLT+YFP+EM+I+Q KIP+ SFTW WL+ILS+ 
Sbjct  419   VVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSWA  478

Query  1423  CFVVSVLAAVGSICDLAKSVMHFKPF  1500
             CFVVS++AA GS+  L  S+  FKPF
Sbjct  479   CFVVSIVAAAGSVQGLITSLKDFKPF  504



>ref|NP_176132.1| amino acid permease 1 [Arabidopsis thaliana]
 sp|Q42400.1|AAP1_ARATH RecName: Full=Amino acid permease 1; AltName: Full=Amino acid 
transporter AAP1; AltName: Full=Neutral amino acid transporter 
II [Arabidopsis thaliana]
 gb|AAF82252.1|AC008051_3 Identical to the amino acid permease I (AAP1) gb|X67124 and neutral 
amino acid transport system II (NAT2) gb|AF031649 from 
Arabidopsis thaliana and contains a transmembrane amino acid 
transporter protein PF|01490 domain. EST gb|AI995511, gb|Z18061 
comes from this gene [Arabidopsis thaliana]
 emb|CAA47603.1| amino acid permease I [Arabidopsis thaliana]
 gb|AAA32726.1| amino acid transporter [Arabidopsis thaliana]
 dbj|BAB83868.1| amino acid permease I [Arabidopsis thaliana]
 gb|AEE33541.1| amino acid permease 1 [Arabidopsis thaliana]
Length=485

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 346/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG   ++ FS IT +T+ +
Sbjct  30    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + ++NC+H  G  T  C  S    + +FG ++V+LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  150   VGKSNCFHDKGH-TADCTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTYAT  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +TS+TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAIATVAGGKVGKTSMTGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG +GY AFGN APG+ LTD  GF+EPFWL+
Sbjct  269   TLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTD-FGFFEPFWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI VHL+GAYQV  QP+F FVE      +    FIT E+++  PFLG F++SLFR
Sbjct  328   DFANACIAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYSVNVPFLGKFNISLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q KI + S  WI 
Sbjct  388   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIA  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+ + + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKTMCYVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>ref|XP_006392303.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
 gb|ESQ29589.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
Length=484

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 346/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + ++ FS IT +T+ +
Sbjct  29    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  LVG ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLVGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NC+H  G   + C  S    + +FG ++++LSQIPNFH+L FLS++AA+MSF Y++
Sbjct  149   VGKANCFHDKGHHAD-CALSNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  208   IGIGLAIATVAGGKVGKTNLTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIEIQD  267

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TLKSSP E +AMK+AS +G+ + TFFY+LCG LGY AFGN APG+ LTD  GFYEPFWL+
Sbjct  268   TLKSSPAENKAMKRASLVGVSTTTFFYILCGCLGYAAFGNQAPGDFLTD-FGFYEPFWLI  326

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI VHL+GAYQV  QP+F FVE      W    FIT E+++  PFLG F++SLFR
Sbjct  327   DFANACIAVHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNVPFLGKFNISLFR  386

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TT+VAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  387   LVWRTAYVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIG  446

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C VVS+LA  GSI  L  SV  +KPF
Sbjct  447   LKMLCWVCLVVSLLAGAGSIAGLISSVKTYKPF  479



>ref|XP_010667459.1| PREDICTED: amino acid permease 6-like [Beta vulgaris subsp. vulgaris]
Length=491

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 349/474 (74%), Gaps = 14/474 (3%)
 Frame = +1

Query  112   LAVEEGGGD------DLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             + +E+GG        D   D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG  
Sbjct  17    MYIEQGGHGGNVHDFDKNLDDDGRHKRTGTALTASAHIITAVIGSGVLSLAWAIAQLGWA  76

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
              GP  +VAFS IT  T+  LAD YRSPD   GKRNY+YM+ VRA LGG +V+ CG+AQY 
Sbjct  77    VGPAVLVAFSFITYMTSTFLADGYRSPDPVTGKRNYTYMEVVRANLGGRKVQLCGLAQYV  136

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              LVG SIGY ITA++S+ A+ R+NC+HK+G   + C  S    ++IFG +++LLSQIPNF
Sbjct  137   NLVGVSIGYTITASISMVAVKRSNCFHKYGHHVK-CNTSNNPFMIIFGCIQILLSQIPNF  195

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSA  804
             H L +LS+VAA+MSF Y+SIG+ALS  K+ GG    TS+TGV VGV+ +  DK++  F A
Sbjct  196   HELSWLSMVAAIMSFTYASIGLALSIAKVVGGGIARTSLTGVTVGVDVTAADKVWRCFQA  255

Query  805   LGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
             +G+IA A+ +S +LI+IQDTLKSSP E + MK+AS +G+ + + FY+LCG  GY AFGN 
Sbjct  256   IGDIAFAYAYSNVLIEIQDTLKSSPPENKVMKKASLVGVSTTSLFYILCGCFGYAAFGNE  315

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFIT  1164
             APGN LT   GFYEPFWLVD ANVCI VHLVGAYQV  QPVF FVE WS+  W    FIT
Sbjct  316   APGNFLT-GFGFYEPFWLVDFANVCIAVHLVGAYQVFTQPVFGFVESWSKKHWPENKFIT  374

Query  1165  GEHTIRFPFLGN--FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
              +H I  PF GN  +  + FRLVWRT +V+ T ++AM+FPFFN  LGLLGS++FWPLT++
Sbjct  375   RDHPIEIPF-GNGIYYFNWFRLVWRTSYVIVTAILAMLFPFFNDFLGLLGSLSFWPLTVF  433

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEM+ISQAK+P+ S  WI L+ LS+ C VVS++AA GSI  L  SV  +KPF
Sbjct  434   FPVEMHISQAKVPKYSSKWIALKTLSYACLVVSLIAAAGSIQGLVGSVKKYKPF  487



>ref|XP_009102845.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=484

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/453 (58%), Positives = 347/453 (77%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + +V FS IT +T+ +
Sbjct  29    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NC+HK G   + C  S    + +FG ++++LSQIPNFH+L FLS++AA+MSF Y++
Sbjct  149   VGKANCFHKKGHEAD-CTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  208   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  267

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TLKSSP E ++MK+AS +G+ + TFFY+LCG LGY AFGN APG+ LTD  GFYEPFWL+
Sbjct  268   TLKSSPAENKSMKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTD-FGFYEPFWLI  326

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++  PFLG F++SLFR
Sbjct  327   DFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISLFR  386

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  387   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIG  446

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   LKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  479



>ref|XP_010475859.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/467 (57%), Positives = 346/467 (74%), Gaps = 7/467 (1%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G     ++D+DGR KRTGTVLTASAHII A+IGSGVLSL+WAIAQLG +AG + +V 
Sbjct  2     VESGNASGNRFDDDGREKRTGTVLTASAHIIAAVIGSGVLSLSWAIAQLGWLAGTVILVP  61

Query  298   FSVITLYTAFLLADCYRSPD-----GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGAS  462
             F++I  YT+ +LADCYRSPD     G RNY+YM  VRAYLGG +V+ CG+AQYA+LVG +
Sbjct  62    FAIINYYTSTMLADCYRSPDSVGVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGVT  121

Query  463   IGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFL  642
             IGY ITA++SL AI + NCYH+ G     C  S   S+  FG V++LLSQIPNFH+L FL
Sbjct  122   IGYTITASISLVAIGKANCYHRKGNDAT-CSLSNYPSMAAFGVVQILLSQIPNFHQLSFL  180

Query  643   SIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIAL  822
             SI+A +MSF Y+SIGI LS  K+  G   +T++TG  VGV+ +  DK++ +F A+G+IA 
Sbjct  181   SIIATVMSFSYASIGIGLSIAKVISGKVGKTALTGTVVGVDVTASDKLWRSFQAVGDIAF  240

Query  823   AFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             ++ +S+IL++IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+LL
Sbjct  241   SYSYSIILVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNRAPGDLL  300

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             TD  GFYEP+WLVD AN CI++HLV AYQV  QP+F FVE     +W    FIT EH++ 
Sbjct  301   TD-FGFYEPYWLVDFANACIVLHLVAAYQVFAQPIFQFVENKCNKKWPESKFITSEHSMS  359

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
              P +G   ++LFRL WRT +V+ TTVVAMIFPFFNAILGL+GS AFWPLT+YFPV M+I+
Sbjct  360   IPLIGKCRINLFRLWWRTAYVILTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIA  419

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             Q K+ + S  W+ L +L   C +VS+LAA+GSI  L  SV  +KPF+
Sbjct  420   QTKVKKYSPRWLALNLLVVVCLIVSLLAALGSIVGLISSVKAYKPFS  466



>ref|XP_002888218.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64477.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/453 (58%), Positives = 346/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG   ++ FS IT +T+ +
Sbjct  30    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTAILLIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + ++NC+H  G   + C  S    + +FG ++V+LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  150   VGKSNCFHDKGHKAD-CTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTYAT  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +TS+TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAIATVAGGKVGKTSMTGTAVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG +GY AFGN APG+ LTD  GF+EPFWL+
Sbjct  269   TLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNKAPGDFLTD-FGFFEPFWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI VHL+GAYQV  QP+F FVE      +    FIT E+ +  PFLG F++SLFR
Sbjct  328   DFANACIAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYPVNVPFLGKFNISLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWR+ +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q KI + S  WI 
Sbjct  388   LVWRSAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIA  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+++ + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKMMCYVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>emb|CAD92449.1| amino acid permease 1 [Brassica napus]
Length=485

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/453 (58%), Positives = 345/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + ++ FS IT +T+ +
Sbjct  30    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NCYH  G   + C  S    +  FG +++LLSQIPNFH+L FLS++AA+MSF Y+S
Sbjct  150   IGKANCYHNKGHHAD-CTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAYAS  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG LGY AFGN APG+ LT+  GFYEPFWL+
Sbjct  269   TLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTN-FGFYEPFWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++  PFLG FS++LFR
Sbjct  328   DFANACIAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFSINLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TT+VAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  388   LVWRTAYVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSSRWIG  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>ref|XP_011074307.1| PREDICTED: amino acid permease 6 [Sesamum indicum]
Length=483

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/485 (56%), Positives = 360/485 (74%), Gaps = 12/485 (2%)
 Frame = +1

Query  61    DRYRERERF-AEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
               Y++   + A+  +SL     E G     +D+DGR KRTGT+LTASAHIITA+IGSGVL
Sbjct  3     KEYQKNSMYIAQPMESL-----ETGHSSKSFDDDGRVKRTGTMLTASAHIITAVIGSGVL  57

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG VAGP  ++AFS IT +T+ LLAD YR P    G RNY+YM  VR++LGG
Sbjct  58    SLAWAIAQLGWVAGPAVLMAFSFITYFTSTLLADSYRCPGPVHGTRNYTYMGVVRSHLGG  117

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
             ++V+ CG+AQY  LVG +IGY ITA++S+ A+ R+NC+HK+G   + C  S    + IF 
Sbjct  118   LKVQLCGLAQYGNLVGVTIGYTITASISMVAVKRSNCFHKNGHDVK-CSISNYPFMAIFA  176

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNH  768
              ++++LSQIPNFH+L +LSIVAA+MSF YSSIG+ LS  K+AGG  V TS+TG  VGV+ 
Sbjct  177   GIQIILSQIPNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVAGGGHVRTSLTGTTVGVDV  236

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +  DK++ +F A+G+IA A+ +S +LI+IQDTLKS P E + MK+AS +G+ + T FY+L
Sbjct  237   TGADKVWRSFQAIGDIAFAYAYSTVLIEIQDTLKSQPAENKVMKKASFVGVTTTTVFYVL  296

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG +GY AFGN APGN LT   GFYEPFWL+D ANVCI VHL+GAYQV  QP+F FVE  
Sbjct  297   CGCVGYAAFGNNAPGNFLT-GFGFYEPFWLIDFANVCIAVHLIGAYQVFAQPLFGFVENH  355

Query  1129  SRARWGGVWFITGEHTIRFPFL-GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLL  1305
                ++    FIT EH +  P L G+++++ FRLVWRT +VV T ++AMIFPFFN  LGL+
Sbjct  356   YSQKYPDNKFITTEHAVNIPLLCGSYNINFFRLVWRTAYVVVTALIAMIFPFFNDFLGLI  415

Query  1306  GSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVM  1485
             G+ +F+PLT+YFP+EM+I+Q KIP+ SF+W+WL+ILS+ C VVSV+AA GSI  LA+ V 
Sbjct  416   GAASFYPLTVYFPIEMHIAQNKIPKYSFSWMWLKILSWACLVVSVVAAAGSIQGLAEDVK  475

Query  1486  HFKPF  1500
              +KPF
Sbjct  476   TYKPF  480



>gb|AAB87674.1| neutral amino acid transport system II [Arabidopsis thaliana]
Length=485

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 345/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG   ++ FS IT +T+ +
Sbjct  30    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGVTVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + ++NC+H  G  T  C  S    + +FG ++V+LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  150   VGKSNCFHDKGH-TADCTISNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTYAT  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +TS+TG  VGV+ +   K++ +F A+G IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAIATVAGGKVGKTSMTGTAVGVDVTAAQKIWRSFQAVGYIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG +GY AFGN APG+ LTD  GF+EPFWL+
Sbjct  269   TLRSSPAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTD-FGFFEPFWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI VHL+GAYQV  QP+F FVE      +    FIT E+++  PFLG F++SLFR
Sbjct  328   DFANACIAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYSVNVPFLGKFNISLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q KI + S  WI 
Sbjct  388   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIA  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+ + + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKTMCYVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>gb|KHG24473.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=480

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 361/480 (75%), Gaps = 19/480 (4%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGD----DLK--YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             EMQK+ ++ +E+  GD    DL+   D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA
Sbjct  4     EMQKN-TMFIEQNTGDYENGDLQKNLDDDGREKRTGTWVTASAHIITAVIGSGVLSLAWA  62

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG V GP  ++AFS IT +T+ LLADCYR+PD   GKRNY+YMD VRAYLGG +V+ 
Sbjct  63    IAQLGWVVGPAVLIAFSFITYFTSTLLADCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQL  122

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQYA L+G +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  ++++
Sbjct  123   CGLAQYANLLGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CQTSNNPFMIIFACIQIV  181

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKD  780
             LSQIPNFH+L +LSI+AA+MSF Y+SIG+ LS  K A GG  V TS+TGV VGV+ S  +
Sbjct  182   LSQIPNFHKLSWLSILAAVMSFTYASIGLGLSIAKAASGGEHVRTSLTGVQVGVDVSGSE  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF A+G+IA A+ +S       DT+K+SP E ++MK+AS +G+ + T FY+LCGI+
Sbjct  242   KVWRTFQAIGDIAFAYAYS------TDTIKASPPENKSMKRASGVGVTTTTLFYVLCGIV  295

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWL+D ANVCI VHL+GAYQV  QP+F FVE      
Sbjct  296   GYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLIGAYQVFAQPLFGFVESLCARH  354

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             +    FIT EH +  PF G + ++ FRLVWRT +V+ T V+AMIFPFFN  LGL+G+ +F
Sbjct  355   YPDNKFITREHAMDVPFCGIYYLNFFRLVWRTAYVIVTAVLAMIFPFFNDFLGLIGAGSF  414

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EM+I+QAKIP+ SF W+WL+ILS+ C ++S++AA GS+  L +S+  +KPF
Sbjct  415   WPLTVYFPIEMHIAQAKIPKYSFRWVWLKILSWVCLIISLIAAAGSVEGLIQSLKTYKPF  474



>ref|XP_007143143.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
 gb|ESW15137.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
Length=466

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/458 (59%), Positives = 346/458 (76%), Gaps = 5/458 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             + LK+D+DGR KR GT +TASAHI+TA+IGSGVLSLAWA+AQLG +AGP+ +  FS+ITL
Sbjct  10    NSLKFDDDGRLKRKGTWITASAHIVTAVIGSGVLSLAWAVAQLGWIAGPVILTLFSLITL  69

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             YT FLL DCYR PD   G RN +YM+ V+  LGG Q   CGVAQ+A LVG+ IGY ITA+
Sbjct  70    YTCFLLCDCYRYPDSVHGTRNITYMNMVKTILGGRQYHLCGVAQFANLVGSCIGYTITAS  129

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI R+NC+HK+G   + C  S  + + IFGAVE+L+SQIP+FH L  LS VAA+MS
Sbjct  130   ISMVAIRRSNCFHKYGHEAK-CQVSNYAYMSIFGAVEILISQIPDFHNLSGLSFVAAVMS  188

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             FGYS+IGI LS VKIAGG  VETS+TG+ VG + +   K++S+F A+GNIA A+ FS ++
Sbjct  189   FGYSAIGIGLSIVKIAGGSHVETSITGLVVGEDVTGTQKIWSSFQAIGNIAFAYCFSQVM  248

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             ++IQDTLKS P ER AMK+A+  GI   TFFYLLCG+LGY AFGN APGN LT   GFYE
Sbjct  249   VEIQDTLKSVPSERGAMKKATVTGISITTFFYLLCGLLGYEAFGNKAPGNFLTG-FGFYE  307

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             P+WLVD+ NV I+VHLVGAYQV  QPVF  VE WS  RW     IT E+ +  P +G F 
Sbjct  308   PYWLVDIGNVFIVVHLVGAYQVFSQPVFTLVESWSAGRWPESKIITKEYGVGIPLVGTFR  367

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             +++FR++WRT FV+FT V+AMI PFFN+I+GLLG+IAFWPL +YFP  MY+ QA++P+ S
Sbjct  368   LNVFRVIWRTVFVIFTVVIAMILPFFNSIVGLLGAIAFWPLAVYFPTHMYLVQAEVPKFS  427

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
               W  +++L+ FCF+VS++AA GSI  +   +  +KPF
Sbjct  428   MVWNGIKLLNVFCFIVSLVAAAGSIQGIITDLKTYKPF  465



>ref|XP_006307429.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
 gb|EOA40327.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
Length=468

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 346/464 (75%), Gaps = 5/464 (1%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G     ++D+DGR KRTGTVLTASAHIITA+IGSGVLSL+WAIAQLG +AG + +V 
Sbjct  2     VESGDVSGNRFDDDGREKRTGTVLTASAHIITAVIGSGVLSLSWAIAQLGWLAGTLILVT  61

Query  298   FSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             F++I  YT+ +LADCYRSPD   G RNY+YMD VRAYLGG +V+ CG+AQYA+LVG +IG
Sbjct  62    FAIINYYTSTMLADCYRSPDDDPGSRNYTYMDVVRAYLGGRKVQLCGLAQYASLVGITIG  121

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y ITA++SL AI + +CYH  G G + C  S   S+  FG  +++LSQIPNFH+L FLSI
Sbjct  122   YTITASISLVAIGKADCYHDKGHGAK-CSLSNYPSMAAFGVAQIMLSQIPNFHKLSFLSI  180

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +A +MSF Y+SIGI LS   +  G   +T +TG  VGV+ +  +K++ +F A+G+IA ++
Sbjct  181   IATVMSFCYASIGIGLSIATVTSGKVGKTGLTGTVVGVDVTAFEKLYRSFQAVGDIAFSY  240

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S++L++IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+LLTD
Sbjct  241   SYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGGMGYAAFGNQAPGDLLTD  300

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFYEP+WL+D AN CI++HLV AYQV  QP+F FVE     +W    FIT EH++  P
Sbjct  301   -FGFYEPYWLIDFANACIVLHLVAAYQVFAQPIFQFVEKKCNKKWPESNFITSEHSMDIP  359

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
              +G   ++ FRL+WRT +V+ TTVVAMIFPFFNAILGL+GS AFWPLT+YFPV M+++Q 
Sbjct  360   LIGTCRINFFRLLWRTAYVIVTTVVAMIFPFFNAILGLIGSFAFWPLTVYFPVAMHMAQT  419

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             K+ + S  WI L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  420   KVKKYSLRWIGLELLVSLCLIVSLLAAMGSIVGLISSVKAYKPF  463



>dbj|BAC82953.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30613.1| putative amino acid permease [Oryza sativa Japonica Group]
Length=460

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/446 (60%), Positives = 338/446 (76%), Gaps = 6/446 (1%)
 Frame = +1

Query  178   GTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD  357
             GT++TASAHIITA+IGSGVLSLAWAIAQLG V GP  +VAFSVIT + + LLADCYRSPD
Sbjct  14    GTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLVAFSVITWFCSSLLADCYRSPD  73

Query  358   ---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHK  528
                GKRNY+Y  AVRA LG  + + C VAQY  LVG +IGY IT A+S+ AI R+N +H+
Sbjct  74    PVHGKRNYTYGQAVRANLGVAKYRLCSVAQYVNLVGVTIGYTITTAISMGAIKRSNWFHR  133

Query  529   HGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVK  708
             +G     C+ S  ++++IF  +++LLSQ+PNFH++W+LSIVAA+MS  YS+IG+ LS  K
Sbjct  134   NGH-DAACLASDTTNMIIFAGIQILLSQLPNFHKIWWLSIVAAVMSLAYSTIGLGLSIAK  192

Query  709   IAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRER  888
             IAGG   E ++TGV VGV+ S  +K++ TF +LG+IA A+ +S +LI+IQDTL+SSP E 
Sbjct  193   IAGGAHPEATLTGVTVGVDVSASEKIWRTFQSLGDIAFAYSYSNVLIEIQDTLRSSPAEN  252

Query  889   RAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIV  1068
               MK+AS IG+ + T FY+LCG+LGY AFGN APGN LT   GFYEPFWLVD+ NVCI+V
Sbjct  253   EVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLT-GFGFYEPFWLVDVGNVCIVV  311

Query  1069  HLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF-LGNFSVSLFRLVWRTGFV  1245
             HLVGAYQV  QP++ F E W+R+RW    F+ GE  +R P   G+F VS  RLVWRT +V
Sbjct  312   HLVGAYQVFCQPIYQFAEAWARSRWPDSAFVNGERVLRLPLGAGDFPVSALRLVWRTAYV  371

Query  1246  VFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFC  1425
             V T V AM FPFFN  LGL+G+++FWPLT+YFPV+MY+SQAK+ R S TW W+ +LS  C
Sbjct  372   VLTAVAAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLSLAC  431

Query  1426  FVVSVLAAVGSICDLAKSVMHFKPFA  1503
              VVS+LAA GSI  L KSV H+KPF+
Sbjct  432   LVVSLLAAAGSIQGLIKSVAHYKPFS  457



>emb|CDP00979.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/479 (56%), Positives = 354/479 (74%), Gaps = 6/479 (1%)
 Frame = +1

Query  76    RERFAEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             +E F      L    E     DLK +D+DGR KRTGTV+TASAHIITA+IGSGVLSLAWA
Sbjct  2     KEEFQNNGMYLEQNPEAPENGDLKNFDDDGRPKRTGTVITASAHIITAVIGSGVLSLAWA  61

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG VAGP  ++AFS IT +T+ +LAD YRSP    G+RNY+YMD VR++LGG +V+ 
Sbjct  62    IAQLGWVAGPAVLMAFSFITFFTSTMLADSYRSPGPITGRRNYTYMDVVRSHLGGYKVQL  121

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  L+G +IGY ITA++S+ A+ R+NC+H++G   + C  S    ++IF A+++ 
Sbjct  122   CGIAQYGNLIGVTIGYTITASISMVAVKRSNCFHRNGHHVK-CHISNNPFMIIFAAIQIF  180

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+AG    +T++TGV VGV+ S  +K
Sbjct  181   LSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSIAKVAGDGIAKTTLTGVTVGVDVSGTEK  240

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ +F A+G+IA A+ +S +LI+IQDTL+S P E + MK AS +G+ + T FY+LCG  G
Sbjct  241   VWRSFQAIGDIAFAYAYSTVLIEIQDTLRSHPPESKVMKWASGVGVSTTTLFYVLCGCTG  300

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+D ANVCI +HL+GAYQV  QP+F FVE    + W
Sbjct  301   YAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLIGAYQVFAQPIFGFVENRCSSIW  359

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FI  EH +  P  G + ++LFRLVWRT +V+ T V+AMIFPFFN  LGL+G+ +F+
Sbjct  360   PENKFINTEHAVNVPLYGTYYINLFRLVWRTVYVILTAVIAMIFPFFNDFLGLIGAGSFY  419

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+QAKIP+ S  WIWL++LS+ C VVS++AA GSI  L++ V  +KPF
Sbjct  420   PLTVYFPIEMHIAQAKIPKYSVRWIWLKVLSWACLVVSLVAAAGSIQGLSQDVKTYKPF  478



>ref|XP_004299846.1| PREDICTED: amino acid permease 6-like [Fragaria vesca subsp. 
vesca]
Length=482

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/480 (56%), Positives = 351/480 (73%), Gaps = 12/480 (3%)
 Frame = +1

Query  88    AEMQKSLSLAVE------EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             AE QK  S+ ++      E G      D+DGR KRTGT +TASAHIITA+IGSGVLSLAW
Sbjct  2     AEFQKP-SMYIDHNPSTIENGDFRKNVDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAW  60

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGPI ++ FS IT +T+ LLAD YRSPD   GKRNY+YMD V+A LGG +V+
Sbjct  61    AIAQLGWVAGPIVLMIFSFITYFTSTLLADSYRSPDPVSGKRNYTYMDVVQANLGGRKVQ  120

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF   ++
Sbjct  121   LCGLAQYGNLIGVTIGYTITASISMVAVKRSNCFHKHGHHVK-CHTSNNPFMIIFACFQI  179

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             LLSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+  G    T++TGV VGV+ S  +
Sbjct  180   LLSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSVAKVIDGPTARTTLTGVTVGVDVSGSE  239

Query  781   KMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGIL  960
             K++ TF A+G+IA A+ +S +L++IQDTL S P E ++MK+A+SIGI + T FY+LCG +
Sbjct  240   KVWRTFQAIGDIAFAYAYSTVLVEIQDTLGSPPAENKSMKKATSIGISTTTVFYVLCGTV  299

Query  961   GYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRAR  1140
             GY AFGN APGN LT   GFYEPFWLVD+AN+CI +HL+GAYQV  QPV+ FVE     R
Sbjct  300   GYAAFGNDAPGNFLTG-FGFYEPFWLVDIANICIAIHLIGAYQVFCQPVYGFVESKCAKR  358

Query  1141  WGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
             W    FI  E+ +  P  G +  + FRLVWRT +VV T ++AM+FPFFN  LGLLG+ +F
Sbjct  359   WPESKFINREYAVNIPCCGAYYFNSFRLVWRTAYVVMTAILAMLFPFFNDFLGLLGAASF  418

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFP+EMYI++ K+P+ SFTW W++ILS+ C V+S++AA  SI  LA  V  +KPF
Sbjct  419   WPLTVYFPIEMYIARTKMPKFSFTWTWMKILSWICLVISLVAAAASIQGLATDVKKYKPF  478



>gb|KFK40897.1| hypothetical protein AALP_AA2G057600 [Arabis alpina]
Length=484

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/484 (55%), Positives = 352/484 (73%), Gaps = 8/484 (2%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             +  +      +  +     AV E   D    DEDGR KRTGT LTASAHIITA+IGSGVL
Sbjct  1     MKSFNTEHDHSAAESGHGYAVTEPTKD---VDEDGREKRTGTWLTASAHIITAVIGSGVL  57

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG +AG + +  FS IT +T+ +LADCYR+PD   GKRNY+YMD VR+YLGG
Sbjct  58    SLAWAIAQLGWIAGVVILTIFSFITYFTSTMLADCYRAPDPVTGKRNYTYMDVVRSYLGG  117

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
              +V+ CGVAQY  L+G ++GY ITA++SL AI ++NC+H  G   + C  S    +  FG
Sbjct  118   RKVQLCGVAQYGNLIGITVGYTITASISLVAIGKSNCFHGKGHHAD-CAISPYPYMAAFG  176

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNH  768
              ++++LSQIPNFH+L FLS++AA+MSF Y++IGI L+   +AGG   +T++TG  VGV+ 
Sbjct  177   IIQIILSQIPNFHKLSFLSLMAAVMSFTYATIGIGLAIATVAGGKVGKTTLTGTVVGVDV  236

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
             +   K++ +F A+G+IA A+ ++ +LI+IQDTLKSSP E +AMK+AS +G+ + TFFY+L
Sbjct  237   TAAQKIWRSFQAVGDIAFAYAYATVLIEIQDTLKSSPAENKAMKRASLVGVSTTTFFYVL  296

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG +GY AFGN APG+ LTD  GF+EPFWL+D AN CI  HL+GAYQV  QP+F FVE  
Sbjct  297   CGCIGYAAFGNKAPGDFLTD-FGFFEPFWLIDFANACIAAHLIGAYQVFAQPIFQFVEKN  355

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
              +  W    FI  EH++  PFLG F+VS FRLVWRT +VV TT+VAMIFPFFNAILGL+G
Sbjct  356   CKKNWPDNKFINSEHSVNIPFLGKFNVSFFRLVWRTAYVVITTLVAMIFPFFNAILGLIG  415

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             + +FWPLT+YFPVEM+I+Q KI + S  WI L++L + C +VS+LAA GSI  L  SV  
Sbjct  416   AASFWPLTVYFPVEMHIAQTKIKKYSPRWIGLKMLCWVCLIVSLLAAAGSIAGLIGSVKQ  475

Query  1489  FKPF  1500
             +KPF
Sbjct  476   YKPF  479



>ref|XP_006302194.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
 gb|EOA35092.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
Length=486

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/482 (55%), Positives = 351/482 (73%), Gaps = 10/482 (2%)
 Frame = +1

Query  79    ERFAEMQKSLSLAVEEGGGDDL-----KYDEDGRSKRTGTVLTASAHIITAIIGSGVLSL  243
             + F   Q+      E G G ++       DEDGR KRTGT LTASAHIITA+IGSGVLSL
Sbjct  2     KSFNTDQERNHSTAESGDGYNISDPTKNVDEDGREKRTGTWLTASAHIITAVIGSGVLSL  61

Query  244   AWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQ  414
             AWAIAQLG +AG   ++ FS IT +T+ +LADCYR+PD   GKRNY+YM+ VRAYLGG +
Sbjct  62    AWAIAQLGWIAGTTILLIFSFITYFTSTMLADCYRAPDPVTGKRNYTYMEVVRAYLGGRK  121

Query  415   VKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAV  594
             V+ CGVAQY  L+G ++GY ITA++SL A+ + NC+H  G   + C  S    +  FG +
Sbjct  122   VQLCGVAQYGNLIGITVGYTITASISLVAVGKANCFHDKGHDAD-CAASNYPYMAAFGII  180

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHST  774
             +V+LSQIPNFH+L FLSI+AA+MSF Y++IGI L+   +AGG   +TS+TG  VGV+ + 
Sbjct  181   QVILSQIPNFHKLSFLSIMAAVMSFTYATIGIGLAIATVAGGKVGKTSMTGTAVGVDVTA  240

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCG  954
               K++ +F A+G+IA A+ ++ +LI+IQDTL+SSP E +AMK+AS +G+ + TFFY+LCG
Sbjct  241   AQKIWRSFQAVGDIAFAYAYATVLIEIQDTLRSSPAENKAMKRASLVGVSTTTFFYILCG  300

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              LGY AFGN APG+ LTD  GF+EP+WL+D AN CI  HL+GAYQV  QP+F FVE   +
Sbjct  301   CLGYAAFGNNAPGDFLTD-FGFFEPYWLIDFANACIAAHLIGAYQVFAQPIFQFVEKKCK  359

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
               +    FI  E+++  P LG F++S FRLVWRT +VV TTVVAMIFPFFNAILGL+G+ 
Sbjct  360   KNYPDNKFINAEYSVNVPLLGKFNISFFRLVWRTAYVVLTTVVAMIFPFFNAILGLIGAA  419

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             +FWPLT+YFPVEM+I+Q KI + S  WI L+++ + C +VS+LAA GSI  L  SV  +K
Sbjct  420   SFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCYVCLIVSLLAAAGSIAGLISSVKTYK  479

Query  1495  PF  1500
             PF
Sbjct  480   PF  481



>ref|XP_002889784.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66043.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/488 (55%), Positives = 352/488 (72%), Gaps = 17/488 (3%)
 Frame = +1

Query  46    PFSHIDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIG  225
             PFS +  +      +        AVE G     ++D+DGR KRTGT +TASAHIITA+IG
Sbjct  16    PFSQMKSFNTEHNPS--------AVESGN----RFDDDGREKRTGTFMTASAHIITAVIG  63

Query  226   SGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRA  396
             SGVLSL+WAIAQLG +AG + +V F+ I  YT+ +LADCYRSPD   G RNY+YMD VRA
Sbjct  64    SGVLSLSWAIAQLGWLAGTVILVTFASINYYTSTMLADCYRSPDTAPGTRNYTYMDVVRA  123

Query  397   YLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSI  576
             YLGG +V+ CG+AQY +LVG +IGY ITA++SL AI + NC+H  G   + C  S   S+
Sbjct  124   YLGGRKVQLCGLAQYGSLVGVTIGYTITASISLVAIGKANCFHDKGHDAK-CSLSNYPSM  182

Query  577   LIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPV  756
               FG V+++LSQIPNFH+L FLSI+A +MSF Y+SIGI LS   +  G   +T +TG  V
Sbjct  183   AAFGIVQLMLSQIPNFHKLSFLSIIATVMSFCYASIGIGLSITTVTSGKVGKTGLTGTVV  242

Query  757   GVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATF  936
             GV+ +  +KM+ +F A+G+IA ++ +S++L++IQDTLKS+P E + MK+AS  G+ + T 
Sbjct  243   GVDVTASEKMWRSFQAVGDIAFSYAYSIVLVEIQDTLKSTPPENKVMKKASLAGVSTTTV  302

Query  937   FYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAF  1116
             FY+LCG +GY AFGN APG+LLTD  GFYEP+WL+D AN CI++HL+ AYQV  QP+F F
Sbjct  303   FYILCGGIGYAAFGNKAPGDLLTD-FGFYEPYWLIDFANACIVLHLIAAYQVFAQPIFQF  361

Query  1117  VECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAIL  1296
             VE     +W    FIT EH++  P +G  +++LFRL+WRT +VV TTVVAMIFPFFNAIL
Sbjct  362   VEKKCNKKWPESIFITSEHSMNIPLIGKCTINLFRLLWRTCYVVLTTVVAMIFPFFNAIL  421

Query  1297  GLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAK  1476
             GLLG++AFWPLT+YFPV M+I QAK+ + S  WI L++L   C +VS+LA +GSI  L  
Sbjct  422   GLLGALAFWPLTVYFPVAMHIEQAKVKKYSLRWIGLKLLVSLCLIVSLLATIGSIVGLIT  481

Query  1477  SVMHFKPF  1500
             SV  +KPF
Sbjct  482   SVKAYKPF  489



>ref|XP_003557617.1| PREDICTED: amino acid permease 6 [Brachypodium distachyon]
Length=473

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 345/453 (76%), Gaps = 10/453 (2%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR +RTGT++TASAHIITA+IGSGVLSLAWAIAQLG V GP  ++AFSVIT + + L
Sbjct  25    DDDGRERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPAVLLAFSVITWFCSSL  84

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYRSPD   GKRNY+Y  AVRA LG  + + C +AQY  LVG +IGY IT A+S+ A
Sbjct  85    LADCYRSPDPVHGKRNYTYGQAVRANLGVGKYRLCSLAQYINLVGVTIGYTITTAISMGA  144

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I R+NC+H++G     C  S  ++++IF A++V+LSQ+PNFH++W+LSIVAA+MS  YSS
Sbjct  145   IGRSNCFHRNGHDAN-CEASNTTNMIIFAAIQVMLSQLPNFHKIWWLSIVAAVMSLAYSS  203

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IG+ LS  +I GG   +T++TGV VGV+ S+ +K++ TF +LG+IA A+ +S +LI+IQD
Sbjct  204   IGLGLSIARIVGGAHAKTTLTGVTVGVDVSSSEKIWRTFQSLGDIAFAYSYSNVLIEIQD  263

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+S+P E + MK+AS IG+ + T FY+LCG+LGY AFG+ APGN LT   GFYEPFWLV
Sbjct  264   TLRSNPAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSGAPGNFLT-GFGFYEPFWLV  322

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D+ N CI+VHLVGAYQV  QP++ FVE W+RARW    F+  E    FP LG   VS FR
Sbjct  323   DIGNACIVVHLVGAYQVFCQPIYQFVESWARARWPDSAFLHAE----FP-LGPVHVSPFR  377

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             L WRT +V  T VVAM+FPFFN  LGL+G+++FWPLT+YFPVEMY++QAK+ R S TW W
Sbjct  378   LTWRTAYVALTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMAQAKVRRFSPTWTW  437

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + +LS  C VVS+LAA GS+  L K+V  +KPF
Sbjct  438   MNVLSAACLVVSLLAAAGSVQGLIKAVSGYKPF  470



>ref|XP_009118278.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=489

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 346/465 (74%), Gaps = 3/465 (1%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S AVE G       D+DG  KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG VAG + 
Sbjct  23    SSAVESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVL  82

Query  289   MVAFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             +V+F+V+  YT+ +LADCYRSPD G RN +YMD VRAYLGG +V+ CG+AQY +LVG +I
Sbjct  83    LVSFAVVVNYTSRMLADCYRSPDAGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTI  142

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI + NC+H  G G + C+ S   ++  FG ++++LSQIPNFH+L FLS
Sbjct  143   GYTITASISLVAIGKANCFHDKGHGAK-CLVSNYPAMAAFGIIQIVLSQIPNFHKLSFLS  201

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF YSSIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA +
Sbjct  202   IIAAVMSFSYSSIGTGLALADLASGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFS  261

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + +S++L++IQDTL SSP E   MK+AS +G+ +AT FY+LC  +GY  FG+ APG+LLT
Sbjct  262   YAYSVVLVEIQDTLSSSPPENIVMKKASLVGVSTATAFYILCACMGYATFGSQAPGDLLT  321

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
             D  GFYEP+WL+D AN CI VHL+G YQV+ QP+F FVE      W    FIT EH++  
Sbjct  322   D-FGFYEPYWLIDFANACIAVHLIGVYQVIAQPIFQFVEKKCNKAWPESNFITKEHSMNI  380

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P LG   ++ FRLVWRT +V+F+TV+AMIFPFFNA+LGL+G++AFWPLT+YFPVEM+ISQ
Sbjct  381   PLLGKCRINFFRLVWRTIYVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVYFPVEMHISQ  440

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              KI + +  WI L++L   C +VS+LAAVGSI  L  SV  +KPF
Sbjct  441   KKIKKYTMRWIGLKLLVLVCLIVSLLAAVGSIVGLISSVKAYKPF  485



>emb|CDY46779.1| BnaCnng14480D [Brassica napus]
Length=479

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/478 (56%), Positives = 354/478 (74%), Gaps = 17/478 (4%)
 Frame = +1

Query  70    RERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
              ++  F E     S    + G  +  +D+DGR KRTGT +T SAHIITA+IGSGVLSLAW
Sbjct  2     EKKSMFIEQ----SFTDHKSGDMNKNFDDDGRQKRTGTWMTGSAHIITAVIGSGVLSLAW  57

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG VAGP  ++AFS IT +T+ +LADCYRSPD   GKRNY+YM+ VR+YLGG +V 
Sbjct  58    AIAQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVM  117

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G +IGY ITA++S+ A+ R+NC+HK+G   + C  S    ++IF  +++
Sbjct  118   LCGLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK-CSTSNTPFMIIFACIQI  176

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGG-VDVETSVTGVPVGVNHSTK  777
             +LSQIPNFH L +LSI+AA+MSF Y+SIG+ LS  K+AGG V   T++TGV VGV+ +  
Sbjct  177   VLSQIPNFHNLSWLSILAAVMSFSYASIGVGLSIAKVAGGGVHARTALTGVTVGVDVTGS  236

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCG  954
             DK++ TF A+G+IA A+ +S       DTLK+SP  E +AMK+AS +G+ + TFFY+LCG
Sbjct  237   DKVWRTFQAVGDIAFAYAYS------TDTLKASPPSENKAMKRASLVGVSTTTFFYMLCG  290

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP+F FVE  S 
Sbjct  291   CVGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPIFQFVESQSA  349

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
              RW    FITGE+ +  P  G+F +SLFRLVWRT +VV T VVAMIFPFFN  LGL+G+ 
Sbjct  350   KRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAA  409

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             +FWPLT+YFP+EM+I+Q K+ + SFTW WL+ILS+ CF+VS++AA GS+  L +S+++
Sbjct  410   SFWPLTVYFPIEMHIAQKKMKKFSFTWTWLKILSWACFLVSLVAAAGSVQGLIQSLLN  467



>emb|CDY04349.1| BnaC04g18440D [Brassica napus]
Length=484

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/453 (58%), Positives = 343/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSL+WAIAQLG +AG + +V FS IT +T+ +
Sbjct  29    DDDGREKRTGTWLTASAHIITAVIGSGVLSLSWAIAQLGWIAGLLILVIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NC+H  G   + C  S    +  FG ++++LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  149   IGKANCFHDKGHHAD-CTFSSYPYMAAFGIIQIILSQIPNFHKLSFLSIMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  208   IGIGLAMATVAGGKVGKTNMTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIEIQD  267

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TLKSSP E ++MK+AS +G+ + TFFY+LCG  GY AFGN APG+ LTD  GFYEPFWL+
Sbjct  268   TLKSSPAENKSMKRASLLGVSTTTFFYILCGCFGYAAFGNKAPGDFLTD-FGFYEPFWLI  326

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++  PFLG F++S+FR
Sbjct  327   DFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISIFR  386

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM I+Q K+ + S  WI 
Sbjct  387   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMNIAQTKVKKYSPRWIG  446

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   LKVLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  479



>ref|XP_006417504.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
 gb|ESQ35857.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
Length=478

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 342/470 (73%), Gaps = 5/470 (1%)
 Frame = +1

Query  100   KSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             K +S AVE G       D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA+AQLG VAG
Sbjct  7     KHISSAVETGDAAVKSVDDDGREKRTGTFITASAHIITAVIGSGVLSLAWALAQLGWVAG  66

Query  280   PIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATL  450
              + +V F++IT YT+ LLADCYRSPD   G RNY+YM  VRAYLGG +V+ CG+AQY  L
Sbjct  67    TVILVTFAIITYYTSTLLADCYRSPDSVTGTRNYTYMGVVRAYLGGKKVQLCGLAQYGNL  126

Query  451   VGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHR  630
             VG +IGY ITA++SL AI + NC+H  G G + C  S    +  FG V+++LSQI NFH 
Sbjct  127   VGVTIGYTITASISLVAIGKANCFHNKGHGAK-CSVSNYPYMAAFGIVQIILSQISNFHE  185

Query  631   LWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALG  810
             L FLSI+AA+MSF Y+SIGI L+   +A G   +T +TG  VGV+ +  +K++ +F A+G
Sbjct  186   LSFLSIIAAVMSFSYASIGIGLAIATVASGKIGKTDLTGTVVGVDVTASEKLWRSFQAIG  245

Query  811   NIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             +IA A+ +S ILI+IQDTL+SSP E + MK+AS +G+ + T FY+LCG +GY AFGN AP
Sbjct  246   DIAFAYAYSTILIEIQDTLRSSPPENKVMKKASLVGVSTTTVFYILCGCIGYAAFGNQAP  305

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
             G+ LTD  GFYEP+WL+D AN CI +HL+GAYQV  QP F FVE   + +W    FI  E
Sbjct  306   GDFLTD-FGFYEPYWLIDFANACIALHLIGAYQVYGQPFFQFVESKCKKKWPESKFINKE  364

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             ++   P LG   V+LFRLVWRT +V+ TTVVAMIFPFFNAILGLLG++AFWPLT+YFPV 
Sbjct  365   YSSNIPMLGKCRVNLFRLVWRTCYVILTTVVAMIFPFFNAILGLLGALAFWPLTVYFPVA  424

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             M+I+Q K+ + S  W+ L +L   C +VS LAAVGSI  L  SV  +KPF
Sbjct  425   MHIAQTKVKKYSRRWLALYLLVLVCLIVSFLAAVGSIVGLISSVKTYKPF  474



>emb|CDP00978.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/479 (54%), Positives = 355/479 (74%), Gaps = 6/479 (1%)
 Frame = +1

Query  76    RERFAEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             +E F      L    E     DLK +D+DGR KRTGTV+TASA IITA+IGSGVLSLAWA
Sbjct  2     KEEFQNSGMYLEQNPEAPENGDLKNFDDDGRPKRTGTVITASARIITAVIGSGVLSLAWA  61

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKF  423
             +AQLG VAGP  ++AFS+IT +T+ +LADCYRSP    G+RN +YMDAVR++LGG +V+ 
Sbjct  62    VAQLGWVAGPAVLMAFSLITFFTSTMLADCYRSPGPITGRRNNTYMDAVRSHLGGCKVQL  121

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQY  L+G +IGY I A++S+ A+ R+NC+ ++G   + C  S    ++IF A+++ 
Sbjct  122   CGIAQYGKLIGVTIGYTIRASISMVAVKRSNCFRRNGHHVK-CHISNNPFMIIFAAIQIF  180

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQIPNFH+L +LSI+AA+MSF YSSIG+ LS  K+AG    +T++TGV VGV+ S  +K
Sbjct  181   LSQIPNFHKLSWLSILAAVMSFAYSSIGLGLSIAKVAGDGIAKTTLTGVTVGVDVSGSEK  240

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ +F A+G+IA A+ +S +LI+IQDTL+S P E + MK+AS +G+ + T FY+LCG +G
Sbjct  241   VWRSFQAIGDIAFAYAYSTVLIEIQDTLRSHPPESKVMKRASGVGVSTITLFYVLCGCIG  300

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+D ANVCI +HL+GAYQV  QP+F FVE    ++W
Sbjct  301   YAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLIGAYQVFAQPIFGFVENRCSSKW  359

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FI  EH +  P  G + ++LFRL WRT +V+ T V+A+IFPFFN  LGL+G+ +F+
Sbjct  360   PENKFINTEHAVNVPLYGTYYINLFRLAWRTVYVILTAVIAVIFPFFNDFLGLIGAGSFY  419

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+QAKIP+ S  WIWL++LS+ C VVS++AA GSI  L++ V  +KPF
Sbjct  420   PLTVYFPIEMHIAQAKIPKYSVRWIWLKVLSWACLVVSLVAAAGSIQKLSQDVKTYKPF  478



>ref|XP_002301129.2| amino acid transport protein AAP2 [Populus trichocarpa]
 gb|EEE80402.2| amino acid transport protein AAP2 [Populus trichocarpa]
Length=487

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/483 (56%), Positives = 354/483 (73%), Gaps = 16/483 (3%)
 Frame = +1

Query  91    EMQKSLSLAV-------EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAW  249
             EMQ S SL +       E GG      D+DGR KRTGT +TASAHIITA+IGSGVLSLAW
Sbjct  4     EMQNS-SLYISRGPEGSESGGIISKNLDDDGRPKRTGTWITASAHIITAVIGSGVLSLAW  62

Query  250   AIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVK  420
             AIAQLG V GP+ +V FS IT +T+ LLAD YRSPD   G RNY+YMDAVRA LGG +V+
Sbjct  63    AIAQLGWVVGPLVLVVFSFITFFTSTLLADSYRSPDPITGNRNYTYMDAVRANLGGRKVQ  122

Query  421   FCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEV  600
              CG+AQY  L+G ++GY ITA++S+ A+ R+NC+HKHG   + C  S    ++IF  +++
Sbjct  123   LCGLAQYVNLIGITVGYTITASISMVAVRRSNCFHKHGHAVK-CQTSNNPYMIIFACIQI  181

Query  601   LLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKD  780
             +LSQIPNFH+L +LSI+AA+MSF Y+SIG+ LS  K+ GG    TS+TGV VGV+ S + 
Sbjct  182   MLSQIPNFHKLSWLSILAAVMSFAYASIGLGLSLAKVIGGAHARTSLTGVTVGVDVSAQQ  241

Query  781   KMFSTFSALGNIALAFGFSLILIDIQ---DTLKSSPRERRAMKQASSIGILSATFFYLLC  951
             K++ TF ALG+IA A+ +S + + ++   DTLKSSP E +AMK+AS +GIL+ T FY+LC
Sbjct  242   KVWRTFQALGDIAFAYAYSTLNLTVELRDDTLKSSPPENKAMKRASFVGILTTTTFYILC  301

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G LGY AFGN APGN LT   GFYEPF L+D+ANVCI +HL+GAYQV  QP+F+FVE   
Sbjct  302   GCLGYAAFGNDAPGNFLTG-FGFYEPFVLIDIANVCIAIHLIGAYQVFCQPIFSFVESRC  360

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
               RW    FIT EH I  PF G + ++LFRLVWRT +V+ T V+AMI PFFN  L LLG+
Sbjct  361   HRRWPDSKFITSEHAINIPFYGVYYLNLFRLVWRTLYVIVTAVLAMILPFFNDFLALLGA  420

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
             I+FWPLT+YFPVEMY+++ K+P+ SF W  L++LS+ C  VS+++A GS+  L +++  +
Sbjct  421   ISFWPLTVYFPVEMYMARTKMPKFSFRWTSLKMLSWACLAVSLVSAAGSVEGLIQALKTY  480

Query  1492  KPF  1500
             KPF
Sbjct  481   KPF  483



>ref|XP_009138576.1| PREDICTED: amino acid permease 1-like [Brassica rapa]
Length=484

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 343/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSL+WAIAQLG +AG + +V FS IT +T+ +
Sbjct  29    DDDGREKRTGTWLTASAHIITAVIGSGVLSLSWAIAQLGWIAGLLILVIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VRAYLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRAYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NC+H  G   + C  S    +  FG ++++LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  149   IGKANCFHDKGHHAD-CTLSSYPYMAAFGIIQIILSQIPNFHKLSFLSIMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  208   IGIGLAMATVAGGKVGKTNMTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIEIQD  267

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TLKSSP E ++MK+AS +G+ + TFFY+LCG  GY AFGN APG+ LTD  GFYEPFWL+
Sbjct  268   TLKSSPAENKSMKRASLVGVSTTTFFYILCGCFGYAAFGNKAPGDFLTD-FGFYEPFWLI  326

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++   FLG F++S+FR
Sbjct  327   DFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITYEYSVNIHFLGKFNISIFR  386

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  387   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIG  446

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+++ + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   LKVMCWVCLIVSLLAAAGSIAGLISSVKTYKPF  479



>gb|KEH43993.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 352/459 (77%), Gaps = 6/459 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             +D KYD+DGR KRTGT  T+SAHI+TA+IGSGVLSLAWA+AQLG + G I ++ FS++TL
Sbjct  11    EDGKYDDDGRMKRTGTWFTSSAHIVTAVIGSGVLSLAWAVAQLGWIGGTIVLILFSLVTL  70

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             +T+ L+ADCYR PD   G RN +YM  V+  LGG+Q KFCG+AQY  LVG +IGY IT +
Sbjct  71    FTSILMADCYRYPDPIHGTRNPTYMKMVQNILGGIQYKFCGLAQYTNLVGCTIGYTITGS  130

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI ++NC+HK G   + C  S    + IFG VE+LLS IP+FH L +LSI+AA+MS
Sbjct  131   ISMVAIKKSNCFHKEGHLAD-CKISNYKFMAIFGIVEILLSLIPDFHELSWLSILAAVMS  189

Query  667   FGYSSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLI  843
             FGY+SIGI LS  K+A  G  V TSVTG+ VGV+ ++ +KM++TF A+GNIA A+ FS +
Sbjct  190   FGYASIGIGLSIAKVAEKGHHVTTSVTGIAVGVDVTSTEKMWNTFQAIGNIAFAYAFSNV  249

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             +++IQDTLKSSP E + MK+++  GI   TFFY LCG++GY AFGN APGN LT   GFY
Sbjct  250   IVEIQDTLKSSPPENQVMKKSNLTGITITTFFYALCGLVGYAAFGNKAPGNFLTG-FGFY  308

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
             EPFWLVD+ N+ I++HLVGAYQV  QPVF+ VE W   RW     +T E+ ++ P +G +
Sbjct  309   EPFWLVDIGNLFIVIHLVGAYQVFGQPVFSLVESWGNKRWPQSKLVTQEYYVKIPLVGTW  368

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              +++FR++WRT +V+FTTV+AMIFPFFN+++GLLG+I+F+PLT+YFP+EMY++QAK+P+ 
Sbjct  369   RMNMFRVIWRTLYVIFTTVIAMIFPFFNSVVGLLGAISFFPLTVYFPIEMYLTQAKVPKY  428

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             S  WI +++LS+FC +V+++AAVGSI  +   +  +KPF
Sbjct  429   SSIWIGMKLLSWFCLIVTLVAAVGSIEGIVTDLKTYKPF  467



>ref|NP_172472.1| amino acid permease 8 [Arabidopsis thaliana]
 sp|O80592.1|AAP8_ARATH RecName: Full=Amino acid permease 8; AltName: Full=Amino acid 
transporter AAP8 [Arabidopsis thaliana]
 gb|AAC34329.1| putative amino acid permease [Arabidopsis thaliana]
 gb|AEE28528.1| amino acid permease 8 [Arabidopsis thaliana]
Length=475

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 338/465 (73%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE G       D+DGR KRTGT  TASAHIITA+IGSGVLSLAWAIAQLG VAG   +V
Sbjct  9     AVESGDAAVKSVDDDGREKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGTTVLV  68

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AF++IT YT+ LLADCYRSPD   G RNY+YM  VR+YLGG +V+ CGVAQY  LVG +I
Sbjct  69    AFAIITYYTSTLLADCYRSPDSITGTRNYNYMGVVRSYLGGKKVQLCGVAQYVNLVGVTI  128

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI ++NCYH  G   + C  S    +  FG V+++LSQ+PNFH+L FLS
Sbjct  129   GYTITASISLVAIGKSNCYHDKGHKAK-CSVSNYPYMAAFGIVQIILSQLPNFHKLSFLS  187

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF Y+SIGI L+   +A G   +T +TG  +GV+ +  +K++  F A+G+IA +
Sbjct  188   IIAAVMSFSYASIGIGLAIATVASGKIGKTELTGTVIGVDVTASEKVWKLFQAIGDIAFS  247

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + F+ ILI+IQDTL+SSP E + MK+AS +G+ + T FY+LCG +GY AFGN APG+ LT
Sbjct  248   YAFTTILIEIQDTLRSSPPENKVMKRASLVGVSTTTVFYILCGCIGYAAFGNQAPGDFLT  307

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
             D  GFYEP+WL+D AN CI +HL+GAYQV  QP F FVE     +W    FI  E++ + 
Sbjct  308   D-FGFYEPYWLIDFANACIALHLIGAYQVYAQPFFQFVEENCNKKWPQSNFINKEYSSKV  366

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P LG   V+LFRLVWRT +VV TT VAMIFPFFNAILGLLG+ AFWPLT+YFPV M+I+Q
Sbjct  367   PLLGKCRVNLFRLVWRTCYVVLTTFVAMIFPFFNAILGLLGAFAFWPLTVYFPVAMHIAQ  426

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             AK+ + S  W+ L +L   C +VS LAAVGSI  L  SV  +KPF
Sbjct  427   AKVKKYSRRWLALNLLVLVCLIVSALAAVGSIIGLINSVKSYKPF  471



>ref|XP_010104540.1| hypothetical protein L484_025514 [Morus notabilis]
 gb|EXC01141.1| hypothetical protein L484_025514 [Morus notabilis]
Length=484

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/483 (56%), Positives = 355/483 (73%), Gaps = 7/483 (1%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
               Y++   F E  ++   AV E G      DEDGR+KRTGT +TASAHIITA+IGSGVLS
Sbjct  3     KEYQKNSMFIE--QNPQSAVLENGDFRKNVDEDGRAKRTGTWVTASAHIITAVIGSGVLS  60

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWA AQLG  AGP  ++AFS IT +T+ LLADCYR+PD   GKRNY+YMDAV+AYLGG 
Sbjct  61    LAWANAQLGWAAGPAVLMAFSFITYFTSTLLADCYRAPDPVTGKRNYTYMDAVKAYLGGR  120

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             +V+ CG+AQY  LVG ++GY ITA++S+ A+ R+NC+HK+G   + C  S    ++IFG 
Sbjct  121   KVQLCGLAQYGNLVGITVGYTITASISMVAVKRSNCFHKNGHSAK-CSISNYPFMIIFGC  179

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHS  771
             ++++LSQIPNFH L +LSI+AA+MSF YSSIG+ LS  K+ GG    T++TGV VGV+ +
Sbjct  180   IQIVLSQIPNFHDLSWLSILAAVMSFAYSSIGVGLSIAKVIGGTHARTTLTGVTVGVDVT  239

Query  772   TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLC  951
               +K++ TF A+G+IA A+ FS +LI+IQDTL++SP E ++MK+A+  GI + T FY+LC
Sbjct  240   GSEKVWRTFQAIGDIAFAYAFSTVLIEIQDTLRASPPENKSMKKATFTGIATTTTFYVLC  299

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G +GY AFGN APGN LT   GFYEPFWL+D ANVCI +HL+GAYQV  QP++  VE + 
Sbjct  300   GCVGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLIGAYQVFSQPIYGVVERYC  358

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
               R     FIT E+ +  PF G + VS F++VWRT +V+ TTV+AMIFPFFN  LGLLG+
Sbjct  359   SNRLSENKFITSEYAVNIPFHGAYYVSPFKVVWRTAYVILTTVIAMIFPFFNDFLGLLGA  418

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
              +FWPLT+YFP+EM+I+Q K P+ SF W  L+ LS+ C VVS++AA GS+  LA  V  +
Sbjct  419   ASFWPLTVYFPIEMHIAQTKTPKYSFRWTMLKTLSWACLVVSIVAAAGSVQGLATDVKTY  478

Query  1492  KPF  1500
             KPF
Sbjct  479   KPF  481



>ref|XP_010268968.1| PREDICTED: amino acid permease 6-like isoform X1 [Nelumbo nucifera]
Length=466

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/465 (56%), Positives = 347/465 (75%), Gaps = 4/465 (1%)
 Frame = +1

Query  112   LAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAM  291
             +A+   G D    D+DGR +RTGT++TASAH+IT +IGSGVLSLAW IAQLG  AGP A+
Sbjct  1     MAMMGMGIDTKNLDDDGRERRTGTMMTASAHVITTVIGSGVLSLAWVIAQLGWAAGPAAL  60

Query  292   VAFSVITLYTAFLLADCYRSP-DGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             V FSVIT +T+ LLADCYRSP  G RNY+YMD VRA LGGV++K CG+AQY   +GA+IG
Sbjct  61    VLFSVITWFTSTLLADCYRSPVTGNRNYTYMDVVRANLGGVKIKLCGIAQYGCFIGATIG  120

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             + ITA++S+ A+ R+NC+H +G   + C  S    ++IF  ++++LSQIPN H+L +LSI
Sbjct  121   FTITASLSMAAVKRSNCFHMNGHHAQ-CKVSNVPFMIIFACIQIVLSQIPNIHKLSWLSI  179

Query  649   VAALMSFGYSSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             VAALMSF YS IGI LSA K+A G  +V TS  GV VGV+ +  +K++  F A+G+IA A
Sbjct  180   VAALMSFSYSLIGIGLSAAKVAEGSHEVRTSWRGVEVGVDVTETEKVWRIFQAIGDIAFA  239

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + F+ +L+++QDTLKSSP E + MK+ S IG+ +   FY+LCG +GY AFGN APGN LT
Sbjct  240   YTFAPVLVEVQDTLKSSPPENKVMKRVSFIGVSTTAMFYVLCGCIGYAAFGNDAPGNFLT  299

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWL+D ANVCI +HL+G YQ++ Q +FAFVE + R  W    FI  E  +  
Sbjct  300   G-FGFYEPFWLIDFANVCIALHLIGVYQLLSQILFAFVENFCRNHWPENKFIAKERAVNV  358

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P  G + ++LFRLVWR+ +V+ TTVVAMIFPFFN  LGL+G+ ++WPL++YFP+E+YISQ
Sbjct  359   PLHGKYYINLFRLVWRSVYVIATTVVAMIFPFFNDFLGLIGAFSYWPLSVYFPIEIYISQ  418

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +KIP+ SFTW WL+ILS+ C VVS++AAVGS+  LA  V  +KPF
Sbjct  419   SKIPKFSFTWTWLKILSYACLVVSIVAAVGSVQGLAADVKTYKPF  463



>ref|XP_006306441.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
 gb|EOA39339.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
Length=475

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/465 (57%), Positives = 340/465 (73%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE G       D+DGR KRTGT LTASAHIITA+IGSGVLSLAWA+AQLG VAG I +V
Sbjct  9     AVEMGDTAVKNVDDDGRQKRTGTFLTASAHIITAVIGSGVLSLAWALAQLGWVAGTIVLV  68

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             +F+VIT YT+  L+DCYR PD   G RNYSYM  VRAYLGG +V+ CG+AQY  LVG +I
Sbjct  69    SFAVITYYTSTFLSDCYRGPDSITGTRNYSYMGVVRAYLGGRKVQLCGLAQYVNLVGVTI  128

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI R+NCYH+ G   + C  S    +  FG V+++LSQIPNFH + FLS
Sbjct  129   GYTITASISLVAIGRSNCYHEKGHKAK-CSVSNYPYMASFGVVQIILSQIPNFHEISFLS  187

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF Y+SIGI L+   +A G   +T VTG  +GV+ +  +K++ +F A+G++A +
Sbjct  188   IIAAVMSFSYASIGIGLAISSVASGNVGKTEVTGTVIGVDVTATEKVWKSFQAIGDMAFS  247

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + F+ ILI+IQDTL+SSP E + MK+A+  G+ + T FY+LCG LGY AFGN APG+ LT
Sbjct  248   YAFTTILIEIQDTLRSSPPENKVMKRATLAGVSTTTVFYILCGCLGYAAFGNHAPGDFLT  307

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
             D  GFYEP+WLVD AN CI +HL+GAYQV  QP F FVE     +W    FI  E++ + 
Sbjct  308   D-FGFYEPYWLVDFANACIALHLIGAYQVYAQPFFQFVESNCNKKWPQNNFINREYSTKV  366

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P LG F V+LFRLVWRT +VV TTVVAM FPFFNAILGLLG+++FWPLT+YFPV M+++Q
Sbjct  367   PLLGKFRVNLFRLVWRTCYVVMTTVVAMTFPFFNAILGLLGALSFWPLTVYFPVSMHMAQ  426

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + S  W+ L +L + C +VS LAA GSI  L KSV  +KPF
Sbjct  427   KKVQKYSRRWLALNLLLWVCLIVSCLAATGSIIGLIKSVKSYKPF  471



>emb|CDY04448.1| BnaA03g59400D [Brassica napus]
Length=540

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/453 (58%), Positives = 341/453 (75%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IG GVLSL+WAIAQLG +AG + +V FS IT  T+ +
Sbjct  29    DDDGREKRTGTCLTASAHIITAVIGYGVLSLSWAIAQLGWIAGLLILVIFSFITYLTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VRAYLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRAYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NC+H  G   + C  S    +  FG ++++LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  149   IGKANCFHDKGHHAD-CTLSSYPYMAAFGIIQIILSQIPNFHKLSFLSIMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  208   IGIGLAMATVAGGKVRKTNMTGTVVGVDVTATQKIWRSFQAVGDIAFAYAYATVLIEIQD  267

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TLKSSP E ++MK+AS +G+ + TFFY+LCG  GY AFGN APG+ LTD  GFYEPFWL+
Sbjct  268   TLKSSPAENKSMKRASLVGVSTTTFFYILCGCFGYAAFGNKAPGDFLTD-FGFYEPFWLI  326

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++   FLG F++S+FR
Sbjct  327   DFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITYEYSVNIHFLGKFNISIFR  386

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  387   LVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIG  446

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+++ + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   LKVMCWVCLIVSLLAAAGSIAGLISSVKTYKPF  479



>gb|KDO81356.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=483

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 361/480 (75%), Gaps = 8/480 (2%)
 Frame = +1

Query  91    EMQK-SLSLAVEEGGGDDLK--YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQ  261
             EMQK S+ +   +  GD  K   D+DGR+KRTGT +TASAHIITA+IGSGVLSLAWAIAQ
Sbjct  4     EMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQ  63

Query  262   LGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGV  432
             LG VAGP  ++AFS IT YT+ LL+DCYRSPD   GKRNY+YMD VRA LGG  V+ CG+
Sbjct  64    LGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQLCGL  123

Query  433   AQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQ  612
             AQY  L+G +IGY ITA++S+ A+ R+NC+H+HG   + C  S    ++IF  ++++LSQ
Sbjct  124   AQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVK-CYTSNNPLMIIFACIQIVLSQ  182

Query  613   IPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFS  792
             IPNFH+L +LSI+AA+MSF YSSIGI LS  K+ G     T++TG  VGV+ S  +K++ 
Sbjct  183   IPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHATTLTGTTVGVDVSASEKVWR  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
              F A+G++A A+ FS +L++IQDTLKSSP E ++MK+A+++G+ + T FY++CG++GYLA
Sbjct  243   AFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMGYLA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWLVD AN CI VHL+GAYQV  QP+F FVE W   RW   
Sbjct  303   FGNDAPGNFLTG-FGFYEPFWLVDFANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPEN  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT EH I  P  G + V+ FRLVWRT +V+ + V+AMIFPFFN  +GL+G+ +FWPLT
Sbjct  362   KFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA*IE  1512
             +YFPVEMYI++ KI R SFTW+WL+IL + CF+VS++A VGS+  L +S+  +KPF  ++
Sbjct  422   VYFPVEMYIARTKIRRFSFTWVWLKILIWSCFIVSLVALVGSVQGLIQSLKTYKPFQAVQ  481



>ref|XP_009148319.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=466

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/461 (57%), Positives = 336/461 (73%), Gaps = 3/461 (1%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G      +D+DGR KRTGT++TASAHIITA++GSGVLSLAWAIAQLG VAG + +V 
Sbjct  7     VESGDATGNNFDDDGREKRTGTLMTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  298   FSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYII  477
             F+VI  YT+ +LADCYRS  G RN +YMD VRAYLGG +V+ CG+AQY   +G +IGY I
Sbjct  67    FAVINYYTSTMLADCYRSDTGTRNCTYMDVVRAYLGGRKVQLCGLAQYGCFIGVTIGYTI  126

Query  478   TAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAA  657
             TA++SL AI + NC+H  G G E C       + +FG VE++LSQIP+FH+L FLSI+A 
Sbjct  127   TASISLVAIGKANCFHDKGHG-EKCSMPNYPFMAVFGIVEIILSQIPSFHKLSFLSIIAT  185

Query  658   LMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFS  837
             +MSF Y+SIGI L+   +A G   +T  TG  VGV  +  DK++ +F A G+IA ++ +S
Sbjct  186   VMSFSYASIGIGLAMAVVASGKVGKTGATGTVVGVEVTASDKIWKSFQATGDIAFSYAYS  245

Query  838   LILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHG  1017
              IL++IQDTL+SSP E + MK+AS  G+ + TFFY+LCG +GY AFGN APG+ LTD   
Sbjct  246   SILVEIQDTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTDF--  303

Query  1018  FYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG  1197
             FYEP+WL+D AN CI++HL+ AYQV  QP+F FVE      W    FIT EH++   FLG
Sbjct  304   FYEPYWLIDFANACIVLHLIAAYQVFAQPIFQFVENKCNKAWPESNFITKEHSMNILFLG  363

Query  1198  NFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIP  1377
                +S FRLVWRT +V+FTTVVAMIFPFFNAILGL+G+ AFWPLT+YFPVEM+ISQ KI 
Sbjct  364   KCRISFFRLVWRTAYVIFTTVVAMIFPFFNAILGLIGAAAFWPLTVYFPVEMHISQRKIK  423

Query  1378  RLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + S  WI L++L   C +V++LAA+GSI  L KSV  +K F
Sbjct  424   KHSMRWIGLKLLVLVCMIVTLLAAIGSIVGLIKSVKAYKHF  464



>ref|XP_010268971.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=469

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 343/460 (75%), Gaps = 5/460 (1%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             G  +   D+DGR KRTGT++TASAH+IT +IGSGVLSLAW IAQLG VAGP A+V FSVI
Sbjct  9     GACEKNLDDDGRVKRTGTLMTASAHLITTVIGSGVLSLAWIIAQLGWVAGPAALVLFSVI  68

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
               +T+ LLADCYRSPD   G RNY+YMD VRA LGG++V+ CG+AQY +  GA+IG+ IT
Sbjct  69    ACFTSSLLADCYRSPDPVTGNRNYTYMDVVRANLGGIKVQLCGIAQYGSFAGATIGFTIT  128

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A++S+ A+ R+NC+H +G     C  S     +IF  ++++LSQIPN H+L +LSIVAAL
Sbjct  129   ASLSMAAVKRSNCFHMNGHHAN-CKVSNYPYTIIFACIQIVLSQIPNIHKLSWLSIVAAL  187

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSF YS IGI L+A KIAG  +V  S  GV VGV+ +  +K++  F A+G+IA ++ F+ 
Sbjct  188   MSFSYSLIGIGLAAAKIAGCHEVRNSWRGVEVGVDVTETEKVWRIFQAIGDIAFSYSFAP  247

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             +L++IQDTLKSSP E + MK+AS IG+ +   FY+LCG +GY AFGN APGN LT   GF
Sbjct  248   VLVEIQDTLKSSPPENKVMKRASFIGVSTTAMFYILCGCIGYAAFGNDAPGNFLTG-LGF  306

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN  1200
             YEPFWL+D ANVCI +HL+G YQ++ Q +FA+VE + R  W    FIT EH +  P  G 
Sbjct  307   YEPFWLIDFANVCIAIHLIGVYQLLSQILFAYVENFCRNHWPDNGFITKEHPVNIPLHGT  366

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             + ++ FRLVWRT +V+ T +VAMIFPFFN  LGL+G+ ++WPL++YFP+E+YI+Q++IPR
Sbjct  367   YHINFFRLVWRTVYVIATAIVAMIFPFFNDFLGLIGAFSYWPLSVYFPIEIYIAQSRIPR  426

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              SFTW WL++LSF C VVS++AAVGS+  LA  +  +KPF
Sbjct  427   FSFTWTWLKMLSFACLVVSIVAAVGSVQGLAADLKTYKPF  466



>ref|XP_006433701.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
 gb|ESR46941.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
Length=483

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 361/480 (75%), Gaps = 8/480 (2%)
 Frame = +1

Query  91    EMQK-SLSLAVEEGGGDDLK--YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQ  261
             EMQK S+ +   +  GD  K   D+DGR+KRTGT +TASAHIITA+IGSGVLSLAWAIAQ
Sbjct  4     EMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQ  63

Query  262   LGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGV  432
             LG VAGP  ++AFS IT YT+ LL+DCYRSPD   GKRNY+YMD VRA LGG  V+ CG+
Sbjct  64    LGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQLCGL  123

Query  433   AQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQ  612
             AQY  L+G +IGY ITA++S+ A+ R+NC+H+HG   + C  S    ++IF  ++++LSQ
Sbjct  124   AQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVK-CYTSNNPLMIIFACIQIVLSQ  182

Query  613   IPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFS  792
             IPNFH+L +LSI+AA+MSF YSSIGI LS  K+ G     T++TG  VGV+ S  +K++ 
Sbjct  183   IPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHATTLTGTTVGVDVSASEKVWR  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
              F A+G++A A+ FS +L++IQDTLKSSP E ++MK+A+++G+ + T FY++CG++GYLA
Sbjct  243   AFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMGYLA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWL+D AN CI VHL+GAYQV  QP+F FVE W   RW   
Sbjct  303   FGNDAPGNFLTG-FGFYEPFWLIDFANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPEN  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT EH I  P  G + V+ FRLVWRT +V+ + V+AMIFPFFN  +GL+G+ +FWPLT
Sbjct  362   KFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA*IE  1512
             +YFPVEMYI++ KI R SFTW+WL+IL + CF+VS++A VGS+  L +S+  +KPF  ++
Sbjct  422   VYFPVEMYIARTKIRRFSFTWVWLKILIWSCFIVSLVALVGSVQGLIQSLKTYKPFQAVQ  481



>ref|XP_006472367.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=483

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 361/480 (75%), Gaps = 8/480 (2%)
 Frame = +1

Query  91    EMQK-SLSLAVEEGGGDDLK--YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQ  261
             EMQK S+ +   +  GD  K   D+DGR+KRTGT +TASAHIITA+IGSGVLSLAWAIAQ
Sbjct  4     EMQKNSMYIEQNDPEGDIRKDFLDDDGRAKRTGTWVTASAHIITAVIGSGVLSLAWAIAQ  63

Query  262   LGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGV  432
             LG VAGP  ++AFS IT YT+ LL+DCYRSPD   GKRNY+YMD VRA LGG  V+ CG+
Sbjct  64    LGWVAGPAVLMAFSFITYYTSTLLSDCYRSPDPVTGKRNYTYMDVVRASLGGRSVQLCGL  123

Query  433   AQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQ  612
             AQY  L+G +IGY ITA++S+ A+ R+NC+H+HG   + C  S    ++IF  ++++LSQ
Sbjct  124   AQYGNLIGVTIGYTITASISMVAVKRSNCFHRHGHHVK-CYTSNNPLMIIFACIQIVLSQ  182

Query  613   IPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFS  792
             IPNFH+L +LSI+AA+MSF YSSIGI LS  K+ G     T++TG  VGV+ S  +K++ 
Sbjct  183   IPNFHKLSWLSILAAVMSFAYSSIGIGLSIAKVIGDGPHATTLTGTTVGVDVSASEKVWR  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
              F A+G++A A+ FS +L++IQDTLKSSP E ++MK+A+++G+ + T FY++CG++GYLA
Sbjct  243   AFQAIGDVAFAYAFSTVLVEIQDTLKSSPPENKSMKRATAVGVTTTTLFYIMCGVMGYLA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWLVD AN CI VHL+GAYQV  QP+F FVE W   RW   
Sbjct  303   FGNDAPGNFLTG-FGFYEPFWLVDFANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPEN  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT EH I  P  G + V+ FRLVWRT +V+ + V+AMIFPFFN  +GL+G+ +FWPLT
Sbjct  362   KFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA*IE  1512
             +YFPVEMYI++ KI R SFTW+WL+IL + CF+VS++A VGS+  L +S+  ++PF  ++
Sbjct  422   VYFPVEMYIARTKIRRFSFTWVWLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQAVQ  481



>emb|CDY44564.1| BnaA01g21750D [Brassica napus]
Length=507

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/476 (56%), Positives = 347/476 (73%), Gaps = 28/476 (6%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + +V FS IT +T+ +
Sbjct  29    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NC+HK G   + C  S    + +FG ++++LSQIPNFH+L FLS++AA+MSF Y++
Sbjct  149   VGKANCFHKKGHEAD-CTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ-  858
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQ 
Sbjct  208   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQA  267

Query  859   ----------------------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
                                   DTLKSSP E ++MK+AS +G+ + TFFY+LCG LGY A
Sbjct  268   SFHIKYLWNLVSFEYEPLDRIVDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCLGYAA  327

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APG+ LTD  GFYEPFWL+D AN CI  HL+GAYQV  QP+F FVE      W   
Sbjct  328   FGNKAPGDFLTD-FGFYEPFWLIDFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDN  386

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT E+++  PFLG F++SLFRLVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT
Sbjct  387   KFITSEYSVNVPFLGKFNISLFRLVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLT  446

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +YFPVEM+I+Q K+ + S  WI L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   VYFPVEMHIAQTKVKKYSPRWIGLKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  502



>ref|XP_010490519.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490528.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490536.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=476

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/465 (57%), Positives = 339/465 (73%), Gaps = 5/465 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE G       DEDGR KRTGT  TASAHIITA+IGSGVLSLAWA+AQL  VAG I +V
Sbjct  10    AVELGDTPVKGVDEDGREKRTGTFFTASAHIITAVIGSGVLSLAWALAQLSWVAGTIILV  69

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
              F+VIT YT+  LADCYRSPD   G RNYSYMD VRAYLGG +V+ CG+AQY  LVG +I
Sbjct  70    TFAVITYYTSTFLADCYRSPDPITGTRNYSYMDVVRAYLGGKKVQLCGLAQYVNLVGVTI  129

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI ++NCYH  G+  + C  S    +  FG V+++LSQIPNFH L FLS
Sbjct  130   GYTITASISLVAIGKSNCYHDKGKSAK-CSVSNYPFMAAFGVVQIILSQIPNFHELSFLS  188

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
              +AA+MSF Y+SIGI L+  K+A G   +T +TG  +GV+ ++ +K++  F A+G+IA +
Sbjct  189   FIAAVMSFSYASIGIGLAIAKVASGKVGKTELTGTVIGVDVTSSEKVWRMFQAIGDIAFS  248

Query  826   FGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
             + F+ ILI+IQDTL+SSP E + MK+AS  G+ + T FY+LCG +GY AFGNAAPG+ LT
Sbjct  249   YAFTTILIEIQDTLRSSPPENKVMKRASLAGVSTTTVFYILCGCIGYAAFGNAAPGDFLT  308

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
             +  GFY+P+WL+D AN CI +HL+GAYQV  QP F FVE   + +W    FI  E++   
Sbjct  309   E-FGFYDPYWLIDFANACIALHLIGAYQVYGQPFFQFVESNCKKKWPQSNFINKEYSSNI  367

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             P  G   V+LFRLVWRT +VV TTVVAMIFPFFNAILGLLG+++FWPLT+YFPV M+I+Q
Sbjct  368   PLFGKCRVNLFRLVWRTCYVVMTTVVAMIFPFFNAILGLLGALSFWPLTVYFPVSMHIAQ  427

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + S  W+ L +L   C +VS LAAVGSI  L +SV  +KPF
Sbjct  428   TKVKKYSPRWLALNLLVVVCLIVSCLAAVGSIIGLIRSVKAYKPF  472



>emb|CDY53793.1| BnaCnng25620D [Brassica napus]
Length=479

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 339/453 (75%), Gaps = 11/453 (2%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + ++ FS IT +T+ +
Sbjct  30    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NCYH  G   + C  S    +  FG +++LLSQIPNFH+L FLS++AA+MSF Y+S
Sbjct  150   IGKANCYHNKGHHAD-CTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAYAS  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++       D
Sbjct  209   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYA------TD  262

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG LGY AFGN APG+ LTD  GFYEPFWL+
Sbjct  263   TLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTD-FGFYEPFWLI  321

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++  PFLG FS++LFR
Sbjct  322   DFANACIAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFSINLFR  381

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TT+VAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  382   LVWRTAYVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSSRWIG  441

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  442   LKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  474



>ref|XP_002313926.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
 gb|EEE87881.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
Length=473

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/458 (56%), Positives = 341/458 (74%), Gaps = 5/458 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D +K D+DGR KR G +++ASAHIITA+IGSGVLSLAWA+AQLG +AGPI+++ FS IT 
Sbjct  14    DIVKTDDDGRLKRDGNLMSASAHIITAVIGSGVLSLAWAMAQLGWIAGPISLLIFSFITW  73

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             + + LLADCYR P    G R Y+YM AV+A+LGG++   CG++QY  LVG SIGY ITA+
Sbjct  74    FNSCLLADCYRFPGPLGGTRTYTYMGAVKAHLGGIKYTLCGISQYTNLVGTSIGYTITAS  133

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI R+NC+H+ G   E C  S    ++IFG V+V++SQ+PNFH L  LS +AA+MS
Sbjct  134   ISMAAIKRSNCFHREGHDAE-CHASTNMFMIIFGIVQVMMSQLPNFHELVGLSTLAAIMS  192

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             F YS IGI LS   IAGG DV+TS+TG  VGV+ ++ +K ++ F A+GNIA A+ +S IL
Sbjct  193   FAYSLIGIGLSIAAIAGGNDVKTSLTGTVVGVDVTSTEKAWNCFQAIGNIAFAYTYSSIL  252

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             ++IQDTLKSSP E + MK+AS +G+ + T FY+LCG LGY AFGN APGN LT   GFYE
Sbjct  253   VEIQDTLKSSPPENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTG-FGFYE  311

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             P+WLVD AN+CI++HLVGAYQV  QP+F  VE   R +W    FIT EH +  PF G F 
Sbjct  312   PYWLVDFANLCIVIHLVGAYQVYGQPIFKLVEDSCRKKWPESGFITNEHPVDIPFCGVFH  371

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             V+ FRL+WRT +V+ ++V+AM FPFFN++LG +G+I+FWPLT+YFPV+MYISQA+I R +
Sbjct  372   VNSFRLLWRTAYVIASSVIAMTFPFFNSVLGFIGAISFWPLTLYFPVQMYISQARIRRFT  431

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FTW WL IL+  C +VS+ AA   +  L   + +F+PF
Sbjct  432   FTWTWLTILTVACLIVSLAAAAACVQGLIMQLRNFEPF  469



>emb|CDY48843.1| BnaA09g14700D [Brassica napus]
Length=479

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/453 (58%), Positives = 339/453 (75%), Gaps = 11/453 (2%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + ++ FS IT +T+ +
Sbjct  30    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NCYH  G   + C  S    +  FG +++LLSQIPNFH+L FLS++AA+MSF Y+S
Sbjct  150   IGKANCYHNKGHHAD-CTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAYAS  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++       D
Sbjct  209   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYA------TD  262

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG LGY AFGN APG+ LTD  GFYEPFWL+
Sbjct  263   TLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTD-FGFYEPFWLI  321

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      W    FIT E+++  PFLG F+++LFR
Sbjct  322   DFANACIAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFNINLFR  381

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TT+VAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q K+ + S  WI 
Sbjct  382   LVWRTAYVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIG  441

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  442   LKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  474



>ref|XP_010490547.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
 ref|XP_010490556.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
Length=467

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/467 (57%), Positives = 349/467 (75%), Gaps = 7/467 (1%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G     ++D+DGR KRTGT+LTASAHIITA++GSGVLSL+WAIAQLG +AG + +V 
Sbjct  2     VESGDVSGDRFDDDGREKRTGTLLTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  298   FSVITLYTAFLLADCYRSPD-----GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGAS  462
             F++I  YT+ +LADCYRSPD     G RNY+YM  VRAYLGG +V+ CG+AQYA+LVG +
Sbjct  62    FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGIT  121

Query  463   IGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFL  642
             +GY ITA++SL AI + NCYH  G G + C  S   S+  FG V++LLSQIPNFH+L FL
Sbjct  122   VGYTITASISLVAIGKANCYHNKGHGAK-CSSSNYPSMAAFGVVQILLSQIPNFHQLSFL  180

Query  643   SIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIAL  822
             SI+A +MSF Y+SIGI LS  K+  G   +T++TG  VGV+ +  DK++ +F A+G+IA 
Sbjct  181   SIIATVMSFCYASIGIGLSIAKVTSGKVGKTALTGTLVGVDVTASDKLWRSFQAVGDIAF  240

Query  823   AFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             ++ +S++L++IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+LL
Sbjct  241   SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T+  GFYEP+WLVD AN CI++HLV AYQV  QP+F FVE     +W    FI  EH++ 
Sbjct  301   TE-FGFYEPYWLVDFANACIVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFIISEHSMS  359

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
              P +G   ++LFRL+WRT +VV TTVVAMIFPFFNAILGL+GS AFWPLT+YFPV M+I+
Sbjct  360   IPLIGKCRINLFRLLWRTAYVVLTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIA  419

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             Q K+ + S  WI L++L   C +VS+LAA+GSI  L  SV  +KPF+
Sbjct  420   QTKVTKYSLRWIGLELLVLLCLIVSLLAALGSIVGLISSVKAYKPFS  466



>ref|XP_006417505.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
 gb|ESQ35858.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
Length=469

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/468 (57%), Positives = 348/468 (74%), Gaps = 5/468 (1%)
 Frame = +1

Query  100   KSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             KSL        G+++  D+DG+ KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG VAG
Sbjct  2     KSLDTEHNPSAGNNV--DDDGKEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAG  59

Query  280   PIAMVAFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              + +V F++I  YT+ +LADCYRSPD G RNY+YMD VRAYLGG +V+ CG+AQY +LVG
Sbjct  60    TVILVTFAIINYYTSTMLADCYRSPDAGTRNYTYMDVVRAYLGGRKVQLCGLAQYGSLVG  119

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              +IG+ ITA++SL AI + NC+H  G G + C  S    +  FG ++++LSQIPNFH+L 
Sbjct  120   VTIGFTITASISLVAIGKANCFHDKGHGAK-CSVSNYPYMATFGIIQIILSQIPNFHKLS  178

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             FLSI AA+MSF Y+SIGI LS   +A G   +T++TG  VGV+ +  DK++ +F A G+I
Sbjct  179   FLSIFAAIMSFSYASIGIGLSIATVASGKVGKTTLTGTVVGVDVNASDKIWKSFQATGDI  238

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A ++ +S++L++IQDTL+SSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+
Sbjct  239   ASSYAYSIVLVEIQDTLRSSPPENKVMKKASLAGVSTTTVFYILCGCIGYAAFGNNAPGD  298

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
              LTD  GFYEP+WL+D AN CI +HL+ AYQV  QP+F FVE     +W    FIT EH 
Sbjct  299   FLTD-FGFYEPYWLIDFANACIALHLIAAYQVFAQPIFQFVESKCNKKWPESNFITNEHL  357

Query  1177  IRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMY  1356
             +  P LG + ++LFRLVWRTG+V+ TTVVAMIFPFFNAILGL+G+++FWPLT+YFPVEM+
Sbjct  358   MNLPLLGKYRINLFRLVWRTGYVILTTVVAMIFPFFNAILGLIGAVSFWPLTVYFPVEMH  417

Query  1357  ISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             ISQ  + + S  WI LQ+L   C +VS+LAA GSI  L  SV  +KPF
Sbjct  418   ISQKNVKQYSLRWIGLQLLVLLCLIVSLLAATGSIVGLITSVKAYKPF  465



>emb|CDY60248.1| BnaC01g42990D [Brassica napus]
Length=507

 Score =   531 bits (1369),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 346/476 (73%), Gaps = 28/476 (6%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + +V FS IT +T+ +
Sbjct  29    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILVIFSFITYFTSTM  88

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  89    LADCYRAPDPVTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  148

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NC+HK G   + C  S    + +FG ++++LSQIPNFH+L FLS++AA+MSF Y++
Sbjct  149   VGKANCFHKKGHEAD-CTISNYPYMAVFGIIQIILSQIPNFHKLSFLSLMAAVMSFTYAT  207

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ-  858
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQ 
Sbjct  208   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQA  267

Query  859   ----------------------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
                                   DTLKSSP E ++MK+AS +G+ + TFFY+LCG LGY A
Sbjct  268   SFHIKYLWNLVSFEYEPLDRIVDTLKSSPAENKSMKRASLVGVSTTTFFYILCGCLGYAA  327

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APG+ LTD  GFYEPFWL+D AN CI  HL+GAYQV  QP+F FVE      W   
Sbjct  328   FGNKAPGDFLTD-FGFYEPFWLIDFANACIAFHLIGAYQVFAQPIFQFVEKRCNRNWPDN  386

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT E+++   FLG F++SLFRLVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT
Sbjct  387   KFITSEYSVNVLFLGKFNISLFRLVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLT  446

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +YFPVEM+I+Q K+ + S  WI L++L + C +VS+LAA GSI  L  SV  +KPF
Sbjct  447   VYFPVEMHIAQTKVKKYSPRWIGLKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPF  502



>ref|XP_010458325.1| PREDICTED: amino acid permease 8 [Camelina sativa]
Length=476

 Score =   530 bits (1365),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 263/453 (58%), Positives = 332/453 (73%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT  TASAHIITA+IGSGVLSLAWA+AQLG VAG I +V F+VIT YT+  
Sbjct  22    DDDGREKRTGTFFTASAHIITAVIGSGVLSLAWALAQLGWVAGTIILVTFAVITYYTSTF  81

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYRSPD   G RNYSYMD VRAYLGG +V+ CG+AQY  LVG +IGY ITA++SL A
Sbjct  82    LADCYRSPDPITGTRNYSYMDVVRAYLGGKKVQLCGLAQYVNLVGVTIGYTITASISLVA  141

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I ++NC+H  G   + C  S    +  FG V+++LSQIPNFH L FLS +AA+MSF YSS
Sbjct  142   IGKSNCFHDKGHEAK-CSVSNYPYMAAFGVVQIILSQIPNFHELSFLSFIAAVMSFSYSS  200

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+  K+A G   +T +TG  +GV+ ++ +K++  F A+G+IA ++ F+ ILI+IQD
Sbjct  201   IGIGLAIAKVASGKVGKTELTGTVIGVDVTSSEKVWRMFQAIGDIAFSYAFTTILIEIQD  260

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E + MK+AS  G+ + TFFY+LCG  GY AFGN APG+ LT+  GFY+P+WL+
Sbjct  261   TLRSSPPENKVMKRASLAGVSTTTFFYILCGCFGYAAFGNKAPGDFLTE-FGFYDPYWLI  319

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI +HL+GAYQV  QP F FVE   +  W    FI  E++   P  G   V+LFR
Sbjct  320   DFANACIALHLIGAYQVYGQPFFQFVESNCKKNWPQSNFINKEYSSNIPLFGKCRVNLFR  379

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGLLG+++FWPLT+YFPV M+I+Q K+ + S  W+ 
Sbjct  380   LVWRTCYVVMTTVVAMIFPFFNAILGLLGALSFWPLTVYFPVSMHIAQTKVKKYSPRWLA  439

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L +L   C +VS LAAVGSI  L  SV  +KPF
Sbjct  440   LNLLVVVCLIVSCLAAVGSIIGLISSVKAYKPF  472



>ref|XP_011002369.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=473

 Score =   529 bits (1363),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 256/458 (56%), Positives = 340/458 (74%), Gaps = 5/458 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D +K D+DGR KR G +++ASAHIITA+IGSGVLSLAWA+AQLG +AGPI+++ FS+IT 
Sbjct  14    DIVKTDDDGRLKRDGNLMSASAHIITAVIGSGVLSLAWAMAQLGWIAGPISLLIFSLITW  73

Query  316   YTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             + + LLADCYR P   +G R Y+YM AV+A+LGG++   CG++QY  LVG SIGY ITA+
Sbjct  74    FNSCLLADCYRFPGPLEGTRTYTYMGAVKAHLGGIKYTLCGISQYTNLVGTSIGYTITAS  133

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI R+NC+H+ G   E C  S    ++IFG V+V++SQIPNFH L  LS +AA+MS
Sbjct  134   ISMAAIKRSNCFHREGHDAE-CHASTNMFMIIFGIVQVMMSQIPNFHELVGLSTLAAIMS  192

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             F YS +GI LS   IAGG DV+TS+TG  VGV+ ++ +K ++ F A+GNIA A+ +S IL
Sbjct  193   FAYSLVGIGLSIAAIAGGKDVKTSLTGTVVGVDVTSTEKAWNCFQAIGNIAFAYTYSSIL  252

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             ++IQDTLKSS  E + MK+AS +G+ + T FY+LCG LGY AFGN APGN LT   GFYE
Sbjct  253   VEIQDTLKSSSPENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTG-FGFYE  311

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             P+WLVD AN+CI++HLVGAYQV  QP+F  VE   R +W    FIT EH +   F G F 
Sbjct  312   PYWLVDFANLCIVIHLVGAYQVYCQPIFKLVEDSCRKKWPESGFITNEHPVDILFYGVFH  371

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             V+ FRL+WRT +V+ ++V+AM FPFFN++LG +G+I+FWPLT+YFPV+MYISQA+I R +
Sbjct  372   VNSFRLLWRTAYVIASSVMAMTFPFFNSVLGFIGAISFWPLTLYFPVQMYISQARIRRFT  431

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FTW WL IL+  C +VS+ AA   +  L   +  F+PF
Sbjct  432   FTWTWLTILTVSCLIVSLAAAAACVQGLIVELHSFQPF  469



>ref|XP_009113317.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=515

 Score =   530 bits (1366),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 264/483 (55%), Positives = 344/483 (71%), Gaps = 35/483 (7%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             D+DGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG + ++ FS IT +T+ +
Sbjct  30    DDDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTLILIIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YMD VR+YLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPLTGKRNYTYMDVVRSYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I + NCYH  G   + C  S    +  FG +++LLSQIPNFH+L FLS++AA+MSF Y+S
Sbjct  150   IGKANCYHNKGHHAD-CTISNYPYMAAFGIIQILLSQIPNFHKLSFLSLMAAVMSFAYAS  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +AGG   +T++TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAIATVAGGKVGKTNMTGTVVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG LGY AFGN APG+ LT D GFYEPFWL+
Sbjct  269   TLRSSPAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLT-DFGFYEPFWLI  327

Query  1042  DLANVCIIVHLVGAY------------------------------QVVVQPVFAFVECWS  1131
             D AN CI  HL+GAY                              QV   P+F FVE   
Sbjct  328   DFANACIAFHLIGAYQVKPNPKGEKDCFLFALSRSLAYEKETYFLQVFAHPIFQFVEKKG  387

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
                W    FIT E+++  PFLG F+++LFRLVWRT +VV TT+VAMIFPFFNAILGL+G+
Sbjct  388   NRNWPDNKFITSEYSVNIPFLGKFNINLFRLVWRTAYVVITTLVAMIFPFFNAILGLIGA  447

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
              +FWPLT+YFPVEM+I+Q K+ + S  WI L++L + C +VS+LAA GSI  L  SV  +
Sbjct  448   ASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCWVCLIVSLLAAAGSIAGLISSVKTY  507

Query  1492  KPF  1500
             KPF
Sbjct  508   KPF  510



>ref|XP_010269103.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/459 (55%), Positives = 341/459 (74%), Gaps = 6/459 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D+   D+DGR KRTGT++TASAHI T +IGSGVLSLAW +AQLG +AGP+ ++ F+VIT 
Sbjct  6     DNKDLDDDGRIKRTGTLMTASAHIFTTVIGSGVLSLAWVVAQLGWIAGPVVLILFAVITW  65

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             +T+ LLADCYRSPD   GKRNY+YMDAV+A LGG+ ++ CG+AQY + +GA+IGY ITA+
Sbjct  66    FTSVLLADCYRSPDPVTGKRNYTYMDAVKANLGGIMIQLCGLAQYGSFIGATIGYTITAS  125

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ A+  +NC+HK+G   + C  S    ++IF  ++++LSQIPNFH+L +LSI+AA+MS
Sbjct  126   ISMAAVQMSNCFHKNGHHAK-CDASHYPFMIIFACIQIILSQIPNFHKLSWLSIIAAIMS  184

Query  667   FGYSSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLI  843
             F YS IGI LS  K+A    +V TS+ GV VG++ +  +KM+  F A+G+ A A+ F+ +
Sbjct  185   FSYSLIGIGLSVAKVAEKNHNVRTSLRGVEVGLDVTATEKMWRVFQAIGDTAFAYTFAPV  244

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             L++IQDTLKS+P E   MK+AS IG+L  + FY+LCG +GY AFGN APGN LT   GFY
Sbjct  245   LVEIQDTLKSNPPENEVMKKASFIGVLITSMFYVLCGCIGYAAFGNDAPGNFLTG-FGFY  303

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
             EPFWL+D +N CI+VHLVGAYQV  Q  FAFVE W R +W    FI  E  +  P  G +
Sbjct  304   EPFWLIDFSNACIVVHLVGAYQVFCQIFFAFVEKWCRKQWPNNGFIGKERAVSVPLYGKY  363

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              ++ FRLVWRT +V+  TV+AMIFPFFN  +GL+G+ ++WPL ++FP+EMYI+Q++IP+ 
Sbjct  364   YINSFRLVWRTMYVILMTVIAMIFPFFNDFMGLIGAASYWPLCVFFPIEMYIAQSRIPKF  423

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             SF W  LQILS+ C  VS++AAVGS+  LA  V  +KPF
Sbjct  424   SFRWALLQILSWACLSVSIVAAVGSVQGLAADVKTYKPF  462



>ref|XP_010061591.1| PREDICTED: amino acid permease 6-like [Eucalyptus grandis]
 gb|KCW68572.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
 gb|KCW68573.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
Length=486

 Score =   529 bits (1363),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 269/483 (56%), Positives = 352/483 (73%), Gaps = 8/483 (2%)
 Frame = +1

Query  73    ERERFAEMQKSLSLAVE--EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLA  246
             ERE  A+    +    E    GG     D+DGR KRTGTV+TASAHIITA+IGSGVLSLA
Sbjct  2     ERETMAKSNMRVEQDPEAFRSGGVQKNLDDDGRVKRTGTVVTASAHIITAVIGSGVLSLA  61

Query  247   WAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQV  417
             WAIAQLG V GP+ + AFS IT +T+ LLADCYRSPD   G+RNY+YMD V+A+LGG +V
Sbjct  62    WAIAQLGWVMGPVVLAAFSFITYFTSTLLADCYRSPDPITGERNYTYMDVVKAHLGGRKV  121

Query  418   KFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEG-CIPSKRSSILIFGAV  594
             + CG+AQY  LVG +IGY ITA++S+ A+ ++NC+HK+G   +  C  S    ++IF  +
Sbjct  122   QLCGLAQYGNLVGITIGYTITASISMVAVKKSNCFHKNGHEVKSVCETSSYPFMIIFACI  181

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGG-VDVETSVTGVPVGVNHS  771
             +++LSQIP+FH+L +LSIVAA+MSF Y+SIG+ LS  K+AGG     T++TG  VGV+ S
Sbjct  182   QIVLSQIPDFHKLSWLSIVAAVMSFAYASIGVGLSIAKVAGGGHHARTTLTGTTVGVDVS  241

Query  772   TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLC  951
               +K++  F A+GNIA A+ +S +L++IQDTLKSSP E + MK+AS IGI + T FY LC
Sbjct  242   GSEKVWRVFQAVGNIAFAYAYSTVLVEIQDTLKSSPPENKVMKRASLIGISTTTMFYALC  301

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G +GY AFGN APGN LT   GFYEPFWL+D ANVCI VHL+GAYQV  QP+F FVE W 
Sbjct  302   GCIGYAAFGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLIGAYQVFSQPIFGFVESWC  360

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
               RW     I  E  +  P+ G + ++LFRL+WRT +V+ T V+AMI PFFN  LGL+G+
Sbjct  361   SKRWPNNTLIMREIPVDVPWYGIYHINLFRLIWRTVYVIVTAVIAMILPFFNDFLGLIGA  420

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
              +FWPLT+YFPVEMYI++  + + SFTW WL+ILS+ C VVS++AA GS+  L +S+  +
Sbjct  421   ASFWPLTVYFPVEMYIARTNMRKFSFTWAWLKILSWACLVVSLVAAAGSVQGLIQSLKTY  480

Query  1492  KPF  1500
             KPF
Sbjct  481   KPF  483



>ref|XP_010414737.1| PREDICTED: amino acid permease 1-like [Camelina sativa]
Length=485

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 345/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG   ++ FS IT +T+ +
Sbjct  30    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGISILLIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YM+ V+AYLGG +V+ CGVAQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPVTGKRNYTYMEVVQAYLGGRKVQLCGVAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NCYH  G+  + C  S    + +FG ++V+LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  150   VGKANCYHDKGKQAD-CSVSNYPYMAVFGIIQVILSQIPNFHKLSFLSIMAAVMSFTYAT  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +A G   +TS+TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAISYVAVGRVGKTSITGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG +GY AFG+AAPG+ LTD  GFYEP+WL+
Sbjct  269   TLRSSPAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTD-FGFYEPYWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      +    FIT E+++  P LG F++SLFR
Sbjct  328   DFANACIAAHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITAEYSVNVPVLGKFNISLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q KI + S  WI 
Sbjct  388   LVWRTAYVVVTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIA  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+++ + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKMMCYVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>emb|CDY22607.1| BnaC08g42410D [Brassica napus]
Length=481

 Score =   528 bits (1360),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 339/473 (72%), Gaps = 11/473 (2%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S  VE G G     D+D R KRTGT++TASAHIIT +IGSGVLSLAWAIAQLG V G + 
Sbjct  7     SSVVESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVI  66

Query  289   MVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             +VAF+VI  YT+ +LAD YRSP+G RNY+YMD VR YLGG +V+ CG+AQ+ +LVG +IG
Sbjct  67    LVAFAVIVNYTSRMLADSYRSPEGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y ITA++SL AI + NC+H  G G + C  S    +  FG V++ LSQIPNFH+L FLSI
Sbjct  127   YTITASISLVAIGKANCFHDKGHGAK-CSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSI  185

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +A +MSF Y+SIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA ++
Sbjct  186   IATVMSFSYASIGFGLALAALASGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  829   GFSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
              +S++L++IQ        DTL+SSP E + MK+AS   + + T FY+LCG +GY  FGN 
Sbjct  246   AYSVVLVEIQACILSINDDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQ  305

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAY-QVVVQPVFAFVECWSRARWGGVWFI  1161
             APG+ LT D GFYEP+WL+D AN CI VHL+GAY QV  QP+F FVE      W    FI
Sbjct  306   APGDFLT-DFGFYEPYWLIDFANACIAVHLIGAYQQVFAQPIFQFVEKKCNQAWPESNFI  364

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T EH++  P LG   ++ FRLVWRT +V+F+TVVAMIFPFFNAILGL+G++AFWPLT+YF
Sbjct  365   TKEHSMNVPLLGKCRINFFRLVWRTTYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYF  424

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEM+ISQ K+ + S  WI L++L F C +VS+LAA+GSI  L  SV  +KPF
Sbjct  425   PVEMHISQKKVKKYSVRWIVLKLLVFVCLIVSLLAAIGSIVGLISSVKAYKPF  477



>ref|XP_002889785.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66044.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   528 bits (1359),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 267/477 (56%), Positives = 339/477 (71%), Gaps = 17/477 (4%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE G       D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA+AQLG VAG I +V
Sbjct  9     AVESGDAAVKSLDDDGREKRTGTFMTASAHIITAVIGSGVLSLAWALAQLGWVAGTIILV  68

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             AF++IT YT+ +LADCYRSPD   G RNY+YM  VR YLGG +V+ CG+AQY  LVG +I
Sbjct  69    AFAIITYYTSTMLADCYRSPDPINGTRNYNYMGVVRTYLGGKKVQLCGLAQYVNLVGVTI  128

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI ++NCYH  G   + C  S    +  FG V+++LSQ+PNFH+L FLS
Sbjct  129   GYTITASISLVAIGKSNCYHDKGHKAK-CSVSNYPYMAAFGIVQIILSQLPNFHKLSFLS  187

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF Y+SIGI L+   +A G   +T +TG  +GV+ +  +K++  F A+G+IA +
Sbjct  188   IIAAVMSFSYASIGIGLAIATVASGKIGKTELTGTVIGVDVTASEKVWKLFQAIGDIAFS  247

Query  826   FGFSLILIDIQ------------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYL  969
             + F+ ILI+IQ            DTL+SSP E + MK+AS  G+ + T FY+LCG +GY 
Sbjct  248   YAFTTILIEIQAYHFYYHFLQREDTLRSSPPENKVMKRASLAGVSTTTVFYILCGCIGYA  307

Query  970   AFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGG  1149
             AFGN APG+ LTD  GFYEP+WLVD AN CI +HL+GAYQV  QP F FVE     +W  
Sbjct  308   AFGNQAPGDFLTD-FGFYEPYWLVDFANACIALHLIGAYQVYAQPFFQFVEENCNKKWPQ  366

Query  1150  VWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPL  1329
               FI  E++   P LG   V+LFRLVWRT +VV TT VAMIFPFFNAILGLLG++AFWPL
Sbjct  367   SNFINKEYSSDIPLLGKCRVNLFRLVWRTCYVVLTTFVAMIFPFFNAILGLLGALAFWPL  426

Query  1330  TIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             T+YFPV M+I+QAK+ + S  W+ L +L   C +VS+LAAVGSI  L  SV  +KPF
Sbjct  427   TVYFPVAMHIAQAKVKKYSRRWLALNLLVLVCLIVSILAAVGSIIGLINSVKSYKPF  483



>gb|KEH43994.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   526 bits (1356),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 355/477 (74%), Gaps = 20/477 (4%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             +Q SLS+       D +KYD+DG  KRTGT +TASAHI+TA+IGSGVLSLAWA+AQLG +
Sbjct  3     VQSSLSI-------DSVKYDDDGHIKRTGTWVTASAHIVTAVIGSGVLSLAWAVAQLGWI  55

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
             AG   ++ FS+ITL T+FLLADCYR PD   G RN++YM+ V+  LGGVQ K CG+AQY 
Sbjct  56    AGSFILILFSLITLLTSFLLADCYRYPDPIHGTRNHTYMEMVKNILGGVQYKLCGLAQYT  115

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              LVG +IGY +T ++S+ AI ++NC+HK G   + C  S  + + IFG+ ++LLSQIP+F
Sbjct  116   NLVGCTIGYTLTGSISMVAISKSNCFHKKGHLAD-CNISNFTFMAIFGSFQILLSQIPDF  174

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             H L +LSIVAA+MSFGY+SIGI LS  KIA  G  VET +TG+ VGV+ +   K+++TF 
Sbjct  175   HELSWLSIVAAIMSFGYASIGIGLSIAKIAERGHHVETGLTGLIVGVDETGMQKLWNTFQ  234

Query  802   ALGNIALAFGFSLILIDIQ---DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
             A+GNIA A+ FS+++ +IQ   DT+KSSP E + MK+++  GIL  TFFY LCG+LGY A
Sbjct  235   AIGNIAFAYAFSMVIAEIQASNDTIKSSPPENKVMKKSAFTGILITTFFYALCGLLGYEA  294

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWLVD+ N+ II+HLVGAYQV  QP+F+ VE W   RW   
Sbjct  295   FGNKAPGNFLTG-FGFYEPFWLVDIGNLFIIIHLVGAYQVFAQPIFSIVESWGNKRWPQS  353

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              F+T E+ +  P +G + +++FRL+WRT +V+FTTV+A+I PFFN+I+GLLG+I+F+PLT
Sbjct  354   KFMTKEYHVNIPLVGIWRMNMFRLIWRTMYVIFTTVIAIILPFFNSIVGLLGAISFFPLT  413

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGS----ICDLAKSVMHF  1491
             +YFP EMY+ QAK+P+ S  WI +++LS FC +V+++AAVGS    I DL  S + F
Sbjct  414   VYFPTEMYLKQAKVPKYSSIWIGMKLLSGFCLIVTLVAAVGSIVGIITDLKTSTLPF  470



>ref|XP_004515440.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 350/474 (74%), Gaps = 11/474 (2%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             M  S SL + +G     KYD+DGR KRTGT +T SAHI+TA+IGSGVLSLAWAIAQLG +
Sbjct  1     MTYSNSLPINDG-----KYDDDGRLKRTGTWITGSAHIVTAVIGSGVLSLAWAIAQLGWI  55

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
             AG I ++ FSVITL T+FLLADCYR PD   G RN++YM  V+  LGG Q  FCG+AQY 
Sbjct  56    AGSIVLILFSVITLLTSFLLADCYRYPDPVHGTRNHTYMAMVKNILGGTQYMFCGLAQYT  115

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              L+G +IGY IT ++S+ AI ++NC+HK+G     C  S    + +FG  E+LLSQIP+F
Sbjct  116   NLIGITIGYTITTSISMVAIKKSNCFHKYGH-EANCKTSNYPFMALFGVSEILLSQIPDF  174

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             H L +LS VAA+MSFGY+SIGI LS  KIA  G  VET +TG+ VGV+ ++  K ++TF 
Sbjct  175   HELSWLSFVAAVMSFGYASIGIGLSIAKIAEPGHHVETGLTGLVVGVDETSSQKYWNTFQ  234

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             A+G+IA ++ F  +++DIQDTLKSSP E +AMK+++ IGI   TFFY LCG+LGY AFGN
Sbjct  235   AIGDIAFSYAFCAVIVDIQDTLKSSPPENQAMKKSNVIGITVTTFFYALCGLLGYEAFGN  294

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGN LT   GFYEPFWLVD+ N+ II+HLVGAYQV  QP+F+ VE W   RW     +
Sbjct  295   KAPGNFLTG-FGFYEPFWLVDIGNLFIIIHLVGAYQVFAQPIFSLVESWGSKRWPESKLM  353

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T E+ ++ P +G + +++FRL+WRT +V+FTT+ AMIFPFFN+I+GL+G+++F+PL++YF
Sbjct  354   TKEYYVKIPLVGIWRMNMFRLIWRTLYVIFTTLFAMIFPFFNSIVGLVGAMSFFPLSVYF  413

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             P EMY+ Q+K+ + S  WI ++ LS FC +V+++AAVGSI  +   +  +KPFA
Sbjct  414   PTEMYLVQSKVTKYSPMWIGMKSLSGFCLIVTLVAAVGSIEGIISELKTYKPFA  467



>ref|XP_010470262.1| PREDICTED: amino acid permease 1 [Camelina sativa]
Length=485

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/453 (57%), Positives = 345/453 (76%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDGR KRTGT LTASAHIITA+IGSGVLSLAWAIAQLG +AG   ++ FS IT +T+ +
Sbjct  30    DEDGREKRTGTWLTASAHIITAVIGSGVLSLAWAIAQLGWIAGTSILLIFSFITYFTSTM  89

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LADCYR+PD   GKRNY+YM+ V+AYLGG +V+ CG+AQY  L+G ++GY ITA++SL A
Sbjct  90    LADCYRAPDPVTGKRNYTYMEVVQAYLGGRKVQLCGLAQYGNLIGITVGYTITASISLVA  149

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             + + NCYH  G+  + C  S    + +FG ++V+LSQIPNFH+L FLSI+AA+MSF Y++
Sbjct  150   VGKANCYHDKGKQAD-CSVSSYPYMALFGIIQVILSQIPNFHKLSFLSIMAAVMSFTYAT  208

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IGI L+   +A G   +TS+TG  VGV+ +   K++ +F A+G+IA A+ ++ +LI+IQD
Sbjct  209   IGIGLAISYVAVGRVGKTSITGTAVGVDVTAAQKIWRSFQAVGDIAFAYAYATVLIEIQD  268

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             TL+SSP E +AMK+AS +G+ + TFFY+LCG +GY AFG+AAPG+ LTD  GF+EP+WL+
Sbjct  269   TLRSSPAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTD-FGFFEPYWLI  327

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D AN CI  HL+GAYQV  QP+F FVE      +    FIT E+++  P LG F++SLFR
Sbjct  328   DFANACIAAHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITAEYSVNVPVLGKFNISLFR  387

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT +VV TTVVAMIFPFFNAILGL+G+ +FWPLT+YFPVEM+I+Q KI + S  WI 
Sbjct  388   LVWRTAYVVVTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIA  447

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             L+++ + C +VS+LAA GSI  L  SV  +KPF
Sbjct  448   LKMMCYVCLIVSLLAAAGSIAGLISSVKTYKPF  480



>ref|XP_010243490.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=462

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 265/461 (57%), Positives = 353/461 (77%), Gaps = 6/461 (1%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             G ++   D+DGR KRTGT++TAS HIITA+IGSGVLSLAW +AQLG VAGP+++VAFSVI
Sbjct  2     GKENESLDDDGRVKRTGTLMTASVHIITAVIGSGVLSLAWVMAQLGWVAGPVSLVAFSVI  61

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
             T +T+ LLADCYRS D   GKRNY+Y+DAVR  LGG +V+ CG+AQ   L+GA+IGY IT
Sbjct  62    TWFTSILLADCYRSDDPVPGKRNYTYVDAVRTNLGGYKVRICGLAQIGNLIGATIGYTIT  121

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A +S+ A++R+NC+HK+G   + C  S    I+IFG ++++LSQIPNFH+L +LS++AA+
Sbjct  122   AGISMAAVIRSNCFHKNGHHAK-CQASNYPFIIIFGGIQIVLSQIPNFHKLSWLSMIAAV  180

Query  661   MSFGYSSIGIALSAVKIAGGVD-VETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFS  837
             MSF Y+ IGI LS  ++AGG +   T +TGV VG++ +  +K++ TF A+GN+A A+ FS
Sbjct  181   MSFSYTLIGIGLSIAQVAGGNNGARTGLTGVVVGLDVTVSEKVWKTFQAIGNVAFAYTFS  240

Query  838   LILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHG  1017
              ILI+IQDTLKSSP E + MK+A+SIG+ +  F Y++CG +GY AFGN APGN LT   G
Sbjct  241   PILIEIQDTLKSSPPENKVMKKATSIGVSTIAFLYIVCGGVGYAAFGNDAPGNFLTG-FG  299

Query  1018  FYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG  1197
             FYEPFWL+D AN+CI VHLVGAYQV  QP+F  VE W    W    FIT EH ++ P  G
Sbjct  300   FYEPFWLIDFANLCIAVHLVGAYQVFAQPLFRIVENWCITHWPENGFITPEHAVKIPLYG  359

Query  1198  NFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIP  1377
              + ++ F++VWRT +VV TTV+AMIFPFFN ILGL+G+I++WPLT+Y P+EMYI +++IP
Sbjct  360   KYHINFFQVVWRTVYVVSTTVIAMIFPFFNDILGLVGAISYWPLTVYLPIEMYIVRSRIP  419

Query  1378  RLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             R SFTW WL++LSF C +V+V+AAVGS+  LA  V  +K F
Sbjct  420   RFSFTWTWLKVLSFTCLLVAVVAAVGSVQGLAAGVKTYKLF  460



>emb|CDY22608.1| BnaC08g42420D [Brassica napus]
Length=504

 Score =   526 bits (1356),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 263/474 (55%), Positives = 345/474 (73%), Gaps = 12/474 (3%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S AVE G       D+DG  KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG VAG + 
Sbjct  29    SSAVESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVL  88

Query  289   MVAFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             +V+F+V+  YT+ +LADCYRSPD G RN +YMD VRAYLGG +V+ CG+AQY +LVG +I
Sbjct  89    LVSFAVVVNYTSRMLADCYRSPDAGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTI  148

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++S  AI + NC+H  G G +  + S   ++  FG ++++LSQIPNFH+L FLS
Sbjct  149   GYTITASISFVAIGKANCFHDKGHGAKFSV-SNYPAMAAFGIIQIVLSQIPNFHKLSFLS  207

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF YSSIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA +
Sbjct  208   IIAAVMSFSYSSIGTGLALADLASGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFS  267

Query  826   FGFSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             + +S++L++IQ        DTL SSP E   MK+AS +G+ +AT FY+LC  +GY  FG+
Sbjct  268   YAYSVVLVEIQACIFSTRNDTLSSSPPENIVMKKASIVGVSTATAFYILCACMGYATFGS  327

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQ-VVVQPVFAFVECWSRARWGGVWF  1158
              APG+LLTD  GFYEP+WL+D AN CI VHL+GAYQ V+ QP+F FVE      W    F
Sbjct  328   QAPGDLLTD-FGFYEPYWLIDFANACIAVHLIGAYQQVIAQPIFQFVEKKCNKAWPESNF  386

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             IT EH++  P LG   ++ FRLVWRT +V+F+TV+AMIFPFFNA+LGL+G++AFWPLT+Y
Sbjct  387   ITKEHSMNIPLLGKCRINFFRLVWRTIYVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVY  446

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEM+ISQ KI + +  WI L++L   C +VS+LAAVGSI  L  SV  +KPF
Sbjct  447   FPVEMHISQKKIKKYTMRWIGLKLLVLVCLIVSLLAAVGSIVGLISSVKAYKPF  500



>ref|XP_010475860.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 348/466 (75%), Gaps = 7/466 (2%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G     ++D+DGR KRTGT++TASAHIITA++GSGVLSL+WAIAQLG +AG + +V 
Sbjct  2     VESGDVSGDRFDDDGREKRTGTLVTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  298   FSVITLYTAFLLADCYRSPD-----GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGAS  462
             F++I  YT+ +LADCYRSPD     G RNY+YM  VRAYLGG +V+  G+AQYA+LVG +
Sbjct  62    FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLYGLAQYASLVGIT  121

Query  463   IGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFL  642
             +GY ITA++SL AI + NCYH  G G + C  S   S+  FG V++LLSQIPNFH+L FL
Sbjct  122   VGYTITASISLVAIGKANCYHNKGHGAK-CSSSNYPSMAAFGVVQILLSQIPNFHQLSFL  180

Query  643   SIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIAL  822
             SI+A +MSF Y+SIGI LS  K+  G   +T++TG  VGV+ +  DK++ +F A+G+IA 
Sbjct  181   SIIATVMSFCYASIGIGLSIAKVISGKVGKTALTGTVVGVDVTASDKLWRSFQAVGDIAF  240

Query  823   AFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             ++ +S++L++IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+LL
Sbjct  241   SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T+  GFY+P+WLVD AN CI++HLV AYQV  QP+F FVE     +W    FIT EH++ 
Sbjct  301   TE-FGFYDPYWLVDFANACIVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFITSEHSMS  359

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
              P +G   ++LFRL+WRT +V+ TTVVAMIFPFFNAILGL+GS AFWPLT+YFPV M+I+
Sbjct  360   IPLIGKCRINLFRLLWRTAYVILTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIA  419

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             Q K+ + S  W+ L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  420   QTKVKKYSLRWMGLELLVLLCLIVSLLAALGSIVGLISSVKAYKPF  465



>ref|XP_002522103.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF40303.1| amino acid transporter, putative [Ricinus communis]
Length=454

 Score =   524 bits (1349),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 263/456 (58%), Positives = 344/456 (75%), Gaps = 10/456 (2%)
 Frame = +1

Query  142   LKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYT  321
             ++ D+D R KRTGT++TASAHIITA+IGSGVLSLAWA AQLG +AGP++++ F+VIT ++
Sbjct  2     IEIDDDDR-KRTGTLVTASAHIITAVIGSGVLSLAWATAQLGWIAGPVSLLVFAVITWFS  60

Query  322   AFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMS  492
             + LLADCYR P    G RN +Y++AV+A+LGG++ K CG+AQY  +VG SIGY ITA++S
Sbjct  61    SCLLADCYRFPGPLVGSRNPTYINAVKAHLGGMKQKLCGMAQYGNMVGVSIGYTITASIS  120

Query  493   LQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFG  672
             + AI R+NC+HK G  + GC  S    ++IFG  E++LSQ PNFH L  LSIVAA+MSF 
Sbjct  121   MAAIARSNCFHKEGHNS-GCHTSNNMFMIIFGITEIILSQTPNFHELSGLSIVAAIMSFA  179

Query  673   YSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILID  852
             YSSI + LS  KIAG  +V TS+TG   GVN ++ +K+++T  ALG+IA AF +S++LI+
Sbjct  180   YSSIALGLSIAKIAGENNVRTSLTGATGGVNMASTEKIWNTLQALGDIAFAFAYSVVLIE  239

Query  853   IQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPF  1032
             IQDTLK SP E + MK++S +G+ + T FY+LCG LGY AFG  APGNLLT   GFYEPF
Sbjct  240   IQDTLKPSPPENQVMKKSSLVGVTTTTIFYILCGTLGYAAFGEQAPGNLLT-GFGFYEPF  298

Query  1033  WLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVS  1212
             WLVDLAN+CI++HLVGAYQV  QP+F  VE W   +W    F+T      +P  G F V+
Sbjct  299   WLVDLANICIVIHLVGAYQVFCQPIFKLVEDWCNKKWPESRFLTKG----YPIGGVFHVN  354

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
              FRL+WRTG+V+ T+++AM FPFFN++LGLLG+++FWPLT+YFP+EMYISQAKI R SFT
Sbjct  355   FFRLLWRTGYVMVTSLLAMTFPFFNSVLGLLGALSFWPLTLYFPLEMYISQAKIARFSFT  414

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WIWL ILS  C V S+LAA  SI  +   + +FKP 
Sbjct  415   WIWLNILSMVCLVASLLAAAASIRGIIMDLSNFKPL  450



>emb|CDY57932.1| BnaA06g38010D [Brassica napus]
Length=462

 Score =   524 bits (1349),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 260/461 (56%), Positives = 335/461 (73%), Gaps = 7/461 (2%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G      +D+DGR KRTGT++TASAHIITA++GSGVLSLAWAIAQLG VAG + +V 
Sbjct  7     VESGDATGNNFDDDGREKRTGTLMTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  298   FSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYII  477
             F+VI  YT+ +LADCYRS  G RN +YMD VRAYLGG +V+ CG+AQY   VG +IGY I
Sbjct  67    FAVINYYTSTMLADCYRSDTGTRNCTYMDVVRAYLGGKKVQLCGLAQYGCFVGVTIGYTI  126

Query  478   TAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAA  657
             TA++SL AI + NC+H    G +  +P+    + +FG VE++LSQIP+FH+L FLSI+A 
Sbjct  127   TASISLVAIGKANCFHDKRHGAKCSMPN-YPFMAVFGIVEIILSQIPSFHKLSFLSIIAT  185

Query  658   LMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFS  837
             +MSF Y+SIGI L+   +A G   +T  TG  VGV+ +T DK++ +F A G+IA ++ +S
Sbjct  186   VMSFSYASIGIGLAMAVVASGKVGKTGATGTVVGVDVTTSDKIWKSFQATGDIAFSYAYS  245

Query  838   LILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHG  1017
              IL    DTL+SSP E + MK+AS  G+ + TFFY+LCG +GY AFGN APG+ LTD   
Sbjct  246   SIL----DTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTD--F  299

Query  1018  FYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG  1197
             FYEP+WL+D AN CI++HL+ AYQV  QP+F FVE      W    FIT EH++   FLG
Sbjct  300   FYEPYWLIDFANACIVLHLIAAYQVFAQPIFQFVENKCNKAWPESNFITKEHSMNILFLG  359

Query  1198  NFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIP  1377
                +S FRLVWRT +V+FTTVVAMIFPFFNAILGL+G+ AFWPLT+YFPVEM+ISQ KI 
Sbjct  360   KCRISFFRLVWRTAYVIFTTVVAMIFPFFNAILGLIGAAAFWPLTVYFPVEMHISQRKIK  419

Query  1378  RLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + S  WI L++L   C +V++LAA+GSI  L KSV  +K F
Sbjct  420   KHSMRWIGLKLLVLVCLIVTLLAAIGSIVGLIKSVKAYKHF  460



>gb|KFK43301.1| hypothetical protein AALP_AA1G106500 [Arabis alpina]
Length=472

 Score =   523 bits (1348),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/472 (56%), Positives = 339/472 (72%), Gaps = 5/472 (1%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             +S   E      +  D+DGR KRTGT  TASAHIITA+IGSGVLSLAWAIAQLG VAG +
Sbjct  3     ISYDQEHNPSPVVPLDDDGREKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGTV  62

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              +V F+VIT YT+ LLADCYRSP+   G RNY+YM  VRAYLGG QV+ CG+AQY  LVG
Sbjct  63    ILVTFAVITYYTSTLLADCYRSPNSDTGTRNYTYMGVVRAYLGGTQVQLCGLAQYVNLVG  122

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              +IGY ITA++SL AI R NCYH  G   + C  S    +  FG V+++LSQIP+FH+L 
Sbjct  123   VTIGYTITASISLVAIGRANCYHDKGHSAK-CSASPYQYMGAFGIVQIILSQIPSFHKLS  181

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             FLS++AALMSF Y+SIGI L+   +A G   +T +TG  +GV+ S  DK++ +F A+G+I
Sbjct  182   FLSLIAALMSFSYASIGIGLAIASVASGKIGKTELTGTVIGVDVSASDKVWRSFQAIGDI  241

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A ++ F+ ILI+IQDTL+SSP E + MK+AS  G+ + T FY+LCG +GY  FGN+APG+
Sbjct  242   AFSYAFTTILIEIQDTLRSSPPENKVMKKASLAGVSTTTVFYILCGCIGYATFGNSAPGD  301

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
              LTD  GFYEP+WLVD AN CI +HL+GAYQV  QP F FVE   + +W    FI  E++
Sbjct  302   FLTD-FGFYEPYWLVDFANACIALHLIGAYQVYAQPFFRFVENICKKKWPESNFINHEYS  360

Query  1177  IRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMY  1356
              + P LG   V+ FRLVWRT +V+ TTVVAMIFPFFN+ILGLLG+++F PLT+YFPV M+
Sbjct  361   SKIPLLGKCRVNFFRLVWRTVYVILTTVVAMIFPFFNSILGLLGALSFCPLTVYFPVAMH  420

Query  1357  ISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA*IE  1512
             I+Q K+   S  W+ L +L F C +VS LAAVGS+  L + V  ++PF  ++
Sbjct  421   IAQKKVKVFSPRWLALNLLVFVCLIVSSLAAVGSVVGLIQKVKTYQPFKKVD  472



>ref|XP_004497265.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=467

 Score =   522 bits (1345),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 343/460 (75%), Gaps = 6/460 (1%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             +D KYD+DGR KRTGT +T SAHI+TA+IGSGVLSLAWAIAQLG +AG I ++ FS+ITL
Sbjct  9     NDGKYDDDGRLKRTGTWVTGSAHIVTAVIGSGVLSLAWAIAQLGWIAGSIVLILFSLITL  68

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
              T+FLLADCYR PD   G RN++YM  V+  LGG Q  FCG+AQY  L+G +IGY +TA+
Sbjct  69    LTSFLLADCYRYPDPVHGTRNHTYMGMVKNILGGTQYMFCGLAQYTNLIGCTIGYTLTAS  128

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI ++NC+HK+G     C  S    + IFG  E+LLSQIP+FH L +LS VAA+MS
Sbjct  129   ISMVAIKKSNCFHKYGH-EANCKTSNYPFMAIFGVSEILLSQIPDFHELSWLSFVAAVMS  187

Query  667   FGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLI  843
             FGY+SIGI LS  KIA  G  VET +TG+ VGV+ ++  K ++TF A+G+IA A+ FS +
Sbjct  188   FGYASIGIGLSIAKIAEPGHHVETGLTGLVVGVDETSSQKYWNTFQAIGDIAFAYAFSTV  247

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             +++IQDTL+S P E +AMK++   GI   TFFY LCG+LGY AFGN APGN LT   GFY
Sbjct  248   IVEIQDTLQSRPPENQAMKKSVFTGITVTTFFYALCGLLGYEAFGNKAPGNFLTG-FGFY  306

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
             EPFWLVD+ N+ I++HLVGAYQV  QPVF+ VE W   RW     +T E+ ++ P +G +
Sbjct  307   EPFWLVDIGNIFIVIHLVGAYQVFAQPVFSLVESWGSKRWPESKLMTKEYYVKIPLVGIW  366

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              +++FRL+WRT +V+FTT+ AMIFPFFN+I+GLLG+++F+PLT+YFP EMY+ Q+K+ + 
Sbjct  367   RMNMFRLIWRTLYVIFTTLFAMIFPFFNSIVGLLGAMSFFPLTVYFPTEMYLVQSKVTKY  426

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             S  WI ++ LS FC +V+++A VGSI  +   +  +KPFA
Sbjct  427   SPMWIGMKSLSGFCLIVTLVAGVGSIEGIISELKTYKPFA  466



>emb|CAA70968.2| amino acid transporter [Solanum tuberosum]
Length=469

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 264/453 (58%), Positives = 347/453 (77%), Gaps = 8/453 (2%)
 Frame = +1

Query  91    EMQKS-LSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQL  264
             E QK+ + ++ E   GD  K +D+DGR KRTGT+LTASAHIITA+IGSGVLSLAWAIAQL
Sbjct  4     EFQKNAMYVSNELENGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQL  63

Query  265   GSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKFCGVA  435
             G VAGP  + AFS IT +T+ LLADCYRSP    GKRNY+YMD VR++LGGV+V  CG+A
Sbjct  64    GWVAGPAVLFAFSFITYFTSTLLADCYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGIA  123

Query  436   QYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQI  615
             QYA LVG +IGY ITA++S+ A+ R+NC+HK+G     C       ++IF  ++++LSQI
Sbjct  124   QYANLVGVTIGYTITASISMVAVKRSNCFHKNGH-EASCSIESYPYMIIFAVIQIVLSQI  182

Query  616   PNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFS  792
             PNFH+L +LSI+AA+MSF Y+SIG+ LS  K +G G  V+T++TGV VGV+ S  +K++ 
Sbjct  183   PNFHKLSWLSILAAVMSFTYASIGLGLSIAKASGVGHHVKTALTGVVVGVDVSGTEKVWR  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
             +F A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY A
Sbjct  243   SFQAIGDIAFAYAYSTVLIEIQDTLKSSPSESKVMKRASLAGVSTTTLFYVLCGTIGYAA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWL+D ANVCI VHLVGAYQV  QP++ FVE     RW   
Sbjct  303   FGNNAPGNFLTG-FGFYEPFWLIDFANVCIAVHLVGAYQVFCQPLYGFVEGRCSERWPDS  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT E+ ++ P+ G ++++LFRLVWRT +V+ T V+AMIFPFFN  LGL+G+ +F+PLT
Sbjct  362   KFITSEYAMQVPWCGTYNLNLFRLVWRTTYVIVTAVIAMIFPFFNDFLGLIGAASFYPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFV  1431
             +YFP+EMYI+Q KIP+ SFTW+WL+ILS+ C +
Sbjct  422   VYFPIEMYIAQRKIPKYSFTWVWLKILSWTCLI  454



>ref|XP_004496860.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   521 bits (1342),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 253/448 (56%), Positives = 343/448 (77%), Gaps = 6/448 (1%)
 Frame = +1

Query  169   KRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYR  348
             KRTGT +T SAHI+TA+IGSGVLSLAWAIAQLG +AG I ++ FS+ITL T+FLLADCYR
Sbjct  20    KRTGTWITGSAHIVTAVIGSGVLSLAWAIAQLGWIAGSIVLILFSLITLLTSFLLADCYR  79

Query  349   SPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNC  519
              PD   G RN +YM  V+  LGG Q   CG+AQY  L+G +IGY +TA++S+ AI ++NC
Sbjct  80    YPDPVHGARNPTYMVMVKNILGGTQYMLCGLAQYTNLIGCTIGYTLTASISMTAIKKSNC  139

Query  520   YHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALS  699
             +HK+G     C  S    + IFG  ++LLSQIP+FH L +LSIVAA+MSFGY+SIGI LS
Sbjct  140   FHKYGH-EANCNTSNYPFMAIFGVSQILLSQIPDFHELSWLSIVAAVMSFGYASIGIGLS  198

Query  700   AVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSS  876
               KIA  G  V+T +TG+ VGV+ ++ +K+++TF A+GNIA A+ FS+++++IQDTLKSS
Sbjct  199   IAKIAEPGHHVKTGLTGLVVGVDETSYEKLWNTFQAIGNIAFAYAFSMVIVEIQDTLKSS  258

Query  877   PRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANV  1056
             P E +AMK+++ +GI   TFFY LCG+LGY AFGN APGN LT   GFYEPFWLVD+ N+
Sbjct  259   PPENQAMKKSNVVGITVTTFFYALCGLLGYEAFGNKAPGNFLTG-FGFYEPFWLVDIGNL  317

Query  1057  CIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRT  1236
              II+HLVGAYQV  QPVF+ VE W    W     +T E+ I+ P +G + +++FR++WRT
Sbjct  318   LIIIHLVGAYQVFAQPVFSLVESWGSKCWPESKLMTKEYYIKIPLVGIYRINIFRVIWRT  377

Query  1237  GFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILS  1416
              +V+FTTV+AMIFPFFN+++GLLG+I+F+PLT+YFP EMY++QAK+P+ S  WI +++LS
Sbjct  378   MYVIFTTVMAMIFPFFNSVVGLLGAISFFPLTVYFPTEMYLTQAKVPKFSPIWIGMKMLS  437

Query  1417  FFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              FCF+V+++AAVGS+  +   +  +KPF
Sbjct  438   VFCFIVTLVAAVGSVEGIISDLKTYKPF  465



>tpg|DAA59488.1| TPA: hypothetical protein ZEAMMB73_156584 [Zea mays]
Length=483

 Score =   522 bits (1344),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 253/450 (56%), Positives = 335/450 (74%), Gaps = 8/450 (2%)
 Frame = +1

Query  163   RSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADC  342
             R +RTGT++TASAHIITA+IGSGVLSLAWAIAQLG V GP+ ++AFS IT + + LLADC
Sbjct  34    RERRTGTLVTASAHIITAVIGSGVLSLAWAIAQLGWVIGPVVLLAFSAITWFCSSLLADC  93

Query  343   YRSP----DGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVR  510
             YR+P     GKRNY+Y  AVR+YLG  + + C +AQY  LVG +IGY IT A+S+ AI R
Sbjct  94    YRAPPGPGQGKRNYTYGQAVRSYLGESKYRLCSLAQYVNLVGVTIGYTITTAISMGAIKR  153

Query  511   TNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGI  690
             +NC+H  G G + C  S  ++++IF  +++LLSQ+PNFH+LW+LSIVAA+MS  YSSIG+
Sbjct  154   SNCFHSRGHGAD-CEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVAAVMSLAYSSIGL  212

Query  691   ALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLK  870
              LS  KIAGGV V+TS+TG  VGV+ +  +K++ TF +LG+IA A+ +S +LI+IQDTL+
Sbjct  213   GLSIAKIAGGVHVKTSLTGAAVGVDVTAAEKVWKTFQSLGDIAFAYTYSNVLIEIQDTLR  272

Query  871   SSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLA  1050
             SSP E   MK+AS IG+ + T FY+LCG+LGY AFG+ APGN LT   GFY+PFWL+D+ 
Sbjct  273   SSPPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLT-GFGFYDPFWLIDVG  331

Query  1051  NVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVW  1230
             NVCI VHLVGAYQV  QP++ FVE W+R RW    F+  E  +      +F+ S FRLVW
Sbjct  332   NVCIAVHLVGAYQVFCQPIYQFVEAWARGRWPDCAFLHAELAVVAG--SSFTASPFRLVW  389

Query  1231  RTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQI  1410
             RT +VV T +VA +FPFFN  LGL+G+++FWPLT+YFP++MY++QAK  R S  W W+ +
Sbjct  390   RTAYVVLTALVATVFPFFNDFLGLIGAVSFWPLTVYFPIQMYMAQAKTRRFSPAWTWMNV  449

Query  1411  LSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             LS+ C  VS+LAA GS+  L K +  +KP 
Sbjct  450   LSYACLFVSLLAAAGSVQGLVKDLKGYKPL  479



>emb|CDY62728.1| BnaC05g49210D [Brassica napus]
Length=482

 Score =   521 bits (1341),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/477 (55%), Positives = 338/477 (71%), Gaps = 19/477 (4%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G      +D+DGR KRTGT++TASAHIITA++GSGVLSLAWAIAQLG VAG + +V 
Sbjct  7     VESGDATGNNFDDDGREKRTGTLVTASAHIITAVVGSGVLSLAWAIAQLGWVAGIVILVT  66

Query  298   FSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYII  477
             F+VI  YT+ +LADCYRS  G RN +YMD VRAYLGG +V+ CG+AQY   VG +IGY I
Sbjct  67    FAVINYYTSTMLADCYRSDTGTRNCTYMDVVRAYLGGRKVQLCGLAQYGCFVGVTIGYTI  126

Query  478   TAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAA  657
             TA++SL AI + NC+H  G G +  +P+    +  FG VE++LSQIP+FH+L FLSI+A 
Sbjct  127   TASISLVAIGKANCFHDKGHGAKCSMPN-YPFMAAFGIVEIILSQIPSFHKLSFLSIIAT  185

Query  658   LMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFS  837
             +MSF Y+SIGI L+   +A G   +T VTG   GV+ +  DK++ +F A G+IA ++ +S
Sbjct  186   VMSFSYASIGIGLAMAVVASGKVGKTGVTGTVAGVDVTASDKIWKSFQATGDIAFSYAYS  245

Query  838   LILIDIQ----------------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYL  969
              IL++IQ                DTL+SSP E + MK+AS  G+ + TFFY+LCG +GY 
Sbjct  246   SILVEIQACILSSIDVLGVIIKIDTLRSSPPENKVMKKASLAGVSTTTFFYMLCGCIGYA  305

Query  970   AFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGG  1149
             AFGN APG+ LT+   FYEP+WL+D AN CI++HL+ AYQV  QP+F FVE      W  
Sbjct  306   AFGNKAPGDFLTEF--FYEPYWLIDYANACIVLHLIAAYQVFAQPIFQFVENKCNKAWPE  363

Query  1150  VWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPL  1329
               FIT EH++  PFLG   V+ FRLVWRT +V+ TTVVAMIFPFFN+ILGL+G+ AFWPL
Sbjct  364   SNFITIEHSMNIPFLGKCRVNFFRLVWRTAYVILTTVVAMIFPFFNSILGLIGAAAFWPL  423

Query  1330  TIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             T+YFPVEM+ISQ KI + S  WI L++L   C +V++LAA+GSI  L KSV  +K F
Sbjct  424   TVYFPVEMHISQRKIKKYSMRWIGLKLLVSVCLIVTLLAAIGSIVGLIKSVKAYKHF  480



>ref|XP_009118276.1| PREDICTED: amino acid permease 8-like isoform X2 [Brassica rapa]
Length=472

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/464 (56%), Positives = 338/464 (73%), Gaps = 2/464 (0%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S  VE G G     D+D R KRTGT++TASAHIIT +IGSGVLSLAWAIAQLG V G + 
Sbjct  7     SSVVESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVI  66

Query  289   MVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             +VAF+VI  YT+ +LAD YRSP+G RNY+YMD VR YLGG +V+ CG+AQ+ +LVG +IG
Sbjct  67    LVAFAVIVNYTSRMLADSYRSPEGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y ITA++SL AI + NC+H  G G + C  S    +  FG V++ LSQIPNFH+L FLSI
Sbjct  127   YTITASISLVAIGKANCFHDKGHGAK-CSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSI  185

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +A +MSF Y+SIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA ++
Sbjct  186   IATVMSFSYASIGFGLALAALASGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S++L++IQDTL+SSP E + MK+AS   + + T FY+LCG +GY  FGN APG+ LTD
Sbjct  246   AYSVVLVEIQDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTD  305

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFYEP+WL+D AN CI VHL+GAYQV  QP+F FVE      W    FIT EH++  P
Sbjct  306   -FGFYEPYWLIDFANACIAVHLIGAYQVFAQPIFQFVEKKCNQAWPESNFITKEHSMNIP  364

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
              LG   ++ FRLVWRT +V+F+TVVAMIFPFFNAILGL+G++AFWPLT+YFPVEM+ISQ 
Sbjct  365   LLGKCRINFFRLVWRTTYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYFPVEMHISQK  424

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             K+ + S  WI L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  425   KVKKYSVRWIVLKLLVLVCLIVSLLAAIGSIVGLISSVKAYKPF  468



>ref|NP_001136620.1| uncharacterized protein LOC100216745 [Zea mays]
 gb|ACF82283.1| unknown [Zea mays]
Length=483

 Score =   520 bits (1339),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 252/450 (56%), Positives = 334/450 (74%), Gaps = 8/450 (2%)
 Frame = +1

Query  163   RSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADC  342
             R +RTGT++TASAHIITA+IGS VLSLAWAIAQLG V GP+ ++AFS IT + + LLADC
Sbjct  34    RERRTGTLVTASAHIITAVIGSSVLSLAWAIAQLGWVIGPVVLLAFSAITWFCSSLLADC  93

Query  343   YRSP----DGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVR  510
             YR+P     GKRNY+Y  AVR+YLG  + + C +AQY  LVG +IGY IT A+S+ AI R
Sbjct  94    YRAPPGPGQGKRNYTYGQAVRSYLGESKYRLCSLAQYVNLVGVTIGYTITTAISMGAIKR  153

Query  511   TNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGI  690
             +NC+H  G G + C  S  ++++IF  +++LLSQ+PNFH+LW+LSIVAA+MS  YSSIG+
Sbjct  154   SNCFHSRGHGAD-CEASNTTNMIIFAGIQILLSQLPNFHKLWWLSIVAAVMSLAYSSIGL  212

Query  691   ALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLK  870
              LS  KIAGGV V+TS+TG  VGV+ +  +K++ TF +LG+IA A+ +S +LI+IQDTL+
Sbjct  213   GLSIAKIAGGVHVKTSLTGAAVGVDVTAAEKVWKTFQSLGDIAFAYTYSNVLIEIQDTLR  272

Query  871   SSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLA  1050
             SSP E   MK+AS IG+ + T FY+LCG+LGY AFG+ APGN LT   GFY+PFWL+D+ 
Sbjct  273   SSPPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLT-GFGFYDPFWLIDVG  331

Query  1051  NVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVW  1230
             NVCI VHLVGAYQV  QP++ FVE W+R RW    F+  E  +      +F+ S FRLVW
Sbjct  332   NVCIAVHLVGAYQVFCQPIYQFVEAWARGRWPDCAFLHAELAVVAG--SSFTASPFRLVW  389

Query  1231  RTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQI  1410
             RT +VV T +VA +FPFFN  LGL+G+++FWPLT+YFP++MY++QAK  R S  W W+ +
Sbjct  390   RTAYVVLTALVATVFPFFNDFLGLIGAVSFWPLTVYFPIQMYMAQAKTRRFSPAWTWMNV  449

Query  1411  LSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             LS+ C  VS+LAA GS+  L K +  +KP 
Sbjct  450   LSYACLFVSLLAAAGSVQGLVKDLKGYKPL  479



>ref|XP_010320244.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 347/453 (77%), Gaps = 8/453 (2%)
 Frame = +1

Query  91    EMQKS-LSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQL  264
             E QK+ + ++ E   GD  K +D+DGR KRTGT+LTASAHIITA+IGSGVLSLAWAIAQL
Sbjct  4     EFQKNAMYVSNELESGDVQKNFDDDGREKRTGTLLTASAHIITAVIGSGVLSLAWAIAQL  63

Query  265   GSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQVKFCGVA  435
             G VAGP  ++AFS IT +T+ LLAD YRSP    GKRNY+YMD VR++LGGV+V  CG+A
Sbjct  64    GWVAGPAVLLAFSFITYFTSTLLADSYRSPGPISGKRNYTYMDVVRSHLGGVKVTLCGIA  123

Query  436   QYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQI  615
             QYA LVG +IGY ITA++S+ A+ R+NC+HK+G     C       ++IF  ++++LSQI
Sbjct  124   QYANLVGVTIGYTITASISMVAVRRSNCFHKNGH-EASCSIGSYPYMIIFAVIQIVLSQI  182

Query  616   PNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFS  792
             PNFH+L +LSI+AA+MSF Y+SIG+ LS  K+AG G  V+T++TGV VGV+ S  +K++ 
Sbjct  183   PNFHKLSWLSILAAVMSFTYASIGLGLSIAKVAGVGHHVKTTLTGVVVGVDVSGTEKVWR  242

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
             +F A+G+IA A+ +S +LI+IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY A
Sbjct  243   SFQAIGDIAFAYAYSTVLIEIQDTLKSSPPESKVMKRASLAGVSTTTLFYVLCGTIGYAA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FGN APGN LT   GFYEPFWL+D ANVCI VHL+GAYQV  QP++ FVE     RW   
Sbjct  303   FGNDAPGNFLTG-FGFYEPFWLIDFANVCIAVHLIGAYQVFCQPLYGFVEARCSERWPDS  361

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FIT E+ ++ P  G ++++LFRLVWRT +V+ T V+AMIFPFFN  LGL+G+ +F+PLT
Sbjct  362   KFITSEYAMQVPCCGTYNLNLFRLVWRTTYVIVTAVIAMIFPFFNDFLGLIGAASFYPLT  421

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFV  1431
             +YFP+EM+I+Q KIP+ SFTW+WL+ILS+ C +
Sbjct  422   VYFPIEMHIAQRKIPKYSFTWVWLKILSWTCLI  454



>gb|KEH43995.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=469

 Score =   516 bits (1330),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 347/458 (76%), Gaps = 6/458 (1%)
 Frame = +1

Query  139   DLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLY  318
             D KYD+DG  KRTG+ +TASAHI+TA+IGSGVLSLAWA+AQLG +AG I ++ FS+ITL 
Sbjct  11    DEKYDDDGLIKRTGSWVTASAHIVTAVIGSGVLSLAWAVAQLGWIAGCIVLILFSLITLL  70

Query  319   TAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAM  489
             T+FLLADCYR PD   G RN +YM  V++ LGGVQ ++C +AQYA LVG +IG+ +T ++
Sbjct  71    TSFLLADCYRYPDSVHGIRNPTYMAMVKSILGGVQYRYCALAQYANLVGVTIGFTLTGSI  130

Query  490   SLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSF  669
             S+ AI + NC+HK+G   + C  +    + IFG  E+LLSQIPNFH L +LSIVAA+MSF
Sbjct  131   SMVAIQKCNCFHKYGHEAD-CSTTNYQFMAIFGIFEILLSQIPNFHELSWLSIVAAIMSF  189

Query  670   GYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             GY+SIGI LS  KIA  G  + T +TG+ VGV+ +  +K+++TF A+GNIA A+ FS+++
Sbjct  190   GYASIGIGLSIAKIAEEGYHINTGLTGLVVGVDVTGTEKLWNTFQAIGNIAFAYCFSMVI  249

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             ++IQDTLKSSP E + MK++S +GI+  TFFY LCG+LGY AFGN APGN LT   GFYE
Sbjct  250   VEIQDTLKSSPPENQVMKKSSLVGIIITTFFYALCGLLGYAAFGNKAPGNFLTG-FGFYE  308

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             P+WLVD+ N+ II+HLVGAYQV  QP+F+ VE     +W     +T E+ +R PF+G + 
Sbjct  309   PYWLVDIGNLFIIIHLVGAYQVFAQPIFSAVERLGSKQWPQSKLMTKEYDVRIPFVGIWR  368

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             +++FRL WRT +V+ TT++AMI PFFN ++GLLG+I+F+PLT+YFP EMY++QA++P+ S
Sbjct  369   MNMFRLTWRTIYVIITTLIAMILPFFNNVVGLLGAISFFPLTVYFPTEMYLTQAQVPKYS  428

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
               WI +++LS FC +V+++AAVGSI  +   +  + PF
Sbjct  429   TIWIGMKLLSGFCLIVTLVAAVGSIEGIVSDLKTYHPF  466



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   517 bits (1332),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/489 (52%), Positives = 352/489 (72%), Gaps = 10/489 (2%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             +  Y + E   + Q++ S A+         +D+DGR KRTGT+ TA++HIITA+IGSGVL
Sbjct  23    VRHYLQVETQPKPQETESRAINLQENYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGVL  82

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWA+ QLG VAGPI M+ F+ + LYT+ LL+ CYRS D   G+RNY+YMDAV+A LGG
Sbjct  83    SLAWAVGQLGWVAGPIVMILFAFVNLYTSDLLSKCYRSGDPVVGQRNYTYMDAVKANLGG  142

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
             V+VK CG+ QY  L G +IGY I A++S+ AI R+NC+HK  + +  C  S    ++ FG
Sbjct  143   VKVKICGLIQYINLFGVAIGYTIAASVSMLAIKRSNCFHKTHKKSR-CHMSSNGYMITFG  201

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG-VN  765
              +E+L SQIP+F ++W+LSIVAA+MSF YS+IG+AL  V++A    ++ S+TG+ +G + 
Sbjct  202   IIEILFSQIPDFDQVWWLSIVAAIMSFTYSTIGLALGIVQVAENKSIKGSLTGITIGTIT  261

Query  766   H----STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSAT  933
             H    +   KM+ +  ALG IA A+ +S+ILI+IQDT+KS P E + MK+A+SI I   T
Sbjct  262   HAGTVTPTQKMWRSLQALGAIAFAYSYSIILIEIQDTIKSPPAEHKTMKKATSISIAVTT  321

Query  934   FFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFA  1113
              FYLLCG +GY AFG+ APGNLLT   GF++P+WL+D+ANV I+VHLVGAYQV  QP+FA
Sbjct  322   IFYLLCGCMGYAAFGDQAPGNLLTG-FGFFDPYWLLDIANVSIVVHLVGAYQVYCQPLFA  380

Query  1114  FVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAI  1293
             FVE WS A+W    F+T E+ I  PF G + ++ FR+VWRT FVV TT++AM+ PFFN +
Sbjct  381   FVEKWSAAKWSRSNFVTAEYDIPVPFFGVYQLNFFRVVWRTCFVVLTTLIAMLMPFFNDV  440

Query  1294  LGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLA  1473
             +G+LG++ FWPLT+YFPVEMYI++ KI + +  WI LQ+LS  C +VSV AAVGS+  + 
Sbjct  441   VGILGALGFWPLTVYFPVEMYIAKNKIGKWTSRWIGLQMLSMACLLVSVAAAVGSVAGVV  500

Query  1474  KSVMHFKPF  1500
               +  +KPF
Sbjct  501   LDLQTYKPF  509



>ref|XP_010095743.1| hypothetical protein L484_003355 [Morus notabilis]
 gb|EXB62126.1| hypothetical protein L484_003355 [Morus notabilis]
Length=488

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 263/485 (54%), Positives = 349/485 (72%), Gaps = 17/485 (4%)
 Frame = +1

Query  91    EMQKSLSLAVEE-GGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             E Q+  + AVE     D   +D+DGR KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  2     EFQRPANFAVETVETNDKTMFDDDGREKRTGTLVTASAHIITAVIGSGVLSLAWAIAQLG  61

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              +AG  A++ FS+ITLYT+ LL + YR P+   GKRNY+YM AV +YLGG + K CGV Q
Sbjct  62    WIAGVTALILFSMITLYTSSLLTNFYRFPEPNSGKRNYTYMQAVESYLGGFKYKLCGVFQ  121

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             Y  LVG SIGY IT A+S+ AI+++NC+HKHG+  + C  S   SI+IFG +++LLSQIP
Sbjct  122   YGNLVGTSIGYTITTALSVGAIIQSNCHHKHGKAAK-CSASTELSIVIFGILQILLSQIP  180

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIA-GGVDVETSVTGVPVGVNHSTKDKMFST  795
             NFH+L  LSI+AA MSF YS IG+ L+  KIA G  + +TS+TGV VGV+ +++ K++ +
Sbjct  181   NFHKLSGLSILAAAMSFTYSIIGVCLAITKIATGEANPKTSLTGVEVGVDVTSQQKIWRS  240

Query  796   FSALGNIALAFGFSLILIDIQ----------DTLKSSPRERRAMKQASSIGILSATFFYL  945
             F ALGNIA A+ +S +LIDIQ          DTLKSSP E   MK+A+++G+   T FY+
Sbjct  241   FQALGNIAFAYAYSQVLIDIQASIILYGLLLDTLKSSPPENVVMKKATAVGVFVTTAFYM  300

Query  946   LCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVEC  1125
             LCGILGY+AFGN APGN L    G++EP W+VD AN CI+VHL+GAYQV  QPV+  +E 
Sbjct  301   LCGILGYIAFGNDAPGNFLAG-FGYFEPAWIVDFANACIVVHLLGAYQVFAQPVYRKMED  359

Query  1126  WSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLL  1305
             WS+ +W    F+  E++I  P LG  + + FR VWRT +V+ T  +A+I PFFN ILGLL
Sbjct  360   WSKEKWPESDFVVKEYSIGIPCLGTCNFNGFRAVWRTLYVILTCTLAIILPFFNDILGLL  419

Query  1306  GSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVM  1485
             G+  FWPLT+YFP+EM+I+Q KIP+ S  W+ L +LS  C +VS+LAA GSI  +  ++ 
Sbjct  420   GAFVFWPLTVYFPLEMHIAQNKIPKYSRRWVGLNLLSGSCLIVSLLAAGGSIQGIITALK  479

Query  1486  HFKPF  1500
              ++PF
Sbjct  480   TYRPF  484



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 258/488 (53%), Positives = 346/488 (71%), Gaps = 16/488 (3%)
 Frame = +1

Query  64    RYRERERFAEMQKSLSLAVEEGGGDDLK-----YDEDGRSKRTGTVLTASAHIITAIIGS  228
             +Y +R  F  M+    ++VE   G+ L+     YD+DGR KR+GT  TASAHI+TA+IGS
Sbjct  11    KYNQRPTFTPME----VSVELSHGNQLQGLGKCYDDDGRLKRSGTFWTASAHIVTAVIGS  66

Query  229   GVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAY  399
             GVLSLAWAIAQLG VAGP+ M+ FS +T YT+ LLADCYRS D   GKRNY+YMDAV AY
Sbjct  67    GVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPDTGKRNYNYMDAVHAY  126

Query  400   LGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSIL  579
             LGG++VK CG  QYA L G ++GY I A++S+ AI R+NC+H+ G     C  S    ++
Sbjct  127   LGGLKVKLCGCIQYANLFGVAVGYTIAASISMMAIRRSNCFHEKGHKNP-CHTSSNPYMI  185

Query  580   IFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG  759
             +FG VE+ LSQIP+F ++W+LSIVAA+MSF YSSIG+AL  V+       + S+TG+ +G
Sbjct  186   MFGVVEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQAIDNKGFKGSLTGISIG  245

Query  760   VNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATF  936
             V   T+ K++ +  A G+IA A+ FSL+LI+IQDT+KS P  E + MK+AS + I+  T 
Sbjct  246   VISPTQ-KIWRSLQAFGDIAFAYSFSLVLIEIQDTIKSPPPSEAKVMKKASLLSIIVTTL  304

Query  937   FYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAF  1116
             FY+LCG +GY AFG+ APGNLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAF
Sbjct  305   FYMLCGCMGYAAFGDKAPGNLLTG-FGFYNPYWLLDIANAAIVVHLVGAYQVFSQPLFAF  363

Query  1117  VECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAIL  1296
             +E W+   W    FI+ E  +       + +SLFRLVWR+ FVV TTV++M+ PFFN ++
Sbjct  364   IEKWALKTWPDATFISKEIAVPLTPTKRYKLSLFRLVWRSAFVVLTTVISMLLPFFNDVV  423

Query  1297  GLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAK  1476
             GLLG++ FWPLT+YFPVEMYI Q +IPR S  W+ LQ+LS  C V++V A +GS+  +  
Sbjct  424   GLLGALGFWPLTVYFPVEMYIVQKRIPRWSTRWVCLQMLSSACLVITVAAVIGSVAGIVT  483

Query  1477  SVMHFKPF  1500
              +  ++PF
Sbjct  484   DLKVYRPF  491



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 256/454 (56%), Positives = 337/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M  FS ++ YT+ 
Sbjct  26    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMFLFSFVSYYTSC  85

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYRS D   GKRNY+Y+DAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  86    LLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKACGLIQYLNLFGIAIGYTIAASVSMM  145

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G + C  S    +++FG  EVLLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  146   AIKRSNCFHESG-GKKPCHMSSNPYMILFGVTEVLLSQIPDFDQIWWLSIVAAVMSFTYS  204

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+AL  VK+A       S+TG+ +G    T+ KM+ +F ALGNIA A+ +S+ILI+IQ
Sbjct  205   SIGLALGIVKVATAGTFRGSLTGISIGTVTETQ-KMWRSFQALGNIAFAYSYSVILIEIQ  263

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+K+ P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PFWL
Sbjct  264   DTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPFWL  322

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I+VHLVGAYQV  QP+FAFVE W+  RW     IT E  +  P L +F ++LF
Sbjct  323   LDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLF  382

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TT+++M+ PFFN ++GLLG++ FWPLT+YFPVEMYI+Q +IP+ S  WI
Sbjct  383   RLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWI  442

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++AA GSI  +   +  ++PF
Sbjct  443   CLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPF  476



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   515 bits (1327),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/474 (54%), Positives = 341/474 (72%), Gaps = 12/474 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLK-----YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             +++++E G    L+     YD+DGR KRTGTV TASAHI+TA+IGSGVLSLAWAIAQLG 
Sbjct  21    MNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAHIVTAVIGSGVLSLAWAIAQLGW  80

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             VAGP+ M+ FS +T YT+ LLADCYRS D   GKRNY Y DAV +YLGG++VK CG  QY
Sbjct  81    VAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYKYTDAVHSYLGGLKVKLCGFIQY  140

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
             A L G ++GY I A++S+ AI R+NC+H+ G     C  S    +++FG  E+ LSQIP+
Sbjct  141   ANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNP-CHTSSNPYMIMFGVAEIFLSQIPD  199

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             F ++W+LSIVAA+MSF YSSIG+AL  V++ G    + S+TG+ +GV   T+ K++ +  
Sbjct  200   FDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFKGSLTGISIGVVSPTQ-KVWRSLQ  258

Query  802   ALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
             A G+IA A+ FSLILI+IQDT+K+ P  E + MK+AS   I   T FY+LCG +GY AFG
Sbjct  259   AFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASLTSIAVTTIFYMLCGCMGYAAFG  318

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             + APGNLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAF+E W+   W    F
Sbjct  319   DEAPGNLLTG-FGFYNPYWLLDVANAAIVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAF  377

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             IT E  +  P    + +SLFRLVWR+ FVV TTV++M+ PFFN ++GLLG++ FWPLT+Y
Sbjct  378   ITKEVAVPLPSTKRYRLSLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVY  437

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEMYI+Q +IPR S  W+ LQILS  C V++V AA+GS+  +   +  ++PF
Sbjct  438   FPVEMYIAQKRIPRWSTRWVCLQILSLACLVITVAAAIGSVAGVVTDLEAYRPF  491



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   516 bits (1328),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 257/474 (54%), Positives = 341/474 (72%), Gaps = 12/474 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLK-----YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             +++++E G    L+     YD+DGR KRTGTV TASAHI+TA+IGSGVLSLAWAIAQLG 
Sbjct  35    MNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAHIVTAVIGSGVLSLAWAIAQLGW  94

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             VAGP+ M+ FS +T YT+ LLADCYRS D   GKRNY Y DAV +YLGG++VK CG  QY
Sbjct  95    VAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYKYTDAVHSYLGGLKVKLCGFIQY  154

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
             A L G ++GY I A++S+ AI R+NC+H+ G     C  S    +++FG  E+ LSQIP+
Sbjct  155   ANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNP-CHTSSNPYMIMFGVAEIFLSQIPD  213

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             F ++W+LSIVAA+MSF YSSIG+AL  V++ G    + S+TG+ +GV   T+ K++ +  
Sbjct  214   FDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFKGSLTGISIGVVSPTQ-KVWRSLQ  272

Query  802   ALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
             A G+IA A+ FSLILI+IQDT+K+ P  E + MK+AS   I   T FY+LCG +GY AFG
Sbjct  273   AFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASLTSIAVTTIFYMLCGCMGYAAFG  332

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             + APGNLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAF+E W+   W    F
Sbjct  333   DEAPGNLLTG-FGFYNPYWLLDVANAAIVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAF  391

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             IT E  +  P    + +SLFRLVWR+ FVV TTV++M+ PFFN ++GLLG++ FWPLT+Y
Sbjct  392   ITKEVAVPLPSTKRYRLSLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVY  451

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEMYI+Q +IPR S  W+ LQILS  C V++V AA+GS+  +   +  ++PF
Sbjct  452   FPVEMYIAQKRIPRWSTRWVCLQILSLACLVITVAAAIGSVAGVVTDLEAYRPF  505



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   515 bits (1326),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 254/454 (56%), Positives = 335/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +DEDGR KRTGT+ TASAHIITA+IGSGVLSLAWA+AQLG VAGP  M  FS++T YT+ 
Sbjct  39    FDEDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSS  98

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAVR+ LGGV+VK CG  QY  L G +IGY I +++S+ 
Sbjct  99    LLTDCYRTGDPDTGKRNYTYMDAVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMM  158

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  159   AIKRSNCFHQSG-GQNPCHLSSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  217

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  218   SIGLGLGIGKVAVNGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  276

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG+ APGNLLT   GFY P+WL
Sbjct  277   DTVKSPPAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTG-FGFYNPYWL  335

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I++HLVGAYQV  QP+FAF+E W+  +W G +FIT E  I  P  G + ++LF
Sbjct  336   IDIANAAIVIHLVGAYQVFCQPLFAFIEKWANQKWPGSYFITKEFNIAVPGYGLYKLNLF  395

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  396   RLVWRTIFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWI  455

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GS+  +   +  +KPF
Sbjct  456   CLQMLSMACLVISLVAVAGSVAGVVLDLKAYKPF  489



>ref|XP_009381189.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   513 bits (1322),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 339/460 (74%), Gaps = 5/460 (1%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             G  D + D+DGR +RTGTV TAS+HI+TA+IGSGVLSLAWA+AQLG +AGP+A+  F++I
Sbjct  10    GKMDEELDDDGRPRRTGTVWTASSHIVTAVIGSGVLSLAWAMAQLGWIAGPLALALFALI  69

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
             T+YT+ LLADCYR+ D   G RN +YM AV++ LGG ++  CG+ QY  L G SIGY IT
Sbjct  70    TVYTSSLLADCYRTDDPISGMRNVTYMRAVKSNLGGNKIWLCGLCQYVNLFGVSIGYTIT  129

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A +S  A+ ++NC+HK G+    C  S    ++ +G +++ LSQ+PNFH+LW+LSIVAA+
Sbjct  130   AGLSAAAVSKSNCFHKKGQ-EAACSISTNVFMVGYGIIQIFLSQLPNFHKLWWLSIVAAV  188

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSF YS I + LSA +I  G   +TS+TG  VGV+ S   K++STF ALG+IA ++ +S+
Sbjct  189   MSFAYSFIAVGLSAARIISGNTRKTSITGTIVGVDVSASQKVWSTFQALGDIAFSYSYSM  248

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             ILI+IQDTL+S P E + MK+AS IG+++ T FY+LCG LGY AFGN APGN+LT   GF
Sbjct  249   ILIEIQDTLRSPPAENKEMKKASLIGVVTTTTFYMLCGCLGYSAFGNQAPGNILTG-FGF  307

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN  1200
             YEP+WL+D+ NVCI+ HLVGAYQV  QP+FA VE W   +  G+  +T EH I       
Sbjct  308   YEPYWLIDVGNVCIVAHLVGAYQVYCQPLFAAVETWFARKCPGLQILTHEHPITINKNLG  367

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
              ++++FRL+WRT FVV +TV+AM+ PFFN +L LLG++ FWPL++YFP+EMYIS+  I R
Sbjct  368   CNINIFRLLWRTTFVVISTVLAMLMPFFNDVLSLLGAVGFWPLSVYFPIEMYISRNHIAR  427

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S  W+ LQ LSF CF+VS+ AA GSI  +A+S+ H+ PF
Sbjct  428   SSPKWMLLQSLSFLCFLVSLAAACGSIEGVAQSLQHYSPF  467



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   513 bits (1320),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 255/454 (56%), Positives = 337/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M  FS ++ YT+ 
Sbjct  26    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMFLFSFVSYYTSC  85

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYRS D   GKRNY+Y+DAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  86    LLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKACGLIQYLNLFGIAIGYTIAASVSMM  145

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G + C  S    +++FG  EVLLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  146   AIKRSNCFHESG-GKKPCHMSSNPYMILFGVTEVLLSQIPDFDQIWWLSIVAAVMSFTYS  204

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+AL  VK+A       S+TG+ +G    T+ KM+ +F ALG+IA A+ +S+ILI+IQ
Sbjct  205   SIGLALGIVKVATTGTFRGSLTGISIGTVTETQ-KMWRSFQALGDIAFAYSYSVILIEIQ  263

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+K+ P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PFWL
Sbjct  264   DTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPFWL  322

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I+VHLVGAYQV  QP+FAFVE W+  RW     IT E  +  P L +F ++LF
Sbjct  323   LDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLF  382

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TT+++M+ PFFN ++GLLG++ FWPLT+YFPVEMYI+Q +IP+ S  WI
Sbjct  383   RLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWI  442

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++AA GSI  +   +  ++PF
Sbjct  443   CLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPF  476



>ref|XP_003535676.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=462

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 344/468 (74%), Gaps = 10/468 (2%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             +++  +  G    K+D+DGR KR GT LTA++HI+TA+IGSGVLSLAWA+AQLG +AGP 
Sbjct  1     MTMESQANGVHSSKHDDDGRLKRRGTWLTATSHIVTAVIGSGVLSLAWAVAQLGWIAGPA  60

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              +  FSVIT++T+ LL+DCYR PD   G RN++Y + V+  LGG +  FCG+AQ+A L+G
Sbjct  61    ILTIFSVITVFTSSLLSDCYRYPDSVHGTRNHNYREMVKNILGGRKYLFCGLAQFANLIG  120

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
               IGY +TA++S+ A++R+NC+HK+G   + C  S    + IF  +++LLSQIP+F  L 
Sbjct  121   TGIGYTVTASISMVAVIRSNCFHKYGHEAK-CHTSNYPYMTIFAVIQILLSQIPDFQELS  179

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
              LSI+AA+MSFGYSSIGI LS  KIAGG D +TS+TG+ VG + ++++K+++TF A+GNI
Sbjct  180   GLSIIAAVMSFGYSSIGIGLSIAKIAGGNDAKTSLTGLIVGEDVTSQEKLWNTFQAIGNI  239

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ FS +L++IQDTLKSSP E +AMK+A+  G    + FY+LCG+LGY AFGN APGN
Sbjct  240   AFAYAFSQVLVEIQDTLKSSPPENQAMKKATLAGCSITSLFYMLCGLLGYAAFGNKAPGN  299

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
              LT   GFYEP+WLVD+ NV + VHLVGAYQV  QPVF  VE W   RW    F+  E+ 
Sbjct  300   FLT-GFGFYEPYWLVDIGNVFVFVHLVGAYQVFTQPVFQLVETWVAKRWPESNFMGKEYR  358

Query  1177  IRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMY  1356
             +     G F  + FR++WRT +V+FT VVAMI PFFN+I+GLLG+I+F+PLT+YFP EMY
Sbjct  359   V-----GKFRFNGFRMIWRTVYVIFTAVVAMILPFFNSIVGLLGAISFFPLTVYFPTEMY  413

Query  1357  ISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + QAK+P+ S  WI ++ILS FC +V+++AA GSI  +   +  ++PF
Sbjct  414   LVQAKVPKFSLVWIGVKILSGFCLIVTLVAAAGSIQGIIADLKIYEPF  461



>ref|XP_010490563.1| PREDICTED: amino acid permease 8-like isoform X2 [Camelina sativa]
Length=460

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 320/423 (76%), Gaps = 7/423 (2%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             VE G     ++D+DGR KRTGT+LTASAHIITA++GSGVLSL+WAIAQLG +AG + +V 
Sbjct  2     VESGDVSGDRFDDDGREKRTGTLLTASAHIITAVVGSGVLSLSWAIAQLGWLAGTVILVT  61

Query  298   FSVITLYTAFLLADCYRSPD-----GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGAS  462
             F++I  YT+ +LADCYRSPD     G RNY+YM  VRAYLGG +V+ CG+AQYA+LVG +
Sbjct  62    FAIINYYTSTMLADCYRSPDADDVPGTRNYTYMGVVRAYLGGRKVQLCGLAQYASLVGIT  121

Query  463   IGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFL  642
             +GY ITA++SL AI + NCYH  G G + C  S   S+  FG V++LLSQIPNFH+L FL
Sbjct  122   VGYTITASISLVAIGKANCYHNKGHGAK-CSSSNYPSMAAFGVVQILLSQIPNFHQLSFL  180

Query  643   SIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIAL  822
             SI+A +MSF Y+SIGI LS  K+  G   +T++TG  VGV+ +  DK++ +F A+G+IA 
Sbjct  181   SIIATVMSFCYASIGIGLSIAKVTSGKVGKTALTGTLVGVDVTASDKLWRSFQAVGDIAF  240

Query  823   AFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             ++ +S++L++IQDTLKSSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+LL
Sbjct  241   SYSYSIVLVEIQDTLKSSPPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLL  300

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T + GFYEP+WLVD AN CI++HLV AYQV  QP+F FVE     +W    FI  EH++ 
Sbjct  301   T-EFGFYEPYWLVDFANACIVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFIISEHSMS  359

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
              P +G   ++LFRL+WRT +VV TTVVAMIFPFFNAILGL+GS AFWPLT+YFPV M+I+
Sbjct  360   IPLIGKCRINLFRLLWRTAYVVLTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIA  419

Query  1363  QAK  1371
             Q K
Sbjct  420   QTK  422



>gb|ABR18002.1| unknown [Picea sitchensis]
Length=492

 Score =   513 bits (1320),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 255/458 (56%), Positives = 335/458 (73%), Gaps = 7/458 (2%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D  K+D+DGR +RTGT+ TASAHIITA+IGSGVLSLAW++AQLG +AGP  ++AFS ITL
Sbjct  35    DSEKFDDDGRPRRTGTLWTASAHIITAVIGSGVLSLAWSMAQLGWIAGPAVLIAFSFITL  94

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             YT+ LLADCYRS D   GKRNY+YM AV+A LGG+Q   CG  QY+ L G +IGY ITA+
Sbjct  95    YTSALLADCYRSLDPVNGKRNYNYMAAVKANLGGLQTWLCGFTQYSNLYGTAIGYTITAS  154

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
              S+ AI R++C+H  G+    C PS    +++FG V+++LSQIP+F +LW+LSIVAA+MS
Sbjct  155   TSMAAINRSDCFHSKGKNYP-CHPSNNPFMIMFGIVQLILSQIPDFDQLWWLSIVAAVMS  213

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             F YSSIG+ LS  K+A G +   ++TGV VG     + K++ TF ALG+IA A+ +S+IL
Sbjct  214   FSYSSIGLGLSIGKVAEG-NFHGTLTGVTVGTITGAQ-KVWQTFQALGDIAFAYSYSMIL  271

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             I+IQDTL+S P E + MK+A+ +G+   T FY L G  GY AFGN+APGNLLT   GFY 
Sbjct  272   IEIQDTLRSPPAENKTMKKATVLGVSVTTLFYTLSGCFGYAAFGNSAPGNLLTG-FGFYN  330

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             PFWLVD AN C++VHLVGAYQV VQP+FAF+E W   +W    FI   + I  P  G + 
Sbjct  331   PFWLVDFANACVVVHLVGAYQVFVQPLFAFIEEWCSHKWPRSQFIHKSYNINIPGYGLYK  390

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
              +LFRLVWRT FV+ TT+++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI+Q KI R +
Sbjct  391   ANLFRLVWRTCFVISTTLISMLLPFFNDVVGILGAVGFWPLTVYFPVEMYIAQKKIRRFT  450

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
               W+ LQ LS   F+VS+ AA GSI  + + +  +KPF
Sbjct  451   TKWMLLQTLSVVSFIVSLAAAAGSIEGIIQDLKSYKPF  488



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   511 bits (1317),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 339/475 (71%), Gaps = 8/475 (2%)
 Frame = +1

Query  88    AEMQK-SLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQL  264
             AE Q   LS+ V   GG +  +D+DGR KRTGT  TASAHI+TA+IGSGVLSLAWAIAQL
Sbjct  2     AEKQVFDLSIDVSPQGGSEC-FDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQL  60

Query  265   GSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVA  435
             G +AGP  M+ FS +  YT+ LLADCYRS D   GKRNY+YMDAVR+ LGGV+VK CGV 
Sbjct  61    GWIAGPAMMILFSFVIYYTSSLLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVI  120

Query  436   QYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQI  615
             QY  L G SIGY I A++S+ AI R+NC+H+ G G   C  S    ++IFG  E+LLSQI
Sbjct  121   QYLNLFGVSIGYTIAASISMMAIRRSNCFHESG-GKNSCHVSSNPYMIIFGVTEILLSQI  179

Query  616   PNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFST  795
             P+F ++W+LSIVAA+MS  YS IG+ L   K+A       S+TG+ +G    T+ K++ +
Sbjct  180   PDFDQIWWLSIVAAIMSLTYSVIGLGLGISKVAETGSFRGSLTGITIGAVTETQ-KIWRS  238

Query  796   FSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAF  975
             F ALG+IA A+ +S+IL +IQ+TLKS P E + MK+A+   +   T FY+LCG +GY AF
Sbjct  239   FQALGDIAFAYSYSIILXEIQNTLKSPPSEAKTMKKATLFSVFVTTLFYMLCGCMGYAAF  298

Query  976   GNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVW  1155
             G+ APGNLLT   GFY PFW++D+AN  +++HLVGAYQV  QP+FAF+E W+  RW    
Sbjct  299   GDLAPGNLLTG-FGFYNPFWVIDIANAAVVIHLVGAYQVFCQPLFAFIEKWASQRWPDSK  357

Query  1156  FITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             FIT E  +  P    + ++LFRLVWR+ FVV TT+++M+ PFFN ++G+LG+ +FWPLT+
Sbjct  358   FITNEIKVPIPGFCPYKLNLFRLVWRSAFVVATTIISMLLPFFNDVVGILGAFSFWPLTV  417

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +FPV+MYI+Q KIPR S  W+ LQILSF C V+SV AA GSI  +   +  +KPF
Sbjct  418   FFPVQMYIAQKKIPRWSTRWLSLQILSFACLVISVAAAAGSIAGVILDLKVYKPF  472



>ref|XP_008789212.1| PREDICTED: amino acid permease 8-like [Phoenix dactylifera]
Length=485

 Score =   512 bits (1318),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 338/479 (71%), Gaps = 11/479 (2%)
 Frame = +1

Query  91    EMQKSLSL------AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             EM K L +      A + GG  +   D+DGR KRTGTV TASAHIITA+IGSGVLSLAWA
Sbjct  5     EMIKELEMGGKRRSAQDVGGLGEEDLDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWA  64

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
              AQLG +AGP  ++ FS IT YT+ LLADCYR+ +   GKRNY+Y++AV++ LGG Q+  
Sbjct  65    TAQLGWIAGPATLLIFSFITFYTSSLLADCYRTSNPVSGKRNYTYIEAVKSNLGGAQLWL  124

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+ QY  L G +IGYIITA++S  A+ ++NC+HK G   + C  S    ++ FG V++ 
Sbjct  125   CGLCQYVNLFGVAIGYIITASISAAAVQKSNCFHKKGHQAD-CSVSDSLYMVAFGIVQIF  183

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
             LSQ+PNFH+LW+LSIVAA+MS  YS I + LS   I  G    TS+TG  VGV+ S+  K
Sbjct  184   LSQLPNFHKLWWLSIVAAVMSLAYSFIAVGLSTASIISGSTGRTSITGTEVGVDVSSSQK  243

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++  F ALG+IA A+ +S+ILI+IQDTL+S P E + MK+AS IG+ + T FY+LCG LG
Sbjct  244   VWKVFQALGDIAFAYSYSIILIEIQDTLRSPPAENKVMKKASFIGVSTTTIFYVLCGCLG  303

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN+LT   GFY+PFWL+DLANVCI+VHLVGAYQV  QP++A VE W   R 
Sbjct  304   YSAFGNRAPGNMLTG-FGFYDPFWLIDLANVCIVVHLVGAYQVFSQPIYAAVEKWIAKRC  362

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                  +  EH +        SV++FRL+WRT FVV +T++A++ PFFN +L  LG++ FW
Sbjct  363   PNNKMLAYEHPVTINGRFGCSVNMFRLIWRTSFVVISTLLAILMPFFNDVLAFLGAVGFW  422

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+ MYISQ KI R +  W+ LQ +SF CFVVS+ AA GSI  + +S+ H+ PF
Sbjct  423   PLTVYFPITMYISQKKIARFTPKWMLLQSISFLCFVVSLAAACGSIEGVIESLQHYTPF  481



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 334/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWA+AQLG VAGP  M  FS++T YT+ 
Sbjct  38    FDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSS  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAV + LGGV+VK CG  QY  L G +IGY I +++S+ 
Sbjct  98    LLTDCYRTGDPDTGKRNYTYMDAVESILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  158   AIKRSNCFHQSG-GQNPCHLSSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  217   SIGLGLGIGKVAVNGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG+ APGNLLT   GFY P+WL
Sbjct  276   DTVKSPPAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTG-FGFYNPYWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I++HLVGAYQV  QP+FAF+E W+  +W   +FIT E  I  P LG + ++LF
Sbjct  335   IDIANAAIVIHLVGAYQVFCQPLFAFIEKWANQKWPESYFITKEFNIAVPGLGLYKLNLF  394

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  395   RLVWRTIFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQRKIPKWSTRWI  454

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GS+  +   +  +KPF
Sbjct  455   CLQMLSMACLVISLVAVAGSLAGVVLDLKAYKPF  488



>ref|XP_009118279.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=488

 Score =   511 bits (1315),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/463 (56%), Positives = 340/463 (73%), Gaps = 6/463 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE  G +   +D+DGR KRTGT++TA+AHIITA+IGSGVLSLAWAIAQLG VAG + +V
Sbjct  27    AVETAGNN---FDDDGREKRTGTLMTATAHIITAVIGSGVLSLAWAIAQLGWVAGTVILV  83

Query  295   AFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
              F+VI  +T+ +LADCYRSPD G RNY+YMD VRAYLGG +VK CG+AQY +LVG +IGY
Sbjct  84    TFAVINYFTSTMLADCYRSPDTGIRNYNYMDVVRAYLGGWKVKLCGLAQYGSLVGITIGY  143

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              ITA++SL AI + NC+H  G   + C  S    +  FG  +++LSQI NFH+L FLSI+
Sbjct  144   TITASISLVAIGKANCFHDKGHDAK-CSVSNYPLMAAFGITQIVLSQIHNFHKLSFLSII  202

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             A +MSF Y+SIGI L+   +A G   +T +TG  VGV+ +  DK++ +F A G+IA ++ 
Sbjct  203   ATVMSFSYASIGIGLALAALASGKVGKTDLTGTVVGVDVTASDKIWRSFQAAGDIAFSYA  262

Query  832   FSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDD  1011
             FS++L++IQDTL+SSP E + MK+AS  G+ + T FY+LCG +GY AFGN APG+ LTD 
Sbjct  263   FSVVLVEIQDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQAPGDFLTD-  321

Query  1012  HGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF  1191
              GFYEP+WL+D AN CI VHL+ AYQV  QP+F F+E      W    FI  +++I  P 
Sbjct  322   FGFYEPYWLIDFANACIAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFIAKDYSINIPL  381

Query  1192  LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAK  1371
             LG   ++ FRLVWR+ +V+ TTVVAMIFPFFNAILGL+G++ FWPLT+YFPVEM+ISQ K
Sbjct  382   LGKCRINFFRLVWRSTYVILTTVVAMIFPFFNAILGLIGALTFWPLTVYFPVEMHISQKK  441

Query  1372  IPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             I + +  WI L++L   C VVS+LAAVGSI  L  SV  +KPF
Sbjct  442   IKKYTMRWIGLKLLVLVCLVVSLLAAVGSIVGLISSVKAYKPF  484



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   510 bits (1314),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 337/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M  FS ++ YT+ 
Sbjct  26    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMFLFSFVSYYTSC  85

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYRS D   GKRNY+Y+DAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  86    LLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKACGLIQYLNLFGIAIGYTIAASVSMM  145

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G + C  S    +++FG  EVLLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  146   AIKRSNCFHESG-GKKPCHMSSNPYMILFGVTEVLLSQIPDFDQIWWLSIVAAVMSFTYS  204

Query  679   SIGIALSAVKIAGGVDV-ETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDI  855
             SIG+AL  VK+A        S+TG+ +G    T+ KM+ +F ALG+IA A+ +S+ILI+I
Sbjct  205   SIGLALGIVKVATATGTFRGSLTGISIGTVTETQ-KMWRSFQALGDIAFAYSYSVILIEI  263

Query  856   QDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFW  1035
             QDT+K+ P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PFW
Sbjct  264   QDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPFW  322

Query  1036  LVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSL  1215
             L+D+AN  I+VHLVGAYQV  QP+FAFVE W+  RW     IT E  +  P L +F ++L
Sbjct  323   LLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNL  382

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FRLVWRT FV+ TT+++M+ PFFN ++GLLG++ FWPLT+YFPVEMYI+Q +IP+ S  W
Sbjct  383   FRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRW  442

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             I LQ+LS  C V+S++AA GSI  +   +  ++PF
Sbjct  443   ICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPF  477



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   509 bits (1312),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 255/456 (56%), Positives = 337/456 (74%), Gaps = 8/456 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M  FS ++ YT+ 
Sbjct  26    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMFLFSFVSYYTSC  85

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYRS D   GKRNY+Y+DAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  86    LLSDCYRSGDPLTGKRNYTYIDAVRSILGGARVKACGLIQYLNLFGIAIGYTIAASVSMM  145

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G + C  S    +++FG  EVLLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  146   AIKRSNCFHESG-GKKPCHMSSNPYMILFGVTEVLLSQIPDFDQIWWLSIVAAVMSFTYS  204

Query  679   SIGIALSAVKIAGGVD--VETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILID  852
             SIG+AL  VK+A         S+TG+ +G    T+ KM+ +F ALG+IA A+ +S+ILI+
Sbjct  205   SIGLALGIVKVASQSTGTFRGSLTGISIGTVTETQ-KMWRSFQALGDIAFAYSYSVILIE  263

Query  853   IQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPF  1032
             IQDT+K+ P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PF
Sbjct  264   IQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPF  322

Query  1033  WLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVS  1212
             WL+D+AN  I+VHLVGAYQV  QP+FAFVE W+  RW     IT E  +  P L +F ++
Sbjct  323   WLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLN  382

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
             LFRLVWRT FV+ TT+++M+ PFFN ++GLLG++ FWPLT+YFPVEMYI+Q +IP+ S  
Sbjct  383   LFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTR  442

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WI LQ+LS  C V+S++AA GSI  +   +  ++PF
Sbjct  443   WICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPF  478



>ref|NP_001057853.1| Os06g0556000 [Oryza sativa Japonica Group]
 dbj|BAD53554.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF19767.1| Os06g0556000 [Oryza sativa Japonica Group]
 gb|EAZ01325.1| hypothetical protein OsI_23356 [Oryza sativa Indica Group]
 gb|EAZ37338.1| hypothetical protein OsJ_21679 [Oryza sativa Japonica Group]
 dbj|BAG95706.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   509 bits (1312),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 340/462 (74%), Gaps = 13/462 (3%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             GG+D+  D+DG+ +RTG V TASAHIITA+IGSGVLSLAWA AQLG V GP+ ++ F++I
Sbjct  30    GGEDV--DDDGKQRRTGNVWTASAHIITAVIGSGVLSLAWATAQLGWVVGPVTLMLFALI  87

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
             T YT+ LLADCYR+ D   GKRNY+YMDAV AYLGG QV  CGV QY  LVG +IGY IT
Sbjct  88    TYYTSGLLADCYRTGDPVSGKRNYTYMDAVAAYLGGWQVWSCGVFQYVNLVGTAIGYTIT  147

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A++S  A+ + NCYHK+G   + C     + +++FG V++  S +PNF  L +LSI+AA+
Sbjct  148   ASISAAAVHKANCYHKNGHDAD-CGVYDTTYMIVFGVVQIFFSMLPNFSDLSWLSILAAV  206

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSF YS+I + LS  +   G   +T++TGV VGV+ ++  K++  F ALG+IA A+ +S+
Sbjct  207   MSFSYSTIAVGLSLARTISGATGKTTLTGVEVGVDVTSAQKIWLAFQALGDIAFAYSYSM  266

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             ILI+IQDT+KS P E + MK+A+ +G+ + T FY+LCG LGY AFGNAAPGN+LT   GF
Sbjct  267   ILIEIQDTVKSPPAENKTMKKATLLGVSTTTAFYMLCGCLGYAAFGNAAPGNMLT-GFGF  325

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG-  1197
             YEP+WL+D ANVCI+VHLVGAYQV  QP+FA VE ++  RW G  FIT E     P +  
Sbjct  326   YEPYWLIDFANVCIVVHLVGAYQVFCQPIFAAVETFAARRWPGSEFITRER----PVVAG  381

Query  1198  -NFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
              +FSV++FRL WRT FVV +TV+A++ PFFN ILG LG++ FWPLT+Y+PVEMYI Q +I
Sbjct  382   RSFSVNMFRLTWRTAFVVVSTVLAIVMPFFNDILGFLGAVGFWPLTVYYPVEMYIRQRRI  441

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              R +  W+ LQ LS  CF+VS+ +AV SI  +++S+ H+ PF
Sbjct  442   QRYTSRWVALQTLSLLCFLVSLASAVASIEGVSESLKHYVPF  483



>emb|CDY22609.1| BnaC08g42430D [Brassica napus]
Length=481

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 343/471 (73%), Gaps = 14/471 (3%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE  G +   +D+DGR KRTGTV+TASAHIITA+IGSGVLSLAWAIAQLG VAG + +V
Sbjct  12    AVEAAGNN---FDDDGREKRTGTVMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVILV  68

Query  295   AFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
              F+VI  +T+ +LADCYRSPD G RNY+YMD VRAYLGG +VK CG+AQY +LVG +IGY
Sbjct  69    TFAVINYFTSTMLADCYRSPDTGIRNYNYMDVVRAYLGGWKVKLCGLAQYGSLVGITIGY  128

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              ITA++SL AI + NC+H+ G G + C  S    +  FG ++++LSQI NFH+L FLSI+
Sbjct  129   TITASISLVAIGKANCFHEKGHGAK-CSVSNYPLMAAFGIIQIVLSQIHNFHKLSFLSII  187

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             A +MSF Y+SIGI L+   +A G   +T +TG  VGV+ +  DK++ +F A G+IA ++ 
Sbjct  188   ATVMSFSYASIGIGLALAALASGKVGKTDLTGTVVGVDVTASDKIWRSFQAAGDIAFSYA  247

Query  832   FSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAA  987
             FS++L++IQ        DTL+SSP E + MK+AS  G+ + T FY+LCG +GY AFGN A
Sbjct  248   FSVVLVEIQACILSIRDDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQA  307

Query  988   PGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITG  1167
             PG+ LTD  GFYEP+WL+D AN CI VHL+ AYQV  QP+F F+E      W    FIT 
Sbjct  308   PGDFLTD-FGFYEPYWLIDFANACIAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFITK  366

Query  1168  EHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPV  1347
             +++I  P LG   ++ FRLVWR+ +V+ TTV AMIFPFFNAILGL+G++ FWPLT+YFPV
Sbjct  367   DYSINIPLLGKCRINFFRLVWRSTYVILTTVAAMIFPFFNAILGLIGALTFWPLTVYFPV  426

Query  1348  EMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             EM+ISQ K+ + +  WI L++L   C VVS+LAAVGSI  L  SV  +KPF
Sbjct  427   EMHISQKKVKKYTMRWIGLKLLVLVCLVVSLLAAVGSIVGLISSVKAYKPF  477



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   508 bits (1308),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 338/473 (71%), Gaps = 12/473 (3%)
 Frame = +1

Query  109   SLAVEEGGGDDLK-----YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             S++VE      L+     YD+DGR+KRTGT+ TASAHI+TA+IGSGVLSLAWAIAQLG V
Sbjct  19    SVSVEVSHAHKLQEAFECYDDDGRAKRTGTLWTASAHIVTAVIGSGVLSLAWAIAQLGWV  78

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
             AGP+ M+ FS +T YT+ LLADCYRS D   GKRNYSY DAV AYLGG++VK CG  QYA
Sbjct  79    AGPVVMLLFSFVTHYTSTLLADCYRSGDPIAGKRNYSYTDAVHAYLGGLKVKLCGFIQYA  138

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              L G +IGY I +++S+ AI R+NC+H+ G     C  S    +++FG  E+ LSQIP+F
Sbjct  139   NLFGVAIGYTIASSISMMAIKRSNCFHERGHENP-CHASSNPYMIMFGIAEIFLSQIPDF  197

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSA  804
              ++W+LSIVAA+MSF YSSIG+AL  V++      + S+TG+ +G    T+ K++ +  A
Sbjct  198   DQIWWLSIVAAVMSFTYSSIGLALGIVQVIANKGFKGSLTGISIGAVSPTQ-KIWRSLQA  256

Query  805   LGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             LG+IA A+ FSLILI+IQDT+K+ P  E + MK+AS + I   TFFY+LCG +GY AFG+
Sbjct  257   LGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASVVSIAVTTFFYMLCGCMGYAAFGD  316

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGNLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAFVE W+   W    FI
Sbjct  317   GAPGNLLTG-FGFYNPYWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAVRTWPDSTFI  375

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T E  +       F +SLFRLVWR+ FVV TTV++M+ PFFN ++ LLG++ FWPLT+YF
Sbjct  376   TKEVAVPLTPTKRFRLSLFRLVWRSTFVVLTTVISMLLPFFNDVVALLGALGFWPLTVYF  435

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEMYI Q +IPR S  W+ LQ+LS  C V+++ AAVGS+  +   +  + PF
Sbjct  436   PVEMYIVQKRIPRWSLRWVCLQMLSLGCLVITIAAAVGSVAGIFTDLKVYHPF  488



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   508 bits (1308),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 248/454 (55%), Positives = 334/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TAS+HIITA+IGSGVLSLAWAIAQLG +AGP  M  FS++T YT+ 
Sbjct  38    FDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSS  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAV++ LGGV+V  CG+ QY  L G +IGY I +++S+ 
Sbjct  98    LLTDCYRTGDPDTGKRNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    ++IFG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  158   AIKRSNCFHQSG-GQNPCHISSNPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  217   TIGLGLGIGKVAANGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG+ APGNLLT   GFY P+WL
Sbjct  276   DTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTG-FGFYNPYWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+ANV I++HL+GAYQV  QP+FAF+E W+  +W   +FIT E  I  P    + ++LF
Sbjct  335   IDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFRPYKLNLF  394

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             R+VWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  395   RMVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWI  454

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   +  +KPF
Sbjct  455   CLQMLSMACLVISLVAVAGSIAGVVLDLKVYKPF  488



>ref|XP_010250334.1| PREDICTED: amino acid permease 4-like [Nelumbo nucifera]
Length=544

 Score =   510 bits (1313),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 257/498 (52%), Positives = 356/498 (71%), Gaps = 20/498 (4%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGG--------------DDLKYDEDGRSKRTGTVLTA  195
             +    + ER   M++  SL V+E G                D++ D+DGR  RTGTV TA
Sbjct  46    VSSLEKEERETSMKREASLGVDESGDASGVVSQSRFDGCTRDVRKDDDGRPCRTGTVWTA  105

Query  196   SAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKR  366
             +AHIITA+IGSGVLSLAWA+AQLG +AGP  ++ FS+ITLYT++LLADCYRSPD   GKR
Sbjct  106   TAHIITAVIGSGVLSLAWAVAQLGWIAGPATLIVFSLITLYTSYLLADCYRSPDPVLGKR  165

Query  367   NYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTE  546
             NY+YM++VR+ LGG     CG+ QY  LVG +IGY IT ++S+ AI ++NC+HK G    
Sbjct  166   NYTYMESVRSNLGGTMHLICGIVQYVYLVGTAIGYTITGSISIAAIYKSNCFHKRGHDAP  225

Query  547   GCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVD  726
              C+ S    ++ FG V+++LSQIPNFH+L +LS +AA+MSFGY++IGIALS VK+  G  
Sbjct  226   -CLISTDPFLITFGIVQIILSQIPNFHKLSWLSTLAAVMSFGYAAIGIALSMVKVISGKI  284

Query  727   VETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQA  906
              ++S+TGV +GV+ S   K++  F ALG+IA A+ +S+IL++IQDTL+S+P E + MK+A
Sbjct  285   GKSSLTGVEIGVDVSEAQKVWRIFKALGDIAFAYVYSVILLEIQDTLRSTPAENKVMKKA  344

Query  907   SSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAY  1086
             + I +   T FY+LCG +GY AFGN APGN+LT   GFYEP+WL+DLAN+ I+VHLVGA+
Sbjct  345   TMISVSITTVFYMLCGCMGYAAFGNDAPGNMLT-GFGFYEPYWLIDLANMFIVVHLVGAF  403

Query  1087  QVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVA  1266
             QV  QP FA VE W+  RW     ITGE+ +   ++  +S+++FRL+WR+ FV+  TVVA
Sbjct  404   QVFGQPFFAAVEAWAGRRWPNSKLITGEYQVSRKYM-RYSMNMFRLIWRSLFVIVVTVVA  462

Query  1267  MIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLA  1446
             M+ PFFN I+GLLG+I +WPL++YFPVEMYISQ KI R +  W+ LQ+L+  C ++++ A
Sbjct  463   MLMPFFNEIVGLLGAIGYWPLSVYFPVEMYISQKKIARFTSLWVALQLLNLGCLLITLAA  522

Query  1447  AVGSICDLAKSVMHFKPF  1500
               GSI  + + +  +KPF
Sbjct  523   ICGSIQGIIEDLRVYKPF  540



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   508 bits (1307),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 248/454 (55%), Positives = 334/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TAS+HIITA+IGSGVLSLAWAIAQLG +AGP  M  FS++T YT+ 
Sbjct  40    FDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSS  99

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAV++ LGGV+V  CG+ QY  L G +IGY I +++S+ 
Sbjct  100   LLTDCYRTGDPDTGKRNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMM  159

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    ++IFG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  160   AIKRSNCFHQSG-GQNPCHISSNPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  218

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  219   TIGLGLGIGKVAANGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  277

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG+ APGNLLT   GFY P+WL
Sbjct  278   DTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTG-FGFYNPYWL  336

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+ANV I++HL+GAYQV  QP+FAF+E W+  +W   +FIT E  I  P    + ++LF
Sbjct  337   IDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFRPYKLNLF  396

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             R+VWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  397   RMVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWI  456

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   +  +KPF
Sbjct  457   CLQMLSMACLVISLVAVAGSIAGVVLDLKVYKPF  490



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   508 bits (1307),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 249/454 (55%), Positives = 334/454 (74%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             YD+DGR KRTGT+ TAS+HIITA+IGSGVLSLAWAIAQLG +AGP  M  FS++T YT+ 
Sbjct  40    YDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSS  99

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   G+RNY+YMDAV++ LGGV+V  CG+ QY  L G +IGY I +++S+ 
Sbjct  100   LLTDCYRTGDPYTGERNYTYMDAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMM  159

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  160   AIKRSNCFHQSG-GQNPCHISSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  218

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  219   SIGLGLGIGKVAVNGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  277

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG  APGNLLT   GFY P+WL
Sbjct  278   DTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTG-FGFYNPYWL  336

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+ANV I++HL+GAYQV  QP+FAF+E W+  +W   +FIT E  I  P    ++++LF
Sbjct  337   IDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFRPYNLNLF  396

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  397   RLVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWI  456

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   +  +KPF
Sbjct  457   CLQMLSMACLVISLVAVAGSIAGVVLDLKAYKPF  490



>dbj|BAJ86012.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51006.1| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   506 bits (1304),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 344/483 (71%), Gaps = 19/483 (4%)
 Frame = +1

Query  82    RFAEMQKSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIA  258
             R A M+ S    VE G G +  + D+DGR +R+GTV TASAHIITA+IGSGVLSLAWAIA
Sbjct  14    RMAPMEVS----VEAGNGRESDWLDDDGRPRRSGTVWTASAHIITAVIGSGVLSLAWAIA  69

Query  259   QLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCG  429
             QLG  AGP  M+ F+++  YT+ LLA+CYRS D   GKR+Y+YMDAVR+YL G +VK CG
Sbjct  70    QLGWAAGPAIMLLFALVIYYTSTLLAECYRSGDPETGKRHYTYMDAVRSYLPGTKVKLCG  129

Query  430   VAQYATLVGASIGYIITAAMSLQAIVRTNCYHKH---GR-GTEGCIPSKRSSILIFGAVE  597
             V QYA LVG +IGY I A++S++A+ R +C+H H   GR G + C  S    +++FG V+
Sbjct  130   VIQYANLVGVAIGYTIAASISMRAVRRADCFHYHDVRGRSGKDSCKSSSNPYMIVFGVVQ  189

Query  598   VLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTK  777
             +L SQIP+F ++W+LSIVAA+MSF YS+IG+ L   +      ++ S+TG+ VG   ++ 
Sbjct  190   ILFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAQTVANGGIQGSLTGLSVGPGVTSM  249

Query  778   DKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCG  954
              K++ +  A GNIA A+ +S+ILI+IQDT+K+ P  E + MK+A+ I + + T FY+LCG
Sbjct  250   QKVWRSLQAFGNIAFAYSYSIILIEIQDTVKAPPPSEAKVMKKATGISVATTTVFYMLCG  309

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFG+AAP NLLT   GFYEPFWL+D+AN  I+VHLVGAYQV  QP+FAFVE W+ 
Sbjct  310   CMGYAAFGDAAPDNLLTG-FGFYEPFWLLDVANAAIVVHLVGAYQVFCQPLFAFVEKWAA  368

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
             ARW    FI  E  +     G  ++S+FRL WRT FV  TTVV+M+ PFF  ++GLLG++
Sbjct  369   ARWPDSAFIARELRV-----GPLAISVFRLTWRTAFVCLTTVVSMLLPFFGDVVGLLGAV  423

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             AFWPLT+YFPVEMYI Q  +PR S  W+ LQ+LS  C VVSV AA GSI D+   +  ++
Sbjct  424   AFWPLTVYFPVEMYIVQRGVPRGSTRWVCLQMLSAACLVVSVAAAAGSIADVIGELKEYR  483

Query  1495  PFA  1503
             PF+
Sbjct  484   PFS  486



>ref|XP_007042690.1| Amino acid permease 1 [Theobroma cacao]
 gb|EOX98521.1| Amino acid permease 1 [Theobroma cacao]
Length=479

 Score =   506 bits (1304),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 257/476 (54%), Positives = 329/476 (69%), Gaps = 4/476 (1%)
 Frame = +1

Query  76    RERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAI  255
             R+  A M  +  L   E        D D  SKR GT +TA AHIITA+IGSGVLSL+WAI
Sbjct  3     RDVQARMN-TFMLDTMETAKSTAAADGDNSSKRKGTWVTAGAHIITAVIGSGVLSLSWAI  61

Query  256   AQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP-DGKRNYSYMDAVRAYLGGVQVKFCGV  432
             AQLG +AGP+ ++ FS IT +T+ LLADC R P  G+R  SYMDAV++ LGG+  K CG 
Sbjct  62    AQLGWIAGPVTLLLFSAITWFTSTLLADCCRDPISGRRCSSYMDAVKSNLGGIHYKLCGF  121

Query  433   AQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQ  612
             AQY  LVG SIGY IT+A+S+ AI R+ C+HK+G    GC       ++IFG +E++LSQ
Sbjct  122   AQYGNLVGISIGYSITSAISMAAIKRSGCFHKNGHDA-GCHVKNNVFMIIFGFIEIILSQ  180

Query  613   IPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFS  792
             IPN H L  LS+VAA+MSF YS+IG+ LS  K+A G    TS+TG  VGV+ ++  K+++
Sbjct  181   IPNLHELSGLSVVAAIMSFAYSTIGLGLSIAKLAEGSHARTSLTGTTVGVDVTSAQKIWN  240

Query  793   TFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLA  972
              F A+G+IA A+ FS +L++IQDT+KS+P E  AMK+A+S+GI   T FY+LCG+LGY A
Sbjct  241   CFEAMGDIAFAYAFSTVLVEIQDTVKSNPPENEAMKKATSVGISITTVFYMLCGVLGYAA  300

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
              GN APGN LT   GFYEP+WL+D+ANVCIIVHLVGAYQV  QP+F  VE W   RW   
Sbjct  301   LGNKAPGNFLTG-FGFYEPYWLIDVANVCIIVHLVGAYQVFCQPIFKCVEDWCSNRWPNN  359

Query  1153  WFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLT  1332
              FI     I  P  G +  S FRLVWRT +V+ TT VAMIFPFFN +LGLLG  +F PLT
Sbjct  360   SFIKEGRPISLPIFGVYHFSAFRLVWRTAYVIMTTTVAMIFPFFNDVLGLLGGASFLPLT  419

Query  1333  IYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +YFP++M+I++ KI   S  WIWL +L   C V+S+ AA GSI  + K + +FKPF
Sbjct  420   VYFPIQMHIAREKIQPWSCKWIWLNVLVLLCSVISLPAAAGSIEGIVKDLRNFKPF  475



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   506 bits (1304),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 346/485 (71%), Gaps = 8/485 (2%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAV-EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             +++ ++  F  M+ S+ L   ++  G    YD+D R KRTGT+ TASAHIITA+IGSGVL
Sbjct  7     EKHNQQASFPAMEVSIELGHHQQPQGGSKFYDDDQRLKRTGTLWTASAHIITAVIGSGVL  66

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG VAGP  M+ FS +  YT+ LLADCYR  D   GKRNY+YMDAV AYLGG
Sbjct  67    SLAWAIAQLGWVAGPAVMLLFSFVIYYTSSLLADCYRFGDPITGKRNYTYMDAVHAYLGG  126

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
              +VKFCGV QYA L G +IGY I A++S+ AI R++C+H+ G  +  C  S    ++IFG
Sbjct  127   FKVKFCGVIQYANLFGVAIGYTIAASISMMAIRRSDCFHEKGDKSP-CHISSNPYMIIFG  185

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNH  768
               E++ SQIP+F ++W+LSIVAA+MSF YSSIG+ L  V+       + S++G+ +G   
Sbjct  186   VSEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLVLGIVQTIENGGFKGSLSGISIGTVT  245

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYL  945
              T+ K++ +  ALG+IA A+ FS+ILI+IQDT+K+ P  E + MK+A+ + +   TFFY+
Sbjct  246   ETQ-KIWRSLQALGDIAFAYSFSIILIEIQDTIKAPPPSEAKVMKKATMLSLAVTTFFYM  304

Query  946   LCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVEC  1125
             LCG +GY AFG+ APGNLLT   GFY PFWL+D+AN  I++HLVGAYQV  QP+FAFVE 
Sbjct  305   LCGCMGYAAFGDDAPGNLLTG-FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFAFVEK  363

Query  1126  WSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLL  1305
             W+R  W    FIT E  I      +++++LFRLVWR+ FVV TT+++M+ PFFN ++GLL
Sbjct  364   WARQTWPKSTFITKETRIPLSSARSYNLNLFRLVWRSAFVVLTTIISMLLPFFNDVVGLL  423

Query  1306  GSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVM  1485
             G++ FWPLT+YFP+EMYI+Q K+P+ S  W+ LQ+LS  C +VS+ AA GSI  +   + 
Sbjct  424   GALGFWPLTVYFPIEMYIAQKKVPKWSTRWVSLQMLSIACLIVSISAAAGSIAGVVTDLK  483

Query  1486  HFKPF  1500
              ++PF
Sbjct  484   VYRPF  488



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   505 bits (1301),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/454 (55%), Positives = 332/454 (73%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M  FS ++ YT+ 
Sbjct  40    FDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVSYYTSC  99

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMD+VR+ LGG +VK CG  QY  L G +IGY I A++S+ 
Sbjct  100   LLSDCYRAGDPVSGKRNYTYMDSVRSILGGAKVKACGFIQYFNLFGIAIGYTIAASISMM  159

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+   G   C  S    +++FG  E+LLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  160   AIKRSNCFHES-NGENPCHMSSTPYMIMFGITEILLSQIPDFDQIWWLSIVAAVMSFTYS  218

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+AL   ++A     + S+TG+ VG    T+ K++ +F ALG+IA A+ FS+ILI+IQ
Sbjct  219   SIGLALGIAQVAANGSFKGSLTGISVGAVTETQ-KIWRSFQALGDIAFAYSFSVILIEIQ  277

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ +     T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  278   DTVRSPPSEAKTMKKATFLSTAVTTTFYMLCGCMGYAAFGDAAPGNLLTG-FGFYNPFWL  336

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I++HLVGAYQV  QP+FAFVE  +  RW    FI  E  I  P LG ++++LF
Sbjct  337   LDIANAAIVIHLVGAYQVYCQPIFAFVEKQAAQRWPDSEFIAREIKIPVPGLGQYNMNLF  396

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV  TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q +IPR S  W+
Sbjct  397   RLVWRTIFVTLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQKQIPRWSTRWL  456

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++AA GSI  +   +  ++PF
Sbjct  457   CLQVLSMACLVISIMAAAGSIAGVMLDLKSYQPF  490



>emb|CDY53832.1| BnaA09g57240D [Brassica napus]
Length=1054

 Score =   523 bits (1348),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 344/472 (73%), Gaps = 12/472 (3%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S AVE G       D+DG  KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG VAG + 
Sbjct  29    SSAVESGTVAGNNVDDDGGEKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTVL  88

Query  289   MVAFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
             +V+F+V+  YT+ +LADCYRSPD G RN +YMD VRAYLGG +V+ CG+AQY +LVG +I
Sbjct  89    LVSFAVVVNYTSRMLADCYRSPDAGTRNNTYMDVVRAYLGGRKVQLCGLAQYGSLVGMTI  148

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY ITA++SL AI + NC+H  G G + C+ S   ++  FG ++++LSQIPNFH+L FLS
Sbjct  149   GYTITASISLVAIGKANCFHDKGHGAK-CLVSNYPAMAAFGIIQIVLSQIPNFHKLSFLS  207

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             I+AA+MSF YSSIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA +
Sbjct  208   IIAAVMSFSYSSIGTGLALADLASGKVGKTELTGTVVGVDVTASDKLWKSFQAAGNIAFS  267

Query  826   FGFSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             + +S++L++IQ        DTL SSP E   MK+AS +G+ +AT FY+LC  +GY  FG+
Sbjct  268   YAYSVVLVEIQACIFSTRNDTLSSSPPENIVMKKASLVGVSTATAFYILCACMGYATFGS  327

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQ-VVVQPVFAFVECWSRARWGGVWF  1158
              APG+LLTD  GFYEP+WL+D AN CI VHL+G YQ V+ QP+F FVE      W    F
Sbjct  328   QAPGDLLTD-FGFYEPYWLIDFANACIAVHLIGVYQQVIAQPIFQFVEKKCNKAWPESNF  386

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             IT EH++  P LG   ++ FRLVWRT +V+F+TV+AMIFPFFNA+LGL+G++AFWPLT+Y
Sbjct  387   ITKEHSMNIPLLGKCRINFFRLVWRTIYVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVY  446

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFK  1494
             FPVEM+ISQ KI + +  WI L++L   C +VS+LAAVGSI  L  S++  K
Sbjct  447   FPVEMHISQKKIKKYTMRWIGLKLLVLVCLIVSLLAAVGSIVGLISSLIRRK  498


 Score =   509 bits (1311),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 338/473 (71%), Gaps = 11/473 (2%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S  VE G G     D+D R KRTGT++TASAHIIT +IGSGVLSLAWAIAQLG V G + 
Sbjct  580   SSVVESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVI  639

Query  289   MVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             +VAF+VI  YT+ +LAD YRSP+G RNY+YMD VR YLGG +V+ CG+AQ+ +LVG +IG
Sbjct  640   LVAFAVIVNYTSRMLADSYRSPEGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  699

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y ITA++SL AI + NC+H  G G + C  S    +  FG V++ LSQIPNFH+L FLSI
Sbjct  700   YTITASISLVAIGKANCFHDKGHGAK-CSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSI  758

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +A +MSF Y+SIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA ++
Sbjct  759   IATVMSFSYASIGFGLALAALASGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  818

Query  829   GFSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
              +S++L++IQ        DTL+SSP E + MK+AS   + + T FY+LCG +GY  FGN 
Sbjct  819   AYSVVLVEIQACIISINDDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQ  878

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAY-QVVVQPVFAFVECWSRARWGGVWFI  1161
             APG+ LT D GFYEP+WL+D AN CI VHL+GAY QV  QP+F FVE      W    FI
Sbjct  879   APGDFLT-DFGFYEPYWLIDFANACIAVHLIGAYQQVFAQPIFQFVEKKCNQAWPESNFI  937

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
             T EH++  P LG   ++ FRLVWRT +V+F+TVVAMIFPFFNAILGL+G++AFWPLT+YF
Sbjct  938   TKEHSMNIPLLGKCRINFFRLVWRTTYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYF  997

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEM+ISQ K+ + S  WI L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  998   PVEMHISQKKVKKYSVRWIVLKLLVLVCLIVSLLAAIGSIVGLISSVKAYKPF  1050



>ref|XP_004965605.1| PREDICTED: amino acid permease 6-like [Setaria italica]
Length=486

 Score =   504 bits (1298),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 332/460 (72%), Gaps = 10/460 (2%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             GG++L  D+DGR KRTGTV TASAHIITA+IGSGVLSLAW+ AQLG V GP+ ++ F+ I
Sbjct  30    GGEEL--DDDGRKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPVTLMIFAFI  87

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
             T YT+ LLADCYRS +   GKRNY+YMDAV AYLG  QV  CG+ QY  LVG ++GY IT
Sbjct  88    TYYTSSLLADCYRSGNQATGKRNYTYMDAVAAYLGRWQVWSCGIFQYVNLVGTAVGYTIT  147

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A++S  A+ + NC+HK G   + C       +++FG V++  SQ+PNF  L +LSI+AA+
Sbjct  148   ASISAAAVHKANCFHKKGHAAD-CSQYDTVYMVVFGIVQIFFSQVPNFSDLSWLSILAAI  206

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSF YSSI + LS  +   G   +T++TG  VGV+  +  K++    ALGNIA A+ +S+
Sbjct  207   MSFSYSSIAVGLSLARTISGSTGKTTLTGTEVGVDVDSAQKIWMALQALGNIAFAYSYSM  266

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             ILI+IQDT+KS P E + MK+A+ +G+ + T FY+L G LGY AFGNAAPGN++T   GF
Sbjct  267   ILIEIQDTVKSPPAENKTMKKATLLGVSTTTAFYMLAGCLGYAAFGNAAPGNIMT-GFGF  325

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN  1200
             YEP+WL+D ANVCI+VHLVGAYQV  QP+FA VE    ARW    F+TGEH +     G 
Sbjct  326   YEPYWLIDFANVCIVVHLVGAYQVFSQPIFAAVETELAARWPNSKFVTGEHPL---VAGR  382

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             F+V++ RL WRT FVV +TV+A++ PFFN ILG LG+I FWPLT+Y+PVEMYI Q +I +
Sbjct  383   FNVNMLRLTWRTVFVVVSTVLAIVMPFFNDILGFLGAIGFWPLTVYYPVEMYIRQRRIQK  442

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S  W+ L+ LSF CF+VS+ +AV SI  + +S+ H+ PF
Sbjct  443   FSTRWLALETLSFLCFLVSLASAVASIEGVTESLKHYVPF  482



>ref|XP_010314596.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   503 bits (1296),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 339/455 (75%), Gaps = 13/455 (3%)
 Frame = +1

Query  88    AEMQK-SLSLAVE------EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLA  246
             +E +K S ++ VE      E G      D+DGR KRTGTVLTASAHIITA+IGSGVLSLA
Sbjct  3     SEFEKNSTNMYVEQSPKGLENGQVQRNIDDDGREKRTGTVLTASAHIITAVIGSGVLSLA  62

Query  247   WAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSP---DGKRNYSYMDAVRAYLGGVQV  417
             WA+AQLG VAGP+ +  FS IT +T+ LL DCYR P    GKRNYSYM+ VR++LGG +V
Sbjct  63    WAMAQLGWVAGPVILFLFSFITYFTSTLLTDCYRFPGPDSGKRNYSYMEVVRSHLGGFKV  122

Query  418   KFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVE  597
             + CG+AQY  LVG +IGY ITA++S++A+VR+NC+HK G     CI S    ++IF  ++
Sbjct  123   QLCGIAQYGNLVGITIGYTITASISMKAVVRSNCFHKEGH-QASCIVSNYPYMVIFAIIQ  181

Query  598   VLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHST  774
             ++LSQI NFH+L +LS++AA+MSF YS IG+ LS  K+AG G  V+TS+TG  VGV+ S 
Sbjct  182   IILSQIQNFHKLSWLSMLAAVMSFAYSLIGLGLSIAKVAGVGHHVKTSLTGTIVGVDVSA  241

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCG  954
               K++    ++G+IA A+ F+ ILIDIQDTL+S P E +AMK+AS +G+ + T FY+LCG
Sbjct  242   SQKVWRCLQSIGDIAFAYAFATILIDIQDTLRSPPPENKAMKRASLVGVFTTTLFYVLCG  301

Query  955   ILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSR  1134
              +GY AFGN APGN LT   GFYEPFWL+D ANVCI +HL+GAYQV  QP+++FVE    
Sbjct  302   TIGYAAFGNNAPGNFLTG-FGFYEPFWLIDFANVCIAIHLIGAYQVFCQPIYSFVEGRCI  360

Query  1135  ARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSI  1314
              +W    FI  +H I  P+LG +++S FR++WRT +V+ T ++AMIFPFFNAILGL+G+ 
Sbjct  361   EKWPENKFIKSQHDINIPWLGVYNLSYFRMIWRTIYVIVTAIIAMIFPFFNAILGLIGAA  420

Query  1315  AFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSF  1419
             +F+PLT+YFP+EM+I+Q KIP+ SF WIWL ILS+
Sbjct  421   SFYPLTVYFPIEMHIAQRKIPKYSFKWIWLHILSW  455



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   504 bits (1297),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 250/454 (55%), Positives = 329/454 (72%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG +AGP+ M+ FS++T YT+ 
Sbjct  25    FDDDGRLKRTGTIWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPVVMILFSIVTYYTST  84

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLA CYRS D   GKRNY+Y  AVR+YLGG  VKFCG  QYA L G +IGY I A++S+ 
Sbjct  85    LLATCYRSGDQLSGKRNYTYTQAVRSYLGGFSVKFCGWVQYANLFGVAIGYTIAASISMM  144

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NCYH  G G   C  +    ++ +G  E++ SQIP+FH LW+LSIVAA+MSF YS
Sbjct  145   AIKRSNCYHSSG-GKNPCKMNSNWYMISYGVSEIIFSQIPDFHELWWLSIVAAVMSFTYS  203

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
              IG+ L   K+ G   ++ S+TGV +G    ++ K++ TF ALGNIA A+ +S+ILI+IQ
Sbjct  204   FIGLGLGIGKVIGNGRIKGSLTGVTIGTVTESQ-KIWRTFQALGNIAFAYSYSMILIEIQ  262

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E   M +A+ I +L  T FY+LCG  GY +FG+A+PGNLLT   GFY PFWL
Sbjct  263   DTIKSPPAESETMSKATLISVLVTTVFYMLCGCFGYASFGDASPGNLLTG-FGFYNPFWL  321

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I++HLVGAYQV  QP+F+FVE  +  R+    F++ E  +  P    + ++LF
Sbjct  322   IDIANAGIVIHLVGAYQVYCQPLFSFVESNAAERFPNSDFMSREFEVPIPGCKPYKLNLF  381

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ +TV+AM+ PFFN I+GL+G+I FWPLT+Y PVEMYI+Q KIP+    WI
Sbjct  382   RLVWRTLFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQTKIPKWGIKWI  441

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  CFV+++LAA GSI  +   +  +KPF
Sbjct  442   GLQMLSVACFVITILAAAGSIAGVIDDLKVYKPF  475



>ref|XP_002437146.1| hypothetical protein SORBIDRAFT_10g021980 [Sorghum bicolor]
 gb|EER88513.1| hypothetical protein SORBIDRAFT_10g021980 [Sorghum bicolor]
Length=491

 Score =   504 bits (1298),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 248/463 (54%), Positives = 332/463 (72%), Gaps = 8/463 (2%)
 Frame = +1

Query  121   EEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAF  300
              +GG    + D+DGR KRTGTV TASAHIITA+IGSGVLSLAW+ AQLG V GP+ ++ F
Sbjct  30    RDGGAGGQELDDDGRKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPLTLMIF  89

Query  301   SVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
             ++IT YT+ LL+DCYRS D   GKRNY+YMDAV AYLG  QV  CGV QY  LVG ++GY
Sbjct  90    ALITYYTSSLLSDCYRSGDQLTGKRNYTYMDAVAAYLGRWQVLSCGVFQYVNLVGTAVGY  149

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              ITA++S  A+ + NC+HK G   + C       +++FG V++  SQ+PNF  L +LSIV
Sbjct  150   TITASISAAAVHKANCFHKKGHDAD-CSTYDTMYMVVFGIVQIFFSQLPNFSDLSWLSIV  208

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             AA+MSF YS+I + LS  +   G   ++++TG  +GV+  +  K++    ALGNIA A+ 
Sbjct  209   AAIMSFSYSTIAVGLSLARTISGRTGKSTLTGTEIGVDVDSAQKVWLALQALGNIAFAYS  268

Query  832   FSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDD  1011
             +S+ILI+IQDT+KS P E + MK+A+ +G+ + T FY+L G LGY AFGNAAPGN+LT  
Sbjct  269   YSMILIEIQDTVKSPPAENKTMKKATLMGVTTTTAFYMLAGCLGYSAFGNAAPGNILT-G  327

Query  1012  HGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF  1191
              GFYEP+WL+D ANVCI+VHLVGAYQV  QP+FA +E  +  RW    F+T EH +    
Sbjct  328   FGFYEPYWLIDFANVCIVVHLVGAYQVFSQPIFAALETAAAKRWPNAKFVTREHPL---V  384

Query  1192  LGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAK  1371
              G F+V++ RL WRT FVV +TV+A++ PFFN ILG LG+I FWPLT+Y+PVEMYI Q +
Sbjct  385   AGRFNVNMLRLTWRTAFVVVSTVLAIVMPFFNDILGFLGAIGFWPLTVYYPVEMYIRQRR  444

Query  1372  IPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             I + +  W+ LQ+LSF CF+VS+ +AV SI  + +S+ H+ PF
Sbjct  445   IQKYTTRWVALQLLSFLCFLVSLASAVASIEGVTESLKHYVPF  487



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   504 bits (1298),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 339/455 (75%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS++TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    +++FG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E     R+    F++ E  IR P F   + V++
Sbjct  335   LDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRMVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/474 (53%), Positives = 341/474 (72%), Gaps = 12/474 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLK-----YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             L ++VE G    L+     YD+DGR KRTGTV TA+AHI+TA+IGSGVLSLAW IAQLG 
Sbjct  11    LDVSVELGHEHQLQGATKSYDDDGRLKRTGTVWTATAHIVTAVIGSGVLSLAWTIAQLGW  70

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             VAGP+ M  FS +T YT+ LLADCYRS D   GKRNY+Y DAV AYLGG++VK CG  QY
Sbjct  71    VAGPVVMFLFSFVTYYTSTLLADCYRSGDPINGKRNYNYTDAVHAYLGGLKVKLCGFIQY  130

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
             A L G +IGY I A++S+ AI R++C+H+ G     C+ S    +++FG  E+ LSQIP+
Sbjct  131   ANLFGVAIGYTIAASISMMAIKRSDCFHEKGHKNP-CLTSSNPYMIMFGVAEIFLSQIPD  189

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             F ++W+LSIVAA+MSF YSSIG+AL  V++ G    + S+TG+ +GV   T+ K++ +  
Sbjct  190   FDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKSFKGSLTGISIGVISPTQ-KIWRSLK  248

Query  802   ALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
             ALG+IA A+ FS++LI+IQDT+++ P  E + MK+AS + I+  T FY+LCG +GY AFG
Sbjct  249   ALGDIAFAYSFSVVLIEIQDTIRAPPPSEAKVMKKASLLSIVVTTLFYMLCGCMGYAAFG  308

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             ++APGNLLT   GFY P+WL+++AN  I+VHLVGAYQV  QP+FAF+E W+   W    F
Sbjct  309   DSAPGNLLTG-FGFYNPYWLLNIANAAIVVHLVGAYQVFCQPLFAFIEKWAVKTWPESTF  367

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             I  E  +       +++SLFRLVWR+ FVV TTV++M+ PFFN ++GLLG++ FWPLT+Y
Sbjct  368   IAKEIAVPLTPTRRYNLSLFRLVWRSSFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVY  427

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEMYI + +IPR S  W+ LQ+LS  C  VS+ AA+GS+  +   +  ++PF
Sbjct  428   FPVEMYIVRQRIPRWSTRWVCLQMLSLACLAVSIAAAIGSVAGVVTDLNLYRPF  481



>gb|KEH43996.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 339/457 (74%), Gaps = 15/457 (3%)
 Frame = +1

Query  169   KRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYR  348
             KRTGT +TASAHI+T IIGSGVLSLAWA+AQLG +AG I ++ FS ITL T+ L+ADCYR
Sbjct  15    KRTGTWITASAHIVTTIIGSGVLSLAWAVAQLGWIAGTITLIIFSAITLLTSCLMADCYR  74

Query  349   SPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNC  519
              PD   G RN++YM+ V+  LGGVQ KFCG+AQY  L+G +IGY +T ++S+ AI ++NC
Sbjct  75    YPDPIHGIRNHTYMEMVKNILGGVQYKFCGLAQYTNLIGITIGYTLTGSISMVAIKKSNC  134

Query  520   YHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALS  699
             +HK+G   + C  S    + IFG  E+LLSQIP+FH L +LSI+AA+MSFGYSSIG+ LS
Sbjct  135   FHKYGHEAD-CKISNYQFMAIFGVTEILLSQIPDFHELSWLSILAAVMSFGYSSIGVGLS  193

Query  700   AVKIA-GGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ------  858
               KIA GG  V+TS+TG+ VGV+ +  +K+++TF A+GNIA A+ FS ++ +IQ      
Sbjct  194   IAKIAEGGHHVKTSLTGLVVGVDVTISEKLWNTFQAIGNIAFAYSFSTVIAEIQASIKFK  253

Query  859   ---DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEP  1029
                DTLKSSP E + MK++S IGI  +T FY LCG+LGY AFGN APGN LT   GFYEP
Sbjct  254   RTKDTLKSSPPENQVMKKSSLIGITISTIFYSLCGLLGYGAFGNKAPGNFLTG-FGFYEP  312

Query  1030  FWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSV  1209
             +WLVD+ N+ II+HLVGAYQV  QP+F+ VE W   RW     IT E+ +R P +G + +
Sbjct  313   YWLVDIGNLFIIIHLVGAYQVFAQPIFSIVESWVSKRWPQSKLITQEYDVRIPLVGTWRM  372

Query  1210  SLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSF  1389
             ++FR++WRT +V+ TT++AMIFPFFN I+GLLG+++F+PLT+YFP+EMY+ QA++P+ S 
Sbjct  373   NMFRVIWRTLYVIITTLIAMIFPFFNNIVGLLGAMSFFPLTVYFPIEMYLKQARVPKYSC  432

Query  1390  TWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              WI +++LS FC +V+++  V SI  +   +  +KPF
Sbjct  433   IWIRMKLLSGFCLIVTLVGVVASIQGIIVGLKTYKPF  469



>ref|XP_003563762.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=492

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 339/492 (69%), Gaps = 27/492 (5%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDED---------------GRSKRTGTVLTASAHIITAIIGS  228
             M K + +A   G G+     E+               G+ +RTGTV TASAHIITA+IGS
Sbjct  1     MTKDVEMAARNGNGNGAFAGENFAYELPGGDADFDDDGKPRRTGTVWTASAHIITAVIGS  60

Query  229   GVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAY  399
             GVLSLAWA AQLG V GP+ ++ F+ IT YT+ LLADCYR+ D   GKRNY+YMDAV +Y
Sbjct  61    GVLSLAWATAQLGWVVGPVTLMLFAAITYYTSGLLADCYRTGDPVTGKRNYTYMDAVASY  120

Query  400   LGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSIL  579
             L G QV  CGV QY  LVG +IGY ITA++S  AI + NCYHK+GR  + C       ++
Sbjct  121   LSGWQVWACGVFQYVNLVGTAIGYTITASISAAAINKANCYHKNGRAAD-CGVYDSMYMV  179

Query  580   IFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG  759
             +FG V++  SQ+PNFH LW+LSI+AA+MSF Y+SI + LS  +   G   +T++TG  VG
Sbjct  180   VFGVVQIFFSQVPNFHDLWWLSILAAIMSFTYASIAVGLSLAQTISGPTGKTTLTGTEVG  239

Query  760   VNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFF  939
             V+  +  K++  F ALG+IA A+ +S+ILI+IQDT+KS P E + MK+A+ +G+ + T F
Sbjct  240   VDVDSAQKIWLAFQALGDIAFAYSYSMILIEIQDTVKSPPAENKTMKKATLLGVSTTTAF  299

Query  940   YLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFV  1119
             Y+LCG LGY AFGN A GN+LT   GFYEP+WL+D ANVCI+VHLVGAYQV  QP+FA V
Sbjct  300   YMLCGCLGYAAFGNGAKGNILT-GFGFYEPYWLIDFANVCIVVHLVGAYQVFCQPIFAAV  358

Query  1120  ECWSRARWGGVWFITGEHTIRFPFLGN-----FSVSLFRLVWRTGFVVFTTVVAMIFPFF  1284
             E ++ ARW    FI  EH  R    GN     FS++ FRL WRT FVV +TV+A++ PFF
Sbjct  359   ETYAAARWPNAGFIVREH--RVSAAGNNKRFGFSLNFFRLTWRTAFVVVSTVLAILMPFF  416

Query  1285  NAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSIC  1464
             N ILG LG+I FWPLT+YFPVEMYI Q +I + +  W+ LQ LSF CF+VS+ AAV SI 
Sbjct  417   NDILGFLGAIGFWPLTVYFPVEMYIRQRRIHKYTTRWVALQTLSFLCFLVSLAAAVASIE  476

Query  1465  DLAKSVMHFKPF  1500
              + +S+ ++ PF
Sbjct  477   GVTESLKNYVPF  488



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 339/455 (75%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G ++GY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S  S +++FG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNSYMIVFGVTEILLSQVPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTMFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E  +  R+    F+T E  IR P L + +  ++
Sbjct  335   LDIANAAIVVHLVGAYQVFAQPIFAFIEKSAAERYPDNDFLTKEFEIRIPGLKSPYKANV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRVVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSAACLVISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_010915382.1| PREDICTED: amino acid permease 1-like [Elaeis guineensis]
Length=485

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/475 (54%), Positives = 334/475 (70%), Gaps = 9/475 (2%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             EM +  S A + GG +  + D+DGR KR+GTV TASAHIITA+IGSGVLSLAWA AQLG 
Sbjct  11    EMGEKRSSARDVGGLNREELDDDGRPKRSGTVWTASAHIITAVIGSGVLSLAWATAQLGW  70

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             +AGP+ ++ FS IT YT+ LLADCYR+ D   GKRNY+YM AV++ LGG QV  CG+ QY
Sbjct  71    IAGPVTLLLFSFITFYTSCLLADCYRTSDPISGKRNYTYMQAVKSNLGGTQVWLCGLCQY  130

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
               L G  IGY ITA++S  A+ ++NC+H  G   + C  S     ++FG V++ LSQ+PN
Sbjct  131   VNLFGVGIGYTITASISAAAVHKSNCFHAKGHEAD-CSVSDSLYTVVFGIVQIFLSQLPN  189

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             FH+LW+LSIVAA+MS  YS I + LS   I  G   +TS+TG  VGV+  +  K++    
Sbjct  190   FHKLWWLSIVAAVMSLAYSFIAVGLSTASIISGNTAKTSITGTEVGVDVDSSQKVWKACQ  249

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             ALG+IA A+ +S+ILI+IQDTL+S P E + MK+AS +G+ + T FY+LCG LGY AFGN
Sbjct  250   ALGDIAFAYSYSVILIEIQDTLRSPPAEVKVMKKASFMGVSTTTVFYVLCGCLGYAAFGN  309

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGNLLT   GF+EP+WL+D+ANVCI+VHLVGAYQV  QP+FA VE W   R      +
Sbjct  310   RAPGNLLT-GFGFFEPYWLIDVANVCIVVHLVGAYQVFSQPIFAAVEKWIAERCPNNKML  368

Query  1162  TGEHTIRFPFLGNF--SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             T EH  R    G+F  SV++FRL+WRT FVV +T++A + PFFN +L  LG+  FWPLT+
Sbjct  369   TYEH--RVTSNGHFGCSVNMFRLIWRTVFVVISTLLASMMPFFNDVLSFLGAAGFWPLTV  426

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YFP+ MYISQ  I R +  WI LQ +SF CFVV++ AA  SI  + KS+ H+ PF
Sbjct  427   YFPITMYISQKNIARFTPKWIVLQSISFLCFVVALAAACASIEGVIKSLRHYTPF  481



>emb|CDY57931.1| BnaA06g38000D [Brassica napus]
Length=466

 Score =   502 bits (1293),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/462 (56%), Positives = 334/462 (72%), Gaps = 9/462 (2%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE     D   D+DGR KRTGT++TASAHIITA+IGSGVLSLAWAIAQLG VAG + +V
Sbjct  12    AVESA---DANVDDDGREKRTGTLMTASAHIITAVIGSGVLSLAWAIAQLGWVAGTLILV  68

Query  295   AFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              F+V+  YT+ +LADCYRS  G RNY+YMD VR+YLGG +V+ CG+AQY  LVG +IGY 
Sbjct  69    TFAVVNYYTSTMLADCYRSDAGARNYTYMDVVRSYLGGRKVQLCGLAQYGCLVGVTIGYT  128

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             ITA++SL AI +  C+HK G G +  IP+    ++ FG VE+ LSQ+PNFH+L FLSI+A
Sbjct  129   ITASISLVAIWKATCFHKKGHGAKCSIPN-YPFMVAFGVVEIFLSQLPNFHKLSFLSIIA  187

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF Y+SIGI L+   +A G   +TSVTG  VGV+ +  DK++  F A G+IA ++ F
Sbjct  188   AIMSFSYASIGIGLAISVVASGKVGKTSVTGTVVGVDVTASDKIWKAFQATGDIAFSYSF  247

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             S IL    DTL+S+P E + MK+A+  G+ + T FY+LCG +GY AFGN APG+ LTD  
Sbjct  248   STIL----DTLRSNPPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPGDFLTD-F  302

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFYEP+WL++ AN CI++HL+ AYQV  QP+F  VE      W    FI  EH+I   FL
Sbjct  303   GFYEPYWLINFANACIVLHLIAAYQVFAQPIFQLVENKCNKAWPENNFIHKEHSINILFL  362

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
             G + ++ FRLVWRT +V+ TT VA+IFPFFN+ILGL+G+ AFWPLT+YFPVEM+ISQ K+
Sbjct  363   GKWRINFFRLVWRTAYVILTTFVAVIFPFFNSILGLIGATAFWPLTVYFPVEMHISQRKV  422

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              + S  W  L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  423   KKYSMKWNALKLLISVCLIVSLLAAIGSIVGLINSVKAYKPF  464



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   503 bits (1294),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 247/469 (53%), Positives = 335/469 (71%), Gaps = 7/469 (1%)
 Frame = +1

Query  103   SLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
              +SL +   GG +  +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG +AGP
Sbjct  17    DVSLGIPSKGGSEC-FDDDGRIKRTGTLWTASAHIITAVIGSGVLSLAWAIAQLGWIAGP  75

Query  283   IAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
               M  FS++T YT+ LL DCYR+ D   GKRNY+YMDAVR+ LGG +VK CG+ QY  L 
Sbjct  76    AVMFLFSLVTCYTSSLLTDCYRTGDPVSGKRNYTYMDAVRSILGGYKVKACGLIQYLNLC  135

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G S+GY I A++S+ AI R+NC+H+ G G   C  S    +++FG  E+LLSQIP+F ++
Sbjct  136   GISVGYTIAASVSMMAIKRSNCFHESG-GKNPCHMSSTPYMIMFGVTEILLSQIPDFDQI  194

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGN  813
             W+LSIVAA+MSF YS IG+ L   K+A     + S+TG+ VG   +   K++ +F ALG+
Sbjct  195   WWLSIVAAVMSFTYSGIGLGLGIAKVAATGTFKGSLTGISVG-TETQAQKIWRSFQALGD  253

Query  814   IALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPG  993
             IA A+ +S++LI+IQDT+KS P E + MK+A+ + I   T FY+LCG +GY +FG+ APG
Sbjct  254   IAFAYSYSIVLIEIQDTVKSPPAEAKTMKKATKLSIAITTAFYMLCGCMGYASFGDFAPG  313

Query  994   NLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEH  1173
             NLLT   GFY PFWL+D+AN  I++HLVGAYQV  QP+FAF+E W+  RW    FIT E 
Sbjct  314   NLLTG-FGFYNPFWLLDVANAAIVIHLVGAYQVFCQPIFAFIEKWATQRWAESNFITKEF  372

Query  1174  TIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEM  1353
              I  P    + ++LFRLVWRT FV+ TTV++M+ PFFN ++G++G+  FWPLT+YFP+EM
Sbjct  373   KIPIPGYHPYKLNLFRLVWRTAFVILTTVISMLIPFFNDVMGIMGAFGFWPLTVYFPLEM  432

Query  1354  YISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YI Q KI + S  WI L++LS  C +++++A  GSI  +   +  +KPF
Sbjct  433   YIQQKKILKWSTRWICLKMLSMACLLITIVAGAGSIAGVMLDLKVYKPF  481



>emb|CDP08191.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   502 bits (1293),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/470 (54%), Positives = 328/470 (70%), Gaps = 5/470 (1%)
 Frame = +1

Query  100   KSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAG  279
             ++    +E   G +L  D+DG+ KRTGTV TASAHIITAIIGSGVLSLAW +AQLG + G
Sbjct  12    EACEYGLEVQKGTNLLLDDDGKPKRTGTVWTASAHIITAIIGSGVLSLAWGVAQLGWIVG  71

Query  280   PIAMVAFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
                +V FS ITLYT+ LLADCYRSP+ GKRNY+YM+AV+  LGG     CG+ QYA L G
Sbjct  72    VTTLVVFSGITLYTSSLLADCYRSPETGKRNYTYMEAVKNNLGGKMYIACGMVQYANLYG  131

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
               IGY ITA++S+ AI +++C+HK G     C  S    ++  G +E+ LSQIPNFH+L 
Sbjct  132   TIIGYTITASISMAAIQKSDCFHKRGH-EASCSVSNNPYMIGLGILEIFLSQIPNFHKLS  190

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
              LSIVAA+MSF YSSIG+ L+  K+  G    T++TGV VG+N S  +K +  F A G+I
Sbjct  191   MLSIVAAIMSFSYSSIGMGLAFAKVISGKGERTTLTGVEVGINLSAAEKTWRMFRAFGDI  250

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ +S ILI+IQDTL+S P E + MK+A+ +G+ + T FY++CG  GY AFGN APGN
Sbjct  251   AFAYTYSQILIEIQDTLRSQPSENKVMKKANIMGVFTTTTFYMMCGCFGYAAFGNNAPGN  310

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
             LLT   GFYEPFWLVD+AN+CI+VHLVGAYQV  QP+F   E W+   W    F+T E+ 
Sbjct  311   LLT-GFGFYEPFWLVDMANICIVVHLVGAYQVFSQPLFGAFESWALWMWPNSKFVTEEYL  369

Query  1177  IRFPFLGN--FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
             I         FS S  RL+WRT FVV  TV+AM  PFFN IL LLG++ +WPLT+YFP++
Sbjct  370   ISIGGSAKYRFSTSFLRLIWRTLFVVLATVLAMAMPFFNDILALLGALGYWPLTVYFPIQ  429

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             MYI+Q K+ R S  WI LQ+++F C +V+V AA GS+  L+K +  FKPF
Sbjct  430   MYIAQKKVGRWSSRWIALQLINFICLLVAVAAACGSVQGLSKDLNAFKPF  479



>ref|XP_009107481.1| PREDICTED: amino acid permease 5-like [Brassica rapa]
Length=481

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 251/475 (53%), Positives = 340/475 (72%), Gaps = 8/475 (2%)
 Frame = +1

Query  88    AEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             +  +  +S+ V      DL +DEDGR KRTGTV TASAHIITA+IGSGVLSLAWA+AQ+G
Sbjct  7     SRQELGISIDVLPRNSSDL-FDEDGRVKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIG  65

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              V GP+ M+ FS++T YT+ LL  CYRS D   GKRNY+YMDA+ + LGG++VK CGV Q
Sbjct  66    WVGGPVVMILFSLVTYYTSILLCACYRSGDSDTGKRNYTYMDAIHSNLGGIKVKLCGVVQ  125

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             Y  L G +IGY I +A+S+ AI RT+C   +G   + C  +    ++ FGA++++ SQIP
Sbjct  126   YVNLFGTAIGYTIASAISMIAIQRTSCQQSNG-DKDPCHVNGNPYMIAFGAIQIIFSQIP  184

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             +F +LW+LSIVAALMSFGYS+IG+ L   ++    +++ ++TGV +G    T +K++ TF
Sbjct  185   DFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVAIGTVTPT-EKVWRTF  243

Query  799   SALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
              +LGNIA A+ +S+ILI+IQDTLK+ P E + M++A+ I +   T FY+LCG +GY AFG
Sbjct  244   QSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYMLCGCVGYAAFG  303

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             ++APGNLL    GF  P+WL+D+AN+ I++HLVGAYQV  QPVFAFVE  +  R+    F
Sbjct  304   DSAPGNLLAAG-GFRNPYWLLDIANLAIVIHLVGAYQVYCQPVFAFVEKEASKRYPESKF  362

Query  1159  ITGEHTIR-FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             IT E  I  FP    F+++LF+LVWRT FV+ TT+++MI PFFN +LGLLG+I FWPLT+
Sbjct  363   ITKETKIHIFPRSKPFNLNLFKLVWRTVFVITTTLISMIVPFFNDVLGLLGAIGFWPLTV  422

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YFPVEMYI Q  +PR S  W+ LQ+LS  C VVSV AA GS+  +   +  +KPF
Sbjct  423   YFPVEMYIVQKNVPRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLKSYKPF  477



>gb|KHG12273.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=452

 Score =   501 bits (1289),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 333/465 (72%), Gaps = 33/465 (7%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
             E G  +   D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA+AQLG V GP A+V FS
Sbjct  11    ENGDVNKNLDDDGRVKRTGTWVTASAHIITAVIGSGVLSLAWAVAQLGWVGGPAALVVFS  70

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              IT +T+ LLAD YR+PD   G+RNY+YMDAVRAYLGG +V+ CG+AQY  L G +IGY 
Sbjct  71    FITYFTSTLLADAYRAPDPVRGQRNYTYMDAVRAYLGGRKVQLCGLAQYMNLTGITIGYT  130

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             IT+++S+ A+ R+NC+HKHG   + C  S    ++IFG ++++LSQIPNF +L +LSI+A
Sbjct  131   ITSSISMVAVKRSNCFHKHGHQAK-CETSNYPFMVIFGCIQIVLSQIPNFAKLSWLSIIA  189

Query  655   ALMSFGYSSIGIALSAVKIAGGV-DVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             ++MSF YS IG+ LS  K+AGG  DV T++TGV VGV+ S  +K                
Sbjct  190   SVMSFAYSFIGLGLSIAKVAGGEEDVRTTLTGVIVGVDVSGSEK----------------  233

Query  832   FSLILIDIQDTLKSSP--RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLT  1005
                      DT+K SP   E ++MK+A++IG+ + T FYLLCG++GY AFGN APGN LT
Sbjct  234   ---------DTIKWSPVVPENKSMKRATAIGVSTTTIFYLLCGLVGYAAFGNDAPGNFLT  284

Query  1006  DDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRF  1185
                GFYEPFWL+D AN+CI +HL+GAYQV  QP+F FVE W   RW G  FIT E  +R 
Sbjct  285   G-FGFYEPFWLIDFANICIAIHLLGAYQVFAQPLFGFVEGWCSRRWPGNRFITSEQAVRV  343

Query  1186  PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQ  1365
             PF G + ++LFRLVWRT +V+ T  VAM+FPFFN  LGL+G+ +FWPL +YFP+E++I+Q
Sbjct  344   PFYGVYYINLFRLVWRTTYVIVTAFVAMLFPFFNNFLGLIGAGSFWPLVVYFPIEIHIAQ  403

Query  1366  AKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              K+ + SF W+WL+IL++ C +VS++AA  S+  L +S+  +KPF
Sbjct  404   TKMAKFSFKWMWLKILTWACLIVSLIAAAASVQGLIQSLQAYKPF  448



>emb|CDY53831.1| BnaA09g57230D [Brassica napus]
Length=481

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 260/471 (55%), Positives = 340/471 (72%), Gaps = 14/471 (3%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE  G +   +D+DGR KRTGT++TA+AHIITA+IGSGVLSLAWAIAQLG VAG + +V
Sbjct  12    AVETAGNN---FDDDGREKRTGTLMTATAHIITAVIGSGVLSLAWAIAQLGWVAGTVILV  68

Query  295   AFSVITLYTAFLLADCYRSPD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGY  471
              F+VI  +T+ +LADCYRSPD G RNY+YMD VRAYLGG +VK CG+AQY +LVG +IGY
Sbjct  69    TFAVINYFTSTMLADCYRSPDTGIRNYNYMDVVRAYLGGWKVKLCGLAQYGSLVGITIGY  128

Query  472   IITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
              ITA++SL AI + NC+H  G   + C  S    +  FG  +++LSQI NFH+L FLSI+
Sbjct  129   TITASISLVAIGKANCFHDKGHDAK-CSVSNYPLMAAFGITQIVLSQIHNFHKLSFLSII  187

Query  652   AALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFG  831
             A +MSF Y+SIGI L+   +A G   +T +TG  VGV+ +  DK++ +F A G+IA ++ 
Sbjct  188   ATVMSFSYASIGIGLALAALASGKVGKTDLTGTVVGVDVTASDKIWRSFQAAGDIAFSYA  247

Query  832   FSLILIDIQ--------DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAA  987
             FS++L++IQ        DTL+SSP E + MK+AS  G+ + T FY+LCG +GY AFGN A
Sbjct  248   FSVVLVEIQACILSIRDDTLRSSPPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQA  307

Query  988   PGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITG  1167
             PG+ LTD  GFYEP+WL+D AN CI VHL+ AYQV  QP+F F+E      W    FI  
Sbjct  308   PGDFLTD-FGFYEPYWLIDFANACIAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFIAK  366

Query  1168  EHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPV  1347
             +++I  P LG   ++ FRLVWR+ +V+ TTVVAMIFPFFNAILGL+G++ FWPLT+YFPV
Sbjct  367   DYSINIPLLGKCRINFFRLVWRSTYVILTTVVAMIFPFFNAILGLIGALTFWPLTVYFPV  426

Query  1348  EMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             EM+ISQ K+ + +  WI L++L   C VVS+LAAVGSI  L  SV  +KPF
Sbjct  427   EMHISQRKVKKYTMRWIGLKLLVLVCLVVSLLAAVGSIVGLISSVKAYKPF  477



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   503 bits (1295),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 338/489 (69%), Gaps = 10/489 (2%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             I  Y E E   ++QK  + A+         +D+DGR KRTGT  TA+AHIITA+IGSGVL
Sbjct  23    IRHYLEVEAQHKIQKEEAEAITIQSNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVL  82

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG   GP+ M  F+V+ LYT+ LL  CYR+ D   G+RNY+YMDAV++ LGG
Sbjct  83    SLAWAIAQLGWAVGPVVMFLFAVVNLYTSSLLTQCYRTDDSVTGQRNYTYMDAVKSILGG  142

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
              +VK CGV QY  L G +IGY I A++S+ AI R+NCYH+   G + C  S    ++ FG
Sbjct  143   KKVKICGVIQYVNLFGVAIGYTIAASVSMMAIKRSNCYHE-SHGKDPCHMSSNGYMITFG  201

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGV--  762
               EVLLSQIP+F ++W+LSIVAA+MSF YS++G+ L   K+A     + S+ G+ +G   
Sbjct  202   VAEVLLSQIPDFDQVWWLSIVAAIMSFTYSAVGLGLGVAKVAENRSFKGSLMGISIGTVT  261

Query  763   ---NHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSAT  933
                  +  +K++ +  ALG +A A+ FS+ILI+IQDT+KS P E + MK+A+ + I+  T
Sbjct  262   QAGTVTGTNKIWRSLQALGAMAFAYSFSIILIEIQDTIKSPPSEHKTMKKATMLSIMITT  321

Query  934   FFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFA  1113
              FY+LCG +GY AFG+  PGNLLT   GFY P+WL+D+AN  I+VHL+GAYQV  QP+FA
Sbjct  322   VFYILCGSMGYAAFGDHVPGNLLTG-FGFYNPYWLLDIANFAIVVHLIGAYQVFSQPLFA  380

Query  1114  FVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAI  1293
             FVE WS  +W    F+T E+ I  P  G + ++ FRL+WRT FV+ TT++AM+ PFFN +
Sbjct  381   FVEKWSARKWPKNNFVTAEYEIAIPCTGVYKLNFFRLIWRTIFVLLTTIIAMLLPFFNDV  440

Query  1294  LGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLA  1473
             +G+LG+  FWPLT+YFP++MYISQ KI R +  WI LQ+LS  C ++S+LAAVGSI  + 
Sbjct  441   VGILGAFGFWPLTVYFPIDMYISQKKIGRWTNKWIGLQMLSVCCLIISLLAAVGSIAGVV  500

Query  1474  KSVMHFKPF  1500
               +  +KPF
Sbjct  501   LDLKTYKPF  509



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   501 bits (1291),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 252/485 (52%), Positives = 343/485 (71%), Gaps = 13/485 (3%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             ++  + R+        +S+ V      DL +DEDGR KRTGTV TASAHIITA+IGSGVL
Sbjct  2     VENSKNRQELG-----ISIDVLPRNSSDL-FDEDGRVKRTGTVWTASAHIITAVIGSGVL  55

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWA+AQ+G V GP+ M+ FS++T YT+ LL  CYRS D   GKRNY+YMDA+ + LGG
Sbjct  56    SLAWAVAQIGWVGGPVVMILFSLVTYYTSILLCACYRSGDSVTGKRNYTYMDAIHSNLGG  115

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
             ++VK CGV QY  L G +IGY I +A+S+ AI RT+C   +G   + C  +    ++ FG
Sbjct  116   IKVKLCGVVQYVNLFGTAIGYTIASAISMIAIQRTSCQQSNG-DKDPCHVNGNPYMIAFG  174

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNH  768
             A++++ SQIP+F +LW+LSIVAALMSFGYS+IG+ L   ++    +++ ++TGV +G   
Sbjct  175   AIQIIFSQIPDFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVTIGTVT  234

Query  769   STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLL  948
              T +K++ TF +LGNIA A+ +S+ILI+IQDTLK+ P E + M++A+ I +   T FY+L
Sbjct  235   PT-EKVWRTFQSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYML  293

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG +GY AFG++APGNLL    GF  P+WL+D+AN+ I++HLVGAYQV  QP+FAFVE  
Sbjct  294   CGCVGYAAFGDSAPGNLLAAG-GFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVERE  352

Query  1129  SRARWGGVWFITGEHTIR-FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLL  1305
             +  R+    FIT E  I  FP    F+++LFRLVWRT FV+ TT+++MI PFFN +LGLL
Sbjct  353   ASKRYPESKFITKETKIHIFPGSKPFNLNLFRLVWRTVFVITTTLISMIMPFFNDVLGLL  412

Query  1306  GSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVM  1485
             G+I FWPLT+YFPVEMYI Q  +PR S  W+ LQ+LS  C VVSV AA GS+  +   + 
Sbjct  413   GAIGFWPLTVYFPVEMYIVQKNVPRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLK  472

Query  1486  HFKPF  1500
              +KPF
Sbjct  473   SYKPF  477



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   502 bits (1293),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 253/489 (52%), Positives = 342/489 (70%), Gaps = 12/489 (2%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             I  Y E E   + + S S A+         +D+DGR KRTG   T+S+HIITA+IGSGVL
Sbjct  23    IRHYLEVE--VQPKVSESEAINPQSNYSKCFDDDGRLKRTGNFWTSSSHIITAVIGSGVL  80

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG VAGP  MV F+ + LYT+ LLA CYRS D   G+RNY+YMDAV++YLGG
Sbjct  81    SLAWAIAQLGWVAGPAVMVLFAFVNLYTSNLLAQCYRSGDPVTGQRNYTYMDAVKSYLGG  140

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
              +V  CG+ QY  L G +IGY I A++S+ AI R+NC+H  G G + C  S    ++ FG
Sbjct  141   RKVMLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHSSG-GKDPCHMSCNGFMITFG  199

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNH  768
              +E+L SQIP+F ++W+LSIVAA+MSF YS++G+ L   K+AG    + S+TG+ +G   
Sbjct  200   IIEILFSQIPDFDQVWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGTFKGSLTGISIGTET  259

Query  769   -----STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSAT  933
                  ++  K++ +  ALG IA A+ FS+ILI+IQDT++S P E + MK+A+   I++ T
Sbjct  260   HAGPVTSTQKLWRSLQALGAIAFAYSFSVILIEIQDTIRSPPAEYKTMKKATLFSIITTT  319

Query  934   FFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFA  1113
              FYLLCG +GY AFG+ APGNLLT   GFY P+WL+D+ANV I VHLVGAYQV  QP+FA
Sbjct  320   IFYLLCGCMGYAAFGDLAPGNLLTG-FGFYNPYWLLDIANVAIFVHLVGAYQVYCQPLFA  378

Query  1114  FVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAI  1293
             FVE WS  +W    F+T E+ +  PF G + ++ FRLVWRT FV+ TT++AM+ PFFN +
Sbjct  379   FVEKWSARKWPQSNFVTAEYEVPIPFYGVYQLNFFRLVWRTIFVMLTTLIAMLMPFFNDV  438

Query  1294  LGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLA  1473
             +GLLG++ FWPLT++FP+EMYISQ KI R +  WI LQILS  C V+++ AAVGS+  + 
Sbjct  439   VGLLGALGFWPLTVFFPIEMYISQKKIGRWTNQWIGLQILSMTCLVITIAAAVGSVAGVV  498

Query  1474  KSVMHFKPF  1500
               +  ++PF
Sbjct  499   LDLKTYRPF  507



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 338/469 (72%), Gaps = 9/469 (2%)
 Frame = +1

Query  103   SLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
             + SL   +  G+ + +D+DGR KRTG+V TAS+HIITA+IGSGVLSLAWAIAQLG +AGP
Sbjct  9     TTSLRTFDIEGELISHDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGWIAGP  68

Query  283   IAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
               M+ FS++T+ T+  LADCYR+ D   GKRNY+YMDAVR+ LGG +V FCG+ QY  L 
Sbjct  69    AVMILFSLVTVSTSSFLADCYRAGDPHSGKRNYTYMDAVRSILGGAKVTFCGIFQYLNLF  128

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G  IGY I A++S+ AI ++NC+H+HG  +  C  S    +++FG +++ LSQIP+F ++
Sbjct  129   GIVIGYTIAASISMTAIKKSNCFHQHGDKSP-CHMSSNLYMIMFGVIQIFLSQIPDFDQI  187

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGN  813
             W+LS VAA+MSF YS IG+AL   K+A    +  S+TG+ +G    T+ K++ T  ALGN
Sbjct  188   WWLSSVAAVMSFTYSLIGLALGIAKVAENGTILGSLTGISIGAVSETQ-KIWRTSQALGN  246

Query  814   IALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPG  993
             IA A+ ++++LI+IQDTLKS P E ++MK+A+ I I   T FY+LCG +GY AFG+ APG
Sbjct  247   IAFAYSYAVVLIEIQDTLKSPPSEAKSMKKATKISIAVTTVFYMLCGCMGYAAFGDDAPG  306

Query  994   NLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEH  1173
             NLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAFVE  +  RW     I  E+
Sbjct  307   NLLTG-FGFYNPYWLIDIANAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPN---IEKEY  362

Query  1174  TIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEM  1353
              I  P L  + ++LFR++WRT FV  TTV++M+ PFFN I+G++G++ FWPLT+YFPVEM
Sbjct  363   KIELPCLPPYKLNLFRMLWRTVFVTLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEM  422

Query  1354  YISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YI+Q KIP+ +  WI LQI SF C VVS+ AAVGSI  +   +  + PF
Sbjct  423   YIAQKKIPKWNKKWICLQIFSFACLVVSIAAAVGSIAGVLVDLKKYTPF  471



>ref|XP_008658969.1| PREDICTED: uncharacterized protein LOC100501686 isoform X1 [Zea 
mays]
 gb|AFW86931.1| hypothetical protein ZEAMMB73_950309 [Zea mays]
Length=486

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 329/460 (72%), Gaps = 10/460 (2%)
 Frame = +1

Query  130   GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVI  309
             GG+ L  D+DG+ KRTGTV TASAHIITA+IGSGVLSLAW+ AQLG V GP+ ++ F++I
Sbjct  30    GGETL--DDDGKKKRTGTVWTASAHIITAVIGSGVLSLAWSTAQLGWVVGPLTLMIFALI  87

Query  310   TLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
             T YT+ LLADCYRS D   GKRNY+YMDAV AYLG  QV  CGV QY  LVG ++GY IT
Sbjct  88    TYYTSSLLADCYRSGDQLTGKRNYTYMDAVAAYLGRWQVLSCGVFQYVNLVGTAVGYTIT  147

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A++S  A+ + NC+H  G   + C       +++FG V++  SQ+PNF  L +LSIVAA+
Sbjct  148   ASISAAAVHKANCFHNKGHAAD-CSTYDTMYMVVFGIVQIFFSQLPNFSDLSWLSIVAAI  206

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSF YSSI + LS  +   G    T++TG  +GV+  +  K++    ALGNIA A+ +S+
Sbjct  207   MSFSYSSIAVGLSLARTISGRSGTTTLTGTEIGVDVDSAQKVWLALQALGNIAFAYSYSM  266

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             ILI+IQDT+KS P E + MK+A+ +G+ + T FY+L G LGY AFGNAAPGN+LT   GF
Sbjct  267   ILIEIQDTVKSPPAENKTMKKATLMGVTTTTAFYMLAGCLGYSAFGNAAPGNILT-GFGF  325

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN  1200
             YEP+WL+D ANVCI+VHLVGAYQV  QP+FA +E  +  RW    F+T EH +     G 
Sbjct  326   YEPYWLIDFANVCIVVHLVGAYQVFSQPIFAALETAAAKRWPNARFVTREHPL---VAGR  382

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             F V+L RL WRT FVV +TV+A++ PFFN ILG LG+I FWPLT+Y+PVEMYI Q +I +
Sbjct  383   FHVNLLRLTWRTAFVVVSTVLAIVLPFFNDILGFLGAIGFWPLTVYYPVEMYIRQRRIQK  442

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              +  W+ LQ+LSF CF+VS+ +AV SI  + +S+ H+ PF
Sbjct  443   YTSRWVALQLLSFLCFLVSLASAVASIEGVTESLKHYVPF  482



>gb|KHG13110.1| Amino acid permease 6 -like protein [Gossypium arboreum]
 gb|KHG26079.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=433

 Score =   499 bits (1285),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 333/479 (70%), Gaps = 62/479 (13%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGD----DLK--YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWA  252
             +MQK+ S+ +E+  GD    D++   D+DGR KRTGT +TASAHIITA+IGSGVLSLAWA
Sbjct  4     QMQKT-SMFIEQSPGDYENGDIQKNLDDDGRPKRTGTWVTASAHIITAVIGSGVLSLAWA  62

Query  253   IAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKF  423
             IAQLG VAGP  ++AFS IT +T+ LLADCYR+PD   GKRNY+YMD VRAYLGG +V+ 
Sbjct  63    IAQLGWVAGPAVLMAFSFITYFTSTLLADCYRAPDPVHGKRNYTYMDVVRAYLGGRKVQL  122

Query  424   CGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVL  603
             CG+AQYA LVG +IGY ITA++S+                                    
Sbjct  123   CGLAQYANLVGITIGYTITASISM------------------------------------  146

Query  604   LSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDK  783
                      L +LSIVAA+MSF YSSIG+ LS  K+AGG  V TS+TGV VGV+ S  +K
Sbjct  147   ---------LSWLSIVAAIMSFAYSSIGLGLSIAKVAGGEHVRTSLTGVTVGVDVSGSEK  197

Query  784   MFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILG  963
             ++ TF A+G+IA A+ +S       DT+KSSP E ++MK+ASSIG+ + T FY+LCG++G
Sbjct  198   VWRTFQAIGDIAFAYAYS------TDTIKSSPPENKSMKRASSIGVSTTTLFYVLCGLIG  251

Query  964   YLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARW  1143
             Y AFGN APGN LT   GFYEPFWL+D AN+CI +HL+GAYQV  QP+F FVE W    W
Sbjct  252   YAAFGNDAPGNFLTG-FGFYEPFWLIDFANICIAIHLIGAYQVFAQPLFGFVEGWCSRNW  310

Query  1144  GGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFW  1323
                 FIT EH +  PF G + ++ FRLVWRT +V+ T VVAMIFPFFN  LGL+G+ +FW
Sbjct  311   PNSKFITSEHAVDVPFYGIYYLNFFRLVWRTAYVIITAVVAMIFPFFNDFLGLIGAGSFW  370

Query  1324  PLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PLT+YFP+EM+I+Q+K P+ SF WIWL+ILS+ C VVS++AA GS+  L +S+  +KPF
Sbjct  371   PLTVYFPIEMHIAQSKTPKYSFRWIWLKILSWVCLVVSLIAAAGSVQGLIQSLKTYKPF  429



>ref|XP_010691537.1| PREDICTED: amino acid permease 6-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   502 bits (1292),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 334/460 (73%), Gaps = 3/460 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
             E G + +  D+DGR+KRTG VLTASAHIITA+IGSGVLSLAWA+AQ+G +AGP+ ++ FS
Sbjct  50    EHGNNTIDVDDDGRNKRTGNVLTASAHIITAVIGSGVLSLAWAVAQMGWIAGPVVLLIFS  109

Query  304   VITLYTAFLLADCYRSP-DGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIIT  480
              +T + + L ADCYR+P  GKR+Y+Y +AVR+ LGG + K C +AQY+  VG SIGY IT
Sbjct  110   FVTWFASTLQADCYRNPVTGKRHYTYREAVRSILGGRKYKLCALAQYSNFVGVSIGYTIT  169

Query  481   AAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAAL  660
             A++S+ A+ R  C+H HG    GC       I+IFG ++++LSQ+PNFH+L +LSIV+A 
Sbjct  170   ASISMAAVKRAICFHYHGH-EAGCHTQNNPYIIIFGVLQIILSQLPNFHKLSWLSIVSAA  228

Query  661   MSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSL  840
             MSFGYS IGI L+  K+A G    TS+TGV VG + +   K ++  +A+GN+A A+ FS+
Sbjct  229   MSFGYSFIGIGLAVAKVATGSKPRTSLTGVEVGRDVTGSQKTWNIMTAMGNMAFAYAFSM  288

Query  841   ILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGF  1020
             +LI+IQDTLK +P E   MK+A S G+   TFFY+LCG++GY AFGN APGN LT   GF
Sbjct  289   VLIEIQDTLKPNPPENVVMKKAISFGVWITTFFYMLCGVVGYAAFGNDAPGNFLTG-FGF  347

Query  1021  YEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN  1200
             YEP+WLV LANV I VHLVGAYQV VQP+F FVE      W    FIT E+ ++ PF G 
Sbjct  348   YEPYWLVALANVFIAVHLVGAYQVFVQPLFNFVETQCSTAWPENKFITEEYPVKLPFYGV  407

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             +  +  R+ WRT +V+  T++AMIFPFFN I+GL+G+ +FWPLTIYFP++MYI+Q K+ +
Sbjct  408   YHFNFLRVGWRTIYVIIVTIIAMIFPFFNDIVGLMGAFSFWPLTIYFPIQMYIAQGKVRK  467

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S +WI LQILSF C +VS+LAA+ SI  L   V + KPF
Sbjct  468   YSSSWIRLQILSFGCLIVSILAAIASIRGLIVGVSNLKPF  507



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/454 (55%), Positives = 333/454 (73%), Gaps = 7/454 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             YD+DGR KRTGT+ TAS+HIITA+IGSGVLSLAWAIAQLG +AGP  M  FS++T YT+ 
Sbjct  40    YDDDGRLKRTGTLWTASSHIITAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSS  99

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   G+RNY+YMDAV++ LG V+V  CG+ QY  L G +IGY I +++S+ 
Sbjct  100   LLTDCYRTGDPYTGERNYTYMDAVQSILG-VKVNLCGLVQYIGLFGIAIGYTIASSISMM  158

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQIP+F +LW+LSIVAA+MSF YS
Sbjct  159   AIKRSNCFHQSG-GQNPCHISSNPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYS  217

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+ L   K+A     + S+TG+ +G    T +K++ +F ALG IA A+ +S+ILI+IQ
Sbjct  218   SIGLGLGIGKVAVNGTFKGSLTGISIGTVTET-EKIWRSFQALGAIAFAYSYSVILIEIQ  276

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT+KS P E + MK+A+ I I+  T FY+LCG +GY AFG  APGNLLT   GFY P+WL
Sbjct  277   DTIKSPPAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTG-FGFYNPYWL  335

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+ANV I++HL+GAYQV  QP+FAF+E W+  +W   +FIT E  I  P    ++++LF
Sbjct  336   IDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFRPYNLNLF  395

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWRT FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q KIP+ S  WI
Sbjct  396   RLVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWI  455

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   +  +KPF
Sbjct  456   CLQMLSMACLVISLVAVAGSIAGVVLDLKAYKPF  489



>ref|XP_009148320.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=470

 Score =   500 bits (1287),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +1

Query  115   AVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             AVE     D   D+DGR KRTGT++TASAHIITA +GSG L +AW I  LG VAG + +V
Sbjct  12    AVESA---DANVDDDGREKRTGTLMTASAHIITAGVGSGALLVAWGITPLGWVAGTLILV  68

Query  295   AFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              F+V+  YT+ +LADCYRS  G RNY+YMD VR+YLGG +V+ CG+AQY  LVG +IGY 
Sbjct  69    TFAVVNYYTSTMLADCYRSDAGARNYTYMDVVRSYLGGRKVQLCGLAQYGCLVGVTIGYT  128

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             ITA++SL AI +  C+HK G G +  IP+    ++ FG VE+ LSQ+PNFH+L FLSI+A
Sbjct  129   ITASISLVAIWKATCFHKKGHGAKCSIPN-YPFMVAFGVVEIFLSQLPNFHKLSFLSIIA  187

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF Y+SIGI L+   +A G   +TSVTG  VGV+ +  DK++  F A G+IA ++ F
Sbjct  188   AIMSFSYASIGIGLAISVVASGKVGKTSVTGTVVGVDVTASDKIWKAFQATGDIAFSYSF  247

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             S IL++IQDTL+SSP E + MK+A+  G+ + T FY+LCG +GY AFGN APG+ LTD  
Sbjct  248   STILVEIQDTLRSSPPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPGDFLTD-F  306

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFYEP+WL++  N CI +HL+ AYQV  QP+F  VE      W    FI  EH+I  PFL
Sbjct  307   GFYEPYWLINFDNACIDLHLMAAYQVFAQPIFQLVENKCNKAWPENNFINKEHSINIPFL  366

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
             G + ++ FRLVWRT +V+ TT VA+IFPFFN+ILGL+G+ AFWPLT+YFPVEM+ISQ K+
Sbjct  367   GKWRINFFRLVWRTAYVILTTFVAVIFPFFNSILGLIGATAFWPLTVYFPVEMHISQRKV  426

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              + S  W  L++L   C +VS+LAA+GSI  L  SV  +KPF
Sbjct  427   KKYSMKWNALKLLISVCLIVSLLAAIGSIVGLINSVKAYKPF  468



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 333/460 (72%), Gaps = 13/460 (3%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M+ FS +T YT+ 
Sbjct  19    FDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSA  78

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   GKRNY+YMDAV A L GV+V FCG  QYA +VG +IGY I A++S+ 
Sbjct  79    LLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASISML  138

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R NC+H  G G + C  S    ++IFG V++  SQIP+F ++ +LSI+AA+MSF YS
Sbjct  139   AIQRANCFHVEGHG-DPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTYS  197

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   ++     V+ S+TG+ VG+  +  DKM+ +  A G+IA A+ +SLILI+IQ
Sbjct  198   TIGLGLGIAQVVSNKGVQGSLTGISVGLV-TPVDKMWRSLQAFGDIAFAYSYSLILIEIQ  256

Query  859   DTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFW  1035
             DT+++ P  E + M++A+ + +   TFFY+LCG +GY AFG+ APGNLLT   GFYEPFW
Sbjct  257   DTIRAPPPSESKVMRRATVVSVAVTTFFYMLCGCMGYAAFGDNAPGNLLTG-FGFYEPFW  315

Query  1036  LVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-----  1200
             L+D+AN  I VHLVGAYQV  QP+FAFVE W+R RW    +ITGE  +  P LG      
Sbjct  316   LLDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLP-LGTAGGRC  374

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             + +SLFRL WRT FVV TTVV+M+ PFFN ++GLLG++ FWPLT+YFPVEMYI Q K+PR
Sbjct  375   YKLSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPR  434

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S  W+ LQ+LS  C V++V +A GS+  +   +  +KPF
Sbjct  435   WSTRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPF  474



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 343/469 (73%), Gaps = 9/469 (2%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             +S+ V      DL +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWA+AQLG VAGP 
Sbjct  13    VSIDVLPKSSSDL-FDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAMAQLGWVAGPA  71

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              M  FS++T YT+ LL+ CYRS D   GKRNY+YMDAV+A LGGV+VK CG+ QY  L G
Sbjct  72    VMFLFSLVTYYTSILLSSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGLVQYLNLFG  131

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              +IGY I +A+S+ AI R+NC+H+   G + C  +    ++ FG  +++ SQIP+F +LW
Sbjct  132   TAIGYTIASAISMIAIQRSNCHHR-SHGKDPCHINGNPYMIAFGVAQIVFSQIPDFDQLW  190

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             +LSI+AA+MSF YSSIG+AL   K+    +V+ S+TG+ +G   +   K++ +F ALGN+
Sbjct  191   WLSILAAVMSFTYSSIGLALGISKVTENKEVKGSLTGIGLG-TVTPAQKVWRSFQALGNV  249

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ +S+ILI+IQDTLKSSP E + M++A+ I +   T FY+LCG +GY AFG+ +PGN
Sbjct  250   AFAYSYSVILIEIQDTLKSSPAEEKTMRKATLISVAVTTMFYMLCGCIGYAAFGDMSPGN  309

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
             LL+   GF+ P+WL+D+AN+ I++HLVGAYQV  QP+FAFVE  +  R+    FIT E  
Sbjct  310   LLSG--GFFSPYWLLDIANLTIVIHLVGAYQVYCQPLFAFVEKQASKRFPDSKFITKEIK  367

Query  1177  IRF-PFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEM  1353
             IRF P L  ++++LFRLVWRT FV+ TT+++M+ PFFN +LGLLG+I FWPLT+YFPVEM
Sbjct  368   IRFFPGLKPYNLNLFRLVWRTFFVILTTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEM  427

Query  1354  YISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YIS  +I R S  W+ LQIL+  C VV+V++A GS+  +   +  +KPF
Sbjct  428   YISHNRIQRWSTRWVCLQILNLACLVVTVVSAAGSVVGVMTDLNTYKPF  476



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 339/469 (72%), Gaps = 9/469 (2%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             +S+ V      DL +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWA+AQLG VAGP 
Sbjct  13    VSMDVLPKNRSDL-FDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPA  71

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
              M  FS++T YT+ LL  CYRS D   GKRNY+YMDAV+A LGGV+VK CG+ QY  L G
Sbjct  72    VMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGLVQYLNLFG  131

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              +IGY I +A+S+ AI R+NC+HK   G + C  +    ++ FG  +++ SQIP+F RLW
Sbjct  132   TAIGYTIASAVSMIAIQRSNCHHK-SHGKDPCHINGNPYMIAFGVAQIVFSQIPDFDRLW  190

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             +LSIVAA+MSF YSSIG+AL   K+A   +++ S+TG+ VG    ++ K++ +F ALGNI
Sbjct  191   WLSIVAAVMSFMYSSIGLALGVSKVAENKEIKGSLTGIGVGTVTPSQ-KVWRSFQALGNI  249

Query  817   ALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGN  996
             A A+ +S+ILI+IQDTLKS P E + M++A+ I +   T FY+LCG +GY AFG+ +PGN
Sbjct  250   AFAYSYSMILIEIQDTLKSPPVEEKTMRKATLISVAVTTLFYMLCGCIGYAAFGDTSPGN  309

Query  997   LLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHT  1176
             LL+   GF+ P+WL+D+AN+ I++HLVGAYQV  QP+FAFVE  +  R+     IT E  
Sbjct  310   LLSG--GFFNPYWLIDIANLTIVIHLVGAYQVYCQPLFAFVENQASKRFPDSKLITKEIK  367

Query  1177  IR-FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEM  1353
             IR FP    ++++LFRLVWRT FV+ TT+++M+ PFFN +LG LG+I FWPLT+YFPVEM
Sbjct  368   IRLFPGREPYNLNLFRLVWRTLFVILTTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEM  427

Query  1354  YISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YI   +I R S  W+ LQ+LSF C VV++ +A GS+  +   +  +KPF
Sbjct  428   YIEHKRIQRWSTRWVCLQVLSFACLVVTLASAAGSVVGIVTDLKTYKPF  476



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
              G G+   +D+DGR KR+G+V TASAHIITA+IGSGVLSLAWA AQLG VAGP  ++ FS
Sbjct  17    NGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPAVLLLFS  76

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              +T YT+ LLADCYRS D   GKRNY+YMDAVRA LGG+QVK CGV QY  L G ++GY 
Sbjct  77    FVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYT  136

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             I +++S+ A+ R++C+HKHG     C  S    +++FG +E+L SQIP+F ++W+LSIVA
Sbjct  137   IASSISMMAVKRSDCFHKHGH-RAACNVSSTPYMIMFGVMEILFSQIPDFDQIWWLSIVA  195

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF YS+IG+ L   ++A    ++ S+TG+ +G   +   K++ +F ALG IA A+ +
Sbjct  196   AVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGTEVTEMQKIWRSFQALGAIAFAYSY  255

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             SLILI+IQDTLK+ P E + MK+A+ + +   T FY+LCG  GY AFG+ +PGNLLT   
Sbjct  256   SLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLT-GF  314

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFY P+WL+D+ANV I+VHLVGAYQV  QP+FAFVE  +   +    FIT E  +  P  
Sbjct  315   GFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKELDVPIPGF  374

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
               F ++LFRLVWRT FV+ TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI Q KI
Sbjct  375   KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKI  434

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ S  WI LQILS  C V+S+ AA GS   +   +  ++PF
Sbjct  435   PKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPF  476



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/454 (55%), Positives = 330/454 (73%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR  RTGTV TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M  FS +T YT+ 
Sbjct  31    FDDDGRLNRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSFLTYYTSS  90

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  91    LLTDCYRTADPVSGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASISMM  150

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG +E+ LSQIP+F ++W+LSIVAA+MSF YS
Sbjct  151   AIKRSNCFHESG-GNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTYS  209

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ +F ALG+IA A+ +S+ILI+IQ
Sbjct  210   AIGLALGIVQVAANGAFKGSLTGISIGTVTQTQ-KIWRSFQALGDIAFAYSYSVILIEIQ  268

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DTLKS P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PFWL
Sbjct  269   DTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPFWL  327

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I+VHLVGAYQV  QP+FAFVE      W   +F++ E  I  P L  + ++LF
Sbjct  328   LDIANSAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLF  387

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWR+ FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI+Q KI + S  W+
Sbjct  388   RLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWM  447

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   V  + PF
Sbjct  448   CLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPF  481



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/454 (55%), Positives = 330/454 (73%), Gaps = 6/454 (1%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR  RTGTV TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M  FS +T YT+ 
Sbjct  29    FDDDGRLNRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMFLFSFLTYYTSS  88

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL DCYR+ D   GKRNY+YMDAVR+ LGG +VK CG+ QY  L G +IGY I A++S+ 
Sbjct  89    LLTDCYRTADPVSGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASISMM  148

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG +E+ LSQIP+F ++W+LSIVAA+MSF YS
Sbjct  149   AIKRSNCFHESG-GNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTYS  207

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ +F ALG+IA A+ +S+ILI+IQ
Sbjct  208   AIGLALGIVQVAANGAFKGSLTGISIGTVTQTQ-KIWRSFQALGDIAFAYSYSVILIEIQ  266

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DTLKS P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY PFWL
Sbjct  267   DTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTG-FGFYNPFWL  325

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLF  1218
             +D+AN  I+VHLVGAYQV  QP+FAFVE      W   +F++ E  I  P L  + ++LF
Sbjct  326   LDIANSAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLF  385

Query  1219  RLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWI  1398
             RLVWR+ FV+ TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI+Q KI + S  W+
Sbjct  386   RLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWM  445

Query  1399  WLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              LQ+LS  C V+S++A  GSI  +   V  + PF
Sbjct  446   CLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPF  479



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   499 bits (1286),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 338/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS++TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L   +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFVIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    +++FG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E     R+    F++ E  IR P F   + V++
Sbjct  335   LDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRMVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+L+  C V+SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLTVACLVISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_009118275.1| PREDICTED: amino acid permease 8-like isoform X1 [Brassica rapa]
Length=480

 Score =   499 bits (1285),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 241/421 (57%), Positives = 310/421 (74%), Gaps = 2/421 (0%)
 Frame = +1

Query  109   SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIA  288
             S  VE G G     D+D R KRTGT++TASAHIIT +IGSGVLSLAWAIAQLG V G + 
Sbjct  7     SSVVESGAGAGNNVDDDCREKRTGTLITASAHIITTVIGSGVLSLAWAIAQLGWVVGTVI  66

Query  289   MVAFSVITLYTAFLLADCYRSPDGKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             +VAF+VI  YT+ +LAD YRSP+G RNY+YMD VR YLGG +V+ CG+AQ+ +LVG +IG
Sbjct  67    LVAFAVIVNYTSRMLADSYRSPEGTRNYTYMDVVRVYLGGRKVQLCGLAQFGSLVGVTIG  126

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y ITA++SL AI + NC+H  G G + C  S    +  FG V++ LSQIPNFH+L FLSI
Sbjct  127   YTITASISLVAIGKANCFHDKGHGAK-CSVSNYPLMAAFGIVQIFLSQIPNFHKLSFLSI  185

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             +A +MSF Y+SIG  L+   +A G   +T +TG  VGV+ +  DK++ +F A GNIA ++
Sbjct  186   IATVMSFSYASIGFGLALAALASGKVGKTGLTGTVVGVDVTASDKLWKSFQAAGNIAFSY  245

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S++L++IQDTL+SSP E + MK+AS   + + T FY+LCG +GY  FGN APG+ LT 
Sbjct  246   AYSVVLVEIQDTLRSSPPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLT-  304

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
             D GFYEP+WL+D AN CI VHL+GAYQV  QP+F FVE      W    FIT EH++  P
Sbjct  305   DFGFYEPYWLIDFANACIAVHLIGAYQVFAQPIFQFVEKKCNQAWPESNFITKEHSMNIP  364

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
              LG   ++ FRLVWRT +V+F+TVVAMIFPFFNAILGL+G++AFWPLT+YFPVEM+ISQ 
Sbjct  365   LLGKCRINFFRLVWRTTYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYFPVEMHISQK  424

Query  1369  K  1371
             K
Sbjct  425   K  425



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   499 bits (1286),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 330/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT  TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M+ F+ +  YT+ 
Sbjct  33    HDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTST  92

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   G RNY+YMDAV AYLGG++VK CG  QYA L G +IGY I A++S+ 
Sbjct  93    LLADCYRSEDPITGPRNYTYMDAVHAYLGGLKVKMCGFIQYANLFGVAIGYTIAASISMM  152

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G     C  +    ++ FG +E++ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  153   AIRRSNCFHEKGHKNP-CHVNSNPYMIAFGVLEIIFSQIPDFDQIWWLSIVAAVMSFTYS  211

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             SIG+ L  V+       + S+TG+ +G    T+ K++ +  ALG+IA A+ FS+ILI+IQ
Sbjct  212   SIGLTLGIVQTIENKGFKGSLTGISIGAVTETQ-KVWHSLQALGDIAFAYSFSIILIEIQ  270

Query  859   DTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFW  1035
             DT+K+ P  E + MK+A+ + I+  TFFY+LCG +GY AFG+ APGNLLT   GFY PFW
Sbjct  271   DTIKAPPPSEAKVMKKATLLSIVVTTFFYMLCGCMGYAAFGDEAPGNLLTG-FGFYNPFW  329

Query  1036  LVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSL  1215
             L+D+AN  I+VHL+GAYQV  QP+FAF+E W+   W    FIT E  I      +++++L
Sbjct  330   LLDIANTAIVVHLIGAYQVFCQPLFAFIEKWALQTWPKSTFITKEMRISLTSTKSYNLNL  389

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FRLVWR+ FVV TT+++M+ PFFN I+GLLG+++FWPLT+YFP+EMY+ Q K+PR S  W
Sbjct  390   FRLVWRSAFVVLTTIISMLLPFFNDIVGLLGALSFWPLTVYFPIEMYVVQKKVPRWSTRW  449

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQILS  C +VS+ AA GSI  +   +  ++PF
Sbjct  450   VCLQILSVACLIVSIAAATGSIAGVVTDLKVYRPF  484



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   499 bits (1286),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 336/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+LLSQIP+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTMFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E     R+    F T E  I+ P L + +  ++
Sbjct  335   LDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPGLRSPYKANV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRIVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V++V+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSVACLVITVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_008662536.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW56241.1| hypothetical protein ZEAMMB73_107595 [Zea mays]
Length=480

 Score =   498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 338/471 (72%), Gaps = 12/471 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
             L ++VE G G   ++ D+DGR +RTGT  TASAHI+TA+IGSGVLSLAWAIAQLG VAGP
Sbjct  16    LEVSVEAGNGGAAEWLDDDGRPRRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGWVAGP  75

Query  283   IAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
              AM+ F+ +T YTA LLA+CYR+ D   GKRNY+YMDAVR+ LGG +V FCGV QYA LV
Sbjct  76    AAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVAFCGVIQYANLV  135

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G +IGY I A++S++A+ R  C+H HG   + C  S    +++FG V++L SQIP+F ++
Sbjct  136   GVAIGYTIAASISMKAVRRAGCFHAHGHA-DPCNSSSTPYMILFGVVQILFSQIPDFDQI  194

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGN  813
             W+LSIVAA+MSF YSSIG++L   +         S+TG+ +G   ++  K++ T  A G+
Sbjct  195   WWLSIVAAVMSFTYSSIGLSLGIAQTISNGGFMGSLTGISIGAGVTSTQKIWHTLQAFGD  254

Query  814   IALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             IA A+ FS ILI+IQDT+K+ P  E + M++A+ + + + T FY+LCG +GY AFG+ AP
Sbjct  255   IAFAYSFSNILIEIQDTIKAPPPSESKVMQKATRLSVATTTIFYMLCGCMGYAAFGDKAP  314

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
              NLLT   GF+EPFWL+D+ANV I+VHLVGAYQV  QP+FAFVE  + A W    F++ E
Sbjct  315   DNLLTG-FGFFEPFWLIDIANVAIVVHLVGAYQVFCQPIFAFVERRAAAAWPDSAFVSQE  373

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
               +     G F+VS+FRL WR+ FV  TTVVAM+ PFF  ++G LG+++FWPLT+YFPVE
Sbjct  374   LRV-----GPFAVSVFRLTWRSSFVCVTTVVAMLLPFFGNVVGFLGAVSFWPLTVYFPVE  428

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             MYI Q ++PR S  WI LQ LS  C +VSV AA GSI D+  ++  ++PF+
Sbjct  429   MYIKQRRVPRGSTKWICLQTLSVSCLLVSVAAAAGSIADVIDALKVYRPFS  479



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
              G G+   +D+DGR KR+G+V TASAHIITA+IGSGVLSLAWA AQLG +AGP  ++ FS
Sbjct  15    NGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFS  74

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              +T YT+ LLADCYRS D   GKRNY+YMDAVRA LGG+QVK CGV QY  L G ++GY 
Sbjct  75    FVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYT  134

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             I +++S+ A+ R++C+HKHG     C  S    +++FG +E+L SQIP+F ++W+LSIVA
Sbjct  135   IASSISMMAVKRSDCFHKHGH-RAACNVSSTPYMIMFGIMEILFSQIPDFDQIWWLSIVA  193

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF YS+IG+ L   ++A    ++ S+TG+ +G   +   K++ +F ALG IA A+ +
Sbjct  194   AVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTEMQKIWRSFQALGAIAFAYSY  253

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             SLILI+IQDTLK+ P E + MK+A+ + +   T FY+LCG  GY AFG+ +PGNLLT   
Sbjct  254   SLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLT-GF  312

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFY P+WL+D+ANV I+VHLVGAYQV  QP+FAFVE  +   +    FIT +  +  P  
Sbjct  313   GFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGY  372

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
               F ++LFRLVWRT FV+ TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI Q KI
Sbjct  373   KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKI  432

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ S  WI LQILS  C V+S+ AA GS   +   +  ++PF
Sbjct  433   PKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPF  474



>dbj|BAJ93107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   499 bits (1286),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 330/458 (72%), Gaps = 8/458 (2%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             DD   D+DG+ +RTGTV TASAH+ITA+IGSGVLSL W++AQLG VAGP  ++ F++IT 
Sbjct  70    DDYSLDDDGKPRRTGTVWTASAHVITAVIGSGVLSLPWSVAQLGWVAGPATLLLFALITY  129

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             YT+ LL DCYRS D   GKRNY+YMDAV + LG  QV FCG+ QY  LVG +IGY ITA+
Sbjct  130   YTSVLLGDCYRSDDAVAGKRNYTYMDAVGSLLGKGQVWFCGLCQYVNLVGTAIGYTITAS  189

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S  A+ + NC+H  G   + C       +++FG  +++ SQ+PN H + +LS++AA+MS
Sbjct  190   ISAAALYKANCFHSKGHSAD-CGVYTTMYMVVFGISQIVFSQLPNLHEMAWLSMLAAVMS  248

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             F YS+IG+ LS  +   G   +T++ G  +GV+ ++  K++ T  ALGNIA A+ +S++L
Sbjct  249   FSYSTIGVGLSLAQTIKGPTGKTTIGGTQIGVDVTSAQKIWLTLQALGNIAFAYSYSMVL  308

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             I+IQDT+K+ P E + M++A+ +G+ + T FY+LCG LGY AFGN APGN+LT   GFYE
Sbjct  309   IEIQDTVKAPPAENKTMRKANLMGVSTTTAFYMLCGCLGYSAFGNDAPGNMLT-GFGFYE  367

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             PFWL+D  NVCI+VHLVGAYQV  QP++A VE W+  RW    F+  ++    PF G FS
Sbjct  368   PFWLIDFTNVCIVVHLVGAYQVYCQPIYAAVESWAAGRWPNSEFVVRQY---HPFSGTFS  424

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             +++FRLVWRT FV+ +TV+A+  PFFN ILGLLG++ FWPLT+YFPVEMYISQ+K+ + S
Sbjct  425   LNMFRLVWRTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYS  484

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
               W+ LQ LSF CF V+V   V SI  + +S+ ++ PF
Sbjct  485   RKWVALQTLSFACFAVTVAVTVASIQGITQSLKNYVPF  522



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/464 (54%), Positives = 336/464 (72%), Gaps = 8/464 (2%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             +++GG     +D+DGR KRTGT+ TASAHI+TA+IGSGVLSLAWAIAQLG +AGPI M+ 
Sbjct  16    LQQGGSKS--FDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWLAGPIVMIL  73

Query  298   FSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             FS++T YT+ LLA CYRS D   GKRNY+Y  AVR+ LGG+ V FCG  QYA L G +IG
Sbjct  74    FSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYANLFGVAIG  133

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y I A++S+ A+ R+NCYH  G G   C  +    ++ +G  E++ SQIP+FH LW+LSI
Sbjct  134   YTIAASISMMAVKRSNCYHSSG-GKNPCKMNSNWYMISYGVAEIIFSQIPDFHELWWLSI  192

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             VAA+MSF YS IG+ L   K+ G   ++ S+TGV VG    ++ K++ +F ALGNIA A+
Sbjct  193   VAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQ-KIWRSFQALGNIAFAY  251

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S+ILI+IQDT+KS P E + M +A+ I +L  T FY+LCG  GY +FG+A+PGNLLT 
Sbjct  252   SYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASPGNLLTG  311

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFY P+WL+D+ANV I++HLVGAYQV  QP+F+FVE  + AR+    F++ E  +  P
Sbjct  312   -FGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIP  370

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
                 + ++LFRLVWRT FV+ +TV+AM+ PFFN I+GL+G+I FWPLT+Y PVEMYI+Q 
Sbjct  371   GCKPYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQT  430

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             KIP+    WI LQ+LS  CFVV++LAA GSI  +   +  +KPF
Sbjct  431   KIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPF  474



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/464 (54%), Positives = 336/464 (72%), Gaps = 8/464 (2%)
 Frame = +1

Query  118   VEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVA  297
             +++GG     +D+DGR KRTGT+ TASAHI+TA+IGSGVLSLAWAIAQLG +AGPI M+ 
Sbjct  17    LQQGGSKS--FDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWLAGPIVMIL  74

Query  298   FSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIG  468
             FS++T YT+ LLA CYRS D   GKRNY+Y  AVR+ LGG+ V FCG  QYA L G +IG
Sbjct  75    FSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYANLFGVAIG  134

Query  469   YIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSI  648
             Y I A++S+ A+ R+NCYH  G G   C  +    ++ +G  E++ SQIP+FH LW+LSI
Sbjct  135   YTIAASISMMAVKRSNCYHSSG-GKNPCKMNSNWYMISYGVAEIIFSQIPDFHELWWLSI  193

Query  649   VAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
             VAA+MSF YS IG+ L   K+ G   ++ S+TGV VG    ++ K++ +F ALGNIA A+
Sbjct  194   VAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQ-KIWRSFQALGNIAFAY  252

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
              +S+ILI+IQDT+KS P E + M +A+ I +L  T FY+LCG  GY +FG+A+PGNLLT 
Sbjct  253   SYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASPGNLLTG  312

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFY P+WL+D+ANV I++HLVGAYQV  QP+F+FVE  + AR+    F++ E  +  P
Sbjct  313   -FGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIP  371

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
                 + ++LFRLVWRT FV+ +TV+AM+ PFFN I+GL+G+I FWPLT+Y PVEMYI+Q 
Sbjct  372   GCKPYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQT  431

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             KIP+    WI LQ+LS  CFVV++LAA GSI  +   +  +KPF
Sbjct  432   KIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPF  475



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 336/473 (71%), Gaps = 9/473 (2%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             M+ SL L   +G      +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAI QLG V
Sbjct  1     MEVSLELGAPQGASK--CFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWV  58

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
             AGPIAM+ FS +T YT+ LLADCYRS D   GKRNY+YMD VRA L G +VK CG  QY 
Sbjct  59    AGPIAMLLFSFVTYYTSALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYL  118

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              +VG +IGY I A++S+ AI R+NC+HK+G  +  C  +    +++FG  E++ SQIP+F
Sbjct  119   NIVGVAIGYTIAASISMVAIERSNCFHKNGDDSP-CQVNSNPYMIMFGVAEIIFSQIPDF  177

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSA  804
              ++W+LSIVAA+MSF YSSIG++L  V++     V  S+TG+ +G   S  DK++ +  A
Sbjct  178   DQIWWLSIVAAVMSFTYSSIGLSLGIVQVIKNGGVRGSLTGISIG-TVSEMDKIWRSLQA  236

Query  805   LGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
              G+IA A+ +S+ILI+IQDT+++ P  E + MK+A+ I +   T FY+LCG +GY AFG+
Sbjct  237   FGDIAFAYSYSIILIEIQDTIRAPPPSEAKVMKRATLISVAVTTVFYMLCGCMGYAAFGD  296

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
              APGNLLT   GFY P+WL+D+ANV I+VHLVGAYQV  QP+FAFVE W+   W    FI
Sbjct  297   MAPGNLLTG-FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKWALETWPRSQFI  355

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
               E  +  P   ++ ++LFRL+WRT FVV +TVV+M+ PFFN ++GLLG+I FWPLT+YF
Sbjct  356   GKEIQVPLPARRSYKLNLFRLIWRTTFVVISTVVSMLLPFFNDVVGLLGAIGFWPLTVYF  415

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEMYI Q K+ R S  W+ LQ+LS  C  +++ +A GSI  +   +  ++PF
Sbjct  416   PVEMYIVQKKVARWSTRWVCLQLLSLACLAITIASAAGSIAGVVSDLKVYRPF  468



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 331/462 (72%), Gaps = 5/462 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
              G G+   +D+DGR KR+G+V TASAHIITA+IGSGVLSLAWA AQLG +AGP  ++ FS
Sbjct  17    NGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFS  76

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              +T YT+ LLADCYRS D   GKRNY+YMDAVRA LGG+QVK CGV QY  L G ++GY 
Sbjct  77    FVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYT  136

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             I +++S+ A+ R++C+HKHG     C  S    +++FG +E+L SQIP+F ++W+LSIVA
Sbjct  137   IASSISMMAVKRSDCFHKHGH-RAACNVSSTPYMIMFGIMEILFSQIPDFDQIWWLSIVA  195

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF YS+IG+ L   ++A    ++ S+TG+ +G   +   K++ +F ALG IA A+ +
Sbjct  196   AVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTEMQKIWRSFQALGAIAFAYSY  255

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             SLILI+IQDTLK+ P E + MK+A+ + +   T FY+LCG  GY AFG+ +PGNLLT   
Sbjct  256   SLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLT-GF  314

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFY P+WL+D+ANV I+VHLVGAYQV  QP+FAFVE  +   +    FIT +  +  P  
Sbjct  315   GFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGY  374

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
               F ++LFRLVWRT FV+ TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI Q KI
Sbjct  375   KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKI  434

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ S  WI LQILS  C V+S+ AA GS   +   +  ++PF
Sbjct  435   PKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPF  476



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 336/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++ FG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIAFGVAEILLSQVPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHL+GAYQV  QP+FAF+E     R+    F++ E  I+ P F   +  ++
Sbjct  335   LDIANAAIVVHLIGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIKIPGFKSPYKANV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRVVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 335/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KR+GTV TASAHIITA+IGSGVLSLAWAI QLG +AGP  M  FS +T Y++ 
Sbjct  11    FDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYSST  70

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  71    LLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIGYTIAASISMM  130

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQI +F ++W+LSIVAA+MSF YS
Sbjct  131   AIKRSNCFHESG-GKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTYS  189

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  +++A    V+ S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  190   AIGLALGIIQVAANGVVKGSLTGISIGAVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK A+ I I   T FYLLCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  249   DTIRSPPAESKTMKNATKISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTG-FGFYNPFWL  307

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+ANV I++HLVGAYQV  QP+FAF+E  + AR+     +  EH IR P L + + V++
Sbjct  308   LDVANVAIVIHLVGAYQVFAQPIFAFIEKQAAARFPNNDLVIKEHEIRIPGLKSPYKVNV  367

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ R S  W
Sbjct  368   FRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKW  427

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C +++++A VGSI  +   +  +KPF
Sbjct  428   VCLQMLSAGCLMITLVAGVGSIAGVMLDLKVYKPF  462



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 330/456 (72%), Gaps = 10/456 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWA+AQLG +AGPI M+ FS +T YT+ 
Sbjct  28    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYTSA  87

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   GKRNY+YMDAV+A LGG+QVK CG  QYA L G +IGY I +++S+ 
Sbjct  88    LLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSISMI  147

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HKHG     C  S    +++FG VE++ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  148   AIKRSNCFHKHGDQAP-CQVSSTPYMIMFGIVEIIFSQIPDFDQIWWLSIVAAVMSFTYS  206

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   K+A    +  S+TG+ +G   S   K++ +F ALG IA A+ +SLILI+IQ
Sbjct  207   TIGLGLGVAKVAETGKIGGSLTGISIG-TVSEMQKIWKSFQALGAIAFAYSYSLILIEIQ  265

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DTLKS P E + MK A+ I +   T FY+LCG  GY AFG+ APGNLLT   GFY P+WL
Sbjct  266   DTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTG-FGFYNPYWL  324

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG--NFSVS  1212
             +D+AN+ I+VHLVGAYQV  QP+FAF+E  +   +    FIT E  I  P +G  +F ++
Sbjct  325   LDIANIAIVVHLVGAYQVYCQPLFAFIEKTAAEWYPESKFITKE--ISVPIMGYKSFKLN  382

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
             LFR++WRT FV+ TTV++M+ PFFN I+G+LG+  FWPLT+YFPVEMYI Q KI + S  
Sbjct  383   LFRIIWRTIFVIITTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKITKWSTK  442

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WI LQ+LS  C ++S+ AA GS   +   +  +KPF
Sbjct  443   WICLQMLSVACLIISIAAAAGSFAGVVSDLQVYKPF  478



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   497 bits (1279),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KR+GTV TASAHIITA+IGSGVLSLAWAI QLG +AGP  M  FS +T Y++ 
Sbjct  11    FDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYSST  70

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  71    LLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASISMM  130

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQI +F ++W+LSIVA +MSF YS
Sbjct  131   AIKRSNCFHESG-GKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVATIMSFTYS  189

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  +++A    V+ S+TG+ +G    T+ K++ TF ALG+IA A+ +S +LI+IQ
Sbjct  190   AIGLALGIIQVAANGVVKGSLTGISIGAVTQTQ-KIWRTFQALGDIAFAYSYSAVLIEIQ  248

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK A+ I I   T FYLLCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  249   DTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTG-FGFYNPFWL  307

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+ANV I+VHLVGAYQV  QP+FAF+E  + AR+     +T EH IR P L + + V++
Sbjct  308   LDVANVAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPYKVNV  367

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ R S  W
Sbjct  368   FRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKW  427

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C +V+++A VGSI  +   +  +KPF
Sbjct  428   VCLQMLSAGCLMVTLVAGVGSIAGVMLDLKVYKPF  462



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 331/460 (72%), Gaps = 13/460 (3%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M+ FS +T YT+ 
Sbjct  19    FDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSA  78

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   GKRNY+YMDAV A L GV+V FCG  QYA +VG +IGY I A++S+ 
Sbjct  79    LLADCYRSGDACTGKRNYTYMDAVNANLSGVKVWFCGFLQYANIVGVAIGYTIAASISML  138

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R NC+H  G G + C  S    ++IFG V++  SQIP+F ++ +LSI+AA+MSF YS
Sbjct  139   AIQRANCFHVEGHG-DPCNISSTPYMIIFGVVQIFFSQIPDFDQISWLSILAAVMSFTYS  197

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   ++     V+ S+TG+ VG   +  DKM+ +  A G+IA A+ +SLILI+IQ
Sbjct  198   TIGLGLGIAQVVSNKGVQGSLTGISVGAV-TPVDKMWRSLQAFGDIAFAYSYSLILIEIQ  256

Query  859   DTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFW  1035
             DT+++ P  E + M++A+ + +   TF Y+LCG +GY AFG+ APGNLLT   GFYEPFW
Sbjct  257   DTIRAPPPSESKVMRRATVVSVAVTTFXYMLCGCMGYAAFGDNAPGNLLTG-FGFYEPFW  315

Query  1036  LVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-----  1200
             L+D+AN  I VHLVGAYQV  QP+FAFVE W+R RW    +ITGE  +  P LG      
Sbjct  316   LLDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLP-LGTAGGRC  374

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             + +SLFRL WRT FVV TTVV+M+ PFFN ++GLLG++ FWPLT+YFPVEMYI Q K+PR
Sbjct  375   YKLSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPR  434

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S  W+ LQ+LS  C V++V +A GS+  +   +  +KPF
Sbjct  435   WSTRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPF  474



>gb|ADE75660.1| unknown [Picea sitchensis]
Length=508

 Score =   498 bits (1282),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 329/453 (73%), Gaps = 5/453 (1%)
 Frame = +1

Query  151   DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFL  330
             DEDG  +RTG V TAS+H+ITA+IGSGVLSLAW+++QLG +AGP+ ++AFS +T YT+ L
Sbjct  54    DEDGHPQRTGDVWTASSHVITAVIGSGVLSLAWSMSQLGWIAGPLVLLAFSFVTYYTSML  113

Query  331   LADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQA  501
             LAD YRSPD   G+RNY+Y DAV A LGG +V  CG+ QY  L+G +IGY ITA++S+ A
Sbjct  114   LADTYRSPDPVTGRRNYTYTDAVTAILGGKRVFLCGIVQYLNLLGTTIGYTITASISMVA  173

Query  502   IVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSS  681
             I R++C+H+ GR +  C  S    + IFGA +VLLSQIPNF ++W+LS +AA+MS  YS 
Sbjct  174   IGRSDCFHEKGRESP-CHISNNLYMAIFGAAQVLLSQIPNFSKIWWLSTLAAVMSLTYSF  232

Query  682   IGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQD  861
             IG+ L             S+ GV +     + DK+++ F ALGNIA A+ FS+IL++IQD
Sbjct  233   IGLGLGIGMATEKGHSHGSLGGVGIAGVQKSVDKIWNIFQALGNIAFAYSFSMILVEIQD  292

Query  862   TLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLV  1041
             T+KS P E + MK+AS IG++  T FY+  G  GY AFG+ APGNLLT   GFY PFWLV
Sbjct  293   TVKSPPAENKTMKKASFIGVVVTTMFYISVGCAGYAAFGDHAPGNLLTG-FGFYNPFWLV  351

Query  1042  DLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFR  1221
             D+AN+CI++HLVGAYQV  QP++AFVE WS   W    FI  E+ +  P LG F ++LFR
Sbjct  352   DIANICIVIHLVGAYQVFCQPLYAFVEEWSANTWTKSCFIQNEYKVPIPGLGEFKLNLFR  411

Query  1222  LVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIW  1401
             LVWRT FVVFTTVV+M+ PFFNAI+G+LG+IAF+PLT+YFP++M+I+Q K+ R SF W+ 
Sbjct  412   LVWRTCFVVFTTVVSMVLPFFNAIMGVLGAIAFFPLTVYFPIQMHIAQTKLRRWSFKWVA  471

Query  1402  LQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             LQ++   CF V++ A VGSI  + + + H+ PF
Sbjct  472   LQLMCVLCFFVTMAALVGSIAGVVEVLQHYTPF  504



>ref|NP_001140430.1| hypothetical protein [Zea mays]
 gb|ACF83824.1| unknown [Zea mays]
 gb|AFW56245.1| hypothetical protein ZEAMMB73_801988 [Zea mays]
Length=482

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 253/471 (54%), Positives = 341/471 (72%), Gaps = 12/471 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
             + ++VE G     ++ D+DGR +R+GT  TASAHIITA+IGSGVLSLAWAIAQLG VAGP
Sbjct  18    MDVSVEAGNAGAAEWLDDDGRPRRSGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  77

Query  283   IAMVAFSVITLYTAFLLADCYRS--PD-GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
              AM+ F+ +T YTA LLA+CYR+  P+ GKRNY+YMDAVR+ LGGV+V FCGV QYA LV
Sbjct  78    AAMLLFAFVTYYTAALLAECYRTGHPETGKRNYTYMDAVRSNLGGVKVVFCGVIQYANLV  137

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G +IGY I +A+S++A+ R  C+H HG   + C  S    +++FG V++L SQIP+F ++
Sbjct  138   GVAIGYTIASAISMKAVRRAGCFHAHGHA-DPCKSSSTPYMVLFGGVQILFSQIPDFDQI  196

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGN  813
             W+LSIVAA+MSF YSSIG++L   +       + S+TG+ +G   ++  K++ T  A G+
Sbjct  197   WWLSIVAAVMSFTYSSIGLSLGIAQTVSNGGFKGSLTGISIGAGVTSTQKIWHTLQAFGD  256

Query  814   IALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             IA A+ FS ILI+IQDT+K+ P  E + M++A+ + + + T FY+LCG +GY AFG+ AP
Sbjct  257   IAFAYSFSNILIEIQDTIKAPPPSESKVMQKATRLSVATTTVFYMLCGCMGYAAFGDNAP  316

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
              NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV  QP+FAFVE  + A W    F++ E
Sbjct  317   DNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFCQPIFAFVERRAAAAWPDSAFVSRE  375

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
               +     G FS+S+FRL WR+ FV  TTVVAM+ PFF  ++GLLG+++FWPLT+YFPVE
Sbjct  376   LRV-----GPFSLSVFRLTWRSAFVCVTTVVAMLLPFFGDVVGLLGAVSFWPLTVYFPVE  430

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             MYI Q ++PR S  WI LQ LS  C +VSV AA GSI D+  ++  +KPF+
Sbjct  431   MYIKQLRVPRGSTKWICLQTLSVSCLLVSVAAAAGSIADVIAALKVYKPFS  481



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 257/484 (53%), Positives = 344/484 (71%), Gaps = 8/484 (2%)
 Frame = +1

Query  64    RYRERERFAEMQKSLSLAVEEG-GGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLS  240
             +Y ++     M+ S+ L  ++   G    YD+DGR KRTGT+ TASAHIITA+IGSGVLS
Sbjct  8     KYHQQAGIPPMEVSIELGHQKQLQGGSKCYDDDGRLKRTGTLWTASAHIITAVIGSGVLS  67

Query  241   LAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGV  411
             LAWAIAQLG VAGP  M  FS +  YT+ LLADCYRS D   GKRNY+YMDAV AYLGG+
Sbjct  68    LAWAIAQLGWVAGPAVMFLFSFVIFYTSTLLADCYRSGDPITGKRNYTYMDAVHAYLGGL  127

Query  412   QVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGA  591
             +VK CG  QYA L G +IGY I A++S+ AI R+NC+H+ G  +  C  S    ++ FG 
Sbjct  128   KVKMCGYIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKSP-CHVSSNPYMIAFGV  186

Query  592   VEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHS  771
             +E++ SQIP+F ++W+LSIVAA+MSF YSSIG+ L  V+  G    + S+TG+ +G    
Sbjct  187   LEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLILGIVQTIGNKRFKGSLTGISIGAVTE  246

Query  772   TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLL  948
             T+ K++ T  ALG+IA A+ FS+ILI+IQDT+K+ P  E + MK+A+ + I   TFFY+L
Sbjct  247   TQ-KIWRTLQALGDIAFAYSFSIILIEIQDTVKAPPPSEAKVMKKAAVLSIAVTTFFYML  305

Query  949   CGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECW  1128
             CG +GY AFG+ APGNLLT   GFY PFWL+D+AN  I++HLVGAYQV  QP+FAF+E W
Sbjct  306   CGCMGYAAFGDEAPGNLLTG-FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKW  364

Query  1129  SRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLG  1308
             +   W    FIT E  I      +++++LFRLVWR+ FVV TTV++M+ PFFN ++GLLG
Sbjct  365   ALQTWPKSTFITKEVRIPLTSTRSYNLNLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLG  424

Query  1309  SIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMH  1488
             ++ FWPLT+YFPVEMYI+Q ++PR S  W+ LQ+LS  C +VS+ AA GSI  +   +  
Sbjct  425   ALGFWPLTVYFPVEMYIAQKEVPRWSTRWVCLQMLSIACLIVSIAAAAGSIAGVVTDLKV  484

Query  1489  FKPF  1500
             ++PF
Sbjct  485   YRPF  488



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   496 bits (1277),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DG+ KR+GTV TASAHIITA+IGSGVLSLAWAI QLG +AGP+ M  FS +T Y + 
Sbjct  11    FDDDGKLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPVVMFLFSFVTYYCST  70

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  71    LLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASISMM  130

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQI +F ++W+LSIVAA+MSF YS
Sbjct  131   AIKRSNCFHESG-GKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTYS  189

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  +++A    V+ S+TG+ +G    T+ K++ TF ALG+IA A+ +S +LI+IQ
Sbjct  190   AIGLALGIIQVAANGVVKGSLTGISIGAVTQTQ-KIWRTFQALGDIAFAYSYSAVLIEIQ  248

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK A+ I I   T FYLLCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  249   DTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTG-FGFYNPFWL  307

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E  + AR+     +T EH IR P L + + V++
Sbjct  308   LDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPYKVNV  367

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ R S  W
Sbjct  368   FRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKW  427

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C +V+++A VGSI  +   +  +KPF
Sbjct  428   VCLQLLSAGCLMVTLVAGVGSIAGVMLDLKVYKPF  462



>gb|EEC68963.1| hypothetical protein OsI_37697 [Oryza sativa Indica Group]
Length=482

 Score =   497 bits (1279),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 345/476 (72%), Gaps = 12/476 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             ++ K + ++VE G   D  + D+DGR++RTGT  TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  13    QVMKPMEVSVEAGNAGDAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLG  72

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              VAGP  M+ F+ +  YT+ LLA+CYR+ D   GKRNY+YMDAVRA LGG +V FCGV Q
Sbjct  73    WVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQ  132

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             YA LVG +IGY I +++S++AI R  C+H +G G + C  S    +++FG V+++ SQIP
Sbjct  133   YANLVGVAIGYTIASSISMRAIRRAGCFHHNGHG-DPCRSSSNPYMILFGVVQIVFSQIP  191

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             +F ++W+LSIVAA+MSF YS IG++L  V+      ++ S+TG+ +GV  S+  K++ + 
Sbjct  192   DFDQIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSL  251

Query  799   SALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAF  975
              A G+IA A+ FS ILI+IQDT+K+ P  E + MK A+ + + + T FY+LCG +GY AF
Sbjct  252   QAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAF  311

Query  976   GNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVW  1155
             G+AAP NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV VQP+FAFVE W+  RW    
Sbjct  312   GDAAPDNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFVQPIFAFVERWASRRWPDSA  370

Query  1156  FITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             FI  E  +     G F++SLFRL WR+ FV  TTVVAM+ PFF  ++GLLG+++FWPLT+
Sbjct  371   FIAKELRV-----GPFALSLFRLTWRSAFVCLTTVVAMLLPFFGNVVGLLGAVSFWPLTV  425

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             YFPVEMYI+Q  +PR S  W+ L+ LS  C VVS+ AA GSI D+  ++  ++PF+
Sbjct  426   YFPVEMYIAQRGVPRGSARWVSLKTLSACCLVVSIAAAAGSIADVIDALKVYRPFS  481



>ref|XP_010064702.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Eucalyptus 
grandis]
Length=485

 Score =   496 bits (1278),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 335/464 (72%), Gaps = 12/464 (3%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
               GG     D+DGR +RTGTV+TASAHIITA+IGSGVLSLAW IAQLG V G   +V  S
Sbjct  16    RSGGVQKNLDDDGRVERTGTVVTASAHIITALIGSGVLSLAWTIAQLGWVVGSSVLVTLS  75

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              IT +T+ LLADCYRSPD   GKRNY+YMD VRA+LGG +V+ CG+AQY  LVG +IGY 
Sbjct  76    FITYFTSTLLADCYRSPDPITGKRNYTYMDVVRAHLGGRKVQLCGLAQYGNLVGITIGYT  135

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEG-CIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIV  651
             ITA++S+ A+ ++NC+HK+G   +  C  S    ++IF  ++++LSQIP+FH+L +LSIV
Sbjct  136   ITASISMVAVKKSNCFHKNGHEVKSVCETSNYPFMIIFACIQIVLSQIPDFHKLSWLSIV  195

Query  652   AALMSFGYSSIGIALSAVKIAGG-VDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAF  828
              A+MS  Y+SIG+ LS  K+AGG     T++TG  VGV+ S  +K++  F A+GNI    
Sbjct  196   FAVMSLAYASIGVGLSIAKVAGGGHHARTTLTGTTVGVDVSGSEKVWRVFQAVGNI----  251

Query  829   GFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTD  1008
               S +L++IQDTLKSSP E + MK+AS IGI + T FY LCG +GY AFGN AP + LT 
Sbjct  252   --STVLVEIQDTLKSSPPENKVMKRASLIGISTTTMFYALCGCIGYAAFGNDAPXDFLTG  309

Query  1009  DHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP  1188
               GFYEPFW++D AN CI VHL+GAYQV  QP+F FVE W   RW    FIT E  +  P
Sbjct  310   -FGFYEPFWVIDFANACIAVHLIGAYQVFSQPIFGFVESWCSKRWPNNTFITREIPVDVP  368

Query  1189  FLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQA  1368
             + G + ++LFRL+WRT +V+ T V+AMI PFFN  LGL+G+ +FWPLT+YFPVEMYI++ 
Sbjct  369   WYGIYHINLFRLIWRTVYVIVTAVIAMILPFFNDFLGLIGAASFWPLTVYFPVEMYIART  428

Query  1369  KIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              + + SFTW WL+IL++ C VVS++AA GS+  L +S+  +KPF
Sbjct  429   NMRKFSFTWAWLKILNWACLVVSLVAAAGSVQGLIQSLKTYKPF  472



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   497 bits (1280),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 332/459 (72%), Gaps = 10/459 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT  TAS+HIITA+IGSGVLSLAWAI QLG VAGPI M+ F+ + LY++ 
Sbjct  52    FDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWAIGQLGWVAGPIVMILFAFVNLYSSN  111

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLA CYRS D   G+RNY+YM+AV+A LGG +V  CG  QY  L G +IGY I A++S+ 
Sbjct  112   LLAQCYRSGDPLTGQRNYTYMEAVKANLGGKKVLACGWIQYLNLFGTAIGYTIAASVSMM  171

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++ FG +E++ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  172   AIKRSNCFHKSG-GKDPCHMSSNGYMITFGIIEIIFSQIPDFDQVWWLSIVAAIMSFTYS  230

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVG-VNH----STKDKMFSTFSALGNIALAFGFSLI  843
             S+G+ L   K+A     + S+TG+ +G V H    ++  K++ +  ALG IA A+ FSLI
Sbjct  231   SVGLGLGVAKVAENGSFKGSLTGISIGTVTHAGVVTSTQKLWRSLQALGAIAFAYSFSLI  290

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             LI+IQDT+KS P E + M++A+ + I   T FY+LCG  GY AFG+ APGNLLT   GFY
Sbjct  291   LIEIQDTIKSPPAEYKTMRKATVLSIAVTTAFYMLCGCFGYAAFGDLAPGNLLTG-FGFY  349

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
             +P+WL+D+AN+ IIVHLVGAYQV  QP+FAFVE WS  +W    F+T E+ +  P  G +
Sbjct  350   DPYWLLDIANIAIIVHLVGAYQVYCQPLFAFVEKWSAHKWPKSDFVTEEYDLPIPCYGVY  409

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              ++ FRLVWRT FVV TT++AM+ PFFN ++G+LG+  FWPLT+YFPVEMYISQ KI R 
Sbjct  410   QLNFFRLVWRTIFVVLTTLIAMLLPFFNDVVGILGAFGFWPLTVYFPVEMYISQKKIGRW  469

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +  W+ LQILSF C ++S+ AAVGS+  +   +  +KPF
Sbjct  470   TSRWVALQILSFACLLISLAAAVGSVAGVVLDLKTYKPF  508



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   497 bits (1280),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 247/492 (50%), Positives = 337/492 (68%), Gaps = 14/492 (3%)
 Frame = +1

Query  61    DRYRERERFAEMQKSLSLAVEEGGGDDLKY----DEDGRSKRTGTVLTASAHIITAIIGS  228
             +R+  R  F    +    A  E       Y    D+DGR KRTGT  TAS+HIITA+IGS
Sbjct  19    ERHDVRSYFEVEAQPKPHADSEAINPQTNYSKCFDDDGRLKRTGTFWTASSHIITAVIGS  78

Query  229   GVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAY  399
             GVLSLAWAI QLG VAGP  MV F+ +  YT  LL+ CYRS D   G+RNY+YMD V+A 
Sbjct  79    GVLSLAWAIGQLGWVAGPTVMVLFAFVNFYTTNLLSQCYRSGDPITGQRNYTYMDVVKAN  138

Query  400   LGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSIL  579
             LGG +V  CG+ QY  L G +IGY I A++S+ AI R+NC+HK G G + C  S    ++
Sbjct  139   LGGKRVMLCGLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHKSG-GKDPCHMSSNGFMI  197

Query  580   IFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG  759
              FG +E+ LSQIP+F ++W+LSIVAA+MSF YS++G+ L   K+A   + + S+TG+ +G
Sbjct  198   TFGVMEIFLSQIPDFDQVWWLSIVAAIMSFTYSTVGLGLGIDKVAENGNFKGSLTGIKIG  257

Query  760   VNH-----STKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGIL  924
                     ++ +K++ +F ALG IA A+ +S+ILI+IQDT++S P E + MK+A+ + I 
Sbjct  258   TPTAAGVVTSTEKLWRSFQALGAIAFAYSYSVILIEIQDTVRSPPAEHKTMKKATLLSIT  317

Query  925   SATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQP  1104
               T FY+LCG +GY AFG+ APGN+LT   GFY+P+WL+D+AN  I++HLVGAYQV  QP
Sbjct  318   VTTVFYMLCGCMGYAAFGDLAPGNILTG-FGFYDPYWLLDIANAAIVIHLVGAYQVYCQP  376

Query  1105  VFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFF  1284
             +FAFVE WS  +W    F+T E+ I  PF G + ++ FRLVWRT FV+ TTV+AM+ PFF
Sbjct  377   LFAFVEKWSAQKWSTSDFVTAEYDIPIPFCGMYQLNFFRLVWRTLFVILTTVIAMLMPFF  436

Query  1285  NAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSIC  1464
             N ++G+LG+  FWPLT+YFPVEMYIS  +I R +  W+ LQILS  C ++S+ AAVGS+ 
Sbjct  437   NDVVGILGAFGFWPLTVYFPVEMYISSRRIKRWTTMWVGLQILSMTCLLISIAAAVGSVA  496

Query  1465  DLAKSVMHFKPF  1500
              +   +  +KPF
Sbjct  497   GVVLDLKTYKPF  508



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   495 bits (1275),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KR+GTV TASAHIITA+IGSGVLSLAWAI QLG +AGP  M  FS +T Y++ 
Sbjct  11    FDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYSST  70

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  71    LLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASISMM  130

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H+ G G   C  S    +++FG  E+LLSQI +F ++W+LSIVAA+MSF YS
Sbjct  131   AIKRSNCFHESG-GKNPCHMSSNPYMILFGVTEILLSQIKDFDQIWWLSIVAAVMSFTYS  189

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  +++A    V+ S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  190   AIGLALGIIQVAANGAVKGSLTGISIGAVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK A+ I I   T FYLLCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  249   DTVRSPPAESKTMKNATRISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTG-FGFYNPFWL  307

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E  + AR+     +T E+ IR P F   + V++
Sbjct  308   LDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPYKVNV  367

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ R S  W
Sbjct  368   FRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKW  427

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C +++++A VGSI  +   +  +KPF
Sbjct  428   VCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPF  462



>ref|XP_006852748.1| hypothetical protein AMTR_s00033p00114390 [Amborella trichopoda]
 gb|ERN14215.1| hypothetical protein AMTR_s00033p00114390 [Amborella trichopoda]
Length=475

 Score =   496 bits (1276),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 335/474 (71%), Gaps = 7/474 (1%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             MQK   +   + G    + D+DGR KRTGT+LTASAHI+TA+IGSGVLSL+WAIAQLG +
Sbjct  1     MQKEEGVQCLDAGTPFDQTDDDGRVKRTGTLLTASAHIVTAVIGSGVLSLSWAIAQLGWI  60

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
              G   ++ FS+I LYT+F LADCYR PD   GKRNY+Y  AV A+LGG++ K C   QY 
Sbjct  61    FGVFVLLIFSLIILYTSFFLADCYRYPDPVNGKRNYNYKAAVSAHLGGLKTKICASTQYV  120

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              LVG  +GY +TA++S+ A+ R NC+HK+G   E C+ S    ++I+G ++++LSQIPNF
Sbjct  121   FLVGNCLGYAVTASLSMAAVERLNCFHKNGHAAE-CVASTNKYLVIYGCIQIVLSQIPNF  179

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAG-GVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             H+LW LSIVAA+MSF YSSIG+ LS  KIAG G    T +TGV VG++ +  +K +    
Sbjct  180   HKLWGLSIVAAIMSFCYSSIGVGLSIAKIAGEGASKTTCLTGVRVGIDITAGEKFWRVCQ  239

Query  802   ALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFG  978
             ALGNIA A  F+ +L++IQDTLK  P  E + MK+A++I  +  T FYLLCG LGY AFG
Sbjct  240   ALGNIAFASAFTAVLLEIQDTLKGPPPAENKVMKKATTISTIITTVFYLLCGCLGYAAFG  299

Query  979   NAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWF  1158
             + APGN+LT   G+YEPFWL+D ANVC+ VHL G++QV  QP++A +E     RW    F
Sbjct  300   SKAPGNMLTG-FGYYEPFWLIDFANVCVAVHLFGSFQVFAQPLYAVMERVCSRRWPSNPF  358

Query  1159  ITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIY  1338
             I+ E TI    L ++S + FR+  RT +VV  T++AMIFPFFN ++GL+GSIAFWPLT+Y
Sbjct  359   ISNEWTISTLGLCSYSFNFFRITSRTLYVVVLTLIAMIFPFFNDLVGLIGSIAFWPLTVY  418

Query  1339  FPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             FPVEMYI + K+ R S  W WLQIL+  C +VSV AAVGS   LA S+  +KPF
Sbjct  419   FPVEMYIHRKKVQRASTEWCWLQILNLICLLVSVAAAVGSFQGLATSLRTYKPF  472



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 258/471 (55%), Positives = 337/471 (72%), Gaps = 7/471 (1%)
 Frame = +1

Query  97    QKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVA  276
              + LS+ +   GG    +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +A
Sbjct  13    NQHLSIDMLPQGGSKC-FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIA  71

Query  277   GPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYAT  447
             GP  M  FS +  YT+ LL DCYRS D   GKRNY+Y DAVR+ LGGV+VK CG+ QY  
Sbjct  72    GPAVMFLFSFVIYYTSSLLTDCYRSGDPVSGKRNYTYTDAVRSNLGGVKVKICGIIQYLN  131

Query  448   LVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFH  627
             L G +IGY I A++S+ AI R+NC+H+ G G   C  S    ++IFG  E+L SQIP+F 
Sbjct  132   LFGVAIGYTIAASISMMAIKRSNCFHESG-GDNPCHISSNPYMIIFGVTEILFSQIPDFD  190

Query  628   RLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSAL  807
             ++W+LSIVAA+MSF YSSIG+ L   K+A     + S+TG+ +G    T+ K++ +F AL
Sbjct  191   QIWWLSIVAAVMSFTYSSIGLGLGIAKVAETGSFKGSLTGISIGAVTETQ-KIWRSFQAL  249

Query  808   GNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAA  987
             G+IA A+ +S+ILI+IQDT+KS P E + MK+A+ + +   T FY+LCG +GY AFG+ A
Sbjct  250   GDIAFAYSYSIILIEIQDTIKSPPSEAKTMKKATLLSVAVTTLFYMLCGCMGYAAFGDLA  309

Query  988   PGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITG  1167
             PGNLLT   GFY PFWL+D+AN  I++HLVGAYQV  QP+FAF+E  +  RW    FIT 
Sbjct  310   PGNLLTG-FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSASERWSESKFITK  368

Query  1168  EHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPV  1347
             E  +  P    + ++LFRLVWR+ FVV TTV++M+ PFFN ++G+LG+  FWPLT+YFPV
Sbjct  369   EIKVPIPGFRPYKLNLFRLVWRSVFVVATTVISMLLPFFNDVVGILGAFGFWPLTVYFPV  428

Query  1348  EMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             EMYI+Q KIP+ S  W+ LQILSF C VVS+ AA GSI  +A  +  +KPF
Sbjct  429   EMYIAQKKIPKWSTRWLCLQILSFACLVVSIAAAAGSIAGVALDLKVYKPF  479



>ref|XP_004289864.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   497 bits (1279),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 252/492 (51%), Positives = 343/492 (70%), Gaps = 14/492 (3%)
 Frame = +1

Query  61    DRYRERERFA-EMQKSL--SLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSG  231
             +R+  R     E+Q  +  S A+         +D+DGR KRTGT  T+++HIITA+IGSG
Sbjct  19    ERHDVRHYLQVEVQPKVGESEAINPQSNYSKCFDDDGRLKRTGTFWTSTSHIITAVIGSG  78

Query  232   VLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYL  402
             VLSLAWAIAQLG VAGP  +  F+++ LYT+ LLA CYR+ D   G+RNY+YMDAV+A L
Sbjct  79    VLSLAWAIAQLGWVAGPTVLALFAIVNLYTSNLLAMCYRAGDPVTGQRNYTYMDAVKANL  138

Query  403   GGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILI  582
             GG +V  CG+ QY  L G +IGY I +++S+ AI R+NCYHK G G + C  S    ++ 
Sbjct  139   GGRRVMLCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHKSG-GKDPCHMSSNGYMIT  197

Query  583   FGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG-  759
             FG +EV+ SQI +F+ +W+LSIVAA+MSF YS++G+ L   K+AG    + S+ G+ +G 
Sbjct  198   FGIIEVIFSQIKDFNEVWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGGFKGSLLGISIGT  257

Query  760   VNHS-----TKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGIL  924
             V HS     + +KM+ T  ALG IA A+ +SL+LI+IQDT++S P E + MK+A+   I 
Sbjct  258   VTHSGTVVTSTEKMWRTMQALGAIAFAYSYSLVLIEIQDTIRSPPAEHKTMKKATVFSIT  317

Query  925   SATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQP  1104
               T FY+LCG  GY AFG+ APGNLLT   GFY P+WL+D+ANV I+VHLVGA+QV  QP
Sbjct  318   VTTVFYMLCGCFGYAAFGDLAPGNLLTG-FGFYNPYWLLDIANVAIVVHLVGAFQVFCQP  376

Query  1105  VFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFF  1284
             +FAFVE WS  +W    F+T E+ I  PF G + ++LFRLVWRT FV+ TT+++M+ PFF
Sbjct  377   LFAFVEKWSAQKWPKSDFVTAEYDIPIPFYGVYQLNLFRLVWRTLFVILTTLISMLLPFF  436

Query  1285  NAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSIC  1464
             N ++G+LG+  FWPLT+YFPVEMYI+Q KI + S  W+ LQ+LS  C VVS++AAVGS  
Sbjct  437   NDVVGILGAFGFWPLTVYFPVEMYIAQQKIEKWSSRWLGLQMLSMSCLVVSIVAAVGSFA  496

Query  1465  DLAKSVMHFKPF  1500
              +   +  +KPF
Sbjct  497   GVVLDLKSYKPF  508



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/455 (55%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS++TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+ LSQ+P+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEIFLSQVPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S +LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSAVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTMFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+AN  I+VHLVGAYQV  QP+FAF+E     R+    F T E  IR P L + +  ++
Sbjct  335   LDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIRIPGLRSPYRANV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R  FVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRIVYRCIFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 333/467 (71%), Gaps = 12/467 (3%)
 Frame = +1

Query  118   VEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             VE G     K YD+DGR KRTGT+ TASAHIITA+IGSGVLSL WAIAQLG VAGP  M+
Sbjct  26    VENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVML  85

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
              FS++T YT+ LL+DCYRS D   GKRNY+YMDAV A L G++V+ CG  QYA +VG +I
Sbjct  86    LFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAI  145

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY I A++S+ AI R NC+H  G     C  S    ++IFGA ++  SQIP+F ++ +LS
Sbjct  146   GYTIAASISMLAIKRANCFHAKGH-VNPCHISSTPYMIIFGAAQIFFSQIPDFDQISWLS  204

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             IVAA+MSF YS+IG+ L  V++     V+ S+TG+ +GV  +  DK++ +  A G+IA A
Sbjct  205   IVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVV-TPMDKVWRSLQAFGDIAFA  263

Query  826   FGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             + +SLILI+IQDT+++ P  E + M++A+ + + + T FY+LCG +GY AFG+ APGNLL
Sbjct  264   YSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLL  323

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T   GFYEPFWL+D+AN  I+VHLVGAYQV  QP+FAFVE W++ RW    FI GE  + 
Sbjct  324   TG-FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS  382

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
             F     F V+LFRL WR+ FVV TTVV+M+ PFFN ++G LG++ FWPLT+YFPVEMYI 
Sbjct  383   F----GFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIV  438

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             Q KIPR    W+ LQ+LS  C V++V +A GS+  +   +  +KPF+
Sbjct  439   QKKIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKVYKPFS  485



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 333/467 (71%), Gaps = 12/467 (3%)
 Frame = +1

Query  118   VEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMV  294
             VE G     K YD+DGR KRTGT+ TASAHIITA+IGSGVLSL WAIAQLG VAGP  M+
Sbjct  20    VENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVML  79

Query  295   AFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASI  465
              FS++T YT+ LL+DCYRS D   GKRNY+YMDAV A L G++V+ CG  QYA +VG +I
Sbjct  80    LFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAI  139

Query  466   GYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLS  645
             GY I A++S+ AI R NC+H  G     C  S    ++IFGA ++  SQIP+F ++ +LS
Sbjct  140   GYTIAASISMLAIKRANCFHAKGH-VNPCHISSTPYMIIFGAAQIFFSQIPDFDQISWLS  198

Query  646   IVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALA  825
             IVAA+MSF YS+IG+ L  V++     V+ S+TG+ +GV  +  DK++ +  A G+IA A
Sbjct  199   IVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVV-TPMDKVWRSLQAFGDIAFA  257

Query  826   FGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLL  1002
             + +SLILI+IQDT+++ P  E + M++A+ + + + T FY+LCG +GY AFG+ APGNLL
Sbjct  258   YSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLL  317

Query  1003  TDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIR  1182
             T   GFYEPFWL+D+AN  I+VHLVGAYQV  QP+FAFVE W++ RW    FI GE  + 
Sbjct  318   TG-FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS  376

Query  1183  FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYIS  1362
             F     F V+LFRL WR+ FVV TTVV+M+ PFFN ++G LG++ FWPLT+YFPVEMYI 
Sbjct  377   F----GFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIV  432

Query  1363  QAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             Q KIPR    W+ LQ+LS  C V++V +A GS+  +   +  +KPF+
Sbjct  433   QKKIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKVYKPFS  479



>ref|NP_001066317.1| Os12g0181600 [Oryza sativa Japonica Group]
 gb|ABA95955.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29336.1| Os12g0181600 [Oryza sativa Japonica Group]
 dbj|BAG87950.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97363.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 255/473 (54%), Positives = 344/473 (73%), Gaps = 12/473 (3%)
 Frame = +1

Query  100   KSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVA  276
             K + ++VE G   +  + D+DGR++RTGT  TASAHIITA+IGSGVLSLAWAIAQLG VA
Sbjct  9     KPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVA  68

Query  277   GPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYAT  447
             GP  M+ F+ +  YT+ LLA+CYR+ D   GKRNY+YMDAVRA LGG +V FCGV QYA 
Sbjct  69    GPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYAN  128

Query  448   LVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFH  627
             LVG +IGY I +++S++AI R  C+H +G G + C  S    +++FGAV+++ SQIP+F 
Sbjct  129   LVGVAIGYTIASSISMRAIRRAGCFHHNGHG-DPCRSSSNPYMILFGAVQIVFSQIPDFD  187

Query  628   RLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSAL  807
             ++W+LSIVAA+MSF YS IG++L  V+      ++ S+TG+ +GV  S+  K++ +  A 
Sbjct  188   QIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSLQAF  247

Query  808   GNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
             G+IA A+ FS ILI+IQDT+K+ P  E + MK A+ + + + T FY+LCG +GY AFG+A
Sbjct  248   GDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAFGDA  307

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFIT  1164
             AP NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV VQP+FAFVE W+  RW    FI 
Sbjct  308   APDNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFVQPIFAFVERWASRRWPDSAFIA  366

Query  1165  GEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFP  1344
              E  +     G F++SLFRL WR+ FV  TTVVAM+ PFF  ++GLLG+++FWPLT+YFP
Sbjct  367   KELRV-----GPFALSLFRLTWRSAFVCLTTVVAMLLPFFGNVVGLLGAVSFWPLTVYFP  421

Query  1345  VEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             VEMYI+Q  +PR S  W+ L+ LS  C VVS+ AA GSI D+  ++  ++PF+
Sbjct  422   VEMYIAQRGVPRGSARWVSLKTLSACCLVVSIAAAAGSIADVIDALKVYRPFS  474



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/469 (53%), Positives = 333/469 (71%), Gaps = 9/469 (2%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPI  285
             + L  ++GG     YD+DGR KRTGTV TASAHIITA+IGSGVLSLAWAI QLG VAGP 
Sbjct  1     MELGHQQGGSK--CYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPA  58

Query  286   AMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVG  456
             AM+ FS +T YT+ LLADCYRS D   GKRNY+YMDAV+A L G +VK CG  QYA + G
Sbjct  59    AMLLFSYVTYYTSALLADCYRSCDPINGKRNYTYMDAVQANLNGFKVKLCGFIQYANIFG  118

Query  457   ASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLW  636
              SIGY I AA+S+ AI R+NC+H+ G  +  C  S    ++IFG  E+ LSQIP+F ++W
Sbjct  119   VSIGYTIAAAISMTAIKRSNCFHEKGH-SNPCQVSSNPYMIIFGVAEIFLSQIPDFDQIW  177

Query  637   FLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNI  816
             +LSI+AA+MSF YSSIG+ L  V++     ++ S+TG+ + V  S  DK++ +  A G+I
Sbjct  178   WLSILAAVMSFTYSSIGLTLGIVQVIKNGGIKGSLTGISIAV-VSPADKVWRSLQAFGDI  236

Query  817   ALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPG  993
             A A+ +SLILI+IQDT+K SP  E + MK+A+ + +   T FY+LCG +GY AFG+ APG
Sbjct  237   AFAYSYSLILIEIQDTIKESPPSEAKVMKKATLLSVAVTTIFYMLCGCMGYAAFGDMAPG  296

Query  994   NLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEH  1173
             NLLT   GFY+P+WL+D+AN  I++HLVGAYQV  QP+FAFVE W+   W    FIT   
Sbjct  297   NLLTG-FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWALQTWPESKFITKGI  355

Query  1174  TIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEM  1353
              +      ++ ++LFRL WRT FV+ TTV++M+ PFFN ++G LG++ FWPLT+YFPVEM
Sbjct  356   EVPLGPSRSYRLNLFRLTWRTVFVICTTVISMLLPFFNDVVGFLGALGFWPLTVYFPVEM  415

Query  1354  YISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             YI Q K+P+ S  W+ LQ+LS  C ++SV AA GSI  +   +  ++PF
Sbjct  416   YIVQKKVPKWSTKWVCLQLLSLACLIISVAAAAGSIAGVMNDLKVYRPF  464



>gb|EMT26484.1| hypothetical protein F775_32730 [Aegilops tauschii]
Length=490

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 325/449 (72%), Gaps = 5/449 (1%)
 Frame = +1

Query  163   RSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADC  342
             + +RTGTV TASAHIITA+IGSGVLSLAWA AQLG V GP+ ++ F+ IT YT+ LLADC
Sbjct  40    KQRRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVVGPVTLMLFAAITYYTSGLLADC  99

Query  343   YRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRT  513
             YR+ D   GKRNY+YMDAV +YL   QV  CGV QY  LVG +IGY ITA++S  AI + 
Sbjct  100   YRTGDAHTGKRNYTYMDAVASYLSRPQVWACGVFQYVNLVGTAIGYTITASISAAAINKA  159

Query  514   NCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIA  693
             NC+HK+GR  + C       +++FG V++  SQ+PNFH LW+LSI+AA+MSF Y+SI + 
Sbjct  160   NCFHKNGRAAD-CGVYDSMYMVVFGVVQIFFSQVPNFHDLWWLSILAAVMSFTYASIAVG  218

Query  694   LSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKS  873
             LS  +   G   + ++TG  VGV+  +  K++  F ALG+IA A+ +S+ILI+IQDT++S
Sbjct  219   LSLAQTISGPTGKATLTGTEVGVDVDSAQKIWLAFQALGDIAFAYSYSMILIEIQDTVRS  278

Query  874   SPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLAN  1053
              P E + MK+A+ +G+ + T FY+LCG LGY AFGN A GN+LT   GFYEP+WL+D AN
Sbjct  279   PPAENKTMKKATLVGVSTTTAFYMLCGCLGYAAFGNGAKGNILTG-FGFYEPYWLIDFAN  337

Query  1054  VCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWR  1233
             VCI+VHLVGAYQV  QP+FA VE ++ A W    FIT EH +       F+++LFRL WR
Sbjct  338   VCIVVHLVGAYQVFCQPIFAAVEGFAAATWPNAGFITREHRVAAGKRLGFNLNLFRLTWR  397

Query  1234  TGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQIL  1413
             T FV+ +T++A++ PFFN ILG LG+I FWPLT+YFPVEMYI Q  IPR +  W+ LQ L
Sbjct  398   TAFVIVSTLLAILMPFFNDILGFLGAIGFWPLTVYFPVEMYIRQRGIPRYTTRWVALQTL  457

Query  1414  SFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             SF CF+VS+ AAV SI  + +S+ ++ PF
Sbjct  458   SFLCFLVSLAAAVASIEGVTESLKNYVPF  486



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +TLY++ 
Sbjct  38    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSST  97

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  98    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  157

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+L SQIP+F ++W++SIVAA+MSF YS
Sbjct  158   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEILFSQIPDFDQIWWISIVAAVMSFTYS  216

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S +LI+IQ
Sbjct  217   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSAVLIEIQ  275

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  276   DTVRSPPAESKTMKKATKISIAVTTMFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  334

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN-FSVSL  1215
             +D+AN  I++HL+GAYQV  QP+FAF+E     R+    F T E  I+ P L + +  ++
Sbjct  335   LDIANAAIVIHLIGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPGLKSPYKANV  394

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  395   FRIVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  454

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C ++SV+A VGSI  +   +  +KPF
Sbjct  455   VCLQMLSVACLLISVVAGVGSIAGVMLDLKVYKPF  489



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   495 bits (1274),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 247/455 (54%), Positives = 335/455 (74%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHI+TA+IGSGVLSLAWAIAQLG +AGP  M+ FS++TLY++ 
Sbjct  37    FDDDGRLKRTGTVWTASAHIVTAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSST  96

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  97    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  156

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+LLSQIP+F ++W++SIVAA+MSF YS
Sbjct  157   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYS  215

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  216   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  274

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  275   DTVRSPPAESKTMKKATKISIAVTTVFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  333

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHL+GAYQV  QP+FAFVE     R+     +T E  I+ P F   +  ++
Sbjct  334   LDVANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDNDLVTKEFKIKVPGFKSPYRANV  393

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R  FVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  394   FRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  453

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  454   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  488



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   495 bits (1274),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 340/480 (71%), Gaps = 15/480 (3%)
 Frame = +1

Query  88    AEMQKSLSLAVEEGGGDDLK-YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQL  264
             A M++S   ++E G     K YD+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQL
Sbjct  8     ATMEES---SIELGHTAASKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQL  64

Query  265   GSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVA  435
             G VAGP  M+ FS +T YT+ LLADCYRS D   GKRNY+YMDAV A L G++V+ CG  
Sbjct  65    GWVAGPAVMLLFSFVTYYTSALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQLCGFL  124

Query  436   QYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQI  615
             QYA +VG +IGY I A++S+ AI R NC+H  G G + C  S    ++IFG  E+  SQI
Sbjct  125   QYANIVGVAIGYTIAASISMLAIKRANCFHVEGHG-DPCNISSTPYMIIFGVAEIFFSQI  183

Query  616   PNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFST  795
             P+F ++ +LSI+AA+MSF YS+IG+ L  V++     V+ S+TG+ VG   +  DK++ +
Sbjct  184   PDFDQISWLSILAAVMSFTYSTIGLGLGIVQVVANKGVQGSLTGISVGAV-TPLDKVWRS  242

Query  796   FSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLA  972
               A G+IA A+ +SLILI+IQDT+++ P  E + M++A+ + +   T FY+LCG +GY A
Sbjct  243   LQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATIVSVAVTTLFYMLCGCMGYAA  302

Query  973   FGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGV  1152
             FG+ APGNLLT   GFYEPFWL+D+AN  I+VHLVGAYQV  QP+FAFVE W++ RW   
Sbjct  303   FGDNAPGNLLTG-FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKS  361

Query  1153  WFITGEHTIRFPFLGN----FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAF  1320
              +ITGE  +     G     + ++LFRL WRT FVV TTVV+M+ PFFN ++GLLG++ F
Sbjct  362   SYITGEVDVPLSLAGAAGRCYKLNLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGF  421

Query  1321  WPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WPLT+YFPVEMYI Q K+PR S  W+ LQ+LS  C +++V +A GS+  +   +  +KPF
Sbjct  422   WPLTVYFPVEMYIVQKKVPRWSTLWVCLQLLSLGCLIITVASAAGSVAGIISDLKVYKPF  481



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   495 bits (1274),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 339/462 (73%), Gaps = 8/462 (2%)
 Frame = +1

Query  127   GGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSV  306
             G G  L +D+DGR KR GT+ TASAHIITA+IGSGVLSLAWA AQLG VAGPI M+ FS+
Sbjct  33    GSGSKL-FDDDGRLKRRGTMWTASAHIITAVIGSGVLSLAWATAQLGWVAGPIVMLLFSI  91

Query  307   ITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYII  477
             +T YT+ LLADCYRS D   GKRNY+YMDAV+A LGG+QVK CG+ QY  L G +IGY I
Sbjct  92    VTYYTSVLLADCYRSGDPVSGKRNYTYMDAVQANLGGLQVKICGLIQYLNLFGVAIGYTI  151

Query  478   TAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAA  657
              A++S+ AI R+NC+H+ G  ++ C  S    ++ FG  E++ SQIP+F ++W+LSIVAA
Sbjct  152   AASISMTAIKRSNCFHEKGEKSK-CDISTNPYMIAFGVAEIIFSQIPDFDQIWWLSIVAA  210

Query  658   LMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFS  837
             +MSF YS+IG+ L   K+A    V+ S+TG+ +GV   T DK++ +F ALG+IA A+ +S
Sbjct  211   VMSFTYSTIGLGLGIAKVAVNGQVKGSLTGISIGVVTQT-DKIWRSFQALGDIAFAYSYS  269

Query  838   LILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHG  1017
             +ILI+IQDT++S P E + M++A+ I ++  TFFY+LCG  GY AFG+ +PGNLLT   G
Sbjct  270   MILIEIQDTVRSPPSESKTMRKATLISVVVTTFFYMLCGCFGYAAFGDLSPGNLLTG-FG  328

Query  1018  FYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPF-L  1194
             FY PFWLVD+AN  I++HL+GAYQV  QP++AF+E  +   +    FIT E  I  P   
Sbjct  329   FYNPFWLVDIANAAIVIHLIGAYQVYCQPLYAFIEKIASENFPNSDFITKEILIPLPGGY  388

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
               + +++FRLVWRT FV+ TTV++M+ PFFN ++GLLG++ FWPLT+YFPVEMYISQ KI
Sbjct  389   KPYRLNMFRLVWRTIFVIVTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYISQKKI  448

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ S  WI LQ+LSF C ++++ AA GS+  +   +  +KPF
Sbjct  449   PKWSTKWICLQMLSFACLIITIAAAAGSVAGVILDLKSYKPF  490



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   494 bits (1273),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 329/462 (71%), Gaps = 6/462 (1%)
 Frame = +1

Query  124   EGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFS  303
              G G+   +D+DGR KR+G+V TASAHIITA+IGSGVLSLAWA AQLG +AGP  ++ FS
Sbjct  17    NGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPTVLLLFS  76

Query  304   VITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYI  474
              +T YT+ LLADCYRS D   GKRNY+YMDAVRA LGG+QVK CGV QY  L G ++GY 
Sbjct  77    FVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQVKICGVIQYVNLFGVAVGYT  136

Query  475   ITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVA  654
             I +++S+ A+ R++C+HKHG     C  S    +++FG +E++ SQIP+F ++W+LSIVA
Sbjct  137   IASSISMMAVKRSDCFHKHGH-RAACNVSSTPYMIMFGIIEIIFSQIPDFDQIWWLSIVA  195

Query  655   ALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGF  834
             A+MSF YS+IG+ L   K+A    +  S+TG+ +G   +   K++ +F ALG IA A+ +
Sbjct  196   AVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIG-TVTEMQKIWKSFQALGAIAFAYSY  254

Query  835   SLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDH  1014
             SLILI+IQDTLKS P E + MK A+ I +   T FY+LCG  GY AFG+ APGNLLT   
Sbjct  255   SLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTG-F  313

Query  1015  GFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFL  1194
             GFY P+WL+D+AN+ I+VHLVGAYQV  QP+FAFVE  +   +    FIT +  +  P  
Sbjct  314   GFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGY  373

Query  1195  GNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKI  1374
               F ++LFRLVWRT FV+ TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI Q KI
Sbjct  374   KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKI  433

Query  1375  PRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             P+ S  WI LQILS  C V+S+ AA GS   +   +  ++PF
Sbjct  434   PKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPF  475



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   494 bits (1273),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 245/455 (54%), Positives = 334/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M+ FS++TLY++ 
Sbjct  32    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPAVMLVFSLVTLYSST  91

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G +IGY I A++S+ 
Sbjct  92    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMM  151

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  152   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEILLSQVPDFDQIWWISIVAAVMSFTYS  210

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  211   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  269

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ + I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  270   DTVRSPPSESKTMKKATKLSIAITTIFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  328

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHL+GAYQV  QP+FAF E  +  R+     +T E   + P F   +  ++
Sbjct  329   LDIANAAIVVHLIGAYQVFSQPIFAFAEKSASERFPDNDLLTKELEFKIPGFRSPYKTNV  388

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R  FVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  389   FRVVFRCSFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  448

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  449   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  483



>ref|XP_006393747.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
 gb|ESQ31033.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
Length=477

 Score =   494 bits (1272),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 334/473 (71%), Gaps = 8/473 (2%)
 Frame = +1

Query  94    MQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSV  273
             ++  +S+ V      +L +DEDGR KRTGTV TASAHIITA+IGSGVLSLAWA+AQ+G V
Sbjct  5     LKNGVSMGVLPQNSSEL-FDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWV  63

Query  274   AGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYA  444
              GP  M+ FS++T YT+ LL  CYRS D   GKRNY+YMDA+ + LGG++VK CGV QY 
Sbjct  64    GGPAVMLLFSLVTYYTSILLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYV  123

Query  445   TLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNF  624
              L G +IGY I +A+S+ AI RT+C   +G   + C  +    ++ FG  +++ SQIP+F
Sbjct  124   NLFGTAIGYTIASAISMIAIQRTSCQQINGD-KDPCHVNGNPYMIGFGVAQIIFSQIPDF  182

Query  625   HRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSA  804
              +LW+LSI+AA+MSFGYS+IG+ L   ++    +++ ++TGV +G    T DK++ TF +
Sbjct  183   DQLWWLSILAAVMSFGYSTIGLGLGISRVVENKEIKGTLTGVSIGTVTPT-DKVWRTFQS  241

Query  805   LGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNA  984
             LGNIA A+ +S+ILI+IQDTLKS P E   MK+A+ I +   T FY+LCG +GY AFG+ 
Sbjct  242   LGNIAFAYAYSMILIEIQDTLKSPPAEENTMKKATLISVAVTTLFYMLCGCVGYAAFGDT  301

Query  985   APGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFIT  1164
             APGNLL    GF  P+WL+D+AN+ II+HLVGAYQV  QP+FAFVE  +  R+    FIT
Sbjct  302   APGNLLAQG-GFRNPYWLLDIANLAIIIHLVGAYQVYCQPLFAFVEKEASKRYPESKFIT  360

Query  1165  GEHTIR-FPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
              E  I  FP    F+++LFRLVWRT FV+ TT+++M+ PFFN +LGLLG+I FWPLT+YF
Sbjct  361   KETKIHLFPGSKPFNLNLFRLVWRTVFVIITTLISMLMPFFNDVLGLLGAIGFWPLTVYF  420

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEMYI Q  +PR    W+ LQ+LS  C VVS+ AA GS+  +   +  +KPF
Sbjct  421   PVEMYIVQKNVPRWGTRWVCLQVLSLACLVVSIAAAAGSVVGIVTDLKSYKPF  473



>gb|EAY82481.1| hypothetical protein OsI_37698 [Oryza sativa Indica Group]
Length=475

 Score =   494 bits (1271),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 345/476 (72%), Gaps = 12/476 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             ++ K + ++VE G   +  + D+DGR++RTGT  TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  6     KVVKPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLG  65

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              VAGP  M+ F+ +  YT+ LLA+CYR+ D   GKRNY+YMDAVRA LGG +V FCGV Q
Sbjct  66    WVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQ  125

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             YA LVG +IGY I +++S++AI R  C+H +G G + C  S    +++FG V+++ SQIP
Sbjct  126   YANLVGVAIGYTIASSISMRAIRRAGCFHHNGHG-DPCRSSSNPYMILFGVVQIVFSQIP  184

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             +F ++W+LSIVAA+MSF YS IG++L  V+      ++ S+TG+ +GV  S+  K++ + 
Sbjct  185   DFDQIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSL  244

Query  799   SALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAF  975
              A G+IA A+ FS ILI+IQDT+K+ P  E + MK A+ + + + T FY+LCG +GY AF
Sbjct  245   QAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAF  304

Query  976   GNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVW  1155
             G+AAP NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV VQP+FAFVE W+  RW    
Sbjct  305   GDAAPDNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFVQPIFAFVERWASRRWPDSA  363

Query  1156  FITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             FI  E  +     G F++SLFRL WR+ FV  TTVVAM+ PFF  ++GLLG+++FWPLT+
Sbjct  364   FIAKELRV-----GPFALSLFRLTWRSAFVCLTTVVAMLLPFFGNVVGLLGAVSFWPLTV  418

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             YFPVEMYI+Q  +PR S  WI L+ LS  C VVS+ AA GSI D+  ++  ++PF+
Sbjct  419   YFPVEMYIAQRGVPRGSARWISLKTLSACCLVVSIAAAAGSIADVIDALKVYRPFS  474



>ref|XP_007137763.1| hypothetical protein PHAVU_009G153700g [Phaseolus vulgaris]
 gb|ESW09757.1| hypothetical protein PHAVU_009G153700g [Phaseolus vulgaris]
Length=486

 Score =   494 bits (1272),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 251/487 (52%), Positives = 331/487 (68%), Gaps = 15/487 (3%)
 Frame = +1

Query  64    RYRERERFAEMQKSLSLAVEEGGG-----DDLKYDEDGRSKRTGTVLTASAHIITAIIGS  228
              Y  R   +   + L +      G     D   YD+DG  KRTG + T S+HIITA++GS
Sbjct  3     EYSSRTNPSHHHQGLGMEAHSIDGVSSQTDSKFYDDDGHVKRTGNLWTTSSHIITAVVGS  62

Query  229   GVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAY  399
             GVLSLAWA+AQ+G V GP  M+ FSV+TLYT  LLADCYRS D   GKRNY++MDAV+  
Sbjct  63    GVLSLAWAMAQMGWVVGPAVMIFFSVVTLYTTALLADCYRSGDPISGKRNYTFMDAVQTI  122

Query  400   LGGVQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSIL  579
             LG     FCGV QY+ L G ++GY I A++S+ AI ++NC+H  GR    C  S    ++
Sbjct  123   LGRHYDTFCGVIQYSNLYGTAVGYTIAASISMMAIKKSNCFHSSGRDGP-CQISSNPFMI  181

Query  580   IFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVG  759
              FG ++++ SQIP+FH+ W+LSIVAA+MSF YS IG++L   K+A     + S+TG+ +G
Sbjct  182   GFGIIQIVFSQIPDFHKTWWLSIVAAVMSFAYSIIGLSLGIAKVAE-TGFKGSLTGIKIG  240

Query  760   VNHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFF  939
                 T+ K++  F  LG+IA A+ +S ILI+IQDT+KS P E + MK+A+ + I   T F
Sbjct  241   AVTETQ-KVWGVFQGLGDIAFAYSYSQILIEIQDTIKSPPSEAKTMKKAAKLSIGVTTTF  299

Query  940   YLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFV  1119
             Y+LCG +GY AFG+ APGNLLT   GFY+P+WLVD+AN  I++HLVGAYQV  QP+FAFV
Sbjct  300   YMLCGFMGYAAFGDTAPGNLLTG-FGFYDPYWLVDIANAAIVIHLVGAYQVYSQPLFAFV  358

Query  1120  ECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILG  1299
             E W   RW  V     E+ +  P    +++S FRLVWRTGFV+ TT+VAM+ PFFN ILG
Sbjct  359   EKWVSKRWPNV---DKEYKVPIPGFAPYNLSPFRLVWRTGFVIITTIVAMLIPFFNDILG  415

Query  1300  LLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKS  1479
             LLG++ FWPL++YFPVEM I Q KIP+ S  WI +QILSF C VVSV AA+GSI  +   
Sbjct  416   LLGALGFWPLSVYFPVEMSIKQKKIPKWSQRWIGMQILSFVCLVVSVAAAIGSIASIVVD  475

Query  1480  VMHFKPF  1500
             +  +KPF
Sbjct  476   LQKYKPF  482



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   493 bits (1270),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 327/459 (71%), Gaps = 5/459 (1%)
 Frame = +1

Query  133   GDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVIT  312
             G+   +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWA AQLG VAGP  ++ FS +T
Sbjct  15    GESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFSFVT  74

Query  313   LYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITA  483
              YT+ LL+DCYR+ D   GKRNY+YMDAVRA LGG QVK CGV QYA L G +IGY I A
Sbjct  75    YYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAA  134

Query  484   AMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALM  663
             ++S+ A+ R+NC+HK G     C  S    ++IFG +E++ SQIP+F ++ +LSIVAA+M
Sbjct  135   SISMVAVNRSNCFHKQGH-RAACNVSSTPYMIIFGVMEIIFSQIPDFDQISWLSIVAAVM  193

Query  664   SFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLI  843
             SF YS+IG+ L   ++A    +E S+TG+ +G   +   K++ +F ALG IA A+ +SLI
Sbjct  194   SFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAIAFAYSYSLI  253

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             LI+IQDTLKS P E + MK+A+ I +   T FY+LCG  GY AFG+ +PGNLLT   GFY
Sbjct  254   LIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTG-FGFY  312

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
              P+WL+D+ANV I+VHLVGAYQV  QP+FAFVE  +   +     IT E  +  P    F
Sbjct  313   NPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTATEWYPDSKIITKEIDVPIPGFKPF  372

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              ++LFRLVWRT FV+ TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI Q +I + 
Sbjct  373   KLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKW  432

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             S  WI LQILS  C V+S+ AA GS   +A  +  ++PF
Sbjct  433   SGRWICLQILSGACLVISIAAAAGSFAGVASDLKVYRPF  471



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   494 bits (1271),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 339/473 (72%), Gaps = 9/473 (2%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGS  270
             +++ S+   V         YD+DGR KRTG+V TAS+HIITA+IGSGVLSLAWAIAQLG 
Sbjct  16    DIEGSMDGVVSHLDSTSKSYDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAWAIAQLGW  75

Query  271   VAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQY  441
             +AGP  M+ FS++T+YT+  LADCYRS D   GKRNY+YMDAVR+ LGGV V FCG+ QY
Sbjct  76    IAGPAVMILFSMVTIYTSSFLADCYRSGDLNSGKRNYTYMDAVRSILGGVNVTFCGIFQY  135

Query  442   ATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPN  621
               L G  IGY I A++S+ AI R+NC+H+ G G   C  S    ++IFG  E+ LSQIP+
Sbjct  136   LNLFGIVIGYTIAASISMTAIKRSNCFHQSG-GKNPCHMSSNQYMIIFGITEIFLSQIPD  194

Query  622   FHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFS  801
             F ++W+LS VAA+MSF YS IG+AL   K+A    +  S+TG+ +G    T+ K++ T  
Sbjct  195   FDQIWWLSSVAAIMSFTYSIIGLALGIAKVAENGSIMGSLTGISIGTVSETQ-KIWRTSQ  253

Query  802   ALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGN  981
             ALG+IA A+ ++++LI+IQDTLKS P E ++MK+A+ I I   T FY+LCG +GY AFG+
Sbjct  254   ALGDIAFAYSYAVVLIEIQDTLKSPPSEAKSMKKATKISIAVTTTFYMLCGCMGYAAFGD  313

Query  982   AAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFI  1161
             A+PGNLLT   GFY P+WL+D+AN  I+VHLVGAYQV  QP+FAFVE  +  RW     I
Sbjct  314   ASPGNLLTG-FGFYNPYWLIDIANAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPN---I  369

Query  1162  TGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYF  1341
               E  I  P +  + ++LFRLVWRT FVV TTV++M+ PFFN I+G++G++ FWPLT+YF
Sbjct  370   EKEFKIAVPGVPPYKLNLFRLVWRTVFVVLTTVISMLLPFFNDIVGVIGALGFWPLTVYF  429

Query  1342  PVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             PVEMYISQ +IP+ S  WIWLQI S  C VVSV+AAVGS+  +   +  +KPF
Sbjct  430   PVEMYISQKRIPKWSNRWIWLQIFSVACLVVSVVAAVGSVAGVLLDLKKYKPF  482



>ref|XP_004977211.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=477

 Score =   493 bits (1270),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 253/471 (54%), Positives = 342/471 (73%), Gaps = 12/471 (3%)
 Frame = +1

Query  106   LSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGP  282
             + ++VE G G   ++ D+DGR +RTGTV TASAHIITA+IGSGVLSLAWAIAQLG VAGP
Sbjct  13    MEVSVEAGNGGAAEWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWVAGP  72

Query  283   IAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLV  453
              AM+ F+ +T YTA LLA+CYR+ D   GKRNY+YMDAVR+ LGG +V FCG+ QYA LV
Sbjct  73    AAMLLFAFVTYYTATLLAECYRTGDPDTGKRNYTYMDAVRSNLGGAKVAFCGIIQYANLV  132

Query  454   GASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRL  633
             G +IGY I +++S+QAI R  C+HK+G G   C  S    +++FG  ++L SQIP+F ++
Sbjct  133   GVAIGYTIASSISMQAIRRAGCFHKNGHGVP-CKSSSNPYMILFGITQILFSQIPDFDQI  191

Query  634   WFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGN  813
             W+LSIVAA+MSF YSSIG+AL   +       + S+TG+ +G + ++  K++ +  A G+
Sbjct  192   WWLSIVAAVMSFTYSSIGLALGIAQTVSNGGFKGSLTGISIGADVTSTQKIWHSLQAFGD  251

Query  814   IALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAP  990
             IA A+ FS ILI+IQDT+K+ P  E + M++A+ + + + T FY+LCG +GY AFG+ AP
Sbjct  252   IAFAYSFSNILIEIQDTIKAPPPSESKVMQKATRLSVATTTIFYMLCGCMGYAAFGDNAP  311

Query  991   GNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGE  1170
              NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV  QP+FAFVE  + A W    FI+ E
Sbjct  312   DNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFCQPIFAFVERRAAAAWPDSAFISKE  370

Query  1171  HTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVE  1350
               +     G F++SLFRL WR+ FV  TTVVAM+ PFF  ++G LG+++FWPLT+YFPVE
Sbjct  371   LRV-----GPFALSLFRLTWRSAFVCVTTVVAMLLPFFGNVVGFLGAVSFWPLTVYFPVE  425

Query  1351  MYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             MYI Q ++PR+S  WI LQ LS  C +VS+ AA GSI D+  ++  ++PF+
Sbjct  426   MYIKQRRVPRMSTKWICLQTLSITCLLVSIAAAAGSIADVIAALKVYRPFS  476



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   493 bits (1270),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 329/456 (72%), Gaps = 10/456 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTG+V TASAHIITA+IGSGVLSLAWA+AQLG +AGPI M+ FS +T YT+ 
Sbjct  28    FDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGPIVMILFSFVTYYTSA  87

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   GKRNY+YMDAV+A LGG+QVK CG  QYA L G +IGY I +++S+ 
Sbjct  88    LLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVKICGWIQYANLFGVAIGYTIASSISMI  147

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HKHG     C  S    +++FG +E++ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  148   AIKRSNCFHKHGDQAP-CQVSSTPYMIMFGIIEIIFSQIPDFDQIWWLSIVAAVMSFTYS  206

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L   K+A    +  S+TG+ +G   +   K++ +F ALG IA A+ +SLILI+IQ
Sbjct  207   TIGLGLGVAKVAETGKIGGSLTGISIG-TVTEMQKIWKSFQALGAIAFAYSYSLILIEIQ  265

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DTLKS P E + MK A+ I +   T FY+LCG  GY AFG+ APGNLLT   GFY P+WL
Sbjct  266   DTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFGYAAFGDLAPGNLLTG-FGFYNPYWL  324

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG--NFSVS  1212
             +D+AN+ I+VHLVGAYQV  QP+FAF+E  +   +    FI  E  I  P +G  +F ++
Sbjct  325   LDIANIAIVVHLVGAYQVYCQPLFAFIEKTAAEWYPESKFIAKE--ISVPIIGYKSFKLN  382

Query  1213  LFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFT  1392
             LFR++WRT FV+ TTV++M+ PFFN I+G+LG+  FWPLT+YFPVEMYI Q KI + S  
Sbjct  383   LFRIIWRTIFVIITTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKITKWSTK  442

Query  1393  WIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             WI LQ+LS  C ++S+ AA GS   +   +  +KPF
Sbjct  443   WICLQMLSVACLIISIAAAAGSFAGVVSDLQVYKPF  478



>ref|NP_001066316.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|ABA95951.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29335.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|EAZ19852.1| hypothetical protein OsJ_35437 [Oryza sativa Japonica Group]
 dbj|BAG87933.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93965.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   493 bits (1269),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 254/476 (53%), Positives = 345/476 (72%), Gaps = 12/476 (3%)
 Frame = +1

Query  91    EMQKSLSLAVEEGGGDDLKY-DEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLG  267
             ++ K + ++VE G   +  + D+DGR++RTGT  TASAHIITA+IGSGVLSLAWAIAQLG
Sbjct  6     KVVKPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLG  65

Query  268   SVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQ  438
              VAGP  M+ F+ +  YT+ LLA+CYR+ D   GKRNY+YMDAVRA LGG +V FCGV Q
Sbjct  66    WVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQ  125

Query  439   YATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIP  618
             YA LVG +IGY I +++S++AI R  C+H +G G + C  S    +++FG V+++ SQIP
Sbjct  126   YANLVGVAIGYTIASSISMRAIRRAGCFHHNGHG-DPCRSSSNPYMILFGVVQIVFSQIP  184

Query  619   NFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTF  798
             +F ++W+LSIVAA+MSF YS IG++L  V+      ++ S+TG+ +GV  S+  K++ + 
Sbjct  185   DFDQIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSL  244

Query  799   SALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAF  975
              A G+IA A+ FS ILI+IQDT+K+ P  E + MK A+ + + + T FY+LCG +GY AF
Sbjct  245   QAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAF  304

Query  976   GNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVW  1155
             G+AAP NLLT   GFYEPFWL+D+ANV I+VHLVGAYQV VQP+FAFVE W+  RW    
Sbjct  305   GDAAPDNLLTG-FGFYEPFWLLDVANVAIVVHLVGAYQVFVQPIFAFVERWASRRWPDSA  363

Query  1156  FITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTI  1335
             FI  E  +     G F++SLFRL WR+ FV  TTVVAM+ PFF  ++GLLG+++FWPLT+
Sbjct  364   FIAKELRV-----GPFALSLFRLTWRSAFVCLTTVVAMLLPFFGNVVGLLGAVSFWPLTV  418

Query  1336  YFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPFA  1503
             YFPVEMYI+Q  +PR S  W+ L+ LS  C VVS+ AA GSI D+  ++  ++PF+
Sbjct  419   YFPVEMYIAQRGVPRGSARWVSLKTLSACCLVVSIAAAAGSIADVIDALKVYRPFS  474



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 326/460 (71%), Gaps = 11/460 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TA++HIITA+IGSGVLSLAWAIAQLG +AGPI M+ F+ +  YT+ 
Sbjct  52    FDDDGRLKRTGTVWTATSHIITAVIGSGVLSLAWAIAQLGWIAGPIVMILFAFVIYYTSN  111

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYRS D   G+RNY+Y DAVR+ LGG +VK CG  QY  L G +IGY I A++S+ 
Sbjct  112   LLSDCYRSGDPVTGRRNYTYTDAVRSNLGGAKVKICGAIQYVNLFGVAIGYTIAASISMM  171

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H  G G + C  S    ++IFG  E++ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  172   AIKRSNCFHASG-GKDPCHMSSNMYMIIFGITEIVFSQIPDFDQVWWLSIVAAVMSFTYS  230

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGV-----NHSTKDKMFSTFSALGNIALAFGFSLI  843
             ++G+ L   K A       S+ G+ +G        +   K++    ALG+IA A+ +S+I
Sbjct  231   TVGLGLGVTKTAENGSFRGSLMGISIGTVTKAGTVTATQKIWRNLQALGDIAFAYSYSII  290

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             LI+IQDT+KS P E + M++A+ + I+  T FY+LCG +GY AFG+ APGNLLT   GFY
Sbjct  291   LIEIQDTIKSPPAENKTMRKATLLSIVVTTVFYMLCGCMGYAAFGDDAPGNLLTG-FGFY  349

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLG-N  1200
              P+WL+D+AN+ I+VHLVGAYQV  QP+FAFVE WS  RW     IT E+  R P  G  
Sbjct  350   NPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEKWSAKRWPKSELITHEYEARIPCTGAT  409

Query  1201  FSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPR  1380
             + ++LFRLVWRT FVV TTV++M+ PFFN ++G+LG+  FWPLT+YFPVEMYI+Q KI  
Sbjct  410   YKLNLFRLVWRTAFVVLTTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIRP  469

Query  1381  LSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
              S  W+ LQ+LSF C VVS+ AA GS+  +   +  ++PF
Sbjct  470   WSSRWVGLQLLSFTCLVVSLAAACGSMAGVVLDLKSYRPF  509



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/483 (51%), Positives = 335/483 (69%), Gaps = 9/483 (2%)
 Frame = +1

Query  64    RYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSL  243
             +Y +   F  M+ ++ L  ++G      +D DGR KRTGTV TAS+HIITA+IGSGVLSL
Sbjct  8     KYHQHANFTPMEVAIELGHQQGSSK--CFDNDGRLKRTGTVWTASSHIITAVIGSGVLSL  65

Query  244   AWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQ  414
             AWAI QLG VAGP AM+ FS +T YT+ LL+DCYRS D   GKRNY+YMDAV A L G +
Sbjct  66    AWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHANLNGFK  125

Query  415   VKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAV  594
             VK CG  QYA + G SIGY I A++S+ AI R+NC+H+ G     C  S    +++FG  
Sbjct  126   VKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNP-CQASSNPYMIMFGVA  184

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHST  774
             E+L SQIP+F ++W+LSI+AA+MSF YSSIG+AL  V++     ++ S+TG+ + V   T
Sbjct  185   EILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISIAVVSPT  244

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLC  951
              DK++ +  A G+IA A+ +SLILI+IQDT+K +P  E + MK+A+ + +   T FY+LC
Sbjct  245   -DKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTIFYMLC  303

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G +GY AFG+ APGNLLT   GFY+P+WL+D+AN  I++HLVGAYQV  QP+FAFVE W+
Sbjct  304   GCMGYAAFGDMAPGNLLTG-FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWA  362

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
                W    FIT E  +       + ++  RL WRT FV+ TTV++M+ PFFN ++GLLG+
Sbjct  363   LQTWPDSKFITKEVEVPLGPSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVVGLLGA  422

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
             + FWPLT+YFPVEMYI Q K+P+ S  W+ LQ+LS  C  +SV AA GSI  +   +  +
Sbjct  423   LGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVNDLKVY  482

Query  1492  KPF  1500
             +PF
Sbjct  483   QPF  485



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/459 (54%), Positives = 332/459 (72%), Gaps = 10/459 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGT  TA++HIITA+IGSGVLSLAWAI QLG VAGP  M+ F+ + LYT+ 
Sbjct  62    FDDDGRLKRTGTFWTAASHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFAFVNLYTSN  121

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLA CYR+ D   G RNY+YMDAV+A LGG +V FCG+ QY  L G +IGY I A++S+ 
Sbjct  122   LLAQCYRTGDPVKGHRNYTYMDAVKANLGGKKVFFCGLIQYLNLFGVAIGYTIAASVSMM  181

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+H  G G + C  S    ++ FG  EV+ SQIP+F ++W+LSIVAA+MSF YS
Sbjct  182   AIKRSNCFHASG-GKDPCHMSSNGYMIAFGITEVIFSQIPDFDQIWWLSIVAAIMSFTYS  240

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVG-VNH----STKDKMFSTFSALGNIALAFGFSLI  843
             ++G+ L   K+AG   V+ S+TG+ +G V H    +   K++ +F ALG IA A+ +S+I
Sbjct  241   TVGLGLGIGKVAGNGAVKGSLTGISIGTVTHAGLVTATQKLWRSFQALGAIAFAYSYSVI  300

Query  844   LIDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFY  1023
             LI+IQDT+KS P E + MK+A++  I   T FYLLCG +GY AFG++APGNLLT   GFY
Sbjct  301   LIEIQDTVKSPPAEYKTMKKATTFSIAVTTIFYLLCGCMGYAAFGDSAPGNLLTG-FGFY  359

Query  1024  EPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNF  1203
              P+WL+D+AN+ IIVHLVGAYQV  QP+FAFVE WS  +W    F+T E+ I  P  G +
Sbjct  360   NPYWLLDIANIAIIVHLVGAYQVYCQPLFAFVEKWSAHKWPKNDFVTAEYEIPIPHCGVY  419

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              ++ FR+VWR+ FV+ TT++AM+ PFFN I+GLLG++ FWPLT+YFP+EMYISQ KI + 
Sbjct  420   RLNFFRIVWRSIFVIVTTLIAMLMPFFNDIVGLLGALGFWPLTVYFPIEMYISQKKIGQW  479

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             +  WI LQILS  C  +++ AAVGS+  +   +  +KPF
Sbjct  480   TSRWIALQILSVCCLFITIAAAVGSVAGVVLDLKTYKPF  518



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/455 (54%), Positives = 333/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +T Y++ 
Sbjct  17    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTYYSST  76

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G ++GY I A++S+ 
Sbjct  77    LLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMM  136

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G   C  S    +++FG  E+LLSQIP+F ++W+LSIVAA+MSF YS
Sbjct  137   AIKRSNCFHKSG-GKNPCHMSSNPYMIMFGLTEILLSQIPDFDQIWWLSIVAAVMSFTYS  195

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG++L  +++      + S+TG+ +G    T+ K++ +F ALG+IA A+ +S++LI+IQ
Sbjct  196   AIGLSLGILQVTANGFFKGSLTGISIGTVTETQ-KIWRSFQALGDIAFAYSYSVVLIEIQ  254

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E + MK+A+ I I   T FY+LCG +GY AFG+ APGNLLT   G+YEPFWL
Sbjct  255   DTVRSPPAESKTMKKATRISIAVTTMFYMLCGCMGYAAFGDFAPGNLLTG-FGYYEPFWL  313

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I++HLVGAYQV  QP+FAFVE W   R+ G   +  E  IR P F   +  ++
Sbjct  314   LDVANAAIVIHLVGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVPGFRAPYRANV  373

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR V+R+GFVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMY+ Q K+ R S  W
Sbjct  374   FRAVFRSGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQRKVERWSVRW  433

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  434   VCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPF  468



>ref|XP_007137762.1| hypothetical protein PHAVU_009G153700g [Phaseolus vulgaris]
 gb|ESW09756.1| hypothetical protein PHAVU_009G153700g [Phaseolus vulgaris]
Length=468

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/458 (54%), Positives = 324/458 (71%), Gaps = 10/458 (2%)
 Frame = +1

Query  136   DDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITL  315
             D   YD+DG  KRTG + T S+HIITA++GSGVLSLAWA+AQ+G V GP  M+ FSV+TL
Sbjct  14    DSKFYDDDGHVKRTGNLWTTSSHIITAVVGSGVLSLAWAMAQMGWVVGPAVMIFFSVVTL  73

Query  316   YTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAA  486
             YT  LLADCYRS D   GKRNY++MDAV+  LG     FCGV QY+ L G ++GY I A+
Sbjct  74    YTTALLADCYRSGDPISGKRNYTFMDAVQTILGRHYDTFCGVIQYSNLYGTAVGYTIAAS  133

Query  487   MSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMS  666
             +S+ AI ++NC+H  GR    C  S    ++ FG ++++ SQIP+FH+ W+LSIVAA+MS
Sbjct  134   ISMMAIKKSNCFHSSGRDGP-CQISSNPFMIGFGIIQIVFSQIPDFHKTWWLSIVAAVMS  192

Query  667   FGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLIL  846
             F YS IG++L   K+A     + S+TG+ +G    T+ K++  F  LG+IA A+ +S IL
Sbjct  193   FAYSIIGLSLGIAKVAE-TGFKGSLTGIKIGAVTETQ-KVWGVFQGLGDIAFAYSYSQIL  250

Query  847   IDIQDTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYE  1026
             I+IQDT+KS P E + MK+A+ + I   T FY+LCG +GY AFG+ APGNLLT   GFY+
Sbjct  251   IEIQDTIKSPPSEAKTMKKAAKLSIGVTTTFYMLCGFMGYAAFGDTAPGNLLTG-FGFYD  309

Query  1027  PFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGNFS  1206
             P+WLVD+AN  I++HLVGAYQV  QP+FAFVE W   RW  V     E+ +  P    ++
Sbjct  310   PYWLVDIANAAIVIHLVGAYQVYSQPLFAFVEKWVSKRWPNV---DKEYKVPIPGFAPYN  366

Query  1207  VSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLS  1386
             +S FRLVWRTGFV+ TT+VAM+ PFFN ILGLLG++ FWPL++YFPVEM I Q KIP+ S
Sbjct  367   LSPFRLVWRTGFVIITTIVAMLIPFFNDILGLLGALGFWPLSVYFPVEMSIKQKKIPKWS  426

Query  1387  FTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
               WI +QILSF C VVSV AA+GSI  +   +  +KPF
Sbjct  427   QRWIGMQILSFVCLVVSVAAAIGSIASIVVDLQKYKPF  464



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/483 (51%), Positives = 335/483 (69%), Gaps = 9/483 (2%)
 Frame = +1

Query  64    RYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVLSL  243
             +Y +   F  M+ ++ L  ++G      +D DGR KRTGTV TAS+HIITA+IGSGVLSL
Sbjct  11    KYHQHANFTPMEVAIELGHQQGSSK--CFDNDGRLKRTGTVWTASSHIITAVIGSGVLSL  68

Query  244   AWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGGVQ  414
             AWAI QLG VAGP AM+ FS +T YT+ LL+DCYRS D   GKRNY+YMDAV A L G +
Sbjct  69    AWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHANLNGFK  128

Query  415   VKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFGAV  594
             VK CG  QYA + G SIGY I A++S+ AI R+NC+H+ G     C  S    +++FG  
Sbjct  129   VKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNP-CQASSNPYMIMFGVA  187

Query  595   EVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGVNHST  774
             E+L SQIP+F ++W+LSI+AA+MSF YSSIG+AL  V++     ++ S+TG+ + V   T
Sbjct  188   EILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISIAVVSPT  247

Query  775   KDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSP-RERRAMKQASSIGILSATFFYLLC  951
              DK++ +  A G+IA A+ +SLILI+IQDT+K +P  E + MK+A+ + +   T FY+LC
Sbjct  248   -DKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTIFYMLC  306

Query  952   GILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFAFVECWS  1131
             G +GY AFG+ APGNLLT   GFY+P+WL+D+AN  I++HLVGAYQV  QP+FAFVE W+
Sbjct  307   GCMGYAAFGDMAPGNLLTG-FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWA  365

Query  1132  RARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGS  1311
                W    FIT E  +       + ++  RL WRT FV+ TTV++M+ PFFN ++GLLG+
Sbjct  366   LQTWPDSKFITKEVEVPLGPSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVVGLLGA  425

Query  1312  IAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHF  1491
             + FWPLT+YFPVEMYI Q K+P+ S  W+ LQ+LS  C  +SV AA GSI  +   +  +
Sbjct  426   LGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVNDLKVY  485

Query  1492  KPF  1500
             +PF
Sbjct  486   QPF  488



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   493 bits (1269),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 333/455 (73%), Gaps = 7/455 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             +D+DGR KRTGTV TASAHIITA+IGSGVLSLAWAIAQLG +AGP  M+ FS +TLY++ 
Sbjct  32    FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSST  91

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LL+DCYR+ D   GKRNY+YMDAVR+ LGG + K CG+ QY  L G ++GY I A++S+ 
Sbjct  92    LLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMM  151

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI R+NC+HK G G + C  S    ++IFG  E+LLSQ+P+F ++W++SIVAA+MSF YS
Sbjct  152   AIKRSNCFHKSG-GKDPCHMSSNPYMIIFGVTEILLSQVPDFDQIWWISIVAAVMSFTYS  210

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+AL  V++A     + S+TG+ +G    T+ K++ TF ALG+IA A+ +S++LI+IQ
Sbjct  211   AIGLALGIVQVAANGVFKGSLTGISIGTVTQTQ-KIWRTFQALGDIAFAYSYSVVLIEIQ  269

Query  859   DTLKSSPRERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWL  1038
             DT++S P E   MK+A+ I I   T FY+LCG +GY AFG+AAPGNLLT   GFY PFWL
Sbjct  270   DTVRSPPSESTTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNLLTG-FGFYNPFWL  328

Query  1039  VDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFP-FLGNFSVSL  1215
             +D+AN  I+VHL+GAYQV  QP+FAFVE     R+     +T E  I+ P F   +  ++
Sbjct  329   LDIANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDSDLLTKELQIKIPGFRSPYKTNV  388

Query  1216  FRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTW  1395
             FR+V+R  FVV TTV++M+ PFFN ++G+LG++ FWPLT+YFPVEMYI Q K+ + S  W
Sbjct  389   FRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRW  448

Query  1396  IWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             + LQ+LS  C V+SV+A VGSI  +   +  +KPF
Sbjct  449   VCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPF  483



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   494 bits (1272),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 340/489 (70%), Gaps = 12/489 (2%)
 Frame = +1

Query  58    IDRYRERERFAEMQKSLSLAVEEGGGDDLKYDEDGRSKRTGTVLTASAHIITAIIGSGVL  237
             I  Y + E   + + S S A+         +D+DGR KRTGT  T+++HIITA+IGSGVL
Sbjct  26    IRHYLQVE--VQPKVSESKAINPQSNYSTCFDDDGRLKRTGTFWTSASHIITAVIGSGVL  83

Query  238   SLAWAIAQLGSVAGPIAMVAFSVITLYTAFLLADCYRSPD---GKRNYSYMDAVRAYLGG  408
             SLAWAIAQLG VAGP  ++ F+ + LYT+ LLA CYR+ +   G+RNY+YMDAV+A LGG
Sbjct  84    SLAWAIAQLGWVAGPTVLLLFAFVNLYTSNLLAMCYRTGNPITGQRNYTYMDAVKANLGG  143

Query  409   VQVKFCGVAQYATLVGASIGYIITAAMSLQAIVRTNCYHKHGRGTEGCIPSKRSSILIFG  588
              +V  CG+ QY  L G +IGY I +++S+ AI R+NCYH+ G G + C  S    ++ FG
Sbjct  144   RKVMMCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHRSG-GRDPCHMSSNGYMITFG  202

Query  589   AVEVLLSQIPNFHRLWFLSIVAALMSFGYSSIGIALSAVKIAGGVDVETSVTGVPVGV--  762
              +EV+ SQIP+F+++W+LSIVAA+MSF YSS+G+ L   K+AG    + S+ G+ +G   
Sbjct  203   IIEVIFSQIPDFNQVWWLSIVAAIMSFTYSSVGLGLGIXKVAGNGSFKGSLLGISIGTVT  262

Query  763   ---NHSTKDKMFSTFSALGNIALAFGFSLILIDIQDTLKSSPRERRAMKQASSIGILSAT  933
                  ++  K++ +  ALG IA A+ +SL+LI+IQDT++S P E + MK+A+   I   T
Sbjct  263   KSGTVTSTQKIWRSMQALGAIAFAYSYSLVLIEIQDTIRSPPXEHKTMKKATVFSIAITT  322

Query  934   FFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFWLVDLANVCIIVHLVGAYQVVVQPVFA  1113
              FYLLCG  GY AFG+ APGNLLT   GFY P+WL+D+ANV I+VHLVGA+QV  QP+FA
Sbjct  323   VFYLLCGCFGYAAFGDLAPGNLLTG-FGFYNPYWLLDIANVAIVVHLVGAFQVFCQPLFA  381

Query  1114  FVECWSRARWGGVWFITGEHTIRFPFLGNFSVSLFRLVWRTGFVVFTTVVAMIFPFFNAI  1293
             FVE WS  RW    F+T E+ I  PF G + ++LFRLVWRT FV+ TT+++M+ PFFN +
Sbjct  382   FVEKWSAKRWPNSDFVTAEYEIPIPFYGVYQLNLFRLVWRTIFVIITTLISMLLPFFNDV  441

Query  1294  LGLLGSIAFWPLTIYFPVEMYISQAKIPRLSFTWIWLQILSFFCFVVSVLAAVGSICDLA  1473
             +G+LG+  FWPLT+YFPVEMYI+Q KI + S  W+ LQ+LS  C  VS+ AAVGS+  + 
Sbjct  442   VGILGAFGFWPLTVYFPVEMYIAQEKIRKWSSKWVGLQMLSVSCLFVSIAAAVGSVAGVV  501

Query  1474  KSVMHFKPF  1500
               +  +KPF
Sbjct  502   LDLQTYKPF  510



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   493 bits (1269),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 244/459 (53%), Positives = 331/459 (72%), Gaps = 11/459 (2%)
 Frame = +1

Query  148   YDEDGRSKRTGTVLTASAHIITAIIGSGVLSLAWAIAQLGSVAGPIAMVAFSVITLYTAF  327
             YD+DGR KRTGT+ TASAHIITA+IGSGVLSLAWAIAQLG VAGP  M+ FS +T YT+ 
Sbjct  35    YDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSA  94

Query  328   LLADCYRSPD---GKRNYSYMDAVRAYLGGVQVKFCGVAQYATLVGASIGYIITAAMSLQ  498
             LLADCYRS D   GKRNY+YMDAV A L G++V+ CG  QYA +VG +IGY I A++S+ 
Sbjct  95    LLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQICGFLQYANIVGVAIGYTIAASISML  154

Query  499   AIVRTNCYHKHGRGTEGCIPSKRSSILIFGAVEVLLSQIPNFHRLWFLSIVAALMSFGYS  678
             AI + NC+H  G G + C  S    ++IFG  E+  SQIP+F ++ +LSI+AA+MSF YS
Sbjct  155   AIKKANCFHVEGHG-DPCSISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFTYS  213

Query  679   SIGIALSAVKIAGGVDVETSVTGVPVGVNHSTKDKMFSTFSALGNIALAFGFSLILIDIQ  858
             +IG+ L  V++     V+ S+TG+ +G   +  DK++ +  A G+IA A+ +SLILI+IQ
Sbjct  214   TIGLGLGIVQVVANKGVQGSLTGISIGAV-TPIDKVWRSLQAFGDIAFAYSYSLILIEIQ  272

Query  859   DTLKSSP-RERRAMKQASSIGILSATFFYLLCGILGYLAFGNAAPGNLLTDDHGFYEPFW  1035
             DT+++ P  E + M++A+ + +   T FY+LCG +GY AFG+ APGNLLT   GFYEPFW
Sbjct  273   DTIRAPPPSESKVMRRATVVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTG-FGFYEPFW  331

Query  1036  LVDLANVCIIVHLVGAYQVVVQPVFAFVECWSRARWGGVWFITGEHTIRFPFLGN----F  1203
             L+D+AN  I+VHLVGAYQV  QP+FAFVE W++ +W    +ITGE  +     G+    +
Sbjct  332   LLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAKQKWPKSKYITGEVDVPLSLSGSAGRCY  391

Query  1204  SVSLFRLVWRTGFVVFTTVVAMIFPFFNAILGLLGSIAFWPLTIYFPVEMYISQAKIPRL  1383
              ++LFRL WRT FVV TTV++M+ PFFN ++GLLG++ FWPLT+YFPVEMYI Q K+PR 
Sbjct  392   KLNLFRLTWRTAFVVATTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRW  451

Query  1384  SFTWIWLQILSFFCFVVSVLAAVGSICDLAKSVMHFKPF  1500
             S  W+ LQ+LS  C +++V +A GS+  +   +  +KPF
Sbjct  452   STRWVCLQMLSLACLIITVASAAGSVAGIISDLKVYKPF  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5121296209290