BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21282_g2_i1 len=1267 path=[7465:0-1026 3337:1027-1064
7321:1065-1125 5125:1126-1149 7405:1150-1209 5209:1210-1266]

Length=1267
                                                                      Score     E

dbj|BAF36300.1|  hypothetical protein                                   686   0.0      Ipomoea trifida
gb|AAQ62572.1|  glycosyltransferase 10                                  684   0.0      Ipomoea trifida
gb|AAQ62570.1|  glycosyltransferase 1                                   683   0.0      Ipomoea trifida
gb|AAQ62571.1|  glycosyltransferase 5                                   632   0.0      Ipomoea trifida
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    584   0.0      
emb|CDP06989.1|  unnamed protein product                                582   0.0      
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    576   0.0      
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    576   0.0      
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    575   0.0      
gb|ACF33171.1|  mannan synthase                                         574   0.0      Coffea canephora [robusta coffee]
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    574   0.0      
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    573   0.0      
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    571   0.0      
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    562   0.0      
gb|ACV71015.1|  UPA15                                                   560   0.0      Capsicum annuum
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    560   0.0      
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    559   0.0      
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    560   0.0      
ref|XP_010089159.1|  hypothetical protein L484_003290                   559   0.0      
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    559   0.0      
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    558   0.0      
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             559   0.0      
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                557   0.0      
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    556   0.0      
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    556   0.0      
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    555   0.0      
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             552   0.0      
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         551   0.0      
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    551   0.0      
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    551   0.0      
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    551   0.0      
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             550   0.0      
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    550   0.0      Ricinus communis
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    550   0.0      
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    550   0.0      
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       549   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    548   0.0      
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    548   0.0      
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    547   0.0      Vitis vinifera
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    547   0.0      
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             546   0.0      
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       546   0.0      
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    546   0.0      
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    546   0.0      
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    546   0.0      
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                546   0.0      
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    546   0.0      
gb|AFZ78579.1|  cellulose synthase-like protein                         546   0.0      
ref|XP_007015963.1|  Cellulose synthase-like A02 isoform 3              543   0.0      
ref|XP_007015962.1|  Cellulose synthase-like A02 isoform 2              542   0.0      
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              542   0.0      
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    541   0.0      
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    540   0.0      
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             538   0.0      
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             538   0.0      
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              537   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    537   0.0      
emb|CDX88785.1|  BnaA03g08640D                                          534   0.0      
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    535   0.0      
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    535   0.0      
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    535   0.0      
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    534   0.0      
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             534   0.0      
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    534   0.0      
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    533   0.0      
gb|AGE09561.1|  CSLA9-like protein                                      533   0.0      
emb|CDX71011.1|  BnaC03g10950D                                          532   0.0      
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    533   0.0      
ref|XP_007027602.1|  Nucleotide-diphospho-sugar transferases supe...    526   0.0      
emb|CAN82595.1|  hypothetical protein VITISV_013708                     531   0.0      Vitis vinifera
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    530   0.0      
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    530   0.0      
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          530   0.0      
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    530   0.0      
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    530   0.0      Vitis vinifera
emb|CBI30236.3|  unnamed protein product                                530   0.0      
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    529   0.0      
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    529   0.0      
emb|CDY10358.1|  BnaCnng02590D                                          529   0.0      
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     529   0.0      
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         528   0.0      
emb|CAN74357.1|  hypothetical protein VITISV_042153                     528   0.0      Vitis vinifera
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    526   0.0      
ref|XP_008462530.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    521   0.0      
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    528   0.0      
ref|XP_003606274.1|  Glucomannan 4-beta-mannosyltransferase             526   0.0      
emb|CDY11268.1|  BnaA03g01040D                                          527   0.0      
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    527   0.0      
emb|CDX70286.1|  BnaA10g26350D                                          527   0.0      
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    526   1e-180   
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    526   1e-180   
gb|ABG34547.1|  cellulose synthase-like A1                              526   2e-180   Pinus taeda
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    526   2e-180   
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    526   2e-180   
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    526   3e-180   
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             526   3e-180   
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    525   4e-180   
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             525   4e-180   
gb|KEH24115.1|  cellulose synthase-like protein A1                      525   5e-180   
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    525   6e-180   
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    525   7e-180   
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    525   8e-180   
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    524   9e-180   
ref|XP_002873112.1|  ATCSLA09                                           524   1e-179   
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             524   1e-179   
emb|CDP15350.1|  unnamed protein product                                523   2e-179   
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             523   3e-179   
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    523   4e-179   
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    523   4e-179   
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    523   5e-179   
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    522   5e-179   
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             522   5e-179   
ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    522   6e-179   
ref|XP_002315357.1|  4-mannan synthase family protein                   522   8e-179   Populus trichocarpa [western balsam poplar]
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    522   9e-179   
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                521   1e-178   
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    521   1e-178   
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             521   1e-178   
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                521   1e-178   
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    521   2e-178   
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    521   2e-178   
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       520   2e-178   
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              521   3e-178   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98718.1|  hypothetical protein                                   521   3e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    521   3e-178   
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    520   4e-178   
gb|KDO61015.1|  hypothetical protein CISIN_1g0413332mg                  515   4e-178   
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    520   6e-178   
emb|CDY26949.1|  BnaC09g36340D                                          519   6e-178   
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         520   9e-178   
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    519   9e-178   
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    519   1e-177   
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    519   1e-177   
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    519   1e-177   
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             519   1e-177   
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    519   1e-177   
gb|AED99880.1|  glycosyltransferase                                     516   2e-177   
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    518   2e-177   
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    518   2e-177   
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    518   2e-177   
emb|CDY35710.1|  BnaC02g09760D                                          517   3e-177   
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                517   3e-177   
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    518   4e-177   Vitis vinifera
emb|CDY09164.1|  BnaA02g05900D                                          517   4e-177   
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   5e-177   
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   6e-177   
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   7e-177   
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   8e-177   
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   9e-177   
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    517   1e-176   
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    516   2e-176   
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    516   2e-176   
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    516   2e-176   
ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    515   4e-176   
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    514   6e-176   
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    514   9e-176   
gb|ABG34548.1|  cellulose synthase-like A2                              514   1e-175   Pinus taeda
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             513   2e-175   
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   513   3e-175   
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    513   3e-175   
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    514   3e-175   
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    513   3e-175   
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             512   5e-175   
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    511   8e-175   
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    510   3e-174   
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    510   3e-174   
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             508   3e-174   
emb|CDX92340.1|  BnaA10g13790D                                          524   4e-174   
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             509   6e-174   
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    509   8e-174   
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    507   4e-173   
gb|AES60635.2|  cellulose synthase-like protein A1                      506   8e-173   
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    506   1e-172   
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    505   2e-172   
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    504   3e-172   
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    505   4e-172   
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    504   6e-172   
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    504   7e-172   
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                503   1e-171   
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    501   7e-171   
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    501   2e-170   
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    500   2e-170   
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    499   5e-170   
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             498   8e-170   
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    498   1e-169   
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    496   6e-169   
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                495   8e-169   
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    496   9e-169   Oryza sativa Japonica Group [Japonica rice]
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       496   1e-168   
dbj|BAK03076.1|  predicted protein                                      495   2e-168   
ref|XP_010112526.1|  hypothetical protein L484_012804                   496   5e-168   
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    494   6e-168   
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   493   7e-168   
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    494   8e-168   
ref|XP_010110184.1|  hypothetical protein L484_016805                   494   1e-167   
ref|XP_002311972.2|  4-mannan synthase family protein                   493   3e-167   Populus trichocarpa [western balsam poplar]
ref|XP_002963530.1|  glycosyltransferase family 2 protein               492   4e-167   
ref|XP_002981551.1|  family 2 glycosyltransferase                       492   5e-167   
gb|KEH42109.1|  cellulose synthase-like protein A1                      491   5e-167   
gb|AFZ78578.1|  cellulose synthase-like protein                         491   1e-166   
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    489   2e-166   
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          490   2e-166   Sorghum bicolor [broomcorn]
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             490   2e-166   
gb|KEH42113.1|  cellulose synthase-like protein A1                      489   3e-166   
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         489   4e-166   
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    489   4e-166   
gb|KEH42110.1|  cellulose synthase-like protein A1                      489   5e-166   
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    488   1e-165   
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    487   5e-165   
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    486   9e-165   
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    487   1e-164   
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             487   1e-164   
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    486   2e-164   
gb|EAY84833.1|  hypothetical protein OsI_06199                          483   1e-163   Oryza sativa Indica Group [Indian rice]
ref|NP_001046164.1|  Os02g0192500                                       483   2e-163   Oryza sativa Japonica Group [Japonica rice]
gb|AFW66231.1|  hypothetical protein ZEAMMB73_021965                    478   2e-163   
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    480   4e-163   
ref|XP_002528577.1|  conserved hypothetical protein                     478   3e-162   Ricinus communis
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    479   5e-162   
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         479   7e-162   
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              479   7e-162   
ref|NP_001131007.1|  uncharacterized protein LOC100192112               478   1e-161   Zea mays [maize]
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    476   2e-161   
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    476   2e-161   
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    477   2e-161   
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       482   8e-161   
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    473   2e-160   
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             474   4e-160   
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                474   1e-159   
gb|KEH43412.1|  cellulose synthase-like protein A1                      473   1e-159   
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  472   3e-159   
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    471   1e-158   
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    468   2e-158   
ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  470   2e-158   
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    469   2e-158   
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  469   2e-158   Vitis vinifera
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             469   9e-158   
emb|CAN74410.1|  hypothetical protein VITISV_013215                     468   1e-157   Vitis vinifera
gb|KFK25840.1|  hypothetical protein AALP_AA8G168900                    466   2e-157   
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    468   4e-157   
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    465   5e-157   
gb|EYU36103.1|  hypothetical protein MIMGU_mgv1a004186mg                466   5e-157   
ref|NP_193077.2|  putative mannan synthase 15                           466   6e-157   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02317.1|  Mannan synthase 1                                       464   9e-157   
gb|ADW77641.1|  putative mannan synthase                                465   9e-157   
ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       464   2e-156   
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       464   3e-156   
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  464   3e-156   
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       465   4e-156   
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       465   4e-156   
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  463   7e-156   
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  463   7e-156   
gb|EEE56486.1|  hypothetical protein OsJ_05716                          461   1e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  462   2e-155   
emb|CDP06773.1|  unnamed protein product                                461   5e-155   
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             460   5e-155   
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    460   6e-155   
ref|XP_011089998.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    459   7e-155   
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             459   1e-154   
gb|AFV79650.1|  mannan synthase                                         460   2e-154   
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             459   2e-154   
gb|EPS59546.1|  mannan synthase                                         452   2e-154   
gb|KEH24032.1|  cellulose synthase-like protein A1                      459   4e-154   
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              460   4e-154   
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    457   5e-154   
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    459   5e-154   
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                458   5e-154   
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  458   6e-154   
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    459   8e-154   
emb|CDY01129.1|  BnaA04g06900D                                          458   1e-153   
gb|ABD79100.1|  cellulose synthase-like A2                              458   1e-153   Physcomitrella patens
emb|CDY26505.1|  BnaC09g41630D                                          457   1e-153   
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              459   2e-153   
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             458   2e-153   
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             457   2e-153   
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    457   2e-153   
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    457   3e-153   
gb|ACE60600.1|  mannan synthase                                         457   3e-153   Coffea canephora [robusta coffee]
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             456   3e-153   
gb|EYU29872.1|  hypothetical protein MIMGU_mgv1a023425mg                456   3e-153   
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             456   3e-153   
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    458   3e-153   
ref|XP_008783939.1|  PREDICTED: probable mannan synthase 4 isofor...    456   3e-153   
ref|XP_006414327.1|  hypothetical protein EUTSA_v10024828mg             451   4e-153   
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             456   5e-153   
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
gb|AAM61171.1|  putative glucosyltransferase                            457   5e-153   
gb|ACE60601.1|  mannan synthase                                         456   5e-153   
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
emb|CDY40295.1|  BnaA07g09050D                                          457   5e-153   
ref|NP_565813.1|  putative mannan synthase 7                            457   5e-153   
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    456   5e-153   
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              457   6e-153   
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             455   8e-153   
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    457   1e-152   
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    456   1e-152   
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    455   1e-152   
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    456   1e-152   
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             455   2e-152   
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             454   2e-152   
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              455   2e-152   
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    452   2e-152   
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    454   2e-152   
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    455   5e-152   
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    455   5e-152   
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    452   6e-152   
ref|XP_010096071.1|  hypothetical protein L484_000910                   453   6e-152   
gb|EMT23763.1|  hypothetical protein F775_17087                         463   6e-152   
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             454   6e-152   
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             454   7e-152   
gb|AAF87149.1|AC002423_14  T23E23.23                                    453   8e-152   
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        454   9e-152   
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              451   9e-152   
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             453   1e-151   
ref|NP_173818.1|  cellulose synthase-like A10                           453   1e-151   
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    453   2e-151   
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              453   2e-151   
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    452   2e-151   
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             452   3e-151   
ref|XP_010935704.1|  PREDICTED: mannan synthase 1-like isoform X3       451   3e-151   
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    450   3e-151   
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             452   3e-151   
ref|XP_010935703.1|  PREDICTED: mannan synthase 1-like isoform X2       451   3e-151   
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       451   4e-151   
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    452   4e-151   
ref|XP_008780561.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    451   4e-151   
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    451   4e-151   
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    451   5e-151   
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              452   5e-151   
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    452   6e-151   
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    451   6e-151   
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   450   1e-150   
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    450   1e-150   
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             451   2e-150   
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             451   2e-150   
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    450   2e-150   
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             450   2e-150   
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    447   3e-150   
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    451   3e-150   
dbj|BAD94168.1|  cellulose synthase like protein                        446   4e-150   
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    450   6e-150   
emb|CDY09672.1|  BnaC07g33890D                                          441   9e-150   
ref|NP_850952.1|  putative mannan synthase 3                            449   1e-149   
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    446   1e-149   
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              449   1e-149   
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    448   2e-149   
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  446   4e-149   
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             447   4e-149   
emb|CBI32777.3|  unnamed protein product                                443   5e-149   
emb|CDY40448.1|  BnaA04g20690D                                          448   6e-149   
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    446   7e-149   
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    446   1e-148   
emb|CDX79614.1|  BnaC03g19500D                                          446   1e-148   
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    444   1e-148   
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              445   2e-148   
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             445   2e-148   
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             445   2e-148   
ref|XP_010462862.1|  PREDICTED: probable mannan synthase 3              444   2e-148   
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    443   2e-148   
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             445   3e-148   
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              444   4e-148   
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             444   4e-148   
gb|EMT24748.1|  hypothetical protein F775_52670                         443   6e-148   
gb|EPS58942.1|  mannan synthase                                         441   7e-148   
emb|CDY32098.1|  BnaC04g44680D                                          443   9e-148   
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              443   1e-147   
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    444   2e-147   
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    443   2e-147   
emb|CDX90506.1|  BnaA03g42750D                                          442   3e-147   
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    441   3e-147   
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              442   4e-147   
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              441   6e-147   
ref|XP_006428366.1|  hypothetical protein CICLE_v10013685mg             436   1e-146   
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              441   2e-146   
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    437   2e-145   
emb|CBI40224.3|  unnamed protein product                                434   2e-145   
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    437   2e-145   
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    438   3e-145   
ref|XP_006647880.1|  PREDICTED: probable mannan synthase 6-like         436   4e-145   
ref|NP_001031084.1|  putative mannan synthase 3                         434   8e-145   
dbj|BAK08066.1|  predicted protein                                      436   8e-145   
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    436   1e-144   
gb|EMT01783.1|  hypothetical protein F775_21241                         435   3e-144   
ref|XP_002863134.1|  predicted protein                                  433   3e-144   
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              433   9e-144   
emb|CDY44151.1|  BnaA09g31010D                                          433   1e-143   
emb|CDM86569.1|  unnamed protein product                                434   1e-143   
emb|CDY04707.1|  BnaC05g18820D                                          432   2e-143   
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    428   8e-143   
gb|EPS67079.1|  hypothetical protein M569_07697                         420   1e-142   
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    427   3e-142   
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    426   4e-142   
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    429   5e-142   
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    425   1e-141   
gb|KHN09524.1|  Mannan synthase 1                                       425   1e-141   
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          427   2e-141   
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         424   1e-140   
gb|EEC73998.1|  hypothetical protein OsI_08915                          424   2e-140   
gb|EEE68748.1|  hypothetical protein OsJ_27439                          424   2e-140   
gb|EMS50191.1|  hypothetical protein TRIUR3_23716                       425   2e-140   
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  422   6e-140   
ref|NP_001063998.1|  Os09g0572500                                       423   8e-140   
dbj|BAD46620.1|  putative beta-1,4-mannan synthase                      422   8e-140   
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  421   1e-139   
gb|EEE57800.1|  hypothetical protein OsJ_08359                          422   1e-139   
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              421   2e-139   
sp|Q6Z2T9.2|CSLA6_ORYSJ  RecName: Full=Probable mannan synthase 6...    422   3e-139   
ref|XP_006657995.1|  PREDICTED: probable mannan synthase 7-like         420   4e-139   
gb|EMT15170.1|  hypothetical protein F775_14200                         420   6e-139   
gb|EEC85104.1|  hypothetical protein OsI_32487                          420   7e-139   
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          418   4e-138   
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    418   5e-138   
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    414   8e-138   
ref|XP_004958412.1|  PREDICTED: probable mannan synthase 7-like         418   9e-138   
emb|CBI17089.3|  unnamed protein product                                413   1e-137   
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  417   1e-137   
dbj|BAD15538.1|  putative glycosyltransferase 10                        417   3e-137   
ref|XP_008664979.1|  PREDICTED: probable mannan synthase 2 isofor...    414   3e-137   
ref|XP_002461072.1|  hypothetical protein SORBIDRAFT_02g040200          417   3e-137   
emb|CDO99850.1|  unnamed protein product                                413   4e-137   
ref|NP_001183100.1|  hypothetical protein                               416   5e-137   
ref|XP_003562630.1|  PREDICTED: probable mannan synthase 7              416   1e-136   
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    412   2e-136   
tpg|DAA50027.1|  TPA: hypothetical protein ZEAMMB73_959739              413   2e-136   
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    412   3e-136   
sp|Q7XIF5.1|CSLA7_ORYSJ  RecName: Full=Probable mannan synthase 7...    414   5e-136   
gb|EMT23300.1|  hypothetical protein F775_52157                         412   6e-136   
tpg|DAA01745.1|  TPA: cellulose synthase-like A4                        415   7e-136   
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    411   8e-136   
ref|XP_004987156.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    410   1e-135   
ref|XP_008653381.1|  PREDICTED: probable mannan synthase 7              413   1e-135   
ref|XP_006400152.1|  hypothetical protein EUTSA_v100135780mg            401   1e-135   
dbj|BAK06422.1|  predicted protein                                      411   1e-135   
dbj|BAK05964.1|  predicted protein                                      411   2e-135   
ref|XP_004953872.1|  PREDICTED: probable mannan synthase 6-like         412   2e-135   
ref|XP_008664977.1|  PREDICTED: probable mannan synthase 4 isofor...    414   2e-135   
ref|NP_197123.3|  cellulose synthase like A11                           406   1e-134   
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    408   2e-134   
ref|XP_004984220.1|  PREDICTED: probable mannan synthase 5-like i...    407   2e-134   
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         408   2e-134   
emb|CDX72181.1|  BnaC08g26930D                                          407   4e-134   
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             407   6e-134   
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             406   1e-133   
ref|XP_002452557.1|  hypothetical protein SORBIDRAFT_04g028070          407   2e-133   
emb|CDY54604.1|  BnaA05g28600D                                          406   2e-133   
ref|NP_001050229.1|  Os03g0377700                                       407   2e-133   
ref|XP_004984219.1|  PREDICTED: probable mannan synthase 5-like i...    406   4e-133   
emb|CDX70677.1|  BnaC03g07610D                                          402   4e-133   
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    404   5e-133   
gb|EEE67643.1|  hypothetical protein OsJ_25231                          407   6e-133   
ref|XP_008681194.1|  PREDICTED: hypothetical protein isoform X1         405   7e-133   
ref|NP_001132315.1|  hypothetical protein                               405   7e-133   
gb|EAY85180.1|  hypothetical protein OsI_06538                          407   8e-133   
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     400   9e-133   
emb|CDX69464.1|  BnaA10g18130D                                          401   1e-132   
ref|XP_004984218.1|  PREDICTED: probable mannan synthase 5-like i...    406   1e-132   
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             400   1e-132   
emb|CAC01860.1|  putative protein                                       397   1e-132   
ref|XP_002445548.1|  hypothetical protein SORBIDRAFT_07g021300          403   2e-132   
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             400   3e-132   
ref|XP_008780566.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    402   5e-132   
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    399   7e-132   
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         400   7e-132   
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        402   9e-132   
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    398   2e-131   
ref|XP_003570663.2|  PREDICTED: probable mannan synthase 6              399   3e-131   
sp|Q7PC67.2|CSLA2_ORYSJ  RecName: Full=Probable mannan synthase 2...    402   3e-131   
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    400   6e-131   
gb|EYU36101.1|  hypothetical protein MIMGU_mgv1a0044822mg               394   1e-130   
ref|XP_010235155.1|  PREDICTED: probable mannan synthase 11 isofo...    391   1e-130   
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    394   2e-130   
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    394   6e-130   
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         398   7e-130   
dbj|BAJ98507.1|  predicted protein                                      390   8e-130   
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             395   3e-129   
ref|XP_006833228.1|  hypothetical protein AMTR_s00072p00194730          387   9e-129   
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             394   9e-129   
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    393   2e-128   
gb|EEC75358.1|  hypothetical protein OsI_11796                          394   2e-128   
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         395   4e-128   
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       394   7e-128   
emb|CDM86475.1|  unnamed protein product                                391   1e-127   
gb|AAL38528.1|AF435643_1  CSLA7                                         388   3e-127   
ref|XP_006650136.1|  PREDICTED: probable mannan synthase 5-like         389   4e-127   
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    385   8e-127   
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    386   1e-126   
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    389   2e-126   
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             387   5e-126   
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             387   5e-126   
emb|CAB40776.1|  putative protein                                       381   1e-125   
gb|AFW73395.1|  hypothetical protein ZEAMMB73_786146                    384   2e-125   
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    385   3e-125   
ref|XP_008807525.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    374   4e-125   
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    385   5e-125   
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         381   8e-125   
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 382   1e-124   
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       381   2e-124   



>dbj|BAF36300.1| hypothetical protein [Ipomoea trifida]
Length=571

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/337 (96%), Positives = 331/337 (98%), Gaps = 0/337 (0%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE  436
             MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP LRLAVYVCL MS+MLFVE
Sbjct  1     MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVE  60

Query  437   RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  616
             RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA
Sbjct  61    RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  120

Query  617   VCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKE  796
             VCNFAWPSDRLVVQVLDDSTD NIKEMVE+EC+RWASKGINI YQTR+TRGGYKAGALKE
Sbjct  121   VCNFAWPSDRLVVQVLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKE  180

Query  797   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  976
             GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM
Sbjct  181   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  240

Query  977   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  1156
             QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL
Sbjct  241   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  300

Query  1157  KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  301   KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  337



>gb|AAQ62572.1| glycosyltransferase 10 [Ipomoea trifida]
 dbj|BAF36343.1| hypothetical protein [Ipomoea trifida]
Length=537

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/337 (96%), Positives = 331/337 (98%), Gaps = 0/337 (0%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE  436
             MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP LRLAVYVCL MS+MLFVE
Sbjct  1     MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVE  60

Query  437   RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  616
             RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA
Sbjct  61    RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  120

Query  617   VCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKE  796
             VCNFAWPSDRLVVQVLDDSTD NIKEMVE+EC+RWASKGINI YQTR+TRGGYKAGALKE
Sbjct  121   VCNFAWPSDRLVVQVLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKE  180

Query  797   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  976
             GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM
Sbjct  181   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  240

Query  977   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  1156
             QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL
Sbjct  241   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  300

Query  1157  KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  301   KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  337



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/337 (96%), Positives = 331/337 (98%), Gaps = 0/337 (0%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE  436
             MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP LRLAVYVCL MS+MLFVE
Sbjct  1     MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVE  60

Query  437   RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  616
             RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA
Sbjct  61    RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  120

Query  617   VCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKE  796
             VCNFAWPSDRLVVQVLDDSTD NIKEMVE+EC+RWASKGINI YQTR+TRGGYKAGALKE
Sbjct  121   VCNFAWPSDRLVVQVLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKE  180

Query  797   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  976
             GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM
Sbjct  181   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  240

Query  977   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  1156
             QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL
Sbjct  241   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  300

Query  1157  KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  301   KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  337



>gb|AAQ62571.1| glycosyltransferase 5, partial [Ipomoea trifida]
Length=508

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/309 (97%), Positives = 305/309 (99%), Gaps = 0/309 (0%)
 Frame = +2

Query  341   LMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR  520
             LM+DLVKAPLIVP LRLAVYVCL MS+MLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR
Sbjct  1     LMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR  60

Query  521   EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMV  700
             EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD NIKEMV
Sbjct  61    EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDHNIKEMV  120

Query  701   EQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL  880
             E+EC+RWASKGINI YQTR+TRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL
Sbjct  121   EKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL  180

Query  881   RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT  1060
             RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT
Sbjct  181   RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT  240

Query  1061  GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ  1240
             GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ
Sbjct  241   GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ  300

Query  1241  HRWSCGPAN  1267
             HRWSCGPAN
Sbjct  301   HRWSCGPAN  309



>ref|XP_011088835.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/327 (83%), Positives = 299/327 (91%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
              +PE   G   D+  Q+ L+W+L+KAPLIVP L LAVY+CLAMS+M+FVERLYMGIVIIL
Sbjct  9     FLPEAFPGYSSDIGGQIGLLWELIKAPLIVPLLNLAVYICLAMSVMVFVERLYMGIVIIL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KPEKRYKWEPM +D E+G+  FP VL+QIPMFNEKEVYKISIGA CN AWPSDR
Sbjct  69    VKLFWKKPEKRYKWEPMNDDLEMGSETFPKVLVQIPMFNEKEVYKISIGAACNLAWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             LV+QVLDDSTD+ +K+MVE+EC+RWASKGINIRYQ R +RGGYKAGALKEGLTHDYV++C
Sbjct  129   LVIQVLDDSTDLLVKDMVERECIRWASKGINIRYQIRESRGGYKAGALKEGLTHDYVKEC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             EYV IFDADFRPEPDFL R++PFLIHNP+IAL+QARWRFVNADECLLTRMQEMSLDYHF 
Sbjct  189   EYVVIFDADFRPEPDFLRRAVPFLIHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGS+THAFFGFNGTGGIWRIAAIN+AGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD
Sbjct  249   VEQEVGSATHAFFGFNGTGGIWRIAAINDAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LQVKSELPSTFKAFRFQQHRWSCGPAN  335



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/329 (83%), Positives = 299/329 (91%), Gaps = 3/329 (1%)
 Frame = +2

Query  290   MMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             ++PE    RG   D+A Q+ L+W+L++APLIVP LRLAVY+CLAMSLMLF+ERLYMGIVI
Sbjct  9     LIPESFDFRGSTADIAGQIGLIWELIRAPLIVPLLRLAVYICLAMSLMLFIERLYMGIVI  68

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVKIF  KPEKRYKWEPMR+D EIG + FP VL+QIPMFNEKEVYKISIGA CN +WPS
Sbjct  69    ILVKIFWKKPEKRYKWEPMRDDLEIGNAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPS  128

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DR+V+QVLDDSTD  IK+MVE+EC RWASKGI+ RYQ R TRGGYKAGALKEGL HDYV+
Sbjct  129   DRIVIQVLDDSTDPIIKDMVEKECQRWASKGIHCRYQIRETRGGYKAGALKEGLKHDYVK  188

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
             DCEYV IFDADFRPEPDFL R+IPFL+HN +IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  189   DCEYVVIFDADFRPEPDFLRRAIPFLMHNSDIALVQARWRFVNSDECLLTRMQEMSLDYH  248

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF+YL
Sbjct  249   FTVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYL  308

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/337 (80%), Positives = 299/337 (89%), Gaps = 2/337 (1%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE  436
             MA V+ N   L+    +G   D+A Q+ LMW+L+KAPLIVP LR+A+Y+CLAM LMLF+E
Sbjct  1     MAEVSTNA--LLPDTFQGTAADIAGQIGLMWELIKAPLIVPLLRVAIYICLAMELMLFIE  58

Query  437   RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  616
             RLYMGIVIILVK+F  KP+KRYKWE MRED EIG + FP VL+QIPMFNEKEVYK+SIGA
Sbjct  59    RLYMGIVIILVKLFLKKPDKRYKWEAMREDLEIGNAGFPMVLVQIPMFNEKEVYKVSIGA  118

Query  617   VCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKE  796
              CN +WPSDRLV+QVLDDSTD  IK++VE+EC+RWASKGINIRYQ R +RGGYKAGALKE
Sbjct  119   ACNLSWPSDRLVIQVLDDSTDPLIKDLVEKECLRWASKGINIRYQIRESRGGYKAGALKE  178

Query  797   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  976
             GL  DYV+DCEYV IFDADFRPEPDFL R+IPFL+HN EIAL+Q RWRFVN++ECLLTRM
Sbjct  179   GLKRDYVKDCEYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNSNECLLTRM  238

Query  977   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  1156
             QEMSLDYHF VEQEVGSSTHAFFGFNGTGG+WRIAAINEAGGWKDRTTVEDMDLAVRA L
Sbjct  239   QEMSLDYHFTVEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASL  298

Query  1157  KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             KGWKFLYLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  299   KGWKFLYLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_009769755.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=533

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/338 (80%), Positives = 301/338 (89%), Gaps = 4/338 (1%)
 Frame = +2

Query  257   MAGVAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFV  433
             MA V+ N    ++PE  +G   D+A Q+ LMW+L+KAPLIVP LR+A+Y+CL M LMLF+
Sbjct  1     MAEVSTNA---LLPETFQGTAADIAGQIGLMWELIKAPLIVPLLRVAIYICLPMELMLFI  57

Query  434   ERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIG  613
             ERLYMGIVIILVK+F  KP+KRYKWEPMRED EIG S FP VL+QIPMFNEKEVYK+SIG
Sbjct  58    ERLYMGIVIILVKLFLKKPDKRYKWEPMREDLEIGNSGFPMVLVQIPMFNEKEVYKVSIG  117

Query  614   AVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALK  793
             A CN +WPSDRLV+QVLDDSTD+ IK++VE+EC+RWA KGI+IRYQ R +RGGYKAGALK
Sbjct  118   AACNLSWPSDRLVIQVLDDSTDLLIKDLVEKECLRWAGKGIDIRYQIRESRGGYKAGALK  177

Query  794   EGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTR  973
             EGL  DYV+DCEYV IFDADFRPEPDFL R+IPFL+HN EIAL+Q RWRFVN++ECLLTR
Sbjct  178   EGLKRDYVKDCEYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNSNECLLTR  237

Query  974   MQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAG  1153
             MQEMSLDYHF VEQEVGSSTHAFFGFNGTGG+WRIAAINEAGGWKDRTTVEDMDLAVRA 
Sbjct  238   MQEMSLDYHFTVEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRAS  297

Query  1154  LKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LKGWKFLYLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  298   LKGWKFLYLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_009769757.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X2 [Nicotiana sylvestris]
Length=519

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/338 (80%), Positives = 301/338 (89%), Gaps = 4/338 (1%)
 Frame = +2

Query  257   MAGVAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFV  433
             MA V+ N    ++PE  +G   D+A Q+ LMW+L+KAPLIVP LR+A+Y+CL M LMLF+
Sbjct  1     MAEVSTNA---LLPETFQGTAADIAGQIGLMWELIKAPLIVPLLRVAIYICLPMELMLFI  57

Query  434   ERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIG  613
             ERLYMGIVIILVK+F  KP+KRYKWEPMRED EIG S FP VL+QIPMFNEKEVYK+SIG
Sbjct  58    ERLYMGIVIILVKLFLKKPDKRYKWEPMREDLEIGNSGFPMVLVQIPMFNEKEVYKVSIG  117

Query  614   AVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALK  793
             A CN +WPSDRLV+QVLDDSTD+ IK++VE+EC+RWA KGI+IRYQ R +RGGYKAGALK
Sbjct  118   AACNLSWPSDRLVIQVLDDSTDLLIKDLVEKECLRWAGKGIDIRYQIRESRGGYKAGALK  177

Query  794   EGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTR  973
             EGL  DYV+DCEYV IFDADFRPEPDFL R+IPFL+HN EIAL+Q RWRFVN++ECLLTR
Sbjct  178   EGLKRDYVKDCEYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNSNECLLTR  237

Query  974   MQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAG  1153
             MQEMSLDYHF VEQEVGSSTHAFFGFNGTGG+WRIAAINEAGGWKDRTTVEDMDLAVRA 
Sbjct  238   MQEMSLDYHFTVEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRAS  297

Query  1154  LKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LKGWKFLYLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  298   LKGWKFLYLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 293/323 (91%), Gaps = 0/323 (0%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
             + RG   D+A Q+ L+W+L++APLIVP LRLAVY+CLAMSLMLF+ER YMGIVIILVKIF
Sbjct  15    DFRGSTADIAGQIGLIWELIRAPLIVPLLRLAVYICLAMSLMLFIERPYMGIVIILVKIF  74

Query  479   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               KPEKRYKWEPMR+D EIG + FP VL+QIPMFNEKEVYKISIGA CN +WPSDR+V+Q
Sbjct  75    WKKPEKRYKWEPMRDDLEIGNAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDRIVIQ  134

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  IK+MVE+EC RWASKG + RYQ R TRGGYKAGALKEGL HDYV+DCEYV 
Sbjct  135   VLDDSTDPIIKDMVEKECQRWASKGTHCRYQIRETRGGYKAGALKEGLKHDYVKDCEYVV  194

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL R+IPFL+HN +IAL+QARWRFVN+DECLLTRMQEMSLDYHF VEQE
Sbjct  195   IFDADFRPEPDFLRRAIPFLMHNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  254

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF+YLGD  VK
Sbjct  255   VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDPQVK  314

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPSTFKAFRFQQHRWSCGPAN
Sbjct  315   SELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/327 (80%), Positives = 299/327 (91%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
              +PE L G   D+A Q+ L+W+L++ PLI P LR+ VY+CLAMS+M+F+ERLYMG+VI+L
Sbjct  9     FLPESLPGYTADIAGQLGLLWELIRVPLIAPLLRVCVYICLAMSIMVFMERLYMGVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KPEKRYKWEPM++D E+G++ FP VL+QIPMFNEKEVYKISIGA CN +WP+DR
Sbjct  69    VKLFWKKPEKRYKWEPMKDDLEMGSAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPADR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             LV+QVLDDSTD+ IK+MVE+EC+RWASKGINIRYQ R TRGGYKAGALKEGL HDYV++C
Sbjct  129   LVIQVLDDSTDLVIKDMVEKECIRWASKGINIRYQIRETRGGYKAGALKEGLKHDYVKEC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             EYV IFDADFRPEPDFL R++PFLIHN +IAL+QARWRFVNADECLLTRMQEMSLDYHF 
Sbjct  189   EYVVIFDADFRPEPDFLRRAVPFLIHNRDIALVQARWRFVNADECLLTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGS+THAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF+YLGD
Sbjct  249   VEQEVGSATHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=533

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/327 (81%), Positives = 293/327 (90%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             + PE  +G   D+A Q+ LMW+L+KAPLIVP LR AVY+CLAM LMLF+ERLYMGIVI+L
Sbjct  9     LFPETFQGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KP+KRYKWEPMR+D EIG   FP VL+QIPMFNEKEVYKISIGA CN +WPSDR
Sbjct  69    VKLFMKKPDKRYKWEPMRDDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             L++QVLDDSTD  IK++VE+EC+RWA+KGINIRYQ R  RGGYKAGALKEGL  DYV+DC
Sbjct  129   LIIQVLDDSTDHLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             EYV IFDADFRPEPDFL R+IPFL+HN EIAL+Q RWRFVNA+ECLLTRMQEMSLDYHF 
Sbjct  189   EYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSSTHAFFGFNGTGG+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKFLYLGD
Sbjct  249   VEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_004241301.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
lycopersicum]
Length=533

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/327 (81%), Positives = 292/327 (89%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             + PE  +G   D+A Q+ LMW+L+KAPLIVP LR AVY+CLAM LMLF+ERLYMGIVI+L
Sbjct  9     LFPETFQGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KP+KRY WEPMR+D EIG   FP VL+QIPMFNEKEVYKISIGA CN +WP+DR
Sbjct  69    VKLFMKKPDKRYNWEPMRDDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPADR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             LV+QVLDDSTD  IK++VE+EC+RWA+KGINIRYQ R  RGGYKAGALKEGL  DYV+DC
Sbjct  129   LVIQVLDDSTDPLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             EYV IFDADFRPEPDFL R+IPFL+HN EIAL+Q RWRFVNA+ECLLTRMQEMSLDYHF 
Sbjct  189   EYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSSTHAFFGFNGTGG+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKFLYLGD
Sbjct  249   VEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_009794211.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
sylvestris]
Length=526

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/323 (80%), Positives = 290/323 (90%), Gaps = 1/323 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +    D+A Q+ +MW+++KAPL+VP LR AVY+CL M LMLF+ERLYMGIVI++VK+F 
Sbjct  6     FQATASDIAGQIGMMWEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIVIVKLFM  65

Query  482   GKPEKRYKWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
              KP+KRYKWEPM +D  EIG++ FP VL+QIPMFNE+EVYKISIGA CN +WPSDRLV+Q
Sbjct  66    KKPDKRYKWEPMADDDLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSDRLVIQ  125

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  IK+MVE EC+RWASKG+NI YQ R +RGGYKAGALKEGL H+YV+DCEYV 
Sbjct  126   VLDDSTDPIIKDMVETECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKDCEYVV  185

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL RSIPFL+HNPEIAL+Q RWRFVNA+ECLLTRMQEMSLDYHF VEQE
Sbjct  186   IFDADFRPEPDFLRRSIPFLVHNPEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQE  245

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VK
Sbjct  246   VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVK  305

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPSTFKAFRFQQHRWSCGPAN
Sbjct  306   SELPSTFKAFRFQQHRWSCGPAN  328



>gb|ACV71015.1| UPA15 [Capsicum annuum]
Length=528

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/318 (81%), Positives = 289/318 (91%), Gaps = 1/318 (0%)
 Frame = +2

Query  317   GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK  496
             GD+  Q+ +MW+++KAPL+VP L++AVY+C+ M LMLF+ERLYMGIVIILVK+F  KP+K
Sbjct  12    GDIGGQIGMMWEVLKAPLLVPMLKVAVYICIVMELMLFIERLYMGIVIILVKVFMKKPDK  71

Query  497   RYKWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDS  673
             RYKWEPM +D  EIG+  FP VL+QIPMFNEKEVYKISIGA CN +WPSDRLV+QVLDDS
Sbjct  72    RYKWEPMDDDDLEIGSGGFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRLVIQVLDDS  131

Query  674   TDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDAD  853
             TD  +K+MVE EC+RWASKG+NI YQ R TRGGYKAGALKEGL H+YV+DCEYV IFDAD
Sbjct  132   TDPIVKDMVETECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCEYVVIFDAD  191

Query  854   FRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSST  1033
             FRPEPDFL RSIPFLIHNP+IAL+Q RWRFVNA+ECLLTRMQEMSLDYHF VEQEVGSST
Sbjct  192   FRPEPDFLRRSIPFLIHNPKIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSST  251

Query  1034  HAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPS  1213
             HAFFGFNGTGGIWRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VKSELPS
Sbjct  252   HAFFGFNGTGGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPS  311

Query  1214  TFKAFRFQQHRWSCGPAN  1267
             TFKAFRFQQHRWSCGPAN
Sbjct  312   TFKAFRFQQHRWSCGPAN  329



>ref|XP_004251009.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Solanum 
lycopersicum]
Length=524

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 291/326 (89%), Gaps = 1/326 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M  ++    D+A Q+ +MW+++KAPL+VP L+ AVY+C+ M LMLFVERLYMGIVI+LVK
Sbjct  1     MSTVQATASDIAGQIGMMWEVLKAPLLVPLLKSAVYICIVMELMLFVERLYMGIVIVLVK  60

Query  473   IFCGKPEKRYKWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             IF  KP+KRYKW PM +D  EIG++ FP VL+QIPMFNEKEVYKISIGA CN +WPSDRL
Sbjct  61    IFMKKPDKRYKWIPMADDDLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRL  120

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             V+QVLDDSTD  +K+MVE EC+RWASKG+NI YQ R TRGGYKAGALKEGL H+YV+DCE
Sbjct  121   VIQVLDDSTDPIVKDMVETECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCE  180

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YV IFDADFRPEPDFL RSIPFLIHNPEIAL+Q RWRFVN++ECLLTRMQEMSLDYHF V
Sbjct  181   YVVIFDADFRPEPDFLRRSIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTV  240

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSSTHAFFGFNGTGGIWRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL
Sbjct  241   EQEVGSSTHAFFGFNGTGGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  300

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  301   QVKSELPSTFKAFRFQQHRWSCGPAN  326



>ref|XP_006349077.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=524

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 290/326 (89%), Gaps = 1/326 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M  ++    D+A Q+ +MW+++KAPL+VP L+ AVY+C+AM LMLFVERLYMGIVI+LVK
Sbjct  1     MSTVQATAADIAGQIGMMWEVLKAPLLVPLLKAAVYICIAMELMLFVERLYMGIVIVLVK  60

Query  473   IFCGKPEKRYKWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             IF  KP+KRYKW PM +D  EIG++ FP VL+QIPMFNEKEVYKISIGA CN +WPSDRL
Sbjct  61    IFMKKPDKRYKWIPMADDDLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRL  120

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             V+QVLDDSTD  +K+MVE EC+RW SKG+NI YQ R TRGGYKAGALKEGL H+YV+DCE
Sbjct  121   VIQVLDDSTDPIVKDMVETECLRWESKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCE  180

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YV IFDADFRPEPDFL RSIPFLIHNPEIAL+Q RWRFVN++ECLLTRMQEMSLDYHF V
Sbjct  181   YVVIFDADFRPEPDFLRRSIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTV  240

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSSTHAFFGFNGTGGIWRIAAI EAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL
Sbjct  241   EQEVGSSTHAFFGFNGTGGIWRIAAIEEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  300

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  301   QVKSELPSTFKAFRFQQHRWSCGPAN  326



>ref|XP_008458630.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Cucumis 
melo]
Length=539

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/329 (80%), Positives = 295/329 (90%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             ++++PE  +G  GD   Q+ L+W+L+KAPLIVP LRL VY+ LAMSLMLF ERLYMGIVI
Sbjct  6     QILLPESFQGGRGDFTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVI  65

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRYK+EP+++D E+G+S FP VLIQIPMFNE+EVYKISIGA C  +WP+
Sbjct  66    ILVKLFWKKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPA  125

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK+MVEQEC+RWASKGINI YQ R TRGGYKAGALKEGL   YV+
Sbjct  126   DRLVIQVLDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVK  185

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  186   HCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYH  245

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  246   FTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYL  305

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  306   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  334



>ref|XP_010089159.1| hypothetical protein L484_003290 [Morus notabilis]
 gb|EXB37420.1| hypothetical protein L484_003290 [Morus notabilis]
Length=541

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/329 (80%), Positives = 294/329 (89%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             ++++PE  + PG D+A+Q+ LMW+L+KAPLIVP LRL VY+CLAMSLMLF+ERLYMGIVI
Sbjct  7     KILIPETFQNPGYDIASQIGLMWELIKAPLIVPLLRLGVYICLAMSLMLFMERLYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRYK+EP+++D E+G+S FP VLIQIPMFNEKEVYKISIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYKFEPIQDDVEMGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK+MVE EC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPVIKQMVELECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAI DADFRPEPDFL RSIPFL+HNP+IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVAILDADFRPEPDFLRRSIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             G+L  KSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GELQAKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/335 (79%), Positives = 295/335 (88%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A     +++PE  +G   D+A Q+ L+W+L+KAPLIVP LR+ VY+ LAMSLMLF ERL
Sbjct  1     MAETTTRVLIPESFQGGTYDIAGQIGLIWELIKAPLIVPLLRVCVYISLAMSLMLFFERL  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMGIVIILVK+F  KPEKRYK+EP++ED E+G+S FP VLIQIPMFNE+EVYKISIGA C
Sbjct  61    YMGIVIILVKLFWKKPEKRYKYEPIQEDLELGSSNFPVVLIQIPMFNEREVYKISIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVN+DECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_009590983.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/323 (80%), Positives = 289/323 (89%), Gaps = 1/323 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +    D+A Q+ +MW+++KAPL+VP LR AVY+CL M LMLF+ERLYMGIVII+VK+F 
Sbjct  6     FQATASDIAGQIGMMWEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIIIVKLFM  65

Query  482   GKPEKRYKWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
              KP+KRYKWEPM +D  EIG++ FP VL+QIPMFNE+EVYKISIGA CN +WPSDRLV+Q
Sbjct  66    KKPDKRYKWEPMADDDLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSDRLVIQ  125

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  IK+MVE EC+RWASKG+NI YQ R +RGGYKAGALKEGL H+YV+DCEYV 
Sbjct  126   VLDDSTDPIIKDMVETECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKDCEYVV  185

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL RSIPFL+HN EIAL+Q RWRFVNA+ECLLTRMQEMSLDYHF VEQE
Sbjct  186   IFDADFRPEPDFLRRSIPFLVHNREIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQE  245

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VK
Sbjct  246   VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVK  305

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPSTFKAFRFQQHRWSCGPAN
Sbjct  306   SELPSTFKAFRFQQHRWSCGPAN  328



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/335 (79%), Positives = 295/335 (88%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A    ++++PE  +G   D+A QM L+W+L+KAPLIVP LR+ VY+ LAMSLMLF ERL
Sbjct  1     MAETTTKVLIPESFQGGTYDIAGQMGLIWELIKAPLIVPLLRICVYISLAMSLMLFFERL  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMGIVIILVK+F  KPEKRYK+E ++ED E+G+S FP VLIQIPMFNE+EVYKISIGA C
Sbjct  61    YMGIVIILVKLFWKKPEKRYKYEAIQEDLELGSSNFPVVLIQIPMFNEREVYKISIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVN+DECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>gb|EYU36982.1| hypothetical protein MIMGU_mgv1a004240mg [Erythranthe guttata]
Length=538

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/330 (78%), Positives = 295/330 (89%), Gaps = 4/330 (1%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
              +PE  +G   ++A Q+ L+W+L+KAPLIVP L + VY+CLAMS+M+F+ERLYMG+VI+L
Sbjct  9     FIPETFQGYTPEIAGQIGLLWELIKAPLIVPVLTVCVYICLAMSIMVFMERLYMGVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMRED---YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP  637
             VK+F  KPEKRYKWEPM ED    E   + FP VL+QIPMFNEKEVYKISIGA CN +WP
Sbjct  69    VKLFWRKPEKRYKWEPMEEDADDLEAAGANFPIVLVQIPMFNEKEVYKISIGAACNLSWP  128

Query  638   SDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYV  817
             +DRLV+QVLDDSTD  +K+MVE+EC+RWASKG+NI+YQ R +RGGYKAGALKEGL HDY+
Sbjct  129   ADRLVIQVLDDSTDFVVKDMVERECLRWASKGVNIKYQIRESRGGYKAGALKEGLKHDYI  188

Query  818   QDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDY  997
             + CEYV IFDADFRPEPDFL R++PFLIHNP+IAL+QARWRFVN++EC+LTRMQEMSLDY
Sbjct  189   KQCEYVVIFDADFRPEPDFLKRAVPFLIHNPDIALVQARWRFVNSNECMLTRMQEMSLDY  248

Query  998   HFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLY  1177
             HFKVEQEVGS+THAFFGFNGTGGIWRI AINEAGGWKDRTTVEDMDLAVRAGLKGWKFLY
Sbjct  249   HFKVEQEVGSATHAFFGFNGTGGIWRIGAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLY  308

Query  1178  LGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LGDLQVKSELPSTFKAFRFQQHRWSCGPAN  338



>ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=539

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/329 (79%), Positives = 295/329 (90%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             ++++PE  +G  GD   Q+ L+W+L+KAPLIVP LRL VY+ LAMSLMLF ERLYMGIVI
Sbjct  6     QILLPESFQGGRGDFTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVI  65

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRYK+EP+++D E+G+S FP VLIQIPMFNE+EVYKISIGA C  +WP+
Sbjct  66    ILVKLFWKKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPA  125

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK+MVEQEC+RWASKGINI YQ R TRGGYKAGALKEGL   YV+
Sbjct  126   DRLVIQVLDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVK  185

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPD+L R+IPFL++NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  186   HCEYVAIFDADFRPEPDYLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYH  245

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  246   FTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYL  305

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  306   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  334



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/335 (77%), Positives = 295/335 (88%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A    ++++PE  +G   D+A Q+ L+W+L+KAPLIVP L + VYV LAMSLMLF ER+
Sbjct  1     MAETTTQVLIPETFQGTTNDIAGQLGLIWELIKAPLIVPLLTVGVYVSLAMSLMLFFERV  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMG+VI+LVK+F  KPE+RYK+EP+++D E+G+S FP VLIQIPMFNE+EVYK+SIGA C
Sbjct  61    YMGVVIVLVKLFWKKPEERYKYEPIQDDLEVGSSNFPVVLIQIPMFNEREVYKVSIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVN+DECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/335 (77%), Positives = 295/335 (88%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A    ++++PE  +G   D+A Q+ L+W+L+KAPLIVP L + VYV LAMSLMLF ER+
Sbjct  1     MAETTTQVLIPETFQGTTYDIAGQLGLIWELIKAPLIVPLLTVGVYVSLAMSLMLFFERV  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMG+VI+LVK+F  KPE+RYK+EP+++D E+G+S FP VLIQIPMFNE+EVYK+SIGA C
Sbjct  61    YMGVVIVLVKLFWKKPEERYKYEPIQDDLEVGSSNFPVVLIQIPMFNEREVYKVSIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVN+DECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_007132379.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
 gb|ESW04373.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
Length=542

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/332 (77%), Positives = 293/332 (88%), Gaps = 1/332 (0%)
 Frame = +2

Query  275   NEVELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             +E +  +PE ++G   DV AQMR++W+++KAPLIVP + +AVY+CLAM+LMLF+ER+YMG
Sbjct  4     SEPKFFIPESIQGVNFDVTAQMRMVWEVIKAPLIVPLMNVAVYICLAMALMLFMERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVIILVK+F  KP +RYK+EP++ED E+G + FP VLIQIPMFNE+EVYK+SIGA CN +
Sbjct  64    IVIILVKLFWKKPHQRYKFEPLQEDEELGNTNFPVVLIQIPMFNEREVYKVSIGAACNLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINI YQ R TRGGYKAGALKEGL   
Sbjct  124   WPSDRLVIQVLDDSTDPTIKQMVEMECQRWASKGINIIYQIRETRGGYKAGALKEGLKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ CEYVAIFDADFRPEPDFL RSIPFL+ NP+IAL+QARWRFVN+DECLLTRMQEMSL
Sbjct  184   YVKHCEYVAIFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGS+THAFFGFNGT G+WRI AINEAGGWKDRTTVEDMDLAVRA L+GWKF
Sbjct  244   DYHFTVEQEVGSATHAFFGFNGTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLGDL  KSELPST +AFRFQQHRWSCGPAN
Sbjct  304   LYLGDLQAKSELPSTLRAFRFQQHRWSCGPAN  335



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 284/316 (90%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D  AQ+ L+W+L+K PLIVP L L VYVCLAMSLMLF+ERLYMGIVIILVK+F  KPEKR
Sbjct  20    DFGAQIGLIWELIKTPLIVPLLTLGVYVCLAMSLMLFMERLYMGIVIILVKLFWKKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEP+++D E G S FP+VL+QIPMFNE+EVYK+SIGA  N +WP+DRLV+QVLDDSTD
Sbjct  80    YKWEPIQDDLESGNSNFPAVLVQIPMFNEREVYKLSIGAASNLSWPADRLVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK+MVE EC RWASKG+NI YQ R TRGGYKAGALKEGL   YV+ CEYV IFDADF+
Sbjct  140   QEIKKMVELECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNP+IAL+QARWRFVNADECLLTRMQEMSLDYHF VEQEVGS+THA
Sbjct  200   PEPDFLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YLGDLHVKSELPSTF
Sbjct  260   FFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLHVKSELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KAFRFQQHRWSCGPAN
Sbjct  320   KAFRFQQHRWSCGPAN  335



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/316 (81%), Positives = 285/316 (90%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+A Q+ L+W+L+KAPLIVP L+L VY+CLAMSLMLF+ER+YMGIVIILVK+F  KPEKR
Sbjct  20    DIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWQKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             Y W+P+ +D E+G+S FP VLIQIPMFNEKEVYKISIGA C  +WPSDRLV+QVLDDSTD
Sbjct  80    YNWQPIEDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK+MVEQEC RWA+KGINIRYQ R  R GYKAGALKEGL   YV+ CEYVAIFDADFR
Sbjct  140   PAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFR  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L R+IP+L+ N +IAL+QARWRFVN+DECLLTRMQEMSLDYHFKVEQEVGS+THA
Sbjct  200   PEPDYLRRAIPYLVQNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFKVEQEVGSATHA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VKSELPSTF
Sbjct  260   FFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KAFRFQQHRWSCGPAN
Sbjct  320   KAFRFQQHRWSCGPAN  335



>ref|XP_009364844.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/335 (77%), Positives = 293/335 (87%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPELRGPGG-DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A N  ++++PE    G  + A Q+ L W+L+KAPLIVP L + VYV LAMSLMLF ER+
Sbjct  1     MADNTTQILIPETFQRGTYEFAGQIGLTWELIKAPLIVPLLTVGVYVSLAMSLMLFFERV  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMG+VI+LVK+F  KPE+RYK+EP+++D E+G+S FP VLIQIPMFNE+EVYK+SIGA C
Sbjct  61    YMGVVIVLVKLFWKKPEQRYKYEPIQDDLELGSSNFPPVLIQIPMFNEREVYKVSIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVNADECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_004294040.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=540

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/332 (78%), Positives = 292/332 (88%), Gaps = 2/332 (1%)
 Frame = +2

Query  278   EVELMMPEL--RGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
               ++++PE    G   D+A Q+ L+W+L+KAPLIVP LR+ VYV LAM+LMLFVER+YMG
Sbjct  4     STKVLIPETFQGGSSFDIAGQIGLIWELIKAPLIVPLLRVGVYVSLAMALMLFVERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KPEKRY +EP++ED E+G+S FP VL+QIPMFNE+EVYKISIGA C  +
Sbjct  64    IVIVLVKMFWKKPEKRYNYEPIQEDLELGSSNFPVVLVQIPMFNEREVYKISIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINI YQ R +RGGYKAGALKEGL   
Sbjct  124   WPSDRLVIQVLDDSTDPTIKKMVEAECQRWASKGINIVYQIRESRGGYKAGALKEGLKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ CEYVAI DADFRPEPD+L R+IPFL+HNPEIAL+QARWRFVN+DECLLTRMQEMSL
Sbjct  184   YVKHCEYVAIMDADFRPEPDYLRRAIPFLVHNPEIALVQARWRFVNSDECLLTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRAGL+GWKF
Sbjct  244   DYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRAGLRGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  304   LYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/316 (81%), Positives = 285/316 (90%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+A Q+ L+W+L+KAPLIVP L+L VY+CLAMSLMLF+ER+YMGIVIILVK+F  KPEKR
Sbjct  20    DIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWPKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             Y W+P+ +D E+G+S FP VLIQIPMFNEKEVYKISIGA C  +WPSDRLV+QVLDDSTD
Sbjct  80    YNWQPIEDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK+MVEQEC RWA+KGINIRYQ R  R GYKAGALKEGL   YV+ CEYVAIFDADFR
Sbjct  140   PAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFR  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L R+IP+L+ N +IAL+QARWRFVNA+ECLLTRMQEMSLDYHFKVEQEVGS+THA
Sbjct  200   PEPDYLRRAIPYLVQNSDIALVQARWRFVNANECLLTRMQEMSLDYHFKVEQEVGSATHA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VKSELPSTF
Sbjct  260   FFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KAFRFQQHRWSCGPAN
Sbjct  320   KAFRFQQHRWSCGPAN  335



>ref|XP_002527445.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF34937.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=535

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 291/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             +L++PE  +    D+ AQ+ L+W+L+KAPLIVP L+L VY+CL MSLMLF+ERLYMGIVI
Sbjct  7     KLIIPESFQVSRDDIGAQISLIWELIKAPLIVPLLQLGVYICLTMSLMLFMERLYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KPEKRYKWEP+++D E G S FP VL+QIPMFNE+EVYK+SIGA  N +WP+
Sbjct  67    VLVKLFWKKPEKRYKWEPIQDDLESGNSNFPVVLVQIPMFNEREVYKVSIGAASNLSWPA  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK+MVE EC RWASKG+NI YQ R TRGGYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPEIKQMVELECQRWASKGVNITYQIRETRGGYKAGALKEGLKRGYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL R+IPFL++NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HCEYVTIFDADFQPEPDFLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/322 (79%), Positives = 285/322 (89%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             ++G    V  Q+ L+W+LVK PLIVP L+L VY+CLAMSLMLF+ERLYMGIVIILVK+F 
Sbjct  14    IQGVSEHVTGQIELLWELVKVPLIVPLLKLGVYICLAMSLMLFMERLYMGIVIILVKLFW  73

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPE+RY ++P+++D E+G+ +FP+VLIQIPMFNEKEVYK+SIGA C  +WPSDRLV+QV
Sbjct  74    KKPEQRYNYKPLQDDVELGSFIFPTVLIQIPMFNEKEVYKVSIGAACGLSWPSDRLVIQV  133

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  IKEMVEQEC+RWASKGINI YQ R  R GYKAGALKEGL   YV+ CEYVAI
Sbjct  134   LDDSTDTVIKEMVEQECLRWASKGINITYQIRENRTGYKAGALKEGLKRSYVEHCEYVAI  193

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADFRPEPDFL R+IPFL+ NPEIAL+QARWRFVNA+ECLLTRMQEMSLDYHF VEQEV
Sbjct  194   FDADFRPEPDFLRRAIPFLVGNPEIALVQARWRFVNANECLLTRMQEMSLDYHFTVEQEV  253

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL  KS
Sbjct  254   GSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKS  313

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPST +AFRFQQHRWSCGPAN
Sbjct  314   ELPSTLRAFRFQQHRWSCGPAN  335



>ref|XP_008360269.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=549

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/335 (77%), Positives = 292/335 (87%), Gaps = 1/335 (0%)
 Frame = +2

Query  266   VAINEVELMMPELRGPGG-DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERL  442
             +A    ++++PE    G  D A Q+ L+W+L+KAPLIVP L + VYV  AMSLMLF ER+
Sbjct  1     MADTTTQILIPETFQRGTYDFAGQIGLIWELIKAPLIVPLLTVGVYVSXAMSLMLFFERV  60

Query  443   YMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVC  622
             YMG+VI+LVK+F  KPE+RYK+EP+++D E+G+S FP VLIQIPMFNE+EVYK+SIGA C
Sbjct  61    YMGVVIVLVKLFWKKPEQRYKYEPIQDDLELGSSNFPVVLIQIPMFNEREVYKVSIGAAC  120

Query  623   NFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGL  802
               +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL
Sbjct  121   GLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGL  180

Query  803   THDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQE  982
                YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVNADECLLTRMQE
Sbjct  181   KRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQE  240

Query  983   MSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  1162
             MSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+G
Sbjct  241   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  300

Query  1163  WKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             WKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  301   WKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  335



>ref|XP_002312893.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|EEE86848.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=537

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/331 (78%), Positives = 288/331 (87%), Gaps = 3/331 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             ++M+PE    +    D+A Q+ L+W+L+KAPLIVP L L VY+CLAMSLMLF+ER+YMGI
Sbjct  7     KVMIPESFQFQVSSSDIAGQLTLIWELLKAPLIVPLLTLGVYICLAMSLMLFMERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KP+KRYKWEPM++D E G   FP VL+QIPMFNE+EVYK+SIGA  N +W
Sbjct  67    VIILVKLFWKKPDKRYKWEPMQDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAASNLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   Y
Sbjct  127   PADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF+PEPD+L R+IPFLIHNPEIAL+Q RWRFVNADECLLTRMQEMSLD
Sbjct  187   VKHCEYVCIFDADFQPEPDYLRRAIPFLIHNPEIALVQGRWRFVNADECLLTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFL
Sbjct  247   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFL  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   YLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_010535659.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=532

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 290/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++P+   G   ++  Q+ ++W+LVKAP+IVP LRLAVY+CLAMSLML +ERLYMGIVI
Sbjct  6     KFVLPDTFNGVRSEITGQIGMIWELVKAPVIVPLLRLAVYLCLAMSLMLLMERLYMGIVI  65

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KP+KRYK+EP+++D E G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  66    ILVKLFWKKPDKRYKFEPIQDDEEFGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  125

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K MVE EC RWASKG+NI YQ R TRGGYKAGALKEGL   YV+
Sbjct  126   DRLVIQVLDDSTDPTVKHMVEMECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVK  185

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+P+PDFL RSIPFLIHN +IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  186   HCEYVVIFDADFQPKPDFLRRSIPFLIHNSDIALVQARWRFVNADECLLTRMQEMSLDYH  245

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             FKVEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  246   FKVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  305

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  306   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  334



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/331 (77%), Positives = 288/331 (87%), Gaps = 3/331 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             ++M+PE    +    D+A Q+ L+W+L+KAPLIVP L L VY+CLAMSLMLF+ER+YMGI
Sbjct  7     KVMIPESFQFQVSSSDIAGQLTLIWELIKAPLIVPLLTLGVYICLAMSLMLFMERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KP+KRYKWEPM++D E G   FP VL+QIPMFNE+EVYK+SIGA  N +W
Sbjct  67    VIILVKLFWKKPDKRYKWEPMQDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAASNLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R  R GYK+GALKEGL   Y
Sbjct  127   PADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKSGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF+PEPD+L R+IPFLIHNP+IAL+Q RWRFVNADECLLTRMQEMSLD
Sbjct  187   VKHCEYVCIFDADFQPEPDYLRRAIPFLIHNPDIALVQGRWRFVNADECLLTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFL
Sbjct  247   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFL  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   YLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera]
Length=533

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/327 (78%), Positives = 288/327 (88%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+A Q+ L+W+LVKAPLIVP LR+AVY+CL MSLMLFVERLYMGIVIIL
Sbjct  9     LIPETFQGTRLDIAGQIGLVWELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIIL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VKIF  KP+KRYKWEP+RED E G S FP V++QIPM+NEKEVYK+SIGA C  +WP+DR
Sbjct  69    VKIFWKKPDKRYKWEPLREDLESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             LV+QVLDDSTD  IK +VE EC RWA+KGINIRYQ R  R GYKAGAL+EGL   YV+ C
Sbjct  129   LVIQVLDDSTDPAIKNLVETECQRWAAKGINIRYQIRENRVGYKAGALREGLKRSYVKHC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             EYVAIFDADF+PEPD+L R+IPFL++N +IAL+Q RWRFVNADECL+TRMQEMSLDYHF 
Sbjct  189   EYVAIFDADFQPEPDYLKRAIPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGD
Sbjct  249   VEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   LQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/331 (77%), Positives = 289/331 (87%), Gaps = 3/331 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             ++M+PE    +    D++ Q++L+W+L+KAPLIVP L L VY+ LAMSLMLF+ER+YMGI
Sbjct  7     KIMIPESFQFQVSSYDISGQLKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KPEKRYKWEPM++D E G   FP VL+QIPMFNEKEVYK+SIGA  N +W
Sbjct  67    VIILVKLFWKKPEKRYKWEPMQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   Y
Sbjct  127   PADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF+PEPDFL R+IPFL+HNP++AL+QARWRFVNADECLLTRMQEMSLD
Sbjct  187   VKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+
Sbjct  247   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFV  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   YLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/311 (82%), Positives = 281/311 (90%), Gaps = 0/311 (0%)
 Frame = +2

Query  335   MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEP  514
             M L+W+L+KAPLIVP LR+ VY+ LAMSLMLF ERLYMGIVIILVK+F  KPEKRYK+E 
Sbjct  1     MGLIWELIKAPLIVPLLRICVYISLAMSLMLFFERLYMGIVIILVKLFWKKPEKRYKYEA  60

Query  515   MREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKE  694
             ++ED E+G+S FP VLIQIPMFNE+EVYKISIGA C  +WPSDRLV+QVLDDSTD  IK+
Sbjct  61    IQEDLELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTIKQ  120

Query  695   MVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDF  874
             MVE EC RWASKGINIRYQ R TRGGYKAGALKEGL   YV+ CEYVAIFDADFRPEPD+
Sbjct  121   MVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDY  180

Query  875   LLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFN  1054
             L R+IPFL+HNP+IAL+QARWRFVN+DECLLTRMQEMSLDYHF VEQEVGS+THAFFGFN
Sbjct  181   LRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  240

Query  1055  GTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRF  1234
             GT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL VKSELPSTF AFRF
Sbjct  241   GTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRF  300

Query  1235  QQHRWSCGPAN  1267
             QQHRWSCGPAN
Sbjct  301   QQHRWSCGPAN  311



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/331 (77%), Positives = 288/331 (87%), Gaps = 3/331 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             ++M+PE    +    D++ Q++L+WDL+KAPLIVP L L VY+ LAMSLML +ER+YMGI
Sbjct  7     KIMIPESFQFQVSSYDISGQLKLIWDLIKAPLIVPLLTLGVYISLAMSLMLLMERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VII VK+F  KPEKRYKWEPM++D E G   FP VL+QIPMFNEKEVYK+SIGA  N +W
Sbjct  67    VIIFVKLFWKKPEKRYKWEPMQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   Y
Sbjct  127   PADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF+PEPDFL R+IPFL+HNP++AL+QARWRFVNADECLLTRMQEMSLD
Sbjct  187   VKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAIN+AGGWKDRTTVEDMDLAVRA L+GWKF+
Sbjct  247   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAINDAGGWKDRTTVEDMDLAVRASLRGWKFV  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  337



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/323 (78%), Positives = 288/323 (89%), Gaps = 0/323 (0%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
              + G   DVAAQ++++W+++KAPLIVP L LAVY+ LAM+LMLF+ER+YMGIVIILVK+F
Sbjct  13    SINGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  479   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               KP +RYK+EP+++D E+G S +P VL+QIPMFNEKEVYK+SIGA CN +WP+DRLV+Q
Sbjct  73    WKKPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLVIQ  132

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  +K+MVE EC RWASKGINI YQ R TRGGYKAGALKEGL  +YV+ CEYVA
Sbjct  133   VLDDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVA  192

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL RSIPFL+ NP+IAL+QARWRFVN+DECLLTRMQEMSLDYHF VEQE
Sbjct  193   IFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL  K
Sbjct  253   VGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAK  312

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPST +AFRFQQHRWSCGPAN
Sbjct  313   SELPSTLRAFRFQQHRWSCGPAN  335



>ref|XP_010520406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=536

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/329 (78%), Positives = 289/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP LRLAVY+CLAMSLMLF ERLYMG+VI
Sbjct  7     KFVLPETFDGVKSEITGQLGMIWELVKAPVIVPLLRLAVYLCLAMSLMLFFERLYMGVVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRYK+EP++ED E+G S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYKFEPIQEDEELGNSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKG+NIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGLNIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
               EYV IFDADF+PEPDFL RSIPFL+HNP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HSEYVVIFDADFQPEPDFLRRSIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAIN+AGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINDAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL V+SELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVRSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/323 (78%), Positives = 287/323 (89%), Gaps = 0/323 (0%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
              + G   DVAAQ++++W+++KAPLIVP L LAVY+ LAM+LMLF+ER+YMGIVIILVK+F
Sbjct  13    SINGVNFDVAAQIKMVWEVIKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  479   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               KP +RYK+EP+++D E+G S +P VL+QIPMFNEKEVYK+SIGA CN +WP DRLV+Q
Sbjct  73    WKKPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPVDRLVIQ  132

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  IK+MVE EC RWASKGINI YQ R TRGGYKAGALKEGL  +YV+ CEYVA
Sbjct  133   VLDDSTDPTIKQMVEMECNRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVA  192

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL RSIPFL+ NP+IAL+QARWRFVN+DECLLTRMQEMSLDYHF VEQE
Sbjct  193   IFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL  K
Sbjct  253   VGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAK  312

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPST +AFRFQQHRWSCGPAN
Sbjct  313   SELPSTLRAFRFQQHRWSCGPAN  335



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/323 (78%), Positives = 288/323 (89%), Gaps = 0/323 (0%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
              + G   DVAAQ++++W+++KAPLIVP L LAVY+ LAM+LMLF+ER+YMGIVIILVK+F
Sbjct  13    SINGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  479   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               KP +RYK+EP+++D E+G S +P VL+QIPMFNEKEVYK+SIGA CN +WP+DRLV+Q
Sbjct  73    WKKPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLVIQ  132

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  +K+MVE EC RWASKGINI YQ R TRGGYKAGALKEGL  +YV+ CEYVA
Sbjct  133   VLDDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVA  192

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADFRPEPDFL RSIPFL+ NP+IAL+QARWRFVN+DECLLTRMQEMSLDYHF VEQE
Sbjct  193   IFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL  K
Sbjct  253   VGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAK  312

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPST +AFRFQQHRWSCGPAN
Sbjct  313   SELPSTLRAFRFQQHRWSCGPAN  335



>gb|KHF98868.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/329 (79%), Positives = 289/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             +L++PE  +    D+  Q+ L+W+L+K PLIVP L+L VY+CLAMSLMLF+ER+YMGIVI
Sbjct  7     KLLIPESFQVSRDDITGQLGLIWELIKTPLIVPLLQLGVYICLAMSLMLFMERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRY +E +++D E+G+S FP VLIQIPMFNEKEVYKISIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYNFELIQDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK MVEQEC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPDFL RSIPFL++NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HCEYVAIFDADFRPEPDFLRRSIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/331 (77%), Positives = 290/331 (88%), Gaps = 3/331 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             ++M+PE    +    D++ Q++L+W+L+KAPLIVP L L VY+ LAMSLMLF+ER+YMGI
Sbjct  7     KIMIPESFQFQVSSYDISDQLKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KPEKRYKWEPM++D E G   FP VL+QIPMFNEKEVYK+SIGA  N +W
Sbjct  67    VIILVKLFWKKPEKRYKWEPMQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  IK+MVE EC RWASKGI+IRYQ R  R GYKAGALKEGL   Y
Sbjct  127   PADRLVIQVLDDSTDPAIKQMVELECQRWASKGIDIRYQIRENRTGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF+PEPDFL R+IPFL+HNP++AL+QARWRFVNADECLLTRMQEMSLD
Sbjct  187   VKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+
Sbjct  247   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFV  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDLHVKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   YLGDLHVKSELPSTFQAFRFQQHRWSCGPAN  337



>ref|XP_007015963.1| Cellulose synthase-like A02 isoform 3 [Theobroma cacao]
 gb|EOY33582.1| Cellulose synthase-like A02 isoform 3 [Theobroma cacao]
Length=499

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             +L++PE  +    D+  Q+ L+W+L+KAPLIVP L+L VY+CL MSLMLF+ER+YMGIVI
Sbjct  7     KLLIPESFQVSRDDITGQIGLIWELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRY +E +++D E+G+S FP VL+QIPMFNEKEVYKISIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYNFELIQDDVELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK MVEQEC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPDFL RSIPFL  NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HCEYVAIFDADFRPEPDFLRRSIPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVR+ L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_007015962.1| Cellulose synthase-like A02 isoform 2, partial [Theobroma cacao]
 gb|EOY33581.1| Cellulose synthase-like A02 isoform 2, partial [Theobroma cacao]
Length=486

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             +L++PE  +    D+  Q+ L+W+L+KAPLIVP L+L VY+CL MSLMLF+ER+YMGIVI
Sbjct  7     KLLIPESFQVSRDDITGQIGLIWELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRY +E +++D E+G+S FP VL+QIPMFNEKEVYKISIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYNFELIQDDVELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK MVEQEC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPDFL RSIPFL  NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HCEYVAIFDADFRPEPDFLRRSIPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVR+ L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_007015961.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
 gb|EOY33580.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
Length=537

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/329 (78%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             +L++PE  +    D+  Q+ L+W+L+KAPLIVP L+L VY+CL MSLMLF+ER+YMGIVI
Sbjct  7     KLLIPESFQVSRDDITGQIGLIWELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRY +E +++D E+G+S FP VL+QIPMFNEKEVYKISIGA C  +WPS
Sbjct  67    ILVKLFWKKPEKRYNFELIQDDVELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK MVEQEC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPDFL RSIPFL  NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  187   HCEYVAIFDADFRPEPDFLRRSIPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVR+ L+GWKF+YL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/332 (76%), Positives = 289/332 (87%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             I+  +L+   L     D+A Q+ ++W+L+KAPLIVP LRL+VYVCLAM+LMLF+ER+YMG
Sbjct  4     ISAKDLIPDSLTMSREDIAGQLGMVWELIKAPLIVPVLRLSVYVCLAMALMLFMERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KPEKRY WEP+ ED E G+S FP VL+QIPM+NEKEVYKISIGA C  +
Sbjct  64    IVIVLVKLFWKKPEKRYNWEPIEEDLESGSSNFPFVLVQIPMYNEKEVYKISIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WP+DRLV+QVLDDSTD  IK+MVE EC RWASKGINI YQ R TRGGYKAGALKEGL   
Sbjct  124   WPADRLVIQVLDDSTDPVIKQMVELECQRWASKGINIVYQIRETRGGYKAGALKEGLKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ CE+VAIFDADFRPEPD+L R+IP+ + NP++AL+QARWRFVN++ECLLTRMQEMSL
Sbjct  184   YVKHCEFVAIFDADFRPEPDYLKRAIPYFLRNPDLALVQARWRFVNSNECLLTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGS+THAFFGFNGT G+WRI AINEAGGWKDRTTVEDMDLAVRA L+GWKF
Sbjct  244   DYHFTVEQEVGSATHAFFGFNGTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +YLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  304   VYLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  335



>gb|KHG21024.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
 gb|KHG23680.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/316 (80%), Positives = 280/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             DV +Q+ LMW+L+KAPL+VP L+L+VY+CL M+LMLF+ER+YMGIVI+LVK+F  KPE+R
Sbjct  20    DVTSQLGLMWELIKAPLLVPMLKLSVYICLGMALMLFMERVYMGIVIVLVKLFWKKPEER  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YK+ P+ +D E G+S FP VL+QIPMFNEKEVYKISIGA C  +WPSDRLV+QVLDDSTD
Sbjct  80    YKFVPIEDDEEHGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK MVEQEC RWASKGINI YQ R  R GYKAGALKEGL   YV+ CEYVAI DADFR
Sbjct  140   SAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIIDADFR  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             P+PDFL +SIPFL HNP+IAL+QARWRFVNADECLLTRMQEMSLDYHF VEQEVGS+THA
Sbjct  200   PDPDFLRKSIPFLDHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI AINEAGGWKDRTTVEDMDLAVRA L+GWKFLYLGDL VKSELPSTF
Sbjct  260   FFGFNGTAGIWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KAFRFQQHRWSCGPAN
Sbjct  320   KAFRFQQHRWSCGPAN  335



>ref|XP_006287471.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
 gb|EOA20369.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
Length=533

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK++P+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFLIHNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 287/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_004506130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cicer 
arietinum]
Length=538

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/331 (74%), Positives = 288/331 (87%), Gaps = 0/331 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             +E ++ +PE      D+  QM+++WD++KAPLIVP L   VY+ LAM+LMLF+ER+YMGI
Sbjct  4     SEPKVFIPESFQVNYDIVTQMKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGI  63

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VI+L+K+F  KPE+RY +EP+RED E+G S FP VLIQIPMFNEKEVYK+SIGA C  +W
Sbjct  64    VIVLIKLFWKKPEQRYNYEPLREDEELGNSNFPVVLIQIPMFNEKEVYKVSIGAACGLSW  123

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             PSDRLV+QVLDDSTD  +K++VE EC RWASKG+NI YQ R +RGGYKAGALKEGL  +Y
Sbjct  124   PSDRLVIQVLDDSTDPVVKQLVEMECQRWASKGLNITYQIRESRGGYKAGALKEGLKRNY  183

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYVAIFDADFRPEPDFL R+IPFL+ NPE+AL+QARWRFVN++ECLLTRMQEMSLD
Sbjct  184   VKHCEYVAIFDADFRPEPDFLRRAIPFLVGNPELALVQARWRFVNSNECLLTRMQEMSLD  243

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA L+GWKFL
Sbjct  244   YHFTVEQEVGSATHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFL  303

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL  KSELPST +AFRFQQHRWSCGPAN
Sbjct  304   YLGDLEAKSELPSTLRAFRFQQHRWSCGPAN  334



>emb|CDX88785.1| BnaA03g08640D [Brassica napus]
Length=510

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 288/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK+EP+++D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPDKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP+IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPKIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_010493365.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010493366.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
Length=533

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK++P+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFLIHN  IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_009126562.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Brassica 
rapa]
Length=534

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 285/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSIMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KPEKRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 284/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             M+P+   G   D++ QM L+WD +KAPLIVP LRLAV +CL MS+MLFVERLYM +VI+L
Sbjct  9     MLPDSFFGARDDISMQMGLIWDQIKAPLIVPMLRLAVVLCLIMSVMLFVERLYMAVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             +K F  KPEKRYKWEPM++D E+G S +P VL+QIPM+NE+EVY+ISIGA C  +WPSDR
Sbjct  69    IKFFGRKPEKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEREVYQISIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             ++VQVLDDSTD  IKEMVE EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C
Sbjct  129   IIVQVLDDSTDTTIKEMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             ++VAIFDADF+PEPDFL R+IPFL+HNPE+AL+Q RW+FVN++ECL+TRMQEMSLDYHF 
Sbjct  189   DFVAIFDADFQPEPDFLWRTIPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSSTHAFFGFNGT G+WRI AINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG 
Sbjct  249   VEQEVGSSTHAFFGFNGTAGVWRITAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGS  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             + VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   IQVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_010421063.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010454538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X1 
[Camelina sativa]
Length=533

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK++P+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HN  IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_006400777.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
 gb|ESQ42230.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
Length=532

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEMTGQLGMIWELVKAPVIVPLLQLAVYICLIMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFLIHN  IAL+QARWRFVN++ECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSNECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_010454539.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X2 
[Camelina sativa]
Length=533

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK++P+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct  67    VLVKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HN  IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>gb|KFK39910.1| hypothetical protein AALP_AA3G305000 [Arabis alpina]
Length=537

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 285/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+ AVY+CL MS+ML  ER+YMGIVI
Sbjct  9     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQFAVYLCLIMSVMLLCERVYMGIVI  68

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP KRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  AWPS
Sbjct  69    VLVKLFWKKPNKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLAWPS  128

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  129   DRLVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  188

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CE+V IFDADF+PEPDFL RSIPFLIHNP IAL+QARWRFVN++ECLLTRMQEMSLDYH
Sbjct  189   HCEFVVIFDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSNECLLTRMQEMSLDYH  248

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  249   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  308

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  309   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  337



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/320 (74%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   DV+ Q+ L+W  +KAPL+VP LR+AV++CLAMSLMLFVER+YM +VI+LVK+F  K
Sbjct  16    GARDDVSMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFVERVYMAVVILLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRY+WEPM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYRWEPMKDDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKGINIRY+ R  R GYKAGALKEG+   YV+ C+YVAI D
Sbjct  136   DSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R++PFL+HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTVPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  256   STHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+RFQQHRWSCGPAN
Sbjct  316   PSTFKAYRFQQHRWSCGPAN  335



>emb|CDX71011.1| BnaC03g10950D [Brassica napus]
Length=510

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/329 (75%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP+KRYK+ P+++D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPDKRYKFVPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/332 (72%), Positives = 289/332 (87%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   L+    +G   D+A Q+  +W+ +KAPLIVP L++AV+VCL MS+MLFVER+YMG
Sbjct  4     LSATTLLPDTFQGTRDDIAGQLGFIWEQIKAPLIVPLLKIAVFVCLIMSIMLFVERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVIILVK+F  KPEKRYKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVIILVKVFGRKPEKRYKWEPMKDDVEMGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK +VE EC RWASKGINIRY+ R  R GYKAGALKEG+   
Sbjct  124   WPSDRIIIQVLDDSTDSTIKSLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV++C+YVAIFDADF+PEPDFL R+IPFL+HNP+IAL+QARW+FVN+DECL+TRMQEMSL
Sbjct  184   YVRECDYVAIFDADFQPEPDFLWRTIPFLVHNPDIALVQARWKFVNSDECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             +YHF VEQEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   NYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +Y+G L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   VYVGGLQVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_007027602.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3 [Theobroma cacao]
 gb|EOY08104.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3 [Theobroma cacao]
Length=398

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 284/332 (86%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   ++    +G   D + QM ++W  +KAPLIVP LRL V VCL MSLMLF+ER+YMG
Sbjct  4     LSSTTILPDTFQGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KPE+RYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +
Sbjct  64    IVIMLVKLFGRKPERRYKWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+   
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YV IFDADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSL
Sbjct  184   YVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLG L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  304   LYLGSLKVKNELPSTLKAYRYQQHRWSCGPAN  335



>emb|CAN82595.1| hypothetical protein VITISV_013708 [Vitis vinifera]
Length=534

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/328 (76%), Positives = 284/328 (87%), Gaps = 2/328 (1%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+A Q+ L+W+LVKAPLIVP LR+AVY+CL MSLMLFVERLYMGIVIIL
Sbjct  9     LIPETFQGTRLDIAGQIGLVWELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIIL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VKIF  KP+KRYKWEP+RED E G S FP V++QIPM+NEKEVYK+SIGA C  +WP+DR
Sbjct  69    VKIFWKKPDKRYKWEPLREDLESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAG-ALKEGLTHDYVQD  823
             LV+QVLDDSTD  IK +VE EC RWA+KGINIRYQ R  R GYKAG + +      YV+ 
Sbjct  129   LVIQVLDDSTDPTIKNLVETECQRWAAKGINIRYQIRENRVGYKAGGSERRPEAERYVKH  188

Query  824   CEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHF  1003
             CEYVAIFDADF+PEPD+L R+IPFL++N +IAL+Q RWRFVNADECL+TRMQEMSLDYHF
Sbjct  189   CEYVAIFDADFQPEPDYLKRAIPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHF  248

Query  1004  KVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLG  1183
              VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG
Sbjct  249   TVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLG  308

Query  1184  DLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  309   DLQVKSELPSTFKAFRFQQHRWSCGPAN  336



>ref|XP_010683891.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 288/333 (86%), Gaps = 0/333 (0%)
 Frame = +2

Query  269   AINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYM  448
              I+  E++     G   D+  Q+ L+W+ +KAP  VP L+LAV +CL MS+MLF+ER+YM
Sbjct  3     TISTREVLPEGFLGDRDDITGQIGLIWEQIKAPFFVPILKLAVLICLGMSIMLFIERVYM  62

Query  449   GIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNF  628
             GIVI L+K+F  KPEKRYKWE +++D E+G+SV+P VL+QIPM+NEKEVY++SIGA C  
Sbjct  63    GIVITLLKLFGRKPEKRYKWETIKDDVELGSSVYPMVLVQIPMYNEKEVYQLSIGAACGL  122

Query  629   AWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTH  808
             +WPSDR+++QVLDDSTD  IKE+V  EC RWASKGINI+Y+ R  R GYKAGALKEG+ H
Sbjct  123   SWPSDRIIIQVLDDSTDSTIKELVAMECKRWASKGINIKYEIRDNRNGYKAGALKEGMKH  182

Query  809   DYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMS  988
             +YV++C+YVAIFDADF+PEPDFL RS+PFL+HNP++AL+QARW+FVN+DECL+TRMQEMS
Sbjct  183   NYVKNCDYVAIFDADFQPEPDFLWRSVPFLMHNPQLALVQARWKFVNSDECLMTRMQEMS  242

Query  989   LDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWK  1168
             LDYHF VEQEVGSST+AFFGFNGT G+WRI+AINEAGGWKDRTTVEDMDLAVRA LKGWK
Sbjct  243   LDYHFTVEQEVGSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWK  302

Query  1169  FLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             FLYLG L VK+ELPSTFKA+RFQQHRWSCGPAN
Sbjct  303   FLYLGSLQVKNELPSTFKAYRFQQHRWSCGPAN  335



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 289/327 (88%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE L+G   D+  QM L+W  +KAP+IVP LRL V++CLAMS+MLFVE++YM +VI++
Sbjct  9     ILPETLQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVYMAVVIVI  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+   +PEKRYKWEPMR+D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLLGKRPEKRYKWEPMRDDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+DC
Sbjct  129   IIIQVLDDSTDPVIKDLVEVECKRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL+HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLSRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WR++A++EAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRLSALSEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             + VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   IKVKNELPSTLKAYRYQQHRWSCGPAN  335



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 288/327 (88%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G G D+  QM ++W  ++APLIVP L+LAV++CL MSLMLF+ER+YM +VI+L
Sbjct  9     LLPEAFQGTGDDITDQMAIIWQQIRAPLIVPLLKLAVFLCLIMSLMLFMERVYMAVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KP KRYKWE +++D E+G + +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFGKKPGKRYKWEAIKDDLELGNANYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+DC
Sbjct  129   IIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHGYVRDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFLIHNPEI L+QARW+FVN+DECL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLWRTIPFLIHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGD
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_010690012.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=537

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/332 (76%), Positives = 286/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  284   ELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVII  463
             +++  +L    GDV+ Q+ LMWD++KAPLIVP L+L V VCL MSLMLF+ERLYMGIVI 
Sbjct  3     DMIQNQLLQARGDVSYQLELMWDMIKAPLIVPLLKLGVIVCLTMSLMLFMERLYMGIVIS  62

Query  464   LVKIFCGKPEKRYKWEPMRE---DYEIGTS-VFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             LVK+F  KP+KRY WE + +   D E G S  FP VLIQIPMFNE+EVYK+SIGA CN +
Sbjct  63    LVKMFWKKPDKRYNWEALPDSIDDIETGGSNKFPHVLIQIPMFNEREVYKVSIGAACNLS  122

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WP+DR+V+QVLDDSTD  +K+MVE EC RWASKG+NI YQ R  R GYKAGALKEGL  D
Sbjct  123   WPADRMVIQVLDDSTDPIVKDMVELECQRWASKGLNIVYQIRENRVGYKAGALKEGLKRD  182

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ CEYVAIFDADFRPEPD+L R+IPFL++NPE+AL+Q RWRFVNADECL+TRMQEMSL
Sbjct  183   YVKHCEYVAIFDADFRPEPDYLRRAIPFLMYNPELALVQGRWRFVNADECLMTRMQEMSL  242

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHFKVEQEVGSSTHAFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA L+GWKF
Sbjct  243   DYHFKVEQEVGSSTHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKF  302

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +YLGDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  303   VYLGDLQVKSELPSTFKAFRFQQHRWSCGPAN  334



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 289/332 (87%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   L+   L+G   D++ Q+ ++W  +KAP+IVP + +AV VCLAMSLMLF ER+Y+ 
Sbjct  4     LSSTTLLPDALQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLS  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KP+KRYKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVIVLVKLFGRKPDKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H 
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV++C+YVAIFDADF+PEPDFL R++PFL+HNPEIAL+QARW+FVN+DECL+TRMQEMSL
Sbjct  184   YVKECDYVAIFDADFQPEPDFLWRTVPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +YLG L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   VYLGTLKVKNELPSTFKAYRYQQHRWSCGPAN  335



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 289/332 (87%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   L+   L+G   D++ Q+ ++W  +KAP+IVP + +AV VCLAMSLMLF ER+Y+ 
Sbjct  4     LSSTTLLPDALQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLS  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KP+KRYKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVIVLVKLFGRKPDKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H 
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV++C+YVAIFDADF+PEPDFL R++PFL+HNPEIAL+QARW+FVN+DECL+TRMQEMSL
Sbjct  184   YVKECDYVAIFDADFQPEPDFLWRTVPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +YLG L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   VYLGTLKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 281/322 (87%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +G   D+  Q  L+W  +KAPLIVP LRLAV++CL MS+M+F+ER+YMGIVI LVK+F 
Sbjct  14    FQGAKDDITMQFLLIWSQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGIVITLVKLFG  73

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPEKRYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR++VQV
Sbjct  74    KKPEKRYKWEPIKDDIELGNSCYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIVQV  133

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C+ VAI
Sbjct  134   LDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDLVAI  193

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPDFL RS+PFL+HNPE+ LIQARW+FVNADEC++TRMQEMSLDYHF VEQEV
Sbjct  194   FDADFQPEPDFLWRSVPFLVHNPELGLIQARWKFVNADECMMTRMQEMSLDYHFTVEQEV  253

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL +L VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVKN  313

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPSTFKA+R+QQHRWSCGPAN
Sbjct  314   ELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D++ Q+ L+W  +KAPL+VP LR+AV++CLAMSLMLF+ER+YM +VI+LVK+F  K
Sbjct  16    GARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRY+WEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYRWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKGINIRY+ R  R GYKAGALKEG+   YV+ C+YVAI D
Sbjct  136   DSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG L VK+EL
Sbjct  256   STHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+RFQQHRWSCGPAN
Sbjct  316   PSTFKAYRFQQHRWSCGPAN  335



>emb|CDY10358.1| BnaCnng02590D [Brassica napus]
Length=532

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 282/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  QM ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  KPEKR
Sbjct  20    DITMQMSMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +KWEPM++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  80    FKWEPMKDDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  140   PTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  200   PEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  260   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D++ Q+ L+W  +KAPL+VP LR+AV++CLAMSLMLF+ER+YM +VI+LVK+F  K
Sbjct  16    GARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRY+WEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYRWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKGINIRY+ R  R GYKAGALKEG+   YV+ C+YVAI D
Sbjct  136   DSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG L VK+EL
Sbjct  256   STHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+RFQQHRWSCGPAN
Sbjct  316   PSTFKAYRFQQHRWSCGPAN  335



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 282/322 (88%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +G   D++ Q  ++WD +KAPLIVP LRLAV +CL MSLMLF+ER+YMGIVIILVK+F 
Sbjct  14    FQGARDDISMQFSIIWDQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIILVKLFG  73

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPEKRYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QV
Sbjct  74    RKPEKRYKWEPLKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C+YV I
Sbjct  134   LDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVI  193

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPDFL R+IPFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPQLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEV  253

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPST KA+R+QQHRWSCGPAN
Sbjct  314   ELPSTLKAYRYQQHRWSCGPAN  335



>emb|CAN74357.1| hypothetical protein VITISV_042153 [Vitis vinifera]
Length=533

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/332 (71%), Positives = 288/332 (87%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   L+  EL+G   D++ Q+ ++W  +KAP+IVP + +AV VCLAMSLMLF ER+Y+ 
Sbjct  4     LSSTTLLPDELQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLS  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KP+K YKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVIVLVKLFGRKPDKSYKWEPMKDDVELGXSAYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H 
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV++C+YVAIFDADF+PEPDFL R++PFL+HN EIAL+QARW+FVN+DECL+TRMQEMSL
Sbjct  184   YVKECDYVAIFDADFQPEPDFLWRTVPFLVHNXEIALVQARWKFVNSDECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +YLG L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   VYLGTLKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_007027601.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
 gb|EOY08103.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 284/332 (86%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   ++    +G   D + QM ++W  +KAPLIVP LRL V VCL MSLMLF+ER+YMG
Sbjct  4     LSSTTILPDTFQGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KPE+RYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +
Sbjct  64    IVIMLVKLFGRKPERRYKWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+   
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YV IFDADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSL
Sbjct  184   YVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLG L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  304   LYLGSLKVKNELPSTLKAYRYQQHRWSCGPAN  335



>ref|XP_008462530.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=359

 Score =   521 bits (1342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/332 (71%), Positives = 286/332 (86%), Gaps = 1/332 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQ-MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             +E  L +  L+G   +   Q + L+W+ +K+ ++VP LR AVY+CL MSLML +ER+YMG
Sbjct  6     SETLLPVTALQGTTANTLFQVITLIWEGIKSAIVVPLLRGAVYICLTMSLMLLIERVYMG  65

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI LVK+F  KPEKRYKWEPM +D E+G+SV+P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  66    IVIGLVKLFKRKPEKRYKWEPMEDDIELGSSVYPMVLVQIPMYNEKEVYQLSIGAACGLS  125

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  +KE+VE+EC RWASKGINI+Y+ R  R GYKAGALKEGL   
Sbjct  126   WPSDRIIIQVLDDSTDPIVKELVEKECERWASKGINIKYEIRDNRNGYKAGALKEGLKRS  185

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YV IFDADF+PEPDFL R++PFLIHNP+IAL+QARW+FVNA+ECL+TRMQEMSL
Sbjct  186   YVKLCDYVVIFDADFQPEPDFLRRTVPFLIHNPKIALVQARWKFVNANECLMTRMQEMSL  245

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  246   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  305

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLG++ VK+ELPST KAFR+QQHRWSCGPAN
Sbjct  306   LYLGNIQVKNELPSTLKAFRYQQHRWSCGPAN  337



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 286/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D   Q+ L+W+ +KAPLIVP LRLAV++CL MS+M+F+ER+YMGIVI L
Sbjct  9     ILPEAFQGAKDDFTMQLALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGIVITL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KPEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR
Sbjct  69    VKLFGRKPEKRYKWEPMKDDIELGNSCYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C
Sbjct  129   IIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             + VAIFDADF+PEPDFL R++PFL+HNPE+ALIQARW+FVNADECL+TRMQEMSLDYHF 
Sbjct  189   DCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL D
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_003606274.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88471.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=500

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 283/331 (85%), Gaps = 0/331 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             +E ++ +PE      DV++Q++++WD++KAPLIVP L   VY+ LAM+LMLF+ER+YMG 
Sbjct  4     SEPKVYIPESFQVNYDVSSQIKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGF  63

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KPE+RYK+EP+++D E+G   FP VL+QIPMFNE+EVYK+SIGA C  +W
Sbjct  64    VIILVKLFWKKPEQRYKYEPLQDDEELGGENFPVVLVQIPMFNEREVYKVSIGAACGLSW  123

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  +K++VE EC RWASKGINI YQ R TRGGYKAGALKEGL   Y
Sbjct  124   PTDRLVIQVLDDSTDPVVKQLVEMECQRWASKGINITYQIRETRGGYKAGALKEGLKRSY  183

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF P PDFL R+IPFL+ NPEIAL+Q RWRFVNA+ECLLTRMQEMSLD
Sbjct  184   VKHCEYVVIFDADFSPPPDFLRRAIPFLVGNPEIALVQGRWRFVNANECLLTRMQEMSLD  243

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFL
Sbjct  244   YHFTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFL  303

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL   SELPST +AFRFQQHRWSCGPAN
Sbjct  304   YLGDLQANSELPSTLRAFRFQQHRWSCGPAN  334



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/320 (74%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  16    GYRDDITMQMTMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKR+KWEPM++D E G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  76    PEKRFKWEPMKDDIEHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE+EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  136   DSTDPTIKDLVEKECSRWASKGINIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPD+L R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A++EAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  256   STYAFFGFNGTAGIWRISALSEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/320 (74%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D++ QM L+W  +KAPLIVP LRLAV +CL MS+MLFVERLYM IVI+L+K+F  K
Sbjct  16    GGRDDISMQMGLIWSQIKAPLIVPLLRLAVVLCLIMSVMLFVERLYMAIVIVLIKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRYKWEPM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK+MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C++VAIFD
Sbjct  136   DSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFL+H+PE+AL+Q RW+FVN++ECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTIPFLLHSPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG + VK+EL
Sbjct  256   STHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIQVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D   QM ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  KPEKR
Sbjct  20    DFTMQMSMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +KWEPM++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  80    FKWEPMKDDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  140   PTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  200   PEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  260   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   526 bits (1356),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 236/320 (74%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  16    GYRDDITMQMTMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKR+KWEPM++D E G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  76    PEKRFKWEPMKDDIEHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE+EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  136   DSTDPTIKDLVEKECSRWASKGINIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPD+L R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A++EAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  256   STYAFFGFNGTAGIWRISALSEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   526 bits (1356),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D++ QM L+W  +KAPLIVP LRLAV +C  MS+MLFVERLYM +VI+L+K+F  K
Sbjct  16    GGRDDISMQMGLIWSQIKAPLIVPLLRLAVVLCXIMSVMLFVERLYMAVVIVLIKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRYKWEPM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYKWEPMKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK+MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C++VAIFD
Sbjct  136   DSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFL+HNPE+AL+Q RW+FVN++ECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTIPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKF+YLG + VKSEL
Sbjct  256   STHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLQGWKFVYLGSIQVKSEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 283/326 (87%), Gaps = 1/326 (0%)
 Frame = +2

Query  290   MMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILV  469
             ++PE   P  D+  Q+ L+W  ++APLI P LR AV +CL MSLMLF+ER+YM +VI+LV
Sbjct  9     LLPE-SFPSNDMTEQLALIWRQIRAPLIAPLLRFAVGICLIMSLMLFIERVYMAVVIVLV  67

Query  470   KIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             K+F  +PEKRYKWEP+R+D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+
Sbjct  68    KLFGKRPEKRYKWEPIRDDIELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRI  127

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             ++QVLDDSTD  IKE+V  EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+DC+
Sbjct  128   IIQVLDDSTDPAIKELVTMECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKDCD  187

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YVAIFDADF+PEPD+L R++PFL+HNPE+AL+QARW+FVN+DECL+TRMQEMSLDYHF V
Sbjct  188   YVAIFDADFQPEPDYLWRTVPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTV  247

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSSTHAFFGFNGT G+WRI A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+++GDL
Sbjct  248   EQEVGSSTHAFFGFNGTAGVWRINALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDL  307

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  308   KVKNELPSTFKAYRYQQHRWSCGPAN  333



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 286/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  QM L+W  +KAP+IVP LRL V++CLAMS+MLFVE++YM +VI++
Sbjct  9     ILPEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVYMAVVIVI  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+   +PEKRY+WEPMR+D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLLGKRPEKRYRWEPMRDDLELGNSAYPMVLLQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+DC
Sbjct  129   IIIQVLDDSTDPVIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVN+DECL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLFRTIPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGS T+AFFGFNGT G+WRI+A+ EAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSLTYAFFGFNGTAGVWRISALREAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTLKAYRYQQHRWSCGPAN  335



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 282/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q+ ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  KPEKR
Sbjct  20    DITMQISMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +KWEPM++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  80    FKWEPMKDDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  140   PTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L +++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  200   PEPDYLWKTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  260   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   526 bits (1354),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 278/312 (89%), Gaps = 0/312 (0%)
 Frame = +2

Query  332   QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE  511
             Q+ ++WD ++APLIVP LRLAVYVCL MS+MLFVER+YMGIVI LVK+F  KPEKRYKWE
Sbjct  24    QVSMVWDQMRAPLIVPLLRLAVYVCLVMSVMLFVERVYMGIVISLVKLFGRKPEKRYKWE  83

Query  512   PMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIK  691
             PM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLDDSTD  IK
Sbjct  84    PMKDDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIK  143

Query  692   EMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPD  871
             ++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+PEPD
Sbjct  144   DLVELECHRWASKGVNIKYEIRDNRSGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPD  203

Query  872   FLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGF  1051
             FL R+IPFL+HNP +AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFFGF
Sbjct  204   FLWRTIPFLVHNPRLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGF  263

Query  1052  NGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFR  1231
             NGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPST KA+R
Sbjct  264   NGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYR  323

Query  1232  FQQHRWSCGPAN  1267
             +QQHRWSCGPAN
Sbjct  324   YQQHRWSCGPAN  335



>ref|XP_003606273.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88470.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=542

 Score =   526 bits (1354),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 283/331 (85%), Gaps = 0/331 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             +E ++ +PE      DV++Q++++WD++KAPLIVP L   VY+ LAM+LMLF+ER+YMG 
Sbjct  4     SEPKVYIPESFQVNYDVSSQIKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGF  63

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VIILVK+F  KPE+RYK+EP+++D E+G   FP VL+QIPMFNE+EVYK+SIGA C  +W
Sbjct  64    VIILVKLFWKKPEQRYKYEPLQDDEELGGENFPVVLVQIPMFNEREVYKVSIGAACGLSW  123

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             P+DRLV+QVLDDSTD  +K++VE EC RWASKGINI YQ R TRGGYKAGALKEGL   Y
Sbjct  124   PTDRLVIQVLDDSTDPVVKQLVEMECQRWASKGINITYQIRETRGGYKAGALKEGLKRSY  183

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ CEYV IFDADF P PDFL R+IPFL+ NPEIAL+Q RWRFVNA+ECLLTRMQEMSLD
Sbjct  184   VKHCEYVVIFDADFSPPPDFLRRAIPFLVGNPEIALVQGRWRFVNANECLLTRMQEMSLD  243

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGS+THAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFL
Sbjct  244   YHFTVEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFL  303

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLGDL   SELPST +AFRFQQHRWSCGPAN
Sbjct  304   YLGDLQANSELPSTLRAFRFQQHRWSCGPAN  334



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   525 bits (1353),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 237/327 (72%), Positives = 284/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++P+   G  GD+  Q  ++W  ++APLIVP LR+AV++CLAMS MLFVER+YM +VI L
Sbjct  9     LLPDTFAGGRGDMTEQFLVIWSQIRAPLIVPLLRVAVFLCLAMSAMLFVERVYMAVVITL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KP+KRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFGRKPDKRYKWEPLKDDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK +VE EC RWASKGINI+Y+ R  R GYKAGALKEGL H YV+ C
Sbjct  129   IIIQVLDDSTDPIIKNLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHSYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL+HN ++AL+QARW+FVNADECL+TR+QEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLWRTIPFLVHNSQLALVQARWKFVNADECLMTRLQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG 
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGS  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   525 bits (1353),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 285/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE   G   D+  Q+ L+W+ +KAPLIVP LRLAV++CL MS+M+F+ER+YMG+VI L
Sbjct  9     IIPESFLGAKDDLTTQLALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGVVITL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KPEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR
Sbjct  69    VKLFVRKPEKRYKWEPMKDDIELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C
Sbjct  129   IIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             + VAIFDADF+PEPDFL R++PFL+HNPE+ALIQARW+FVNADECL+TRMQEMSLDYHF 
Sbjct  189   DCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL D
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTLKAYRYQQHRWSCGPAN  335



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   525 bits (1352),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 284/322 (88%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             L+G   D+  Q+ L+W  +KAPLIVP LR++V++CL MS+M+F+ER+YMG+VI LVK+F 
Sbjct  13    LQGAKDDLTMQISLIWSQIKAPLIVPLLRISVFLCLIMSVMMFIERVYMGVVITLVKLFG  72

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPEKRYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QV
Sbjct  73    RKPEKRYKWEPIKDDIELGNSCYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  132

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C++VAI
Sbjct  133   LDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDHVAI  192

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPDFL R++PF++HNPEI LIQARW+FVN+DEC++TRMQEMSLDYHF VEQEV
Sbjct  193   FDADFQPEPDFLWRTVPFMVHNPEIGLIQARWKFVNSDECMMTRMQEMSLDYHFTVEQEV  252

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL +L VK+
Sbjct  253   GSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVKN  312

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPSTFKA+R+QQHRWSCGPAN
Sbjct  313   ELPSTFKAYRYQQHRWSCGPAN  334



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   525 bits (1352),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 284/332 (86%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             ++   ++    +G   D + QM ++W  +KAPLIVP LRL V VCL MSLMLF+ER+YMG
Sbjct  4     LSSTTILPDTFQGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KPE+RYKWEP+++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +
Sbjct  64    IVIMLVKLFGRKPERRYKWEPIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+   
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YV IFDADF+PEPDFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSL
Sbjct  184   YVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLG L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  304   LYLGSLKVKNELPSTLKAYRYQQHRWSCGPAN  335



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 285/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D   Q+ L+W+ +KAPLIVP LR+ V++CL MS+M+F+ER+YMGIVI L
Sbjct  9     ILPEAFQGAKDDFTMQLALVWNQIKAPLIVPLLRITVFLCLIMSVMMFIERVYMGIVITL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KPEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR
Sbjct  69    VKLFGRKPEKRYKWEPMKDDIELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C
Sbjct  129   IIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             + VAIFDADF+PEPDFL R++PFL+HNPE+ALIQARW+FVNADECL+TRMQEMSLDYHF 
Sbjct  189   DCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL D
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   525 bits (1351),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 283/332 (85%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             I+   L+     G   D+  Q  +MW+ +KAPLIVP LR+AV +CLAMS+MLF+ER+YM 
Sbjct  4     ISTTTLLPDTFYGTRDDITEQFAIMWEQIKAPLIVPLLRIAVLLCLAMSVMLFIERVYMF  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI LVK+F  KPEKRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVISLVKLFGRKPEKRYKWEPIKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR++VQ+LDDSTD   K +VE EC RWASKGINI+Y+ R  R GYKAGALK+GL H 
Sbjct  124   WPSDRIIVQILDDSTDPITKNLVEMECQRWASKGINIKYEVRDNRSGYKAGALKQGLKHS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C++VAIFDADF+PEPDFL R+IPFL+HNPE++L+QARW++VNADECL+TRMQEMSL
Sbjct  184   YVKQCDFVAIFDADFQPEPDFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGS+THAFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSATHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYL  L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   LYLSSLMVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   524 bits (1350),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 232/315 (74%), Positives = 280/315 (89%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + AQ+ ++WD ++ PL+ P LRLAVYVCLAMS+MLFVER+YMGIVI L+K+F  KPEKRY
Sbjct  14    ITAQVSMLWDQMRTPLVAPLLRLAVYVCLAMSVMLFVERVYMGIVISLLKLFGRKPEKRY  73

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWEPM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLDDSTD 
Sbjct  74    KWEPMKDDIELGDSAYPVVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDP  133

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+P
Sbjct  134   TIKDLVEMECQRWASKGVNIKYEVRDNRKGYKAGALKEGMKKSYVKSCDYVAIFDADFQP  193

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             EPDFL R+IPFL+HNP +AL+QARW+FVN+DECL+TRMQE+SLDYHF VEQEVGSST+AF
Sbjct  194   EPDFLWRTIPFLVHNPSLALVQARWKFVNSDECLMTRMQEISLDYHFTVEQEVGSSTYAF  253

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTFK
Sbjct  254   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFK  313

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  314   AYRYQQHRWSCGPAN  328



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  QM ++ D ++APLIVP LRL VY+CL MS+MLFVER+YMGIVI LVK+F  KP+KR
Sbjct  21    DITMQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKR  80

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +K+EPM++D E+G SV+P VL+QIPMFNE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  81    FKYEPMKDDIELGNSVYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  140

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  141   PTIKDLVEMECSRWASKGVNIKYEIRDNRKGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  200

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R++P+L+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  201   PEPDFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  260

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  261   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  320

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  321   KAYRYQQHRWSCGPAN  336



>ref|XP_006287469.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
 gb|EOA20367.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
Length=533

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  17    GYRDDITMQMSMVLDQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRK  76

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KR+K+EP+++D E+G SV+P VL+QIPMFNE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  77    PDKRFKYEPIKDDLELGNSVYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLD  136

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  137   DSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  196

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPD+L R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  197   ADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  256

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  257   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  316

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  317   PSTFKAYRYQQHRWSCGPAN  336



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   523 bits (1348),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  Q  ++W  +KAPLIVP L+LAV VCL MS+MLF+ER+YMG+VI+LVK+F  K
Sbjct  16    GGRDDMTEQFSMVWAQIKAPLIVPLLKLAVMVCLIMSVMLFIERVYMGVVILLVKLFARK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYKWEPIKDDLELGNSAYPVVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK +VE EC RWASKG+NI+Y+ R  R GYKAGALKEGL H YV+ C+YVAIFD
Sbjct  136   DSTDPIIKALVETECQRWASKGVNIKYEIRDNRNGYKAGALKEGLNHAYVKQCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFL+HNP++AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEPDFLWRTIPFLVHNPQLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT G+WR+AAI+EAGGWKDRTTVEDMDLAVRA L+GWKF+YLG L VK+EL
Sbjct  256   STYAFFGFNGTAGVWRLAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGSLVVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   523 bits (1347),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRL VY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  16    GYRDDITMQMSMILDQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKR+KWEPM++D E G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  76    PEKRFKWEPMKDDIEHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  136   DSTDQTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL +++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPESDFLWKTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  256   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   523 bits (1346),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 236/322 (73%), Positives = 279/322 (87%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +G   DV  Q+ L W   KAPL+VP L+L V +CL MS+MLFVER+YMG VI+LVKIF 
Sbjct  7     FQGGNVDVTNQIELFWVQAKAPLLVPLLKLFVTLCLGMSIMLFVERVYMGFVILLVKIFG  66

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPEK+Y WEP+++D EIG S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+VVQV
Sbjct  67    RKPEKKYNWEPLKDDLEIGNSTYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIVVQV  126

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD   K +VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV++C++VAI
Sbjct  127   LDDSTDPVTKNLVEMECHRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKECDFVAI  186

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPDFL R+IPFL+HNP+IAL+QARW+FVNADECL+TRMQEMSLDYHF VEQEV
Sbjct  187   FDADFQPEPDFLWRTIPFLVHNPQIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  246

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GSST+AFFGFNGT G+WRI+AINEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+G+L VK+
Sbjct  247   GSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGELKVKN  306

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPSTFKA+R+QQHRWSCGPAN
Sbjct  307   ELPSTFKAYRYQQHRWSCGPAN  328



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   523 bits (1346),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 276/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
             A+QM L+W   +APL+VP ++L V +CLAMSLMLFVER+YMGIVII VK+F  KPEK+YK
Sbjct  18    ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  77

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WEP+R+D E G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  78    WEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPI  137

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK MVE EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+PE
Sbjct  138   IKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPE  197

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             P+FL R+IPFL HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFF
Sbjct  198   PNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFF  257

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKG KF+YL DL VKSELPSTFKA
Sbjct  258   GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTFKA  317

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  318   YRYQQHRWSCGPAN  331



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   523 bits (1346),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 237/332 (71%), Positives = 281/332 (85%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             I+   L+     G   D+  Q  +MW  +KAPLIVP LR+AV +CL MS+MLF+ER+YM 
Sbjct  4     ISATTLLPDTFYGTRDDITEQFAIMWGQIKAPLIVPLLRIAVLLCLTMSVMLFIERVYMF  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI LVK+F  KPEKRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +
Sbjct  64    IVISLVKLFGRKPEKRYKWEPLKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR++VQVLDDSTD   K +VE EC RWASKGINI+Y+ R  R GYKAGALKEGL H 
Sbjct  124   WPSDRIIVQVLDDSTDPITKNLVEIECQRWASKGINIKYEVRNNRSGYKAGALKEGLKHS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C++VAIFDADF+PEPDFL R+IPFL+HNPE++L+QARW++VNADECL+TRMQEMSL
Sbjct  184   YVKQCDFVAIFDADFQPEPDFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGS+THAFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  244   DYHFTVEQEVGSATHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYL  L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   LYLSSLMVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   522 bits (1345),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 278/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q+ ++W+ +KAPLIVP LR+AV++CL MS+MLF+ER+YMGIVIILVK F  KPEKR
Sbjct  13    DLTVQLTILWEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEKR  72

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWE +++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR++VQVLDDSTD
Sbjct  73    YKWESLKDDVELGNSSYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIVQVLDDSTD  132

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +V  EC RWASKGINI+Y+ R  R GYKAGALKEGL H YV+ C+YVAIFDADF+
Sbjct  133   PIIKNLVSMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDADFQ  192

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNPE+ L+QARW++VNADECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  193   PEPDFLWRTIPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSSTYA  252

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKFLYL  L VK+ELPSTF
Sbjct  253   FFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELPSTF  312

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  313   KAYRYQQHRWSCGPAN  328



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   522 bits (1345),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 237/314 (75%), Positives = 277/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
              +QM L+W   +APL+VPAL+L V +CLAMS+MLFVER+YMGIVII VK+F  KP+K+YK
Sbjct  19    GSQMGLIWQQARAPLVVPALKLLVALCLAMSIMLFVERVYMGIVIIFVKLFRYKPDKKYK  78

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WEP+R+D EIG S +P VL+QIPM+NEKEVY++SIGA C   WPSDR+++QVLDDSTD  
Sbjct  79    WEPLRDDLEIGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLLWPSDRIIIQVLDDSTDPI  138

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK+MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+PE
Sbjct  139   IKKMVEVECQRWASKGINIKYEIRQNRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPE  198

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             P+FL R+IPFL HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFF
Sbjct  199   PNFLRRTIPFLYHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFF  258

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRI+A+NEAGGWKDRTTVEDMDLA+RAGLKG KF+YL DL VKSELPSTFKA
Sbjct  259   GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAIRAGLKGGKFVYLSDLKVKSELPSTFKA  318

Query  1226  FRFQQHRWSCGPAN  1267
             FR+QQHRWSCGPAN
Sbjct  319   FRYQQHRWSCGPAN  332



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   522 bits (1344),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 278/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q+ ++W+ +KAPLIVP LR+AV++CL MS+MLF+ER+YMGIVIILVK F  KPEKR
Sbjct  13    DLTVQLTIIWEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEKR  72

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWE +++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR++VQVLDDSTD
Sbjct  73    YKWESLKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTD  132

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               I+ +V  EC RWASKGINI+Y+ R  R GYKAGALKEGL H YV+ C+YVAIFDADF+
Sbjct  133   PIIRNLVSMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDADFQ  192

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNPE+ L+QARW++VNADECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  193   PEPDFLWRTIPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSSTYA  252

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKFLYL  L VK+ELPSTF
Sbjct  253   FFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELPSTF  312

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  313   KAYRYQQHRWSCGPAN  328



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   522 bits (1344),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 278/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q  L+W ++K PLIVPAL+L V VCL MS+MLF+ER+YMGIVI+ VK+F  KP K 
Sbjct  17    DITGQFGLIWQVLKEPLIVPALKLLVVVCLGMSIMLFIERVYMGIVIVFVKLFGKKPNKM  76

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD
Sbjct  77    YKWEPMKDDIEVGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTD  136

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+
Sbjct  137   PAIKSLVELECQRWASKGINIKYEIRDNRKGYKAGALKEGMKHSYVKQCDYVAIFDADFQ  196

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEP++L R+IPFL+HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS+T+A
Sbjct  197   PEPNYLWRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYA  256

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTF
Sbjct  257   FFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTF  316

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  317   KAYRYQQHRWSCGPAN  332



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   522 bits (1344),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 282/332 (85%), Gaps = 0/332 (0%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             +   +++    +G   DV  Q  L+W  +KAPLIVP LRLAV +CL MSLMLF+ER+YMG
Sbjct  4     LTSTQIIPDAFQGARDDVTMQFALIWGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI+LVK+F  KP++RYKWEPM++D E G S +P VL+QIPM+NE+EVY++SIGA C  +
Sbjct  64    IVIVLVKLFGRKPDRRYKWEPMKDDVEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLS  123

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK+MVE EC RWASKGINI+Y+ R +R GYK+GALKEG+   
Sbjct  124   WPSDRIIIQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDSRNGYKSGALKEGMKRS  183

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YVAIFDADF+PEPDFL R+IPFL+HNPE+ L+Q RW+FVNADECL+TRMQEMSL
Sbjct  184   YVKSCDYVAIFDADFQPEPDFLRRTIPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSL  243

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGW+F
Sbjct  244   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEF  303

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYL  + VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  304   LYLSSVKVKNELPSTLKAYRYQQHRWSCGPAN  335



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   521 bits (1342),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 276/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
             A+QM L+W   +APL+VP ++L V +CLAMSLMLFVER+YMGIVII VK+F  KPEK+YK
Sbjct  6     ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  65

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WEP+R+D E G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  66    WEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPI  125

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK MVE EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+PE
Sbjct  126   IKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPE  185

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             P+FL R+IPFL HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFF
Sbjct  186   PNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFF  245

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKG KF+YL DL VKSELPSTFKA
Sbjct  246   GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTFKA  305

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  306   YRYQQHRWSCGPAN  319



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   521 bits (1343),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 238/323 (74%), Positives = 281/323 (87%), Gaps = 1/323 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMR-LMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
               G   D++ Q+  L WD ++APL+VP LRL+V++CL MSLMLFVER+YMGIVI  VK+F
Sbjct  16    FEGTIDDMSFQVSSLPWDTIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMGIVISFVKLF  75

Query  479   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               KPEKRYKWEPM++D E+G SV+P VLIQIPM+NEKEVY++SIGA C  +WPSDR+++Q
Sbjct  76    GRKPEKRYKWEPMKDDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQ  135

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             VLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEGL   YV+ C++VA
Sbjct  136   VLDDSTDPIIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKQCDFVA  195

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFDADF+PEPDFL R++PFL+HNP IAL+QARW+FVNA+EC LTRMQEMSLDYHF VEQE
Sbjct  196   IFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQEMSLDYHFTVEQE  255

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLGDL VK
Sbjct  256   VGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLKVK  315

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             +ELPS+ KA+R+QQHRWSCGPAN
Sbjct  316   NELPSSLKAYRYQQHRWSCGPAN  338



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   521 bits (1343),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 282/327 (86%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             M+P+  +G   DV  Q  ++W  +KAPLIVP LRLAV +CL MSLMLF+ER+YMGIVI+L
Sbjct  9     MIPDAFQGARDDVTMQFAMIWGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  KP++RYKWEPM++D E G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR
Sbjct  69    VKLFGRKPDRRYKWEPMKDDVEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK+MVE EC RWASKGINI+Y+ R +R GYK+GALKEG+   YV+ C
Sbjct  129   IIIQVLDDSTDPTIKDMVELECQRWASKGINIKYEVRDSRNGYKSGALKEGMKRSYVKSC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL+HNPE+ L+Q RW+FVNADECL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLRRTIPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGW+FLYL  
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSS  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             + VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   VKVKNELPSTLKAYRYQQHRWSCGPAN  335



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   521 bits (1343),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 282/327 (86%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE   G   D+  Q  ++W  +KAPLIVP L +AV++CL MS MLF+ER+YM +VI L
Sbjct  9     VLPEPFSGARDDITEQFMIIWGQIKAPLIVPLLNIAVFLCLTMSAMLFIERVYMAVVISL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             +K+F  KP+KRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    IKLFGRKPDKRYKWEPLKDDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             ++VQVLDDSTD  IK MVE EC RWASKGINI+Y+ R  R GYKAGALK+GL H YV+ C
Sbjct  129   IIVQVLDDSTDPIIKNMVEIECQRWASKGINIKYEIRDNRNGYKAGALKQGLKHSYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             ++VAIFDADF+PEPDFL ++IPFL+HNPE+AL+QARW+FVNADECL+TRMQEMSLDYHF 
Sbjct  189   DFVAIFDADFQPEPDFLWKTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKFLYLG 
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGS  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  309   LQVKNELPSTFKAYRYQQHRWSCGPAN  335



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   521 bits (1342),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 230/316 (73%), Positives = 282/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  QM +++D ++APLIVP LRL VY+CL MS+MLFVER+YMGIVI LVK+F  KP+KR
Sbjct  20    DITMQMSMVFDQIRAPLIVPVLRLGVYICLVMSVMLFVERVYMGIVISLVKLFGRKPDKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +K+EP+++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  80    FKYEPIKDDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  140   PTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPD+L R++P+L+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  200   PEPDYLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  260   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   521 bits (1342),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQ-MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             E ++P      G   D++ Q + L WD ++APL+VP LRL+V++CL MSLMLFVER+YMG
Sbjct  8     EALLPTETAFEGTINDMSFQVISLPWDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMG  67

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI  VK+F  KPEKR+KWEPM++D E+G SV+P VLIQIPM+NEKEVY++SIGA C  +
Sbjct  68    IVISFVKLFGRKPEKRFKWEPMKDDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLS  127

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEGL   
Sbjct  128   WPSDRIIIQVLDDSTDPMIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRS  187

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C++VAIFDADF+PEPDFL R++PFL+HNP IAL+QARW+FVNA+EC LTRMQEMSL
Sbjct  188   YVKQCDFVAIFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQEMSL  247

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  248   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  307

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLGDL VK+ELPS+ KA+R+QQHRWSCGPAN
Sbjct  308   LYLGDLKVKNELPSSLKAYRYQQHRWSCGPAN  339



>gb|KGN46914.1| hypothetical protein Csa_6G150530 [Cucumis sativus]
Length=525

 Score =   520 bits (1340),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 282/329 (86%), Gaps = 15/329 (5%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             ++++PE  +G  GD   Q+ L+W+L+KAPLIVP LRL VY+ LAMSLMLF ERLYMGIVI
Sbjct  6     QILLPESFQGGRGDFTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVI  65

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             ILVK+F  KPEKRYK+EP+++D E+G+S FP VLIQIPMFNE+EVYKISIGA C  +WP+
Sbjct  66    ILVKLFWKKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPA  125

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  IK+MVEQEC+RWASKGINI YQ R TRGGYKAGALKEGL   YV+
Sbjct  126   DRLVIQVLDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVK  185

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYVAIFDADFRPEPD+L R+IPFL++NP+IAL+QARWRFVNADECLLTRMQEMSLDYH
Sbjct  186   HCEYVAIFDADFRPEPDYLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYH  245

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGS+THAFFGFN              GGWKDRTTVEDMDLAVRA L+GWKF+YL
Sbjct  246   FTVEQEVGSATHAFFGFN--------------GGWKDRTTVEDMDLAVRASLRGWKFVYL  291

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTFKAFRFQQHRWSCGPAN
Sbjct  292   GDLQVKSELPSTFKAFRFQQHRWSCGPAN  320



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   521 bits (1341),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 280/316 (89%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  QM ++ D ++APLIVPALRL VY+CL MS+MLFVER+YMGIVI LVK+F  KP+KR
Sbjct  20    DITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +K+EP+++D E+G S +P VLIQIPMFNE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  80    FKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFDADF+
Sbjct  140   PTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PE DFL R++P+L+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST+A
Sbjct  200   PEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPSTF
Sbjct  260   FFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   521 bits (1341),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 233/320 (73%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVPALRL VY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  16    GYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KR+K+EP+++D E+G S +P VLIQIPMFNE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  76    PDKRFKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  136   DSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R++P+L+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  256   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   521 bits (1341),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  284   ELMMPE---LRGPGGDVAAQ-MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             E ++P      G   D++ Q + L WD ++APL+VP LRL+V++CL MSLMLFVER+YMG
Sbjct  8     EALLPTETAFEGTINDMSFQVISLPWDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMG  67

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI  VK+F  KPEKR+KWEPM++D E+G SV+P VLIQIPM+NEKEVY++SIGA C  +
Sbjct  68    IVISFVKLFGRKPEKRFKWEPMKDDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLS  127

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEGL   
Sbjct  128   WPSDRIIIQVLDDSTDPMIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRS  187

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C++VAIFDADF+PEPDFL R++PFL+HNP IAL+QARW+FVNA+EC LTRMQEMSL
Sbjct  188   YVKQCDFVAIFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQEMSL  247

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  248   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  307

Query  1172  LYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LYLGDL VK+ELPS+ KA+R+QQHRWSCGPAN
Sbjct  308   LYLGDLKVKNELPSSLKAYRYQQHRWSCGPAN  339



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   520 bits (1340),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 275/320 (86%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  Q  L+W+++K PLI+P LR+AV +CL MS+M+F ERLYMG+VIILV +F  K
Sbjct  16    GARDDIFMQFGLVWNMIKEPLIIPLLRMAVAMCLVMSVMIFAERLYMGVVIILVHVFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRYKWEP+++D E+G+S +P VL+QIPMFNE+EVY++SIGA C+  WPSDRL++QVLD
Sbjct  76    PEKRYKWEPIKDDVELGSSNYPMVLVQIPMFNEREVYQLSIGACCSLTWPSDRLIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD   K MVE+EC RWA KGINI+Y+ R  R GYK+GALKEGL   Y ++C+YVAIFD
Sbjct  136   DSTDPTCKAMVERECQRWAGKGINIKYEIRDNRTGYKSGALKEGLKRSYAKNCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL RSIPF +HNP +AL+QARWRFVN +ECL+TR QEMSLDYHFK+EQEVGS
Sbjct  196   ADFQPEPDFLSRSIPFFVHNPNVALVQARWRFVNNNECLMTRFQEMSLDYHFKIEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG L VKSEL
Sbjct  256   STHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLQVKSEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKAFR QQHRWSCGPAN
Sbjct  316   PSTFKAFRHQQHRWSCGPAN  335



>gb|KDO61015.1| hypothetical protein CISIN_1g0413332mg, partial [Citrus sinensis]
Length=394

 Score =   515 bits (1326),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+A Q+ L+W  +KAPLIVP L +AV++CL MSLML +ER+YM IVI+L+K+    
Sbjct  16    GGTDDIAVQLSLLWGWIKAPLIVPLLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSGRS  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PE RYK++PM+ED E+G S +P VL+QIPMFNE+EVY++SIGA C  +WPSDRL++QVLD
Sbjct  76    PETRYKFQPMKEDVELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD+ IK+MVE EC RWASKGINI+Y+ R  R GYKAGAL+EG+   YV+ C++V IFD
Sbjct  136   DSTDLTIKDMVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R+IPFL+HNP++AL+QARW FVNADECL+TR+QEMSLDYHF VEQEVGS
Sbjct  196   ADFQPESDFLTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG + VK+EL
Sbjct  256   STHAFFGFNGTAGVWRIAAVNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTVKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   520 bits (1339),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D + QM ++W  ++APLIVP LR+ + +CL MS+MLF+ERLYM IVI+L+K+F  K
Sbjct  16    GARDDFSMQMGVLWSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMAIVIVLIKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KRY WEPM++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLD
Sbjct  76    PDKRYNWEPMKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  +K+MVE EC RWASKGINI+Y+ R  R GYKAGALKEGL   YV+ C+YVAIFD
Sbjct  136   DSTDSTVKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKHCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R+IPFL+HNPE+AL+Q RW+FVN++ECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPESDFLCRTIPFLVHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG + VK+EL
Sbjct  256   STHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>emb|CDY26949.1| BnaC09g36340D [Brassica napus]
Length=510

 Score =   519 bits (1336),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MSLML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSLMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP KRYK+EP+++D E+G+S FP VL+QIPMFNE+EVYK+SIG+    +WPS
Sbjct  67    VLVKLFWKKPHKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGSASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   520 bits (1338),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 278/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+ +Q+ L+W ++KAP++VP L+L V +CLAMS+MLF+ER+YMG+VI  VK+   KP KR
Sbjct  20    DITSQLNLVWQVLKAPILVPVLKLLVTMCLAMSIMLFIERVYMGVVIAFVKLLGRKPSKR  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD
Sbjct  80    YKWEPMKDDIELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VE EC R ASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+
Sbjct  140   PAIKSLVEMECQRRASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNP+I L+QARW+FVNADECL+TRMQEMSLDYHFKVEQEVGSST+A
Sbjct  200   PEPDFLWRAIPFLLHNPQIGLVQARWKFVNADECLMTRMQEMSLDYHFKVEQEVGSSTYA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+ DL VK+ELPSTF
Sbjct  260   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIADLKVKNELPSTF  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   519 bits (1337),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 289/327 (88%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  QM L+W  +KAP+IVP LRLAV +CLAMS+MLFVER+YMG+VI++
Sbjct  9     LLPEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLAVLLCLAMSVMLFVERVYMGVVILI  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  +PEKRYKWEPMR+D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFGKRPEKRYKWEPMRDDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+DC
Sbjct  129   IIIQVLDDSTDPVIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL+ NPE+AL+QARW+FVN+DECL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLWRTIPFLVRNPELALVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRI+AINEAGGWKDRTTVEDMDLAVRA LKGWKFL+LGD
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTLKAYRYQQHRWSCGPAN  335



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 231/333 (69%), Positives = 283/333 (85%), Gaps = 0/333 (0%)
 Frame = +2

Query  269   AINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYM  448
              ++   L+     G   D+  Q  +MW  +KAPLIVP LR++V++CLAMS+MLF+ER+YM
Sbjct  3     GLSRTNLVSDTFYGTRDDITEQFGIMWGQIKAPLIVPLLRISVFLCLAMSVMLFIERVYM  62

Query  449   GIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNF  628
              +VI L+K+F  KPEKRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  
Sbjct  63    FVVITLLKVFGTKPEKRYKWEPLKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGL  122

Query  629   AWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTH  808
             +WPSDR++VQVLDDSTD   K +V+ EC RWASKGINI+Y+ R  R GYKAGALKEGL H
Sbjct  123   SWPSDRIIVQVLDDSTDPITKNLVDIECQRWASKGINIKYEVRDNRSGYKAGALKEGLKH  182

Query  809   DYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMS  988
              YV+ C++VAIFDADF+PEPDFL ++IPFL+HNPE++L+QARW++VNADECL+TRMQEMS
Sbjct  183   SYVKQCDFVAIFDADFQPEPDFLWQTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMS  242

Query  989   LDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWK  1168
             LDYHF VEQEVGSSTHAFFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWK
Sbjct  243   LDYHFSVEQEVGSSTHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWK  302

Query  1169  FLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             FL+LG + VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  303   FLFLGSVKVKNELPSTLKAYRYQQHRWSCGPAN  335



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 279/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D++ QM ++W  +KAPLIVP L+LAV VCL MS+MLFVER+YMGIVI LVK+F  KP+KR
Sbjct  16    DLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFVERVYMGIVIALVKLFGRKPDKR  75

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             +KWE +++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLDDSTD
Sbjct  76    FKWEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTD  135

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK+MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YV IFDADF+
Sbjct  136   PTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQ  195

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNPE+AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSST++
Sbjct  196   PEPDFLWRTIPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYS  255

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+ELPST 
Sbjct  256   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTL  315

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  316   KAYRYQQHRWSCGPAN  331



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 237/331 (72%), Positives = 285/331 (86%), Gaps = 1/331 (0%)
 Frame = +2

Query  278   EVELMMPELRGPGGDVAAQ-MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             E  L + EL+G   D + Q +RL+ + +K+ ++VP LR AVY+CL MSLML +ER+YMGI
Sbjct  7     ETPLPVTELQGTAADTSFQVIRLICEAIKSVIVVPLLRGAVYICLTMSLMLLIERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VI LVK+F  KPEKRYKWEPM +D E+G SV+P VL+QIPM+NEKEVY++SIGA C+ +W
Sbjct  67    VIGLVKLFKRKPEKRYKWEPMEDDLELGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             PSDR+++QVLDDSTD  +K +VE+EC RWASKGI I+Y+ R  R GYKAGALKEGL   Y
Sbjct  127   PSDRIIIQVLDDSTDPTVKGLVEKECERWASKGITIKYEIRDNRNGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ C+YV IFDADF+PEPDFL R++PFLIHNP+IAL+QARW+FVNA+ECL+TRMQEMSLD
Sbjct  187   VKLCDYVVIFDADFQPEPDFLRRTVPFLIHNPKIALVQARWKFVNANECLMTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFL
Sbjct  247   YHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFL  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLG++ VK+ELPST KAFR+QQHRWSCGPAN
Sbjct  307   YLGNIQVKNELPSTLKAFRYQQHRWSCGPAN  337



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 277/320 (87%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D + QM ++W  ++APLIVP LR+ + +CL MS+MLF+ERLYMGIVI+L+K+F  K
Sbjct  16    GARDDFSMQMGVLWSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMGIVIVLIKLFGRK  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KRY WEPM++D E+G S +P VL+QIPM+NE+EVY++SI A C  +WPSDR+++QVLD
Sbjct  76    PDKRYNWEPMKDDVELGNSAYPMVLVQIPMYNEREVYQLSIRAACGLSWPSDRIIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  +K+MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  136   DSTDSTVKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVAIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R+IPFL+HNPEIAL+Q RW+FVN++ECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPESDFLCRTIPFLVHNPEIALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLG + VK+EL
Sbjct  256   STHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 280/315 (89%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +Q+ L+W  V+APL+VP+LR+ V++CLAMSLMLFVER+YMGIVI  +K+   KPEK+Y
Sbjct  16    ITSQIGLLWQQVRAPLLVPSLRIMVFLCLAMSLMLFVERVYMGIVIAFIKVLRRKPEKKY  75

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWEP+++D E+    +P VL+QIPM+NE+EVY++SIGA CN +WP+DR++VQVLDDSTD+
Sbjct  76    KWEPVKDDLELANYSYPMVLVQIPMYNEREVYQLSIGAACNLSWPADRILVQVLDDSTDL  135

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK MVEQEC RWA KG+NI+Y+ R  R GYKAGALKEG+ H+YV+ C+YVAIFDADF+P
Sbjct  136   TIKAMVEQECRRWAGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKLCDYVAIFDADFQP  195

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             + DFL+R+IPFL+HNPE+ L+Q RW+FVN+DECLLTRMQEMSLDYHF VEQEVGS+THAF
Sbjct  196   DSDFLMRTIPFLVHNPEVGLVQVRWKFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAF  255

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI A+NEAGGWKDRTTVEDMDLAVRAGLKGWKF+Y+G+L VK+ELPSTFK
Sbjct  256   FGFNGTAGVWRITALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYVGELKVKNELPSTFK  315

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  316   AYRYQQHRWSCGPAN  330



>gb|AED99880.1| glycosyltransferase [Panax notoginseng]
Length=465

 Score =   516 bits (1329),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/309 (79%), Positives = 276/309 (89%), Gaps = 1/309 (0%)
 Frame = +2

Query  293   MPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILV  469
             +PE  +G   D+A+Q+ L+W+L+KAPLIVP L+LAV+VCL M LMLF ERLYMGIVIILV
Sbjct  10    LPETFQGNTVDLASQLGLVWELIKAPLIVPLLKLAVFVCLTMELMLFCERLYMGIVIILV  69

Query  470   KIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             K+F  KP+KRY WEPM +D E+G S FP VLIQIPMFNE+EVYKISIGA CN +WPSDRL
Sbjct  70    KLFWKKPDKRYNWEPMTDDLEMGNSNFPLVLIQIPMFNEREVYKISIGAACNLSWPSDRL  129

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             V+QVLDDSTD  IK+MVE+EC RWA+KG+NI YQ R +RGGYKAGALKEGL  DYV++CE
Sbjct  130   VIQVLDDSTDPIIKDMVEKECQRWAAKGLNITYQIRESRGGYKAGALKEGLKRDYVKECE  189

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YVAIFDADFRPEPDFL RSIPFL+HNP+IAL+QARWRFVN++ECL+TRMQEMSLDYHF V
Sbjct  190   YVAIFDADFRPEPDFLRRSIPFLMHNPQIALVQARWRFVNSNECLMTRMQEMSLDYHFTV  249

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGS+THAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL
Sbjct  250   EQEVGSATHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  309

Query  1190  HVKSELPST  1216
              VKSELP T
Sbjct  310   QVKSELPLT  318



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 231/326 (71%), Positives = 284/326 (87%), Gaps = 1/326 (0%)
 Frame = +2

Query  293   MPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILV  469
             +PE  +G   D+  QM ++W  +KAP+IVP LRLAV++CL MS+ML VE++YM +VI+LV
Sbjct  10    LPESFQGTRDDIGGQMGMVWQQIKAPVIVPLLRLAVFLCLVMSVMLVVEKVYMAVVIVLV  69

Query  470   KIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             K+   +PEKRYKWEPMR+D E+G+S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+
Sbjct  70    KLLGRRPEKRYKWEPMRDDLEVGSSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRI  129

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             ++QVLDDSTD  IK++VE EC RWASKG++I+Y+ R  R GYKAGALKEG+   YV+ C+
Sbjct  130   IIQVLDDSTDPVIKDLVELECQRWASKGVDIKYEIRDNRNGYKAGALKEGMKRSYVKHCD  189

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YV IFDADF+PEPDFL R+IPFLIHNP++ L+QARW+FVN+DECL+TRMQEMSLDYHF V
Sbjct  190   YVVIFDADFQPEPDFLWRAIPFLIHNPDVGLVQARWKFVNSDECLMTRMQEMSLDYHFTV  249

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGDL
Sbjct  250   EQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDL  309

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  310   KVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   518 bits (1334),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 276/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
             A+QM L+W   +APL+VP ++L V +CLAMSLMLFVER+YMGIVII VK+F  KPEK+YK
Sbjct  18    ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  77

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WEP+R+D E G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  78    WEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDDSTDPI  137

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK MVE EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+PE
Sbjct  138   IKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPE  197

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             P+FL R+IPFL +NPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFF
Sbjct  198   PNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFF  257

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKG KF+YL DL VKSELPSTFKA
Sbjct  258   GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTFKA  317

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  318   YRYQQHRWSCGPAN  331



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 229/327 (70%), Positives = 285/327 (87%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  Q+ ++W  +KAP+IVP LRL+V +CLAMS+MLFVE++YM +VI+L
Sbjct  9     ILPEAFQGARDDITEQLGVVWQQIKAPVIVPPLRLSVLLCLAMSVMLFVEKVYMAVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  +PE RYKWEPM +D E+G + +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFRRRPETRYKWEPMGDDAELGNAAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H+YV+ C
Sbjct  129   IIIQVLDDSTDPAIKELVQIECRRWASKGVNIKYEIRDNRNGYKAGALKEGMKHNYVKQC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVA+FDADF+PEPDFL R+IPFL+HNP+I L+Q RW+FVN++ECL+TRMQEMSLDYHF 
Sbjct  189   DYVAVFDADFQPEPDFLWRTIPFLVHNPQIGLVQGRWKFVNSNECLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFIFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPST KA+R+QQHRWSCGPAN
Sbjct  309   LKVKSELPSTLKAYRYQQHRWSCGPAN  335



>emb|CDY35710.1| BnaC02g09760D [Brassica napus]
Length=511

 Score =   517 bits (1332),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 284/329 (86%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MSLML  ER+YMG VI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSLMLLCERVYMGTVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KPEKRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   517 bits (1332),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 276/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
             A+QM L+W   +APL+VP ++L V +CLAMSLMLFVER+YMGIVII VK+F  KPEK+YK
Sbjct  6     ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  65

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WEP+R+D E G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  66    WEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDDSTDPI  125

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK MVE EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+PE
Sbjct  126   IKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPE  185

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             P+FL R+IPFL +NPE+AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFF
Sbjct  186   PNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFF  245

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKG KF+YL DL VKSELPSTFKA
Sbjct  246   GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTFKA  305

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  306   YRYQQHRWSCGPAN  319



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   518 bits (1333),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 279/324 (86%), Gaps = 0/324 (0%)
 Frame = +2

Query  296   PELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKI  475
             P  +G    +  ++ L+W+  + PL+VP L+L V VCL MS+MLFVER+YMGIVI LVK+
Sbjct  8     PTFQGTSYGIGDRIGLIWEQTREPLMVPLLKLMVVVCLTMSVMLFVERVYMGIVIALVKL  67

Query  476   FCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  655
             F  KPE+RY WEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPS+R+++
Sbjct  68    FGRKPEQRYNWEPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSERIII  127

Query  656   QVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYV  835
             QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YV
Sbjct  128   QVLDDSTDPTIKDLVEMECQRWASKGINIKYEIRGNRHGYKAGALKEGMKHSYVKQCDYV  187

Query  836   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  1015
             AIFDADF+PEPDFL R+IPFL+HNPEI L+QARW+FVN+DECL+TRMQEMSLDYHF VEQ
Sbjct  188   AIFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQ  247

Query  1016  EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  1195
             EVGSS+HAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+G L V
Sbjct  248   EVGSSSHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGALKV  307

Query  1196  KSELPSTFKAFRFQQHRWSCGPAN  1267
             K+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  308   KNELPSTFKAYRYQQHRWSCGPAN  331



>emb|CDY09164.1| BnaA02g05900D [Brassica napus]
Length=510

 Score =   517 bits (1331),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 284/329 (86%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVK P+IVP L+LAVY+CL MSLML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKGPVIVPLLQLAVYICLLMSLMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KPEKRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINI YQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   517 bits (1332),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +Q+ L W  V+APL+VP L++ V +CLAMSLMLFV+++YMGIVII +KI   KPEK+Y
Sbjct  11    ITSQIGLFWQQVRAPLLVPFLKIMVILCLAMSLMLFVDKVYMGIVIIFIKILRKKPEKKY  70

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWEP+++D E+  S +P VLIQIPM+NE+EVY++SIGA CN +WP++R+++QVLDDSTD 
Sbjct  71    KWEPIKDDLELANSSYPMVLIQIPMYNEREVYQLSIGAACNLSWPANRILIQVLDDSTDP  130

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK MVEQEC RWASKG+NI+Y+ R  R GYKAGALKEG+ H+YV+ C++VAIFDADF+P
Sbjct  131   IIKVMVEQECKRWASKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKMCDFVAIFDADFQP  190

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             E DFLLR++PFL+HNPEI L+QARW+FVN+DECLLTRMQEMSLDYHFKVEQEVGSS HAF
Sbjct  191   EFDFLLRTVPFLVHNPEIGLVQARWKFVNSDECLLTRMQEMSLDYHFKVEQEVGSSNHAF  250

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKGWKF+Y+GDL VK+ELPSTFK
Sbjct  251   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELPSTFK  310

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  311   AYRYQQHRWSCGPAN  325



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   517 bits (1332),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 231/320 (72%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRL VY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  17    GYRDDLTTQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  76

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KR+K+E +++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  77    PDKRFKYEAIKDDMELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  136

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  137   DSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  196

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  197   ADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  256

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  257   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  316

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  317   PSTFKAYRYQQHRWSCGPAN  336



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   517 bits (1332),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 284/331 (86%), Gaps = 1/331 (0%)
 Frame = +2

Query  278   EVELMMPELRGPGGDVAAQ-MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             E  L +  L+G   D + Q +RL+ + +K+ ++VP LR AVY+CL MSLML +ER+YMGI
Sbjct  7     ETPLPVTALQGTAADTSFQVIRLICEAIKSVIVVPLLRGAVYICLTMSLMLLIERVYMGI  66

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VI LVK+F  KPEKRYKWEPM +D E+G SV+P VL+QIPM+NEKEVY++SIGA C+ +W
Sbjct  67    VIGLVKLFKRKPEKRYKWEPMEDDLELGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSW  126

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             PSDR+++QVLDDSTD  +K +VE+EC RWASKGI I+Y+ R  R GYKAGALKEGL   Y
Sbjct  127   PSDRIIIQVLDDSTDPTVKGLVEKECERWASKGITIKYEIRDNRNGYKAGALKEGLKRSY  186

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ C+YV IFDADF+PEPDFL R++PFLIHNP+IAL+QARW+FVNA+ECL+TRMQEMSLD
Sbjct  187   VKLCDYVVIFDADFQPEPDFLRRTVPFLIHNPKIALVQARWKFVNANECLMTRMQEMSLD  246

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFL
Sbjct  247   YHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFL  306

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YLG++ VK+ELPST KAFR+QQHRWSCGPAN
Sbjct  307   YLGNIQVKNELPSTLKAFRYQQHRWSCGPAN  337



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   517 bits (1331),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 231/320 (72%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ D ++APLIVP LRL VY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  17    GYRDDLTMQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  76

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KR+K+E +++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  77    PDKRFKYEAIKDDMELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  136

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  137   DSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  196

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  197   ADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  256

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  257   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  316

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  317   PSTFKAYRYQQHRWSCGPAN  336



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   517 bits (1331),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 231/320 (72%), Positives = 281/320 (88%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  QM ++ + ++APLIVP LRLAVY+CL MS+MLFVER+YMGIVI LVK+F  K
Sbjct  17    GYRDDLTTQMSMVLNQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRK  76

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P+KR+K+E +++D E+G SV+P VL+QIPM+NE+EVY++SIGA C  +WPSDR+V+QVLD
Sbjct  77    PDKRFKYEAIKDDMELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLD  136

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+YVAIFD
Sbjct  137   DSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFD  196

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R++PFL+HNP++AL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  197   ADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGS  256

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG L VK+EL
Sbjct  257   STYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNEL  316

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  317   PSTFKAYRYQQHRWSCGPAN  336



>ref|XP_009120642.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Brassica 
rapa]
Length=534

 Score =   517 bits (1331),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 285/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAV +CL MSLML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVDICLLMSLMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP KRYK+EP+++D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPHKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   516 bits (1329),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 280/331 (85%), Gaps = 0/331 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             +   L    L G   D+  Q+ ++W+ +KAPLIVP LR+AV++CL MS++LF+ER+YMGI
Sbjct  5     SSTTLFPDTLAGTRDDLTEQLTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYMGI  64

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VI LVK+F  K +KRYKWE +++D EIG S +P VL+QIPM+NEKEVY++SIGA C  +W
Sbjct  65    VITLVKLFGRKSDKRYKWESLKDDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAACGLSW  124

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             PSDR+++QVLDDSTD  IK +V  EC RWASKGI+IRY+ R  R GYKAGALKEGL H Y
Sbjct  125   PSDRIIIQVLDDSTDPIIKNLVSMECQRWASKGIDIRYEIRDNRNGYKAGALKEGLKHPY  184

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ C+YVAIFDADF+PEPDFL R+IPFL+HNP++ L+QARW+FVNADECL+TRMQEMSLD
Sbjct  185   VKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQEMSLD  244

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGSST+AFFGFNGT G+WRIAA+ EAGGWKDRTTVEDMDLAVRA LKGWKFL
Sbjct  245   YHFTVEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKGWKFL  304

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YL  L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  305   YLSALKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 282/327 (86%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  QM ++W  +KAP++VP LRLAV++CL MS+ML VE+ YM +VI+L
Sbjct  9     LLPESFQGARDDITEQMGMVWQQIKAPVMVPLLRLAVFLCLVMSVMLVVEKAYMAVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  +PEKRY+WEPMR+D E+G+S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFGRRPEKRYRWEPMRDDLELGSSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV  C
Sbjct  129   IIIQVLDDSTDPVIKDLVEAECRRWASKGVNIKYEIRDNRSGYKAGALKEGMKHSYVNHC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R++PFL+HNP + L+QARW+FVN+DECL+ RMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLYRTVPFLLHNPAVGLVQARWKFVNSDECLMARMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSS +AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSSAYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPST +A+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTLRAYRYQQHRWSCGPAN  335



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q+ L+W   KAPLIVP L+  V +CLAMS+MLFVER+YMGIVI+ VK+F  KPEK 
Sbjct  22    DITGQVGLIWQQTKAPLIVPVLKGMVVLCLAMSIMLFVERVYMGIVIVFVKLFGRKPEKM  81

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YK EPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WP+DR+++QVLDDSTD
Sbjct  82    YKLEPMKDDVELGYSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPADRIIIQVLDDSTD  141

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VE EC RWASKGIN++Y+ R  R GYKAGALKEG+ H YV  C+YVAIFDADF+
Sbjct  142   PAIKTLVELECQRWASKGINVKYEIRDNRNGYKAGALKEGMKHSYVNQCDYVAIFDADFQ  201

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+ NPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGSSTHA
Sbjct  202   PEPDFLWRTIPFLVSNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFIVEQEVGSSTHA  261

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTF
Sbjct  262   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTF  321

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  322   KAYRYQQHRWSCGPAN  337



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   515 bits (1326),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 277/316 (88%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
              V +Q+ L+W  V+ PL+VP LR+ V +CLAMSLMLFVER+YMGIVI  +K+   KPEK+
Sbjct  15    SVTSQIGLLWQQVRVPLLVPFLRIMVVLCLAMSLMLFVERVYMGIVIAFIKLLRRKPEKK  74

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEP+++D E+    +P VL+QIPM+NE+EVY++SIGA CN +WP+DR+++QVLDDSTD
Sbjct  75    YKWEPVKDDLELANYSYPIVLVQIPMYNEREVYQLSIGAACNLSWPADRILIQVLDDSTD  134

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK MVEQEC RW  KG+NI+Y+ R  R GYKAGALKEG+ H+YV+ C+YVAIFDADF+
Sbjct  135   PTIKAMVEQECRRWTGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKLCDYVAIFDADFQ  194

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             P+ DFL+R+IPFL+HNPE+ L+QARW+FVN+DECLLTRMQEMSLDYHF VEQEVGS+THA
Sbjct  195   PDSDFLMRTIPFLVHNPEVGLVQARWKFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHA  254

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRAGLKGWKF+Y+GDL VK+ELPSTF
Sbjct  255   FFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELPSTF  314

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  315   KAYRYQQHRWSCGPAN  330



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   514 bits (1325),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 280/331 (85%), Gaps = 0/331 (0%)
 Frame = +2

Query  275   NEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGI  454
             +   L    L G   D+  Q  ++W+ +KAPLIVP LR+AV++CL MS++LF+ER+YMGI
Sbjct  5     SSTTLFPDTLAGTRDDLTEQWTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYMGI  64

Query  455   VIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAW  634
             VI LVK+F  KP+KRYKWE +++D EIG S +P VL+QIPM+NEKEVY++SIGA C  +W
Sbjct  65    VITLVKMFGRKPDKRYKWESLKDDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAACGLSW  124

Query  635   PSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDY  814
             PSDR+++QVLDDSTD  IK +V  EC RWASKGI+I+Y+ R  R GYKAGALKEGL H Y
Sbjct  125   PSDRIIIQVLDDSTDPIIKNLVSMECQRWASKGIDIKYEIRDNRNGYKAGALKEGLKHPY  184

Query  815   VQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLD  994
             V+ C+YVAIFDADF+PEPDFL R+IPFL+HNP++ L+QARW+FVNADECL+TRMQEMSLD
Sbjct  185   VKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQEMSLD  244

Query  995   YHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFL  1174
             YHF VEQEVGSST+AFFGFNGT G+WRIAA+ EAGGWKDRTTVEDMDLAVRA LKGWKFL
Sbjct  245   YHFTVEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKGWKFL  304

Query  1175  YLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             YL  L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  305   YLSALKVKNELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   514 bits (1324),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 233/317 (74%), Positives = 274/317 (86%), Gaps = 0/317 (0%)
 Frame = +2

Query  317   GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK  496
              D   Q+ ++W+ VKAP+IVP LR+AV++CLAMS+MLFVE++YM  VI+ VK+   +PE 
Sbjct  14    NDDVTQLGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPET  73

Query  497   RYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDST  676
             RYKWEPM +D E G++ +P VL+QIPMFNEKEVY++SIGA C  +WPSDRL++QVLDDST
Sbjct  74    RYKWEPMEDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDST  133

Query  677   DVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADF  856
             D  IKEMV+ EC RWASKG+NIRY+ R  R GYKAGALK G+ H YV+DC+YV IFDADF
Sbjct  134   DPAIKEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADF  193

Query  857   RPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTH  1036
             +P+PDFL R+IPFLIHNP+I L+Q RWRFVNADECL+TRMQEMSLDYHF +EQEVGSST+
Sbjct  194   QPDPDFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTY  253

Query  1037  AFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPST  1216
             AFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF++L DL VKSELPST
Sbjct  254   AFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPST  313

Query  1217  FKAFRFQQHRWSCGPAN  1267
             FKAFR QQHRWSCGPAN
Sbjct  314   FKAFRHQQHRWSCGPAN  330



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   514 bits (1323),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 222/337 (66%), Positives = 285/337 (85%), Gaps = 0/337 (0%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE  436
             M  ++ +   ++    +G   D+  Q+ L+W  ++APL+ P L + +Y CL MS+MLF+E
Sbjct  1     MDRLSYSSANILPQTFQGTRDDIVEQIALLWQQIRAPLVAPLLNICIYFCLLMSVMLFIE  60

Query  437   RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA  616
             R+YM +VI+L+K+F  KPEKRYKW  ++ED E+G SV+P VL+QIPM+NE+EVY++SIGA
Sbjct  61    RVYMAVVIVLIKLFGKKPEKRYKWGAIKEDVELGNSVYPMVLVQIPMYNEREVYQLSIGA  120

Query  617   VCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKE  796
              C  +WPS+R+++QVLDDSTD+ IK++VE EC +WASKGINI+Y+ R  R GYKAGALKE
Sbjct  121   ACALSWPSNRVIIQVLDDSTDLTIKDLVEMECQKWASKGINIKYEIRGNRNGYKAGALKE  180

Query  797   GLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRM  976
             G+ H YV++C+YV IFDADF+P+ DFL R+IPFL+HNPE+AL+QARW+FVNADECL+TRM
Sbjct  181   GMKHSYVRECDYVVIFDADFQPDRDFLSRTIPFLVHNPELALVQARWKFVNADECLMTRM  240

Query  977   QEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGL  1156
             QEMSLDYHF VEQEVGS+THAFFGFNGT G+WRI A+NEAGGWKDRTTVEDMDLAVRA L
Sbjct  241   QEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIKALNEAGGWKDRTTVEDMDLAVRASL  300

Query  1157  KGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             +GWKF+++GDL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  301   RGWKFVFVGDLGVKNELPSTFKAYRYQQHRWSCGPAN  337



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   513 bits (1322),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+A Q+ L+W  +KAPLIVP L +AV++CL MSLML +ER+YM IVI+L+K+    
Sbjct  16    GGTDDIAVQLSLLWGWIKAPLIVPLLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSGRS  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PE RYK++PM+ED E+G S +P VL+QIPMFNE+EVY++SIGA C  +WPSDRL++QVLD
Sbjct  76    PETRYKFQPMKEDVELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD+ IK+MVE EC RWASKGINI+Y+ R  R GYKAGAL+EG+   YV+ C++V IFD
Sbjct  136   DSTDLTIKDMVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVIFD  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PE DFL R+IPFL+HNP++AL+QARW FVNADECL+TR+QEMSLDYHF VEQEVGS
Sbjct  196   ADFQPESDFLTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG + VK+EL
Sbjct  256   STHAFFGFNGTAGVWRIAAVNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTIKVKNEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKA+R+QQHRWSCGPAN
Sbjct  316   PSTFKAYRYQQHRWSCGPAN  335



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   513 bits (1320),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/315 (75%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             ++ QM LMW   KAPLIVP L+L VY+CLA+S+MLFVER+YMGIVI+L+K+F  KPEKRY
Sbjct  15    ISGQMGLMWQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRY  74

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWE +++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+ +QVLDDSTD 
Sbjct  75    KWEAIKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDP  134

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK++VE EC RWASKGINI+Y+ R +R GYKAGALKEG+ H YV+ C+YVAIFDADF P
Sbjct  135   TIKDLVELECQRWASKGINIKYEIRDSRNGYKAGALKEGMKHSYVKQCDYVAIFDADFEP  194

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             EPDFL R+IPFL+HNP+IAL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AF
Sbjct  195   EPDFLWRTIPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAF  254

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTFK
Sbjct  255   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFK  314

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  315   AYRYQQHRWSCGPAN  329



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   513 bits (1320),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/315 (75%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             ++ QM LMW   KAPLIVP L+L VY+CLA+S+MLFVER+YMGIVI+L+K+F  KPEKRY
Sbjct  15    ISGQMGLMWQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRY  74

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWE +++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+ +QVLDDSTD 
Sbjct  75    KWEAIKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDP  134

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+P
Sbjct  135   TIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQP  194

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             EPDFL R+IPFL+HNP+IAL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AF
Sbjct  195   EPDFLWRTIPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAF  254

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTFK
Sbjct  255   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFK  314

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  315   AYRYQQHRWSCGPAN  329



>ref|XP_009403734.1| PREDICTED: probable mannan synthase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=555

 Score =   514 bits (1323),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 233/317 (74%), Positives = 274/317 (86%), Gaps = 0/317 (0%)
 Frame = +2

Query  317   GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK  496
              D   Q+ ++W+ VKAP+IVP LR+AV++CLAMS+MLFVE++YM  VI+ VK+   +PE 
Sbjct  14    NDDVTQLGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPET  73

Query  497   RYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDST  676
             RYKWEPM +D E G++ +P VL+QIPMFNEKEVY++SIGA C  +WPSDRL++QVLDDST
Sbjct  74    RYKWEPMEDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDST  133

Query  677   DVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADF  856
             D  IKEMV+ EC RWASKG+NIRY+ R  R GYKAGALK G+ H YV+DC+YV IFDADF
Sbjct  134   DPAIKEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADF  193

Query  857   RPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTH  1036
             +P+PDFL R+IPFLIHNP+I L+Q RWRFVNADECL+TRMQEMSLDYHF +EQEVGSST+
Sbjct  194   QPDPDFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTY  253

Query  1037  AFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPST  1216
             AFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF++L DL VKSELPST
Sbjct  254   AFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPST  313

Query  1217  FKAFRFQQHRWSCGPAN  1267
             FKAFR QQHRWSCGPAN
Sbjct  314   FKAFRHQQHRWSCGPAN  330



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   513 bits (1321),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 279/322 (87%), Gaps = 1/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             LRG   D+AAQ+ L+W  +KAPLIVP L +AV++CL MSLML +ER+YM IVI+L+K+  
Sbjct  15    LRGTD-DIAAQLSLLWGWIKAPLIVPFLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSG  73

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
               PE RYK+EPM+ED E+G S +P VL+QIPMFNE+EVY++SIGA C  +WPSDRL++QV
Sbjct  74    RSPETRYKFEPMKEDIELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQV  133

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD+ IK+MVE EC RWASKGINI+Y+ R  R GYKAGAL+EG+   YV+ C++V I
Sbjct  134   LDDSTDLTIKDMVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVI  193

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PE DFL R+IPFL+HNP++AL+QARW FVNADECL+TR+QEMSLDYHF VEQEV
Sbjct  194   FDADFQPESDFLTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEV  253

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYLG + VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTVKVKN  313

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPSTFKA+R+QQHRWSCGPAN
Sbjct  314   ELPSTFKAYRYQQHRWSCGPAN  335



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   512 bits (1318),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 280/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M    G   D+++Q+ L+W  VK P++VP LR+AV+VCL MS+M+ VER+YMG VI LVK
Sbjct  1     MEAFEGARDDISSQVGLIWSQVKEPVMVPLLRVAVFVCLGMSIMMLVERVYMGFVICLVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  +PEKRYKWE ++ED E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFGRRPEKRYKWESLKEDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             VQ+LDDSTD +IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+Y
Sbjct  121   VQILDDSTDPSIKELVQMECSRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R++PFL++NPE+ L+QARW+FVNA+ECL+TRMQEMSLDYHF VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL +L 
Sbjct  241   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLANLK  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  301   VKNELPSTLKAYRYQQHRWSCGPAN  325



>ref|XP_008363527.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=499

 Score =   511 bits (1315),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 260/285 (91%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MSLMLF ER+YMG+VI+LVK+F  KPE+RYK+EP+++D E+G+S FP VLIQIPMFNE+E
Sbjct  1     MSLMLFFERVYMGVVIVLVKLFWKKPEQRYKYEPIQDDLELGSSNFPVVLIQIPMFNERE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VYK+SIGA C  +WPSDRLV+QVLDDSTD  IK+MVE EC RWASKGINIRYQ R TRGG
Sbjct  61    VYKVSIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEGL   YV+ CEYVAIFDADFRPEPD+L R+IPFL+HNP+IAL+QARWRFVNA
Sbjct  121   YKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNA  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECLLTRMQEMSLDYHF VEQEVGS+THAFFGFNGT G+WRIAAINEAGGWKDRTTVEDM
Sbjct  181   DECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA L+GWKFLYLGDL VKSELPSTF AFRFQQHRWSCGPAN
Sbjct  241   DLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPAN  285



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   510 bits (1313),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 226/325 (70%), Positives = 277/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M E +G   +V+ Q+  +W  V+ PLIVP LR+AV++CL MSLM+ VER+YMGIVI LVK
Sbjct  1     MVEFQGASDEVSLQLEFIWRQVREPLIVPILRVAVFLCLTMSLMMLVERVYMGIVICLVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  KPEK+YKWE  ++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFDRKPEKQYKWESFKDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +Q+LDDSTD  IKE+VE EC +W SKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C+Y
Sbjct  121   IQILDDSTDPTIKELVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R+IPF ++NPEI L+QARW+FVNADECL+TRMQEMSLDYHF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTIPFFVNNPEIGLVQARWKFVNADECLMTRMQEMSLDYHFRVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSST+AFFGFNGT G+WR  A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL +L 
Sbjct  241   QEVGSSTYAFFGFNGTAGVWRTLALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLK  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  301   VKNELPSTLKAYRYQQHRWSCGPAN  325



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   510 bits (1314),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 232/318 (73%), Positives = 272/318 (86%), Gaps = 0/318 (0%)
 Frame = +2

Query  314   GGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPE  493
             G  + A +  +WD+V+APLI P LR+ + +C A+S+M FVER+YMG+VI+ VK+    PE
Sbjct  18    GDGIPALLLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMGVVIVAVKLLRRTPE  77

Query  494   KRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDS  673
             KRYKWEP+++D E+G SV+P VLIQIPMFNEKEVY++SI A C  +WPSDR+V+QVLDDS
Sbjct  78    KRYKWEPIKDDSELGNSVYPMVLIQIPMFNEKEVYQMSIRAACGLSWPSDRMVIQVLDDS  137

Query  674   TDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDAD  853
             T   IK MVE EC +WASKGINI+Y+ R  R GYKAGALKEG+   Y +DC+YV IFDAD
Sbjct  138   TIPAIKNMVELECKKWASKGINIKYEVRDNRTGYKAGALKEGMKRSYAKDCDYVVIFDAD  197

Query  854   FRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSST  1033
             F+PE DFL RSIPFL+HNP++ALIQARW FVN+DEC++TR+QEMSLDYHF VEQEVGSST
Sbjct  198   FQPESDFLHRSIPFLVHNPQLALIQARWIFVNSDECMMTRLQEMSLDYHFTVEQEVGSST  257

Query  1034  HAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPS  1213
             HAFFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKFLYLGDL VK+ELPS
Sbjct  258   HAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKNELPS  317

Query  1214  TFKAFRFQQHRWSCGPAN  1267
             TFKAFRFQQHRWSCGPAN
Sbjct  318   TFKAFRFQQHRWSCGPAN  335



>ref|XP_003590384.1| Glucomannan 4-beta-mannosyltransferase, partial [Medicago truncatula]
Length=461

 Score =   508 bits (1307),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 275/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +G    +  Q   +W  ++ PLIVP LR+AV+VCL MSLM+ VER+YMGIVI  VK
Sbjct  1     MYAFQGARNGLGLQHEFLWRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  KPEKRYKWE +++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFGRKPEKRYKWETIKDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +Q+LDDSTD  IKE+V+ EC RW SKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C+Y
Sbjct  121   IQILDDSTDPTIKELVQVECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R+IPFL++NP+I L+QARW+FVNADECL+TRMQEMSL+YHF VE
Sbjct  181   VAIFDADFQPEPDFLWRTIPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSS++AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL DL 
Sbjct  241   QEVGSSSYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQ  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST KAFR+QQHRWSCGPAN
Sbjct  301   VKNELPSTLKAFRYQQHRWSCGPAN  325



>emb|CDX92340.1| BnaA10g13790D [Brassica napus]
Length=945

 Score =   524 bits (1349),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 286/329 (87%), Gaps = 1/329 (0%)
 Frame = +2

Query  284   ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI  460
             + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MSLML  ER+YMGIVI
Sbjct  7     KFVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSLMLLCERVYMGIVI  66

Query  461   ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS  640
             +LVK+F  KP KRYK+EP+++D E+G+S FP VL+QIPMFNE+EVYK+SIGA    +WPS
Sbjct  67    VLVKLFWKKPHKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPS  126

Query  641   DRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQ  820
             DRLV+QVLDDSTD  +K+MVE EC RWASKGINIRYQ R  R GYKAGALKEGL   YV+
Sbjct  127   DRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVK  186

Query  821   DCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYH  1000
              CEYV IFDADF+PEPDFL RSIPFL+HNP IAL+QARWRFVN+DECLLTRMQEMSLDYH
Sbjct  187   HCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYH  246

Query  1001  FKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYL  1180
             F VEQEVGSSTHAFFGFNGT GIWRIAAINEAGGWKDRTTVEDMDLAVRA L+GWKFLYL
Sbjct  247   FTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYL  306

Query  1181  GDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             GDL VKSELPSTF+AFRFQQHRWSCGPAN
Sbjct  307   GDLQVKSELPSTFRAFRFQQHRWSCGPAN  335



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   509 bits (1310),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 235/311 (76%), Positives = 278/311 (89%), Gaps = 0/311 (0%)
 Frame = +2

Query  335   MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEP  514
             M LMW   KAPLIVP L+L VY+CLA+S+MLFVER+YMGIVI+L+K+F  KPEKRYKWE 
Sbjct  1     MGLMWQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRYKWEA  60

Query  515   MREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKE  694
             +++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+ +QVLDDSTD  IK+
Sbjct  61    IKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTIKD  120

Query  695   MVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDF  874
             +VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+PEPDF
Sbjct  121   LVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDF  180

Query  875   LLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFN  1054
             L R+IPFL+HNP+IAL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST+AFFGFN
Sbjct  181   LWRTIPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  240

Query  1055  GTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRF  1234
             GT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTFKA+R+
Sbjct  241   GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRY  300

Query  1235  QQHRWSCGPAN  1267
             QQHRWSCGPAN
Sbjct  301   QQHRWSCGPAN  311



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   509 bits (1311),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 275/315 (87%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +QM  +W+ V+ PLIVP L++ V++CLAMS+MLFVE++YMGIVI+ VK+F  KP+K Y
Sbjct  17    IVSQMSFIWEQVRVPLIVPMLKVLVFLCLAMSIMLFVEKVYMGIVIVFVKLFGHKPDKHY  76

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWEP+++D E+G S FP VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD 
Sbjct  77    KWEPLKDDLELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDP  136

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK MVE EC RW  KGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+P
Sbjct  137   IIKNMVEVECKRWGRKGINIKYEIRENRNGYKAGALKEGMKHSYVKLCDYVAIFDADFQP  196

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             +P+FL R+IPFL  N ++AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSSTHAF
Sbjct  197   DPNFLHRTIPFLDQNQKVALVQARWQFVNADECLMTRMQEMSLDYHFLVEQEVGSSTHAF  256

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGL+GWKF+YL DL VK+ELPSTFK
Sbjct  257   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLRGWKFVYLSDLKVKNELPSTFK  316

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  317   AYRYQQHRWSCGPAN  331



>ref|XP_010278246.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nelumbo 
nucifera]
Length=527

 Score =   507 bits (1306),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 274/326 (84%), Gaps = 1/326 (0%)
 Frame = +2

Query  290   MMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILV  469
             ++PE   P  D+A Q+  +W  +K PLIVP L+LAV +CL  +++LF+ER+YMGIVI  V
Sbjct  9     LLPE-AFPRDDLAGQLGFIWQQIKTPLIVPLLKLAVGLCLVFAVLLFMERVYMGIVITYV  67

Query  470   KIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             K F  KPEKRYKWEP+++D E+G SV+P VL+QIPM+NEKEVY++SIGA C  +WPSDR+
Sbjct  68    KWFGRKPEKRYKWEPIKDDPELGNSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRI  127

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             ++QVLDDSTD  IK MVE EC RWASKGINI+Y+ R  R GYKAGALKEGL   Y + C+
Sbjct  128   IIQVLDDSTDPTIKSMVELECHRWASKGINIKYEIRENRVGYKAGALKEGLKRSYSKQCD  187

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YV IFDADF+PEPDFL RSIPFL+HNP+IAL+QARW FVNADEC++TRMQEMSLDYHF V
Sbjct  188   YVVIFDADFQPEPDFLWRSIPFLVHNPDIALVQARWVFVNADECMMTRMQEMSLDYHFTV  247

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSST+AFFGFNGT GIWRIAAI  AGGWKDRTTVEDMDLAVRA LKGWKFLY+GDL
Sbjct  248   EQEVGSSTYAFFGFNGTAGIWRIAAIEAAGGWKDRTTVEDMDLAVRASLKGWKFLYVGDL  307

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VKSELPSTF AFR QQ RWSCGPAN
Sbjct  308   QVKSELPSTFNAFRHQQDRWSCGPAN  333



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   506 bits (1304),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 275/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +G    +  Q   +W  ++ PLIVP LR+AV+VCL MSLM+ VER+YMGIVI  VK
Sbjct  1     MYAFQGARNGLGLQHEFLWRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  KPEKRYKWE +++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFGRKPEKRYKWETIKDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +Q+LDDSTD  IKE+V+ EC RW SKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C+Y
Sbjct  121   IQILDDSTDPTIKELVQVECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R+IPFL++NP+I L+QARW+FVNADECL+TRMQEMSL+YHF VE
Sbjct  181   VAIFDADFQPEPDFLWRTIPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSS++AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL DL 
Sbjct  241   QEVGSSSYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQ  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST KAFR+QQHRWSCGPAN
Sbjct  301   VKNELPSTLKAFRYQQHRWSCGPAN  325



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   506 bits (1304),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 272/319 (85%), Gaps = 0/319 (0%)
 Frame = +2

Query  311   PGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKP  490
             PG  + A +  +WD+V+APLI P LR+ + +C A+S+M FVER+YMG+VI+ VK+    P
Sbjct  17    PGDGIPALLLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMGVVIVAVKLLRRTP  76

Query  491   EKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDD  670
             EKRYKWEP+++D E+G S +P VLIQIPMFNEKEVY++SI A C  +WPSDR+++QVLDD
Sbjct  77    EKRYKWEPIKDDSELGNSAYPMVLIQIPMFNEKEVYQMSIRAACGLSWPSDRMIIQVLDD  136

Query  671   STDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDA  850
             ST   IK MVE EC +WASKGI+I+Y+ R  R GYKAGALKEG+   Y +DC+YV IFDA
Sbjct  137   STIPAIKNMVELECKKWASKGIDIKYEVRDNRTGYKAGALKEGMKRSYAKDCDYVVIFDA  196

Query  851   DFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSS  1030
             DF+PE DFL RSIP+LIHNP++ALIQARW FVN+DEC++TR+QEMSLDYHF VEQEVGSS
Sbjct  197   DFQPESDFLHRSIPYLIHNPQLALIQARWIFVNSDECMMTRLQEMSLDYHFTVEQEVGSS  256

Query  1031  THAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELP  1210
             THAFFGFNGT GIWRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKFLYLGDL VK+ELP
Sbjct  257   THAFFGFNGTAGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKNELP  316

Query  1211  STFKAFRFQQHRWSCGPAN  1267
             STFKAFRFQQHRWSCGPAN
Sbjct  317   STFKAFRFQQHRWSCGPAN  335



>ref|XP_003542549.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   505 bits (1300),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 277/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +G   D++ QM L+W  VK P+IVP LR+AV++CLAMSLM+ VER+YMGIVI LVK
Sbjct  1     MESFQGDRDDISYQMGLIWSQVKEPVIVPMLRVAVFLCLAMSLMMLVERVYMGIVICLVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  +PEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFSRRPEKRYKWEPMKDDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +QVLDDST+  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R++PFL++NPE+ L+QARW+FVNA+ECL+TRMQEMSLDYHF VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGS T+AFFGFNGT G+WRI+A+ E+GGW  RTTVEDMDLAVRA L+GWKFLYL +L 
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST  A+RFQQHRWSCGPAN
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPAN  325



>ref|XP_003535285.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   504 bits (1299),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 222/325 (68%), Positives = 279/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +G   D++ QM L+W  VK P+IVP LR++V++CLAMSLM+ VER+YMGIVI LVK
Sbjct  1     MESFQGSRDDISYQMGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  +PEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFGRRPEKRYKWEPMKDDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +QVLDDST+  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+  +YV+ C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+P+PDFL R++PFL++NPE+AL+QARW+FVNA+ECL+TRMQEMSLDYHF VE
Sbjct  181   VAIFDADFQPDPDFLWRTVPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGS T+AFFGFNGT G+WRI+A+ E+GGW  RTTVEDMDLAVRA L+GWKFLYL +L 
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST  A+RFQQHRWSCGPAN
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPAN  325



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   505 bits (1300),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 223/316 (71%), Positives = 273/316 (86%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q  +MW  +KAPLIVP LR++V++CL MS+MLFVER+YM +VI L+K+F  KP+K+
Sbjct  20    DITEQFGIMWGQIKAPLIVPLLRISVFLCLVMSVMLFVERVYMFVVITLLKVFGKKPQKK  79

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEP+++D E+  S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR++VQVLDDSTD
Sbjct  80    YKWEPLKDDVELANSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTD  139

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
                K +VE EC +WA KGINI+Y+ R  R GYKAGALKEGL H YV+ C++V IFDADF+
Sbjct  140   PITKNLVEIECQKWAKKGINIKYEVRDNRNGYKAGALKEGLKHSYVKQCDFVGIFDADFQ  199

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL ++IPFL+HN E++L+QARW++VNADECL+TRMQEMSLDYHF VEQEVGSSTHA
Sbjct  200   PEPDFLWQTIPFLVHNHELSLVQARWKYVNADECLMTRMQEMSLDYHFSVEQEVGSSTHA  259

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAI+EAGGWKDRTTVEDMDLAVRA LKGWKFL+LG + VK+ELPST 
Sbjct  260   FFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGSVKVKNELPSTL  319

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  320   KAYRYQQHRWSCGPAN  335



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   504 bits (1299),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+A Q++L+W L KAPL++P L +A+ +C +MSLMLF+E++YM IVI+LVK+   +
Sbjct  16    GARDDIAVQIQLLWTLFKAPLLIPLLNMAILLCSSMSLMLFIEKVYMSIVILLVKVLGQE  75

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             PEKRY+WEPM++D E G S +P+VL+QIPM+NE+EVY+ SIGA C  +WPSDR+++QVLD
Sbjct  76    PEKRYRWEPMKDDIEAGNSAYPTVLVQIPMYNEREVYQFSIGAACGLSWPSDRMIIQVLD  135

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DST+  IK+MV+ EC RW SKG+NI+Y+ R +R GYKAGAL+EG+   Y + C++VAI D
Sbjct  136   DSTNPTIKDMVKLECQRWQSKGVNIKYEIRDSRNGYKAGALREGMKRSYAKQCDFVAIID  195

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+P+PDFL R+IPFL+HNPE+AL+QARW FVN+DECL+TRMQEMSLDYHF VEQEVGS
Sbjct  196   ADFQPKPDFLRRTIPFLVHNPELALVQARWTFVNSDECLMTRMQEMSLDYHFTVEQEVGS  255

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             ST+AFFGFNGT G+WRI+AINEAGGWK+RTTVEDMDLAVRA LKGWKF+Y+G L VKSEL
Sbjct  256   STYAFFGFNGTAGVWRISAINEAGGWKERTTVEDMDLAVRASLKGWKFVYVGSLKVKSEL  315

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PST KA+R+QQHRWSCGPAN
Sbjct  316   PSTLKAYRYQQHRWSCGPAN  335



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   504 bits (1299),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 280/327 (86%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  QM ++W  +KAP+IVP LRLAV+VCL MS+ML VER+YM  VI L
Sbjct  9     LLPESFQGTRDDITEQMGVVWQQIKAPVIVPLLRLAVFVCLVMSVMLVVERVYMAAVIAL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK    +PEKRYKWEP+R+D E+G++ +P VL+QIPM+NEKEVY++S+GA C  +WP+DR
Sbjct  69    VKFLGRRPEKRYKWEPIRDDLELGSAAYPMVLVQIPMYNEKEVYQLSVGAACGLSWPADR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD   K++VE EC RWASKG++I+Y+ R  R GYKAGAL++G+   YV+ C
Sbjct  129   IIIQVLDDSTDPVTKDLVEMECNRWASKGVHIKYERRDNRSGYKAGALRDGMKRGYVEHC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YV IFDADF+PEPDFL R++PFLIHNP++AL+QARW+FVN+DECL+TR+QEMSLDYHF 
Sbjct  189   DYVVIFDADFQPEPDFLWRTVPFLIHNPDLALVQARWKFVNSDECLMTRIQEMSLDYHFA  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGS THAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSFTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  309   LKVKNELPSTLKAYRYQQHRWSCGPAN  335



>gb|KHN48194.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=511

 Score =   503 bits (1295),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 222/325 (68%), Positives = 277/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +G   D++ QM L+W  VK P+IVP LR++V++CLAMSLM+ VER+YMGIVI LVK
Sbjct  1     MESFQGDRDDISYQMGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F  +PEKRYKWEPM++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFGRRPEKRYKWEPMKDDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +QVLDDST+  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+ C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R++PFL++NPE+ L+QARW+FVNA+ECL+TRMQEMSLDYHF VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGS T+AFFGFNGT G+WRI+A+ E+GGW  RTTVEDMDLAVRA L+GWKFLYL +L 
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST  A+RFQQHRWSCGPAN
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPAN  325



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   501 bits (1290),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 223/312 (71%), Positives = 271/312 (87%), Gaps = 0/312 (0%)
 Frame = +2

Query  332   QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE  511
             QM   W    +PLI P L+L V +CL MSLMLF ER+YMGIVI+ VK+F   P K YKWE
Sbjct  9     QMGNFWHQTTSPLIAPFLKLFVSICLVMSLMLFFERVYMGIVILFVKLFRKNPHKTYKWE  68

Query  512   PMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIK  691
             P+R+D E+    +P VL+QIPM+NEKEVY++SIGA C  +WP++R+++QVLDDSTD++IK
Sbjct  69    PIRDDLELAHFAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPTNRIIIQVLDDSTDLSIK  128

Query  692   EMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPD  871
             ++VE EC RWA+KGINI+Y+ R  R GYKAGALKEG+ H+YV+ C+YVAIFDADF+PEPD
Sbjct  129   DLVELECKRWANKGINIKYEIRDNRNGYKAGALKEGMKHNYVKLCDYVAIFDADFQPEPD  188

Query  872   FLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGF  1051
             FL R++PFL +NPEIAL+QARW+FVN+DECL+TRMQEMSLDYHFKVEQEVGS+T+AFFGF
Sbjct  189   FLWRTVPFLTNNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFKVEQEVGSATYAFFGF  248

Query  1052  NGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFR  1231
             NGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTFKA+R
Sbjct  249   NGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYR  308

Query  1232  FQQHRWSCGPAN  1267
             +QQHRWSCGPAN
Sbjct  309   YQQHRWSCGPAN  320



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   501 bits (1289),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 224/327 (69%), Positives = 279/327 (85%), Gaps = 1/327 (0%)
 Frame = +2

Query  290   MMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             ++PE  +G   D+  QM ++W+ ++ P++VP LRL+V++CL MS+MLFVE++YM +VI+L
Sbjct  9     ILPEAFQGTRDDITQQMGIVWEQIRTPVVVPLLRLSVFLCLVMSVMLFVEKVYMAVVIVL  68

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+F  +PE RYK EPM +D E+G + +P VLIQIPM+NEKEVY++SIGA C  +WPSDR
Sbjct  69    VKLFRWRPETRYKCEPMGDDPELGNAGYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             +++QVLDDSTD  IKE+V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C
Sbjct  129   IIIQVLDDSTDPAIKELVQIECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKHSYVKHC  188

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             +YVAIFDADF+PEPDFL R+IPFL HNP I L+Q RW+FVN+++CL+TRMQEMSLDYHF 
Sbjct  189   DYVAIFDADFQPEPDFLWRTIPFLEHNPRIGLVQGRWKFVNSNDCLMTRMQEMSLDYHFT  248

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST+AFFGFNGT G+WRI A+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGD
Sbjct  249   VEQEVGSSTYAFFGFNGTAGVWRINALNEAGGWKDRTTVEDMDLAVRASLKGWKFIFLGD  308

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPST  A+R+QQHRWSCGPAN
Sbjct  309   LRVKSELPSTLTAYRYQQHRWSCGPAN  335



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   500 bits (1288),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 224/316 (71%), Positives = 270/316 (85%), Gaps = 1/316 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +Q+ L W   KAPLI P LR+ ++VCLA+S MLFVERLYMGIVI  +K+   KPEK+Y
Sbjct  18    ITSQVGLFWQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIVIAFIKLLRRKPEKKY  77

Query  503   KWEPMR-EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             KWE M+ +D E+G S +P VL+QIPM+NEKEVY++SIGA CN +WP++R+ +QVLDDSTD
Sbjct  78    KWESMKKDDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLSWPANRIFIQVLDDSTD  137

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VEQEC RWASKG+NI+Y+ R  R GYKAGAL+EG+ H YV+ C +VAIFDADF+
Sbjct  138   PAIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHSYVKLCSHVAIFDADFQ  197

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNPEI L+QARW FVNADECL+TRMQEMSL YHF VEQEVGS+ HA
Sbjct  198   PEPDFLERAIPFLVHNPEIGLVQARWEFVNADECLMTRMQEMSLGYHFTVEQEVGSAIHA  257

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WR++A+NEAGGWKDRTTVEDMDLAVRAGL GWKF+Y+ DL VK+ELPSTF
Sbjct  258   FFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVCDLKVKNELPSTF  317

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  318   KAYRYQQHRWSCGPAN  333



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   499 bits (1286),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 223/316 (71%), Positives = 271/316 (86%), Gaps = 1/316 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +Q+ L W   +APLIVP +R+ ++VCLA+S MLFVERLYMGIVI  +K+   KPEK+Y
Sbjct  18    ITSQVGLFWQQTRAPLIVPLIRIVLFVCLALSFMLFVERLYMGIVIAFIKLVRRKPEKKY  77

Query  503   KWEPMR-EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             KWEPM+ +D E+G S +P VL+QIPM+NEKEVY++SIGA C+ +WP++R+ +QVLDDSTD
Sbjct  78    KWEPMKKDDLELGNSSYPVVLVQIPMYNEKEVYQLSIGAACSLSWPANRIFIQVLDDSTD  137

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VEQEC  WASKGINI+Y+ R  R GYKAGAL+EG+ H YV  C +VAIFDADF+
Sbjct  138   PAIKALVEQECRIWASKGINIKYEIRDNRKGYKAGALREGMKHSYVNLCSHVAIFDADFQ  197

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNP+I L+QARW FVNADECL+TRMQEMSL YHF VEQEVGS+ HA
Sbjct  198   PEPDFLERTIPFLVHNPDIGLVQARWEFVNADECLMTRMQEMSLGYHFTVEQEVGSAIHA  257

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WR++A+NEAGGWKDRTTVEDMDLAVRAGL GWKF+Y+GDL VK+ELPSTF
Sbjct  258   FFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVGDLKVKNELPSTF  317

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  318   KAYRYQQHRWSCGPAN  333



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   498 bits (1283),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 222/313 (71%), Positives = 270/313 (86%), Gaps = 0/313 (0%)
 Frame = +2

Query  329   AQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKW  508
              Q  L+    KAPLIVP L+  V VCL MS+MLFVE++YMGI+II +K+F  +P K +KW
Sbjct  7     GQFGLVLQQAKAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPVKHWKW  66

Query  509   EPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNI  688
             E +++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLDDSTD  I
Sbjct  67    EAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  126

Query  689   KEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEP  868
             K++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+PEP
Sbjct  127   KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEP  186

Query  869   DFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFG  1048
             DFL R+IPFL+HN +IAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS+T+AFFG
Sbjct  187   DFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFG  246

Query  1049  FNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAF  1228
             FNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA L+GWKF+YL DL VK+ELPSTFKA+
Sbjct  247   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAY  306

Query  1229  RFQQHRWSCGPAN  1267
             R+QQHRWSCGPAN
Sbjct  307   RYQQHRWSCGPAN  319



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   498 bits (1282),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 222/313 (71%), Positives = 270/313 (86%), Gaps = 0/313 (0%)
 Frame = +2

Query  329   AQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKW  508
              Q  L+    KAPLIVP L+  V VCL MS+MLFVE++YMGI+II +K+F  +P K +KW
Sbjct  7     GQFGLVLQQAKAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPLKHWKW  66

Query  509   EPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNI  688
             E +++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLDDSTD  I
Sbjct  67    EAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  126

Query  689   KEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEP  868
             K++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+PEP
Sbjct  127   KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEP  186

Query  869   DFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFG  1048
             DFL R+IPFL+HN +IAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS+T+AFFG
Sbjct  187   DFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFG  246

Query  1049  FNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAF  1228
             FNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA L+GWKF+YL DL VK+ELPSTFKA+
Sbjct  247   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAY  306

Query  1229  RFQQHRWSCGPAN  1267
             R+QQHRWSCGPAN
Sbjct  307   RYQQHRWSCGPAN  319



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   496 bits (1278),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 229/309 (74%), Positives = 267/309 (86%), Gaps = 2/309 (1%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W  V+AP+IVP LRLAV VCL MS++LF+ERLYM +VI+ VK+   +P++RYK +P+ ED
Sbjct  11    WSQVRAPVIVPLLRLAVAVCLGMSVLLFLERLYMAVVIVGVKLLGRRPDRRYKCDPISED  70

Query  527   --YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMV  700
                E+G++ FP VL+QIPMFNE+EVY++SIGAVC  +WPSDRLVVQVLDDSTD  +KEMV
Sbjct  71    DDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDAVVKEMV  130

Query  701   EQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL  880
               EC RWA KGINI YQ R  R GYKAGALK+G+ H YV++CEYV IFDADF+P+PDFL 
Sbjct  131   RMECERWAHKGINITYQIREDRKGYKAGALKQGMKHGYVRECEYVVIFDADFQPDPDFLH  190

Query  881   RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT  1060
             R+IP+L HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS  AFFGFNGT
Sbjct  191   RTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGT  250

Query  1061  GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ  1240
              G+WRI+A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPSTFKAFRFQQ
Sbjct  251   AGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQ  310

Query  1241  HRWSCGPAN  1267
             HRWSCGPAN
Sbjct  311   HRWSCGPAN  319



>gb|KHN45690.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=497

 Score =   495 bits (1275),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 272/311 (87%), Gaps = 0/311 (0%)
 Frame = +2

Query  335   MRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEP  514
             M L+W  VK P+IVP LR++V++CLAMSLM+ VER+YMGIVI LVK+F  +PEKRYKWEP
Sbjct  1     MGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLFGRRPEKRYKWEP  60

Query  515   MREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKE  694
             M++D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR+++QVLDDST+  IKE
Sbjct  61    MKDDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTIKE  120

Query  695   MVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDF  874
             +V+ EC RWASKG+NI+Y+ R  R GYKAGALKEG+  +YV+ C+YVAIFDADF+P+PDF
Sbjct  121   LVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDYVAIFDADFQPDPDF  180

Query  875   LLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFN  1054
             L R++PFL++NPE+AL+QARW+FVNA+ECL+TRMQEMSLDYHF VEQEVGS T+AFFGFN
Sbjct  181   LWRTVPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFGFN  240

Query  1055  GTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRF  1234
             GT G+WRI+A+ E+GGW  RTTVEDMDLAVRA L+GWKFLYL +L VK+ELPST  A+RF
Sbjct  241   GTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAYRF  300

Query  1235  QQHRWSCGPAN  1267
             QQHRWSCGPAN
Sbjct  301   QQHRWSCGPAN  311



>sp|Q67VS7.1|CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose 
synthase-like protein A9; AltName: Full=OsCslA9 [Oryza 
sativa Japonica Group]
 gb|AAL25128.1|AF432499_1 cellulose synthase-like protein OsCslA9 [Oryza sativa]
 dbj|BAD37742.1| putative glycosyltransferase 1 [Oryza sativa Japonica Group]
 gb|EEC81007.1| hypothetical protein OsI_23768 [Oryza sativa Indica Group]
 gb|EEE66045.1| hypothetical protein OsJ_22033 [Oryza sativa Japonica Group]
Length=527

 Score =   496 bits (1277),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 279/330 (85%), Gaps = 8/330 (2%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             +   G  +  Q+  MW+ VKAP++VP LRL+V  CLAMS+MLFVE++YM +V++ V +F 
Sbjct  1     MAAAGAVLPEQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYMSVVLVGVHLFG  60

Query  482   GKPEKRYKWEPM------REDYEIG--TSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP  637
              +P++RY+ +P+       +D E+    + FP VLIQIPM+NE+EVYK+SIGA C  +WP
Sbjct  61    RRPDRRYRCDPIVAAGADNDDPELADANAAFPMVLIQIPMYNEREVYKLSIGAACGLSWP  120

Query  638   SDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYV  817
             SDR++VQVLDDSTD  IKEMV+ EC RW SKG+ I+Y+ R  R GYKAGAL+EG+ H YV
Sbjct  121   SDRVIVQVLDDSTDPVIKEMVQVECKRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYV  180

Query  818   QDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDY  997
             +DC+YVAIFDADF+P+PDFL R+IPFL+HNP+IAL+QARW+FVNA+ECL+TRMQEMSLDY
Sbjct  181   RDCDYVAIFDADFQPDPDFLARTIPFLVHNPDIALVQARWKFVNANECLMTRMQEMSLDY  240

Query  998   HFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLY  1177
             HFKVEQEVGSSTHAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKGWKF+Y
Sbjct  241   HFKVEQEVGSSTHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVY  300

Query  1178  LGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             LGDL VKSELPSTFKAFR+QQHRWSCGPAN
Sbjct  301   LGDLMVKSELPSTFKAFRYQQHRWSCGPAN  330



>gb|EMS67675.1| hypothetical protein TRIUR3_27071 [Triticum urartu]
Length=522

 Score =   496 bits (1276),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 219/309 (71%), Positives = 272/309 (88%), Gaps = 2/309 (1%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR--  520
             W  V+ P+IVP LR +V +C+AMS MLF E++YM +V++ +++   +P+++ +WEPMR  
Sbjct  17    WQQVRGPVIVPLLRASVLLCVAMSAMLFTEKVYMAVVVLALRLLGRRPKRQSRWEPMRDG  76

Query  521   EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMV  700
             ED E+G++ +P VL+QIPM+NE+EVY++SIGA C  +WPSDR++VQVLDDSTD  +KE+V
Sbjct  77    EDPELGSAAYPMVLVQIPMYNEREVYRLSIGAACGLSWPSDRIIVQVLDDSTDPVVKELV  136

Query  701   EQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL  880
             + EC RWA KG+NI+Y+TR  R GYKAGALKEG+ H YV+DC+ VAIFDADF+PEPDFL 
Sbjct  137   QVECQRWARKGVNIKYETRNNRCGYKAGALKEGMKHGYVKDCDLVAIFDADFQPEPDFLS  196

Query  881   RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT  1060
             RS+PFL+HNP+IAL+QARW+FVNADECL+TRMQEMSLDYHFKVEQEVGSST+AFFGFNGT
Sbjct  197   RSVPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFKVEQEVGSSTYAFFGFNGT  256

Query  1061  GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ  1240
              G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VK+ELPSTFKAFR+QQ
Sbjct  257   AGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLKVKNELPSTFKAFRYQQ  316

Query  1241  HRWSCGPAN  1267
             HRWSCGPAN
Sbjct  317   HRWSCGPAN  325



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 232/318 (73%), Positives = 270/318 (85%), Gaps = 2/318 (1%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D A  +   W  V+AP+IVP L+LAV VCL MS++LF+ERLYM +VI+ VK+   +PE+R
Sbjct  2     DAAVGLPDAWSQVRAPVIVPLLKLAVAVCLLMSVLLFLERLYMAVVIVGVKLLGRRPERR  61

Query  500   YKWEPMRED--YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDS  673
             YK +P+ ED   E+G++ FP VL+QIPMFNE+EVY++SIGAVC  +WPSDRLVVQVLDDS
Sbjct  62    YKCDPISEDDDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDS  121

Query  674   TDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDAD  853
             TD  IKEMV  EC RWA KGINI YQ R  R GYKAGALK G+ H YV++CEY+ IFDAD
Sbjct  122   TDPLIKEMVRMECERWAHKGINITYQIREDRKGYKAGALKAGMKHGYVRECEYMVIFDAD  181

Query  854   FRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSST  1033
             F+P+PDFL R+IP+L HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHFKVEQEV SS 
Sbjct  182   FQPDPDFLHRTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFKVEQEVSSSV  241

Query  1034  HAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPS  1213
              AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPS
Sbjct  242   CAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPS  301

Query  1214  TFKAFRFQQHRWSCGPAN  1267
             TFKAFRFQQHRWSCGPAN
Sbjct  302   TFKAFRFQQHRWSCGPAN  319



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   496 bits (1277),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 234/375 (62%), Positives = 281/375 (75%), Gaps = 42/375 (11%)
 Frame = +2

Query  269   AINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYM  448
             AI    ++     G   D+A Q+ L+W  +KAPLIVP L+LAV +CL MSLMLF+ER+YM
Sbjct  3     AIKSTAILPDTFGGARDDIATQIGLIWGQIKAPLIVPLLQLAVVLCLIMSLMLFLERVYM  62

Query  449   GIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNF  628
             GIVI+LVK+F  KPEKRY WEP+++D E+G   +P VL+QIPM+NE EVY++SIGA C  
Sbjct  63    GIVIVLVKLFGRKPEKRYNWEPIKDDLELGNLAYPMVLVQIPMYNEGEVYQLSIGAACGL  122

Query  629   AWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTH  808
             +WPSDR+ +QVLDDSTD  IK++VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+  
Sbjct  123   SWPSDRITIQVLDDSTDPTIKDLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKR  182

Query  809   DYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMS  988
              YV+ C+YVAIFDADF+PEPDFL R++PFL+HNPEI L+QARW+FVNADECL+TRMQEMS
Sbjct  183   SYVKHCDYVAIFDADFQPEPDFLWRTVPFLVHNPEIGLVQARWKFVNADECLMTRMQEMS  242

Query  989   LDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGW---------------------  1105
             LDYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGW                     
Sbjct  243   LDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWK  302

Query  1106  ---------------------KDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
                                  KDRTTVEDMDLAVRA LKGWKF+YL +L VK+ELPST K
Sbjct  303   FVYLWTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLCNLKVKNELPSTLK  362

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  363   AYRYQQHRWSCGPAN  377



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   494 bits (1272),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 276/316 (87%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+  Q  L+W ++K PLIVP L+L V VCL MS+MLF+ER+YMGIVI+ VK+F  KP K 
Sbjct  17    DITGQFGLIWQVLKEPLIVPVLKLLVVVCLGMSIMLFIERVYMGIVIVFVKLFGRKPNKM  76

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWEPM++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WP DR+++QVLDDSTD
Sbjct  77    YKWEPMKDDIEVGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPPDRIIIQVLDDSTD  136

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+
Sbjct  137   PAIKSLVELECQRWASKGINIKYEIRDNRKGYKAGALKEGMKHSYVKQCDYVAIFDADFQ  196

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEP++L R+IPFL+HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVGS+T+A
Sbjct  197   PEPNYLWRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYA  256

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+ELPSTF
Sbjct  257   FFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTF  316

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  317   KAYRYQQHRWSCGPAN  332



>gb|KDO45609.1| hypothetical protein CISIN_1g040333mg [Citrus sinensis]
Length=513

 Score =   493 bits (1270),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 263/316 (83%), Gaps = 24/316 (8%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             D+A Q+ L+W+L+KAPLIVP L+L VY+CLAMSLMLF+ER+YMGI             KR
Sbjct  20    DIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGI-------------KR  66

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             Y W+P+ +D E+G+S FP VLIQIPMFNEKEVYKISIGA C  +WPSDRLV+QVLDDSTD
Sbjct  67    YNWQPIEDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTD  126

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK+MVEQEC RWA+KGINIRYQ R  R GYKAGALKEGL   YV+ CEY         
Sbjct  127   PAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEY---------  177

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
               PD+L R+IP+L+ N +IAL+QARWRFVNA+ECLLTRMQEMSLDYHFKVEQEVGS+THA
Sbjct  178   --PDYLRRAIPYLVQNSDIALVQARWRFVNANECLLTRMQEMSLDYHFKVEQEVGSATHA  235

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRIAAINEAGGWKDRTTVEDMDLAVRA LKGWKF+YLGDL VKSELPSTF
Sbjct  236   FFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTF  295

Query  1220  KAFRFQQHRWSCGPAN  1267
             KAFRFQQHRWSCGPAN
Sbjct  296   KAFRFQQHRWSCGPAN  311



>ref|XP_004497599.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=524

 Score =   494 bits (1271),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 272/326 (83%), Gaps = 0/326 (0%)
 Frame = +2

Query  290   MMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILV  469
             M+  L+     V  Q+ L+W  ++ PLIVP LR+AV++CL MSLM+ VE++Y  IVI  V
Sbjct  8     MVVFLQEATDGVGLQLELIWKYIRQPLIVPMLRVAVFICLTMSLMMLVEKVYAAIVISWV  67

Query  470   KIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRL  649
             K+F  KPEK YKWE   +D E+G+S +P VL+Q+PM+NEKEVY++SIGA C   WP DR+
Sbjct  68    KLFGRKPEKVYKWESFEDDVEMGSSNYPMVLVQVPMYNEKEVYQLSIGAACGLTWPCDRI  127

Query  650   VVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCE  829
             ++Q+LDDSTD +IKE+VE EC +W SKG+NI+Y+ R  R GYKAGALKEG+ H YV+ C+
Sbjct  128   IIQILDDSTDPSIKELVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCD  187

Query  830   YVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKV  1009
             YVAIFDADF+PE DFLLR+IPFL++NPEI L+QARW FVNADEC +TRMQ+MSLDYHFKV
Sbjct  188   YVAIFDADFQPESDFLLRTIPFLVNNPEIGLVQARWNFVNADECWMTRMQQMSLDYHFKV  247

Query  1010  EQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL  1189
             EQEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFL+L ++
Sbjct  248   EQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLFLSNI  307

Query  1190  HVKSELPSTFKAFRFQQHRWSCGPAN  1267
              VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  308   QVKNELPSTLKAYRYQQHRWSCGPAN  333



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   494 bits (1271),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 279/330 (85%), Gaps = 8/330 (2%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
              +G   D+A QM L+W+  KAP+IVP LRL V VCLAMS+MLF+E++YMG+ I  VK+F 
Sbjct  14    FQGARNDIAGQMALVWEQAKAPVIVPVLRLLVVVCLAMSVMLFIEKVYMGVFITFVKLFR  73

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              +PEKRYKWEP+++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QV
Sbjct  74    KRPEKRYKWEPIKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQV  133

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  IK +VE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAI
Sbjct  134   LDDSTDPTIKSLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVAI  193

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPDFL R+IPFL+HNPEI L+QARW+FVN+DECL+TRMQEMSLDYHF VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEV  253

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDL----  1189
             GS+ ++FFGFNGT G+WR++A+NEAGGWKDRTTVEDMDLAVRA L+GWKF+YL DL    
Sbjct  254   GSTAYSFFGFNGTAGVWRLSALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKYQI  313

Query  1190  ----HVKSELPSTFKAFRFQQHRWSCGPAN  1267
                  VKSELPSTFKAFR+QQHRWSCGPAN
Sbjct  314   FNETQVKSELPSTFKAFRYQQHRWSCGPAN  343



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   493 bits (1268),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 231/321 (72%), Positives = 277/321 (86%), Gaps = 2/321 (1%)
 Frame = +2

Query  311   PGG--DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCG  484
             P G   V  Q+ L+W ++  PLIVP L+L V VCL MS+MLF+ER+YMG+VI+ VK+F  
Sbjct  12    PAGRDGVTGQIGLIWQVIIEPLIVPVLKLLVVVCLGMSIMLFIERVYMGVVIVFVKLFGK  71

Query  485   KPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVL  664
             KP KRYKWEP+++D E+G S +P VL+Q+PM+NEKEVY++SIGA C  +WPSDR+++QVL
Sbjct  72    KPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSWPSDRIIIQVL  131

Query  665   DDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIF  844
             DDSTD  IK MVE EC RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIF
Sbjct  132   DDSTDPAIKSMVEVECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIF  191

Query  845   DADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVG  1024
             DADF+PEPDFL R+IPFL HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVG
Sbjct  192   DADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVG  251

Query  1025  SSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSE  1204
             S+T+AFFGFNGT G+WRI+A+NEAGGWK RTTVEDMDLAVRA LKGWKF+Y+GDL VK+E
Sbjct  252   SATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDMDLAVRASLKGWKFVYVGDLKVKNE  311

Query  1205  LPSTFKAFRFQQHRWSCGPAN  1267
             LPSTFKA+R+QQHRWSCGPAN
Sbjct  312   LPSTFKAYRYQQHRWSCGPAN  332



>ref|XP_002963530.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
 gb|EFJ35401.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
Length=528

 Score =   492 bits (1266),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 267/312 (86%), Gaps = 0/312 (0%)
 Frame = +2

Query  332   QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE  511
             Q+  MW  ++AP I PAL++ V +CL M LMLFVERLYM +V++LVK+   +PE +YKWE
Sbjct  13    QINAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYKWE  72

Query  512   PMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIK  691
             P+++D E G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++VQ+LDDSTD+ IK
Sbjct  73    PIKDDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLTIK  132

Query  692   EMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPD  871
              +VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+DC+YVAIFDADF+PEPD
Sbjct  133   NLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPEPD  192

Query  872   FLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGF  1051
             FL R+IP+L+HN +I L+QARW+FVNADEC++TRMQEMSL YHF VEQ VGS+T+AFFGF
Sbjct  193   FLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFFGF  252

Query  1052  NGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFR  1231
             NGT G+WRIAAI+EAGGW  RTTVEDMDLAVRAGL+GWKF+YL DL VK+ELPSTFKA+R
Sbjct  253   NGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKAYR  312

Query  1232  FQQHRWSCGPAN  1267
             +QQHRWSCGPAN
Sbjct  313   YQQHRWSCGPAN  324



>ref|XP_002981551.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17366.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=529

 Score =   492 bits (1266),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 267/312 (86%), Gaps = 0/312 (0%)
 Frame = +2

Query  332   QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE  511
             Q+  MW  ++AP I PAL++ V +CL M LMLFVERLYM +V++LVK+   +PE +YKWE
Sbjct  13    QINAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYKWE  72

Query  512   PMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIK  691
             P+++D E G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++VQ+LDDSTD+ IK
Sbjct  73    PIKDDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLTIK  132

Query  692   EMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPD  871
              +VE EC RWASKG+NI+Y+ R  R GYKAGALKEG+   YV+DC+YVAIFDADF+PEPD
Sbjct  133   NLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPEPD  192

Query  872   FLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGF  1051
             FL R+IP+L+HN +I L+QARW+FVNADEC++TRMQEMSL YHF VEQ VGS+T+AFFGF
Sbjct  193   FLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFFGF  252

Query  1052  NGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFR  1231
             NGT G+WRIAAI+EAGGW  RTTVEDMDLAVRAGL+GWKF+YL DL VK+ELPSTFKA+R
Sbjct  253   NGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKAYR  312

Query  1232  FQQHRWSCGPAN  1267
             +QQHRWSCGPAN
Sbjct  313   YQQHRWSCGPAN  324



>gb|KEH42109.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=522

 Score =   491 bits (1265),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 270/315 (86%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             V  Q+  +W  ++ PLIVP LR AV++CL+MSLM+ VE +YMGIVI LVK+F   PEKRY
Sbjct  11    VGMQLAFIWRKIREPLIVPMLRAAVFICLSMSLMILVEIVYMGIVICLVKLFKRTPEKRY  70

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWE +++D E+  S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++Q+LDDSTD 
Sbjct  71    KWETIKDDVELENSNYPIVLVQIPMYNEREVYQLSIGAACELSWPSDRIIIQILDDSTDP  130

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IKE+V++EC RW +KG+NI+Y+ R  R GYKAGALKEG+ H +V  CEYVAIFDADF+P
Sbjct  131   TIKELVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEYVAIFDADFQP  190

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             EPDFL ++IPFL++NPEI L+QARW+FVNA+ECL+TRMQ+MSLDYHF VEQEVGSST+AF
Sbjct  191   EPDFLCQTIPFLVNNPEIGLVQARWKFVNANECLMTRMQKMSLDYHFTVEQEVGSSTYAF  250

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WRI+A+NEAGGWKDRTTVEDMDL+VRA L+GWKFLYL ++ VK+ELPST  
Sbjct  251   FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLSVRASLEGWKFLYLSNIQVKNELPSTLN  310

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R+QQHRWSCGPAN
Sbjct  311   AYRYQQHRWSCGPAN  325



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   491 bits (1263),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 277/321 (86%), Gaps = 2/321 (1%)
 Frame = +2

Query  311   PGG--DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCG  484
             P G   V   + L+W ++  PLIVP L+L V VCL MS+MLF+ER+YMG+VI+ VK+F  
Sbjct  12    PAGRDGVTGHLGLIWQVIMEPLIVPVLKLLVVVCLGMSIMLFIERVYMGVVIVFVKLFGK  71

Query  485   KPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVL  664
             KP KRYKWEP+++D E+G S +P VL+Q+PM+NEKEVY++SIGA C  +WPSDR+++QVL
Sbjct  72    KPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSWPSDRIIIQVL  131

Query  665   DDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIF  844
             DDSTD  IK MVE EC RWASKGINI+Y+ R +R GYKAGALKEG+ H YV+ C+YVAIF
Sbjct  132   DDSTDPAIKSMVEVECQRWASKGINIKYEIRDSRNGYKAGALKEGMKHSYVKQCDYVAIF  191

Query  845   DADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVG  1024
             DADF+PEPDFL R+IPFL HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVG
Sbjct  192   DADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVG  251

Query  1025  SSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSE  1204
             S+T+AFFGFNGT G+WRI+A+NEAGGWK RTTVEDMDLAVRA L+GWKF+Y+GDL VK+E
Sbjct  252   SATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDMDLAVRASLQGWKFVYVGDLKVKNE  311

Query  1205  LPSTFKAFRFQQHRWSCGPAN  1267
             LPSTFKA+R+QQHRWSCGPAN
Sbjct  312   LPSTFKAYRYQQHRWSCGPAN  332



>ref|XP_006345855.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=486

 Score =   489 bits (1259),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 217/285 (76%), Positives = 259/285 (91%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MSLMLFVE++YMGIVI+ +KI   KPEK+YKWEP+++D E+  S +P VLIQIPM+NE+E
Sbjct  1     MSLMLFVEKVYMGIVIVFIKILRQKPEKKYKWEPIKDDLELANSSYPMVLIQIPMYNERE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA CN +WP+DR+++QVLDDSTD  IK MVEQEC RWASKG+NI+Y+ R  R G
Sbjct  61    VYQLSIGAACNLSWPADRILIQVLDDSTDPIIKGMVEQECKRWASKGVNIKYEIRDNRKG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H+YV+ C++VAIFDADF+PE DFLLR++PFL+HNPEI L+QARW+FVN+
Sbjct  121   YKAGALKEGMKHNYVKMCDFVAIFDADFQPEFDFLLRTVPFLVHNPEIGLVQARWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECLLTRMQEMSLDYHFKVEQEVGSS HAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDM
Sbjct  181   DECLLTRMQEMSLDYHFKVEQEVGSSNHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRAGLKGWKF+Y+GDL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRAGLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   490 bits (1262),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/308 (73%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPM-RE  523
             W  V+AP+IVP LRLAV VCL MS++LF+ER+YM IVI  V++   +P++RY+ +P+  +
Sbjct  15    WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAIVITGVRLLRFRPDRRYRCDPLPDD  74

Query  524   DYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVE  703
             D E+G+S FP VL+QIPMFNE+EVY++SIGAVC  +WP+DRLVVQVLDDSTD  IKEMV 
Sbjct  75    DPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDEMIKEMVR  134

Query  704   QECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLR  883
              EC RWA KGINI YQ R  R GYKAGAL+ G+ H YV++CEYV IFDADF+P+PDFL R
Sbjct  135   LECERWARKGINITYQIRDDRKGYKAGALRAGMKHAYVRECEYVVIFDADFQPDPDFLKR  194

Query  884   SIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTG  1063
             ++P+L+HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS  AFFGFNGT 
Sbjct  195   TVPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGTA  254

Query  1064  GIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQH  1243
             G+WRI+AINEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPSTFKAFRFQQH
Sbjct  255   GVWRISAINEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQH  314

Query  1244  RWSCGPAN  1267
             RWSCGPAN
Sbjct  315   RWSCGPAN  322



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   490 bits (1261),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 269/314 (86%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
               Q  L+    KA LIVP L+  V VCL MSLMLFVE++YMGI+IIL+K+F  +P K +K
Sbjct  6     VGQFGLVLQQAKATLIVPLLKFLVVVCLGMSLMLFVEKVYMGIMIILIKLFRRRPVKHWK  65

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WE +++D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  66    WEAIKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPT  125

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK++VE EC RWASKGINI+Y+ R  R G+KAG+LKEG+ H YV+ C+YVAIFDADF+PE
Sbjct  126   IKDLVELECQRWASKGINIKYEIRDDRNGFKAGSLKEGMKHSYVKQCDYVAIFDADFQPE  185

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             PDFL R+IPFL+HN +IAL+QARW+FVN+DECL+TRMQEM+LDYHF VEQEVGS+T+AFF
Sbjct  186   PDFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMTLDYHFTVEQEVGSATYAFF  245

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRIAA+N+AGGWKD TTVEDMDLAVRA LKGWKF+YL DL VK+ELPSTFKA
Sbjct  246   GFNGTAGVWRIAALNDAGGWKDCTTVEDMDLAVRASLKGWKFVYLSDLKVKNELPSTFKA  305

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  306   YRYQQHRWSCGPAN  319



>gb|KEH42113.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   489 bits (1260),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 217/325 (67%), Positives = 271/325 (83%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +     V  Q+  +W  ++ PLIVP LR  VY+CL +SL++ VE++YM IVI  VK
Sbjct  1     MEAFKVASEGVVMQLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAIVICYVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F   PEKRYK+E + +D E+G S +P VL+QIPM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFKRTPEKRYKFEAIEDDVELGNSYYPMVLVQIPMYNEREVYQLSIGAACELSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +Q+LDDSTD  IKE+V++EC RW +KG+NI+Y+ R  R GYKAGALKEG+ H +V  CEY
Sbjct  121   IQILDDSTDPTIKELVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFL R+IPFL++NPEI L+QARW+FVNA+ECL+TRMQ+MSLDYHFKVE
Sbjct  181   VAIFDADFQPEPDFLRRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLDYHFKVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSS +AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA L+GWKFLYL +L 
Sbjct  241   QEVGSSAYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLEGWKFLYLCNLE  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  301   VKNELPSTFKAYRYQQHRWSCGPAN  325



>ref|XP_006656269.1| PREDICTED: probable mannan synthase 9-like [Oryza brachyantha]
Length=520

 Score =   489 bits (1259),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 276/320 (86%), Gaps = 6/320 (2%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
             A Q+  MW+ VKAP++VP LRL+V  CLAMS+MLFVE++Y+  V++ V +F  +PE+RY+
Sbjct  4     AGQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYLTAVLVAVHLFGRRPERRYR  63

Query  506   WEPM--REDYEIGTS----VFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
              +P+   +D E+G +     FP VL+QIPM+NE+EVYK+SIGA C  +WPSDR++VQVLD
Sbjct  64    CDPIVAGDDPELGDADADAAFPMVLVQIPMYNEREVYKLSIGAACGLSWPSDRVIVQVLD  123

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD  IKEMV+ EC RW SKG+ I+Y+ R  R GYKAGAL+EG+ H YV+DC++VAIFD
Sbjct  124   DSTDPVIKEMVQVECRRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRDCDFVAIFD  183

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+P+PDFL R+IPFL+HNP++AL+QARW+FVNA+ECL+TRMQEMSLDYHFKVEQEVGS
Sbjct  184   ADFQPDPDFLARTIPFLLHNPDVALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEVGS  243

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             STHAFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRAGLKGWKF+YLGDL VKSEL
Sbjct  244   STHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKSEL  303

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKAFR+QQHRWSCG AN
Sbjct  304   PSTFKAFRYQQHRWSCGRAN  323



>ref|XP_004250002.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=529

 Score =   489 bits (1260),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 263/315 (83%), Gaps = 0/315 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             +   +  +W   + PL+V  LRL +YVCLA+S MLFVERLYMGIVI  VK+F  KPEK+Y
Sbjct  18    ITNHVGFIWQQTRTPLVVQFLRLILYVCLALSFMLFVERLYMGIVIAFVKLFRRKPEKKY  77

Query  503   KWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDV  682
             KWEP++ D E+G   +P VL+QIPM NEKEVY++SIGA CN +WP++R+ +QVLDDSTD 
Sbjct  78    KWEPLKGDLELGNYSYPMVLVQIPMCNEKEVYQLSIGAACNLSWPANRIFIQVLDDSTDP  137

Query  683   NIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRP  862
              IK +VEQEC RWASKG+NI+Y+ R  R GYKAGAL+EG+ H YV+ C +VAIFDADF+P
Sbjct  138   TIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHSYVKLCSHVAIFDADFQP  197

Query  863   EPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAF  1042
             EPDFL RSIPFL+HNPEI L+QARW FVNA+ECL+T+MQEMS  YHF VEQEVGS+ HAF
Sbjct  198   EPDFLERSIPFLVHNPEIGLVQARWEFVNAEECLMTKMQEMSFGYHFTVEQEVGSTAHAF  257

Query  1043  FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFK  1222
             FGFNGT G+WR++A+ EAGGWKDRTTVEDMDLAVRAGL GWKF+Y+ DL VKSELPSTF+
Sbjct  258   FGFNGTAGVWRMSALIEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVDDLKVKSELPSTFR  317

Query  1223  AFRFQQHRWSCGPAN  1267
             A+R QQHRWSCGPAN
Sbjct  318   AYRNQQHRWSCGPAN  332



>gb|KEH42110.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   489 bits (1259),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 216/325 (66%), Positives = 270/325 (83%), Gaps = 0/325 (0%)
 Frame = +2

Query  293   MPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVK  472
             M   +     V  Q+  +W  ++ PLIVP LR  VY+CL +SL++ VE++YM IVI  VK
Sbjct  1     MEAFKVASEGVGMQLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAIVICYVK  60

Query  473   IFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLV  652
             +F   PEK YK++ + +D E+G S +P VL+Q+PM+NE+EVY++SIGA C  +WPSDR++
Sbjct  61    LFKRTPEKCYKFKAIEDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACELSWPSDRII  120

Query  653   VQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEY  832
             +Q+LDDSTD  IKE V++EC RW +KG+NI+Y+ R  R GYKAGALKEG+ H +V  CEY
Sbjct  121   IQILDDSTDPTIKEFVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEY  180

Query  833   VAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVE  1012
             VAIFDADF+PEPDFLLR+IPFL++NPEI L+QARW+FVNA+ECL+TRMQ+MSLDYHFKVE
Sbjct  181   VAIFDADFQPEPDFLLRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLDYHFKVE  240

Query  1013  QEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLH  1192
             QEVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKFLYL +L 
Sbjct  241   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLQ  300

Query  1193  VKSELPSTFKAFRFQQHRWSCGPAN  1267
             VK+ELPST KA+R+QQHRWSCGPAN
Sbjct  301   VKNELPSTLKAYRYQQHRWSCGPAN  325



>ref|XP_006360487.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=530

 Score =   488 bits (1257),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 261/303 (86%), Gaps = 0/303 (0%)
 Frame = +2

Query  359   KAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIG  538
             + PL+V  LR+ +YVCLA+S MLFVERLYMGIVI  VK+F  KPEK+YKWEP++ D E+G
Sbjct  30    RTPLVVQFLRIILYVCLALSFMLFVERLYMGIVIAFVKLFRRKPEKKYKWEPLKGDLELG  89

Query  539   TSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVR  718
                +P VL+Q+PM NEKEVY++SIGA CN +WP++R+ +QVLDDSTD  IK +VEQEC +
Sbjct  90    NYSYPMVLVQLPMCNEKEVYQLSIGAACNLSWPANRIFIQVLDDSTDPTIKALVEQECRK  149

Query  719   WASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFL  898
             WASKG+NI+Y+ R  R GYKAGAL+EG+ H+YV+ C +VAIFDADF+PEPDFL RSIPFL
Sbjct  150   WASKGVNIKYEIRDNRKGYKAGALREGMKHNYVKLCSHVAIFDADFQPEPDFLERSIPFL  209

Query  899   IHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRI  1078
             +HNPEI L+QARW FVNADECL+T+MQEMS  YHF VEQEVGS+ HAFFGFNGT G+WR+
Sbjct  210   VHNPEIGLVQARWEFVNADECLMTKMQEMSFGYHFTVEQEVGSTAHAFFGFNGTAGVWRM  269

Query  1079  AAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCG  1258
             +A+NEAGGWKDRTTVEDMDLAVRAGL GWKF+Y+ DL VKSELPSTF+A+R QQHRWSCG
Sbjct  270   SALNEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVDDLKVKSELPSTFRAYRNQQHRWSCG  329

Query  1259  PAN  1267
             PAN
Sbjct  330   PAN  332



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   487 bits (1253),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 275/321 (86%), Gaps = 2/321 (1%)
 Frame = +2

Query  311   PGG--DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCG  484
             P G   V  Q+ L+W ++  PL VP L+L V VCL MS+M+F+ER+YMG+VI+ VK+F  
Sbjct  12    PAGRDGVTGQIGLIWQVIMEPLTVPVLKLLVVVCLGMSIMIFIERVYMGVVIVFVKLFGK  71

Query  485   KPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVL  664
             KP KRYKWEP+++D E+G S +P VL+Q+PM+NEKEVY++SIGA C  +WPSDR+++QVL
Sbjct  72    KPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSWPSDRIIIQVL  131

Query  665   DDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIF  844
             DDSTD  IK +VE EC RWASKGI I+Y+ R  R GYKAGALKEG+ H YV+ C ++AIF
Sbjct  132   DDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNGYKAGALKEGMKHSYVKQCFFLAIF  191

Query  845   DADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVG  1024
             DADF+PEPDFL R+IPFL HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVG
Sbjct  192   DADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVG  251

Query  1025  SSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSE  1204
             S+T+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+E
Sbjct  252   SATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNE  311

Query  1205  LPSTFKAFRFQQHRWSCGPAN  1267
             LPSTFKA+R+QQHRWSCGPAN
Sbjct  312   LPSTFKAYRYQQHRWSCGPAN  332



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   486 bits (1250),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 233/308 (76%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI +V++   +PE+RY+ EP+ ED
Sbjct  15    WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVIAVVRLLRLRPERRYRCEPLPED  74

Query  527   -YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVE  703
               E+G+S FPSVL+QIPMFNE+EVY++SIGAVC  +WPSDRLVVQVLDDSTD  IKEMV 
Sbjct  75    DPELGSSAFPSVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDEVIKEMVR  134

Query  704   QECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLR  883
              EC RWA KGINI YQ R  R GYKAGALK G+ H YV++CEYVAIFDADF+P+PDFL R
Sbjct  135   MECERWARKGINITYQIRDDRRGYKAGALKAGMKHAYVRECEYVAIFDADFQPDPDFLKR  194

Query  884   SIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTG  1063
             +IP+L+HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS  AFFGFNGT 
Sbjct  195   TIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGTA  254

Query  1064  GIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQH  1243
             G+WRIAA+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPSTFKAFRFQQH
Sbjct  255   GVWRIAAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQH  314

Query  1244  RWSCGPAN  1267
             RWSCGPAN
Sbjct  315   RWSCGPAN  322



>ref|XP_009793130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   487 bits (1253),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 270/338 (80%), Gaps = 23/338 (7%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             + +Q+ L W   KAPLI P LR+ ++VCLA+S MLFVERLYMGIVI  +K+   KPEK+Y
Sbjct  18    ITSQVGLFWQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIVIAFIKLLRRKPEKKY  77

Query  503   KWEPMR-EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             KWE M+ +D E+G S +P VL+QIPM+NEKEVY++SIGA CN +WP++R+ +QVLDDSTD
Sbjct  78    KWESMKKDDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLSWPANRIFIQVLDDSTD  137

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK +VEQEC RWASKG+NI+Y+ R  R GYKAGAL+EG+ H YV+ C +VAIFDADF+
Sbjct  138   PAIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHSYVKLCSHVAIFDADFQ  197

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PEPDFL R+IPFL+HNPEI L+QARW FVNADECL+TRMQEMSL YHF VEQEVGS+ HA
Sbjct  198   PEPDFLERAIPFLVHNPEIGLVQARWEFVNADECLMTRMQEMSLGYHFTVEQEVGSAIHA  257

Query  1040  F----------------------FGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAG  1153
             F                      FGFNGT G+WR++A+NEAGGWKDRTTVEDMDLAVRAG
Sbjct  258   FFGFNGRLPPPPGRQSDLQSMHLFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAG  317

Query  1154  LKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L GWKF+Y+ DL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  318   LNGWKFVYVCDLKVKNELPSTFKAYRYQQHRWSCGPAN  355



>ref|XP_011088832.1| PREDICTED: probable mannan synthase 11 [Sesamum indicum]
Length=565

 Score =   487 bits (1253),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 267/320 (83%), Gaps = 0/320 (0%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+  ++  +W++VK   +VP LR A+Y+CL +S +LFVE ++M  +  L KIF  +
Sbjct  43    GSTADIKGKIGPVWEIVKGFFVVPVLRFALYICLVLSFLLFVEWVHMMFLAALAKIFRKR  102

Query  488   PEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLD  667
             P KRYKWE M++D E     FP VL+QIP++NE EVYKISIGA CN +WP+DR VVQVLD
Sbjct  103   PGKRYKWESMKDDLENACVDFPMVLVQIPIYNEIEVYKISIGAACNLSWPADRFVVQVLD  162

Query  668   DSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFD  847
             DSTD+ IK+ +E+EC++WA++GINIRYQ R TR GYKAGALKEGL HDYV++CEYVAIFD
Sbjct  163   DSTDLVIKDKIEKECMKWANEGINIRYQIRATRVGYKAGALKEGLKHDYVKECEYVAIFD  222

Query  848   ADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGS  1027
             ADF+PEPDFL R+IPFLIHNPEI L+QARWRFVNADEC LTRMQEMSLDY F +EQE GS
Sbjct  223   ADFQPEPDFLRRAIPFLIHNPEIGLVQARWRFVNADECFLTRMQEMSLDYQFVIEQEGGS  282

Query  1028  STHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSEL  1207
             S H+FF FNG+GGIWRI+AI+ AGGW DRTTVEDMDLAVRAGLKGWKF+++GD+ VKSEL
Sbjct  283   SIHSFFSFNGSGGIWRISAIDGAGGWNDRTTVEDMDLAVRAGLKGWKFVFVGDIEVKSEL  342

Query  1208  PSTFKAFRFQQHRWSCGPAN  1267
             PSTFKAFR QQHRWSCGPAN
Sbjct  343   PSTFKAFRSQQHRWSCGPAN  362



>ref|XP_011010406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Populus euphratica]
Length=546

 Score =   486 bits (1251),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 275/321 (86%), Gaps = 2/321 (1%)
 Frame = +2

Query  311   PGG--DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCG  484
             P G   V  Q+ L+W ++  PL VP L+L V VCL MS+M+F+ER+YMG+VI+ VK+F  
Sbjct  12    PAGRDGVTGQIGLIWQVIMEPLTVPVLKLLVVVCLGMSIMIFIERVYMGVVIVFVKLFGK  71

Query  485   KPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVL  664
             KP KRYKWEP+++D E+G S +P VL+Q+PM+NEKEVY++SIGA C  +WPSDR+++QVL
Sbjct  72    KPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSWPSDRIIIQVL  131

Query  665   DDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIF  844
             DDSTD  IK +VE EC RWASKGI I+Y+ R  R GYKAGALKEG+ H YV+ C ++AIF
Sbjct  132   DDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNGYKAGALKEGMKHSYVKQCFFLAIF  191

Query  845   DADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVG  1024
             DADF+PEPDFL R+IPFL HNPEIAL+QARW+FVN+DECL+TRMQEMSLDYHF VEQEVG
Sbjct  192   DADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVG  251

Query  1025  SSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSE  1204
             S+T+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VK+E
Sbjct  252   SATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNE  311

Query  1205  LPSTFKAFRFQQHRWSCGPAN  1267
             LPSTFKA+R+QQHRWSCGPAN
Sbjct  312   LPSTFKAYRYQQHRWSCGPAN  332



>gb|EAY84833.1| hypothetical protein OsI_06199 [Oryza sativa Indica Group]
Length=517

 Score =   483 bits (1242),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/324 (73%), Positives = 274/324 (85%), Gaps = 4/324 (1%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
             E+ G G   AA +   W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI  VKI 
Sbjct  2     EVNGGG---AAGLPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKIL  58

Query  479   CGKPEKRYKWEPM-REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  655
               +P++RY+ +P+  +D E+GTS FP VLIQIPMFNE+EVY++SIGAVC  +WPSDRLVV
Sbjct  59    RRRPDRRYRCDPIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVV  118

Query  656   QVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYV  835
             QVLDDSTD  IKEMV  EC RWA KG+NI YQ R  R GYKAGALKEG+ H YV++CEYV
Sbjct  119   QVLDDSTDPVIKEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYV  178

Query  836   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  1015
             AIFDADF+P+PDFL R+IPFL+HN +IAL+QARWRFVNADECL+TRMQEMSLDYHF VEQ
Sbjct  179   AIFDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQ  238

Query  1016  EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  1195
             EV SS  AFFGFNGT G+WR++A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ V
Sbjct  239   EVSSSVCAFFGFNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQV  298

Query  1196  KSELPSTFKAFRFQQHRWSCGPAN  1267
             KSELPSTFKAFRFQQHRWSCGPAN
Sbjct  299   KSELPSTFKAFRFQQHRWSCGPAN  322



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/324 (73%), Positives = 274/324 (85%), Gaps = 4/324 (1%)
 Frame = +2

Query  299   ELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIF  478
             E+ G G   AA +   W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI  VKI 
Sbjct  2     EVNGGG---AAGLPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKIL  58

Query  479   CGKPEKRYKWEPM-REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  655
               +P++RY+ +P+  +D E+GTS FP VLIQIPMFNE+EVY++SIGAVC  +WPSDRLVV
Sbjct  59    RRRPDRRYRCDPIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVV  118

Query  656   QVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYV  835
             QVLDDSTD  IKEMV  EC RWA KG+NI YQ R  R GYKAGALKEG+ H YV++CEYV
Sbjct  119   QVLDDSTDPVIKEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYV  178

Query  836   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  1015
             AIFDADF+P+PDFL R+IPFL+HN +IAL+QARWRFVNADECL+TRMQEMSLDYHF VEQ
Sbjct  179   AIFDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQ  238

Query  1016  EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  1195
             EV SS  AFFGFNGT G+WR++A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ V
Sbjct  239   EVSSSVCAFFGFNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQV  298

Query  1196  KSELPSTFKAFRFQQHRWSCGPAN  1267
             KSELPSTFKAFRFQQHRWSCGPAN
Sbjct  299   KSELPSTFKAFRFQQHRWSCGPAN  322



>gb|AFW66231.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=395

 Score =   478 bits (1229),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 227/308 (74%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI  V++   +P++RY+ +P+ ED
Sbjct  8     WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERVYMAVVISGVRLLRLRPDRRYRCDPLPED  67

Query  527   -YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVE  703
               E+G+S FP VL+QIPMFNE+EVY++SIGAVC  +WP+DRLVVQVLDDSTD  IKEMV 
Sbjct  68    DPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDEVIKEMVR  127

Query  704   QECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLR  883
              EC RWA KGINI YQ R  R GYKAGAL+ G+ H YV+DCEYVAIFDADF+P+PD+L R
Sbjct  128   MECERWARKGINITYQIREDRKGYKAGALRAGMRHAYVRDCEYVAIFDADFQPDPDYLKR  187

Query  884   SIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTG  1063
             +IP+L+HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS  AFFGFNGT 
Sbjct  188   TIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGTA  247

Query  1064  GIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQH  1243
             G+WRI+A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPSTFKAFRFQQH
Sbjct  248   GVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQH  307

Query  1244  RWSCGPAN  1267
             RWSCGPAN
Sbjct  308   RWSCGPAN  315



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   480 bits (1236),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 214/285 (75%), Positives = 257/285 (90%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MSLMLFVER+YMGIVI+ VK+F   P K YKWEP+++D E+    +P VL+QIPM+NEKE
Sbjct  1     MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIKDDLELAHFAYPMVLVQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WP+DR+++QVLDDSTD +IK++VE EC RWA+KGINI+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNRNG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H+YV+ C+YVAIFDADF+PEPDFL R+IPFLI+NPEIAL+QARW+FVN+
Sbjct  121   YKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHFKVEQEVGS+T+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA LKGWKF+Y+GDL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_002528577.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33785.1| conserved hypothetical protein [Ricinus communis]
Length=498

 Score =   478 bits (1231),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 220/324 (68%), Positives = 266/324 (82%), Gaps = 12/324 (4%)
 Frame = +2

Query  272   INEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMG  451
             +   +++    +G   D++ Q  ++WD ++APLIVP LRLAV VCL MSLMLF+ER+YMG
Sbjct  4     LTTTKIIPDAFQGARDDISMQFLIIWDQIRAPLIVPLLRLAVAVCLLMSLMLFIERVYMG  63

Query  452   IVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFA  631
             IVI LVKIF  KPEKRYKWEP+++D E+G S +P V            Y++SIGA C  +
Sbjct  64    IVITLVKIFGRKPEKRYKWEPLKDDVEMGNSAYPMV------------YQLSIGAACGLS  111

Query  632   WPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHD  811
             WPSDR+++QVLDDSTD  IK++VE EC RWASKGINI+Y+ R  R GYKAGALKEG+   
Sbjct  112   WPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRS  171

Query  812   YVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSL  991
             YV+ C+YVAIFDADF+PEPDFL R+IPFL+HNPE+ L+QARW+FVN+DECL+TRMQEMSL
Sbjct  172   YVKHCDYVAIFDADFQPEPDFLWRTIPFLVHNPELGLVQARWKFVNSDECLMTRMQEMSL  231

Query  992   DYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKF  1171
             DYHF VEQEVGSST+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA LKGWKF
Sbjct  232   DYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKF  291

Query  1172  LYLGDLHVKSELPSTFKAFRFQQH  1243
             LYLG L VK+ELPSTF+A+R+QQH
Sbjct  292   LYLGSLKVKNELPSTFRAYRYQQH  315



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   479 bits (1232),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 271/314 (86%), Gaps = 0/314 (0%)
 Frame = +2

Query  326   AAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYK  505
               Q+ L+    KAPLIVP L+L V +CL MS+MLFVE++YMGIVI L+K+F  KPEK++K
Sbjct  6     GGQIGLVLQQAKAPLIVPLLKLVVVLCLGMSVMLFVEKVYMGIVITLIKLFRRKPEKKWK  65

Query  506   WEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVN  685
             WE +++D E+G S +P VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD  
Sbjct  66    WEAVKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPA  125

Query  686   IKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPE  865
             IK++VE E  RWASKGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+PE
Sbjct  126   IKDLVELEVQRWASKGINIKYEIRGNRNGYKAGALKEGMKHSYVKHCDYVAIFDADFQPE  185

Query  866   PDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFF  1045
             PDFL R+IPFLIHNPE+ L+Q RW+FVN+DECL+TRMQEMSLDYHF VEQEVGS+THAFF
Sbjct  186   PDFLWRTIPFLIHNPEVGLVQTRWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATHAFF  245

Query  1046  GFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKA  1225
             GFNGT G+WRIAA+NEAGGWKDRTTVEDMDLAVRA L GWKF+YL D+ VK+ELPSTFKA
Sbjct  246   GFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLGGWKFVYLSDVKVKNELPSTFKA  305

Query  1226  FRFQQHRWSCGPAN  1267
             +R+QQHRWSCGPAN
Sbjct  306   YRYQQHRWSCGPAN  319



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   479 bits (1233),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 273/324 (84%), Gaps = 7/324 (2%)
 Frame = +2

Query  317   GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK  496
             GD A Q+  +W  +K+P++VP LRLAV +CLAMS+MLF E++Y+  V++  ++   +PE 
Sbjct  17    GDAAGQVAAVWQQLKSPVVVPLLRLAVALCLAMSVMLFAEKVYLAAVVLATRLLGRRPEL  76

Query  497   RYKWEPMR--EDYEI-----GTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  655
             RY+WEP+R  ED ++     G++ +P VL+QIPM+NE+EVY +SIGA C  +WP+DR++V
Sbjct  77    RYRWEPIRGGEDGDLEAAAGGSAAYPMVLVQIPMYNEREVYGVSIGAACGLSWPADRIIV  136

Query  656   QVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYV  835
             QVLDDSTD  I+E+V  EC RWASKG+NIRY+ R +R GYKAGAL+EG+   Y + C+ V
Sbjct  137   QVLDDSTDPAIRELVRAECERWASKGVNIRYEVRDSRRGYKAGALREGMKRGYARGCDMV  196

Query  836   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  1015
             AIFDADF+PEPDFL R++PFL+HNP++AL+QARW+FVNADECL+TRMQE+SLDYHF VEQ
Sbjct  197   AIFDADFQPEPDFLQRAVPFLVHNPDLALVQARWKFVNADECLMTRMQEISLDYHFTVEQ  256

Query  1016  EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  1195
             EVGSST+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF++LGDL V
Sbjct  257   EVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLMV  316

Query  1196  KSELPSTFKAFRFQQHRWSCGPAN  1267
             K+ELPST KA+R+QQHRWSCGPAN
Sbjct  317   KNELPSTLKAYRYQQHRWSCGPAN  340



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   479 bits (1232),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 212/318 (67%), Positives = 270/318 (85%), Gaps = 4/318 (1%)
 Frame = +2

Query  317   GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK  496
              DVAA +   W  +K+P++VP LR++V +CLAMS MLF E++YM +V+   ++   +PE+
Sbjct  18    SDVAAAL---WQQLKSPVVVPLLRVSVALCLAMSAMLFAEKVYMAVVVAASRLLGRRPER  74

Query  497   RYKWEPMREDYEI-GTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDS  673
             RY+W+P+R+  ++   + +P VL+QIPMFNE+EVYK+SIGA C  +WPSDR++VQVLDDS
Sbjct  75    RYRWQPIRDGDDLEAAAAYPMVLVQIPMFNEREVYKVSIGAACGLSWPSDRIIVQVLDDS  134

Query  674   TDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDAD  853
             TD  +KE+V  EC RWASKG+N++Y+ R +R GYKAGAL+EG+   Y + C+ VAIFDAD
Sbjct  135   TDPVVKELVRAECWRWASKGVNVKYEVRDSRRGYKAGALREGMKRAYARGCDLVAIFDAD  194

Query  854   FRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSST  1033
             F+PEPDFL R++PFL+HNP++AL+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGSST
Sbjct  195   FQPEPDFLWRAVPFLLHNPDLALVQARWKFVNADECLMTRMQEMSLDYHFAVEQEVGSST  254

Query  1034  HAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPS  1213
             +AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+Y+GDL VKSELPS
Sbjct  255   YAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLMVKSELPS  314

Query  1214  TFKAFRFQQHRWSCGPAN  1267
             T KA+R+QQHRWSCGPAN
Sbjct  315   TLKAYRYQQHRWSCGPAN  332



>ref|NP_001131007.1| uncharacterized protein LOC100192112 [Zea mays]
 gb|ACF79431.1| unknown [Zea mays]
 gb|ACG40011.1| CSLA1 - cellulose synthase-like family A; mannan synthase [Zea 
mays]
 gb|AFW66229.1| CSLA1-cellulose synthase-like family isoform 1 [Zea mays]
 gb|AFW66230.1| CSLA1-cellulose synthase-like family isoform 2 [Zea mays]
Length=514

 Score =   478 bits (1229),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 227/308 (74%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI  V++   +P++RY+ +P+ ED
Sbjct  8     WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERVYMAVVISGVRLLRLRPDRRYRCDPLPED  67

Query  527   -YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVE  703
               E+G+S FP VL+QIPMFNE+EVY++SIGAVC  +WP+DRLVVQVLDDSTD  IKEMV 
Sbjct  68    DPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDEVIKEMVR  127

Query  704   QECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLR  883
              EC RWA KGINI YQ R  R GYKAGAL+ G+ H YV+DCEYVAIFDADF+P+PD+L R
Sbjct  128   MECERWARKGINITYQIREDRKGYKAGALRAGMRHAYVRDCEYVAIFDADFQPDPDYLKR  187

Query  884   SIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTG  1063
             +IP+L+HNPEIAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS  AFFGFNGT 
Sbjct  188   TIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGTA  247

Query  1064  GIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQH  1243
             G+WRI+A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELPSTFKAFRFQQH
Sbjct  248   GVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQH  307

Query  1244  RWSCGPAN  1267
             RWSCGPAN
Sbjct  308   RWSCGPAN  315



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 212/285 (74%), Positives = 251/285 (88%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MS MLFVER+YMGIVI  +K+   +PEK+YKWE M ED E G+S +P VL+QIPM+NEKE
Sbjct  1     MSTMLFVERVYMGIVIFFIKLLRRRPEKQYKWEAMGEDIEAGSSAYPMVLVQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WP+DR+++QVLDDSTD  IKE+ + EC RWASKGINI+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPADRIIIQVLDDSTDPTIKELKKLECQRWASKGINIKYEIRDNRKG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H YV+ C+YVAIFDADF+PEPDFL R+IPFL+HNPEI L+QARW+FVN+
Sbjct  121   YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHF VEQEVGS+T+AFFGFNGT G+WRI+A+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA LKGWKF+Y+ DL VKSELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLKGWKFVYVSDLKVKSELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 211/285 (74%), Positives = 255/285 (89%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MS++LFVE++YMGIVI+LVK+F  +PEKR+KWE +++D E+G S +P VL+QIPM+NEKE
Sbjct  1     MSVLLFVEKVYMGIVIMLVKVFRRRPEKRWKWEAIKDDVELGNSAYPMVLVQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WPSDR++VQVLDDSTD  IK++VE E  RWASKGINI+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPSDRIIVQVLDDSTDPLIKDLVEVEVQRWASKGINIKYEIRDNRHG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H YV+ C+YVAIFDADF+PEPDFL R+IPFL+HNP+IAL+Q RW+FVNA
Sbjct  121   YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLLHNPDIALVQTRWKFVNA  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHF VEQEVGS+THAFFGFNGT G+WRI A+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRITALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA L+GWKF+Y+ D+ VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLRGWKFVYISDIKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_006646997.1| PREDICTED: LOW QUALITY PROTEIN: glucomannan 4-beta-mannosyltransferase 
1-like [Oryza brachyantha]
Length=520

 Score =   477 bits (1228),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 232/319 (73%), Positives = 268/319 (84%), Gaps = 1/319 (0%)
 Frame = +2

Query  314   GGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPE  493
             GG  AA +   W   +AP+I P LRLAV VCL M ++LF+ R+YM +VI  VK+   +PE
Sbjct  3     GGGAAAVVPEAWSQGRAPVIGPLLRLAVAVCLTMPVLLFLXRMYMAVVIAGVKLLRRRPE  62

Query  494   KRYKWEPM-REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDD  670
             +RY+ +P+  +D E+GTS FP VLIQIPMFNE+EVY++SIGAVC  +WPSDRLVVQVLDD
Sbjct  63    RRYRCDPLPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDD  122

Query  671   STDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDA  850
             STD  IKEMV  EC RWA KG+NI YQ R  R GYKAGALKEG+ H YV++CEYVAIFDA
Sbjct  123   STDPVIKEMVRMECERWAHKGVNITYQIRQDRKGYKAGALKEGMKHGYVRECEYVAIFDA  182

Query  851   DFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSS  1030
             DF+P+PDFL R+IPFL+HN +IAL+QARWRFVNADECL+TRMQEMSLDYHF VEQEV SS
Sbjct  183   DFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSS  242

Query  1031  THAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELP  1210
               AFFGFNGT GIWRI+A+NEAGGWKDRTTVEDMDLA+RA LKGWKF+YLGD+ VKSELP
Sbjct  243   VCAFFGFNGTAGIWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELP  302

Query  1211  STFKAFRFQQHRWSCGPAN  1267
             STFKAFRFQQHRWSCGPAN
Sbjct  303   STFKAFRFQQHRWSCGPAN  321



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   482 bits (1241),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 214/285 (75%), Positives = 257/285 (90%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MSLMLFVER+YMGIVI+ VK+F   P K YKWEP+++D E+    +P VL+QIPM+NEKE
Sbjct  1     MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIKDDLELAHFAYPMVLVQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WP+DR+++QVLDDSTD +IK++VE EC RWA+KGINI+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNRNG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H+YV+ C+YVAIFDADF+PEPDFL R+IPFLI+NPEIAL+QARW+FVN+
Sbjct  121   YKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHFKVEQEVGS+T+AFFGFNGT G+WRIAA+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA LKGWKF+Y+GDL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   473 bits (1217),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 253/285 (89%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MS+MLFVE++YMGIVI L+K+F  KPEK++KWE +++D E+G S +P VL+QIPM+NEKE
Sbjct  1     MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVKDDVELGNSAYPMVLVQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WPSDR+++QVLDDSTD  IK++VE E  RWASKGI+I+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKDLVELEVQRWASKGISIKYEIRGNRNG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H YV+ C+YVAIFDADF+PEPDFL R+IPFLIHNPE+ L+Q RW+FVN+
Sbjct  121   YKAGALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRTIPFLIHNPEVGLVQTRWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHF VEQEVGS+THAFFGFNGT G+WRIAA+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA L GWKF+YL D+ VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLGGWKFVYLSDVKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_010937166.1| PREDICTED: probable mannan synthase 11 [Elaeis guineensis]
Length=543

 Score =   474 bits (1221),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 263/318 (83%), Gaps = 0/318 (0%)
 Frame = +2

Query  314   GGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPE  493
             GG V  Q+ L+W  V+A ++VP +R+AV VCL MS+MLF+E+  MG+V   VKIF  KPE
Sbjct  27    GGVVPDQIGLIWLQVRAMVLVPVVRIAVIVCLIMSVMLFIEKFSMGLVSFYVKIFRRKPE  86

Query  494   KRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDS  673
             K YKWE +RED E+GT  +P VL+QIPM+NE EVY++SIGA CN  WPSDRL++QVLDDS
Sbjct  87    KIYKWETIREDEELGTLAYPMVLVQIPMYNEGEVYRLSIGAACNLVWPSDRLIIQVLDDS  146

Query  674   TDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDAD  853
             TD+ I++MV++EC +W  KGI I Y +R  R GYKAGA+KE +  DYVQ CEYV IFDAD
Sbjct  147   TDLTIRDMVQKECEKWLRKGITIHYISRDNRNGYKAGAMKEAMEIDYVQQCEYVVIFDAD  206

Query  854   FRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSST  1033
             F+P  DFL+R++PFLI NPE+AL+QARW+FVNADECL+TR+QEMSL+YHFK+EQ+ GSST
Sbjct  207   FQPASDFLMRTVPFLICNPELALVQARWKFVNADECLMTRIQEMSLNYHFKIEQQSGSST  266

Query  1034  HAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPS  1213
              AFFGFNGT G+WRI AINE  GWK+RTTVEDMDLA RA L GWKF+Y+G++ VKSELPS
Sbjct  267   FAFFGFNGTAGVWRILAINEVEGWKERTTVEDMDLAARASLAGWKFVYVGNIKVKSELPS  326

Query  1214  TFKAFRFQQHRWSCGPAN  1267
             T+KA+RFQQHRWSCGPAN
Sbjct  327   TYKAYRFQQHRWSCGPAN  344



>gb|EYU36983.1| hypothetical protein MIMGU_mgv1a004073mg [Erythranthe guttata]
Length=545

 Score =   474 bits (1219),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 266/327 (81%), Gaps = 7/327 (2%)
 Frame = +2

Query  308   GPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGK  487
             G   D+ A++  +  L++A ++VP LR+A+Y CL +S +LF+E +++  +  + K+F  K
Sbjct  16    GSTADIRARISPVVALIRANVVVPCLRVALYTCLVLSFLLFLEWVHVMFLAAVAKLFRKK  75

Query  488   PEKRYKWEPMR-------EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             P +RYKWEPM        E+   G   FP VL+QIP+FNE EVYK+SIGA C  +WPSDR
Sbjct  76    PAERYKWEPMANAAAGDLENGGNGKDCFPIVLVQIPIFNEIEVYKMSIGAACRLSWPSDR  135

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
             LVVQVLDDSTD+ IK+M+E+EC+RW+S+GINIRYQ R  R GYKAGALKEGL  DYV++C
Sbjct  136   LVVQVLDDSTDLTIKDMIEKECMRWSSEGINIRYQVREGRVGYKAGALKEGLKRDYVKEC  195

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             E+VAIFDADF+PEPDFL RSIPF  +NPEI LIQARWRFVNA+EC LTRMQEMSLDY F 
Sbjct  196   EFVAIFDADFQPEPDFLRRSIPFFTYNPEIGLIQARWRFVNANECFLTRMQEMSLDYQFV  255

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             +EQE GSS HAFF FNG+GGIWRIAAI EAGGWKDRTTVEDMDLAVRAGLKGWKFL+LGD
Sbjct  256   IEQEGGSSIHAFFSFNGSGGIWRIAAIEEAGGWKDRTTVEDMDLAVRAGLKGWKFLFLGD  315

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VKSELPSTFKA+R QQHRW+CGPAN
Sbjct  316   LDVKSELPSTFKAYRSQQHRWACGPAN  342



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   473 bits (1217),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/316 (71%), Positives = 266/316 (84%), Gaps = 1/316 (0%)
 Frame = +2

Query  323   VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY  502
             +  QM  +W   + PLIVP L+L V +CL MS+MLFVER+YMGIVI+ +K+F  KPEK Y
Sbjct  17    IVNQMNFIWQQARVPLIVPVLKLLVVLCLTMSVMLFVERVYMGIVIVFLKLFGHKPEKHY  76

Query  503   KWEPMRED-YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             KWE +++D  E+G S FP VL+QIPM+NEKEVY++SIGA C  +WPSDR+++QVLDDSTD
Sbjct  77    KWEALKDDDIELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTD  136

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               IK MVE EC RW  KGINI+Y+ R  R GYKAGALKEG+ H YV+ C+YVAIFDADF+
Sbjct  137   PIIKNMVEIECERWRRKGINIKYEIRENRNGYKAGALKEGMKHSYVKLCDYVAIFDADFQ  196

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             PE +FL R+IPFL  NP++ L+QARW+FVNADECL+TRMQEMSLDYHF VEQEVGS THA
Sbjct  197   PESNFLYRTIPFLDQNPQVGLVQARWQFVNADECLMTRMQEMSLDYHFLVEQEVGSITHA  256

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NEAGGWKDRTTVEDMDLAVRA LKGWKF+YL DL VKSELPSTF
Sbjct  257   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLSDLKVKSELPSTF  316

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+R+QQHRWSCGPAN
Sbjct  317   KAYRYQQHRWSCGPAN  332



>ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum]
Length=527

 Score =   472 bits (1215),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 261/307 (85%), Gaps = 1/307 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W+ ++ P++VPAL LA+Y+C+AMS+MLF+ER+YM IVI  VK F  K   +YK E ++ED
Sbjct  25    WERIRVPVVVPALHLAMYICIAMSVMLFLERIYMAIVIAGVKCFGKKRYTKYKLESVKED  84

Query  527   YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQ  706
              E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRLVVQVLDDST+  ++ +V+ 
Sbjct  85    LEKNKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLVVQVLDDSTNEVLRTLVDL  143

Query  707   ECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRS  886
             EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCEYV IFDADF+PE DFL R+
Sbjct  144   ECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEYVVIFDADFQPEEDFLWRT  203

Query  887   IPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGG  1066
             IP+LI NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +FFGFNGT G
Sbjct  204   IPYLIDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAG  263

Query  1067  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHR  1246
             +WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKFL++GDL VK+ELPSTFKA+RFQQHR
Sbjct  264   VWRIRAVNDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGDLAVKNELPSTFKAYRFQQHR  323

Query  1247  WSCGPAN  1267
             WSCGPAN
Sbjct  324   WSCGPAN  330



>ref|XP_010937165.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=541

 Score =   471 bits (1211),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 267/322 (83%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             L  P  D+  ++ L+W  V+A +++P ++ AV  CL MS+M+ VE++ MG++ +  K+F 
Sbjct  21    LSSPVADLLNKIGLIWRQVRAMVVIPVMKAAVVACLIMSVMVLVEKVSMGLISLYAKLFH  80

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              +PE+ YK +P+ ED E+GT  +P VL+QIPM+NEKEVY++SIGA CN +WP DR+++Q+
Sbjct  81    RRPERIYKCDPIAEDEELGTLAYPMVLVQIPMYNEKEVYQLSIGAACNLSWPKDRIIIQI  140

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD+ IK++V++EC +W   G NI+Y+TR  R GYKAGALKEG+ H YV+ CEY+A+
Sbjct  141   LDDSTDLIIKDLVKKECEKWFGMGNNIKYETRDNRKGYKAGALKEGMKHSYVETCEYIAM  200

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+P PDFL R++PFL+HNP IAL+QARW+FVNA+ECL+TRMQEMS+DYHFKVEQE 
Sbjct  201   FDADFQPAPDFLTRTVPFLVHNPSIALVQARWKFVNANECLMTRMQEMSMDYHFKVEQES  260

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GS++ AFFG+NGT G+WRI AINEAGGWKDRTTVEDMDLAVRAGL GWK +Y+G + VKS
Sbjct  261   GSTSCAFFGYNGTAGVWRIQAINEAGGWKDRTTVEDMDLAVRAGLGGWKMIYVGSIKVKS  320

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPSTFKA+RFQQHRWSCGPAN
Sbjct  321   ELPSTFKAYRFQQHRWSCGPAN  342



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   468 bits (1205),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 252/285 (88%), Gaps = 0/285 (0%)
 Frame = +2

Query  413   MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE  592
             MS+MLFVE++YMGIVI L+K+F  KPEK++KWE +++D E+G S +P VL+QIPM+NEKE
Sbjct  1     MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVKDDVELGNSAYPMVLLQIPMYNEKE  60

Query  593   VYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGG  772
             VY++SIGA C  +WPSDR+++QVLDDSTD  IK++VE E  RWA KGINI+Y+ R  R G
Sbjct  61    VYQLSIGAACGLSWPSDRVIIQVLDDSTDPAIKDLVELEVKRWAGKGINIKYEIRDNRNG  120

Query  773   YKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNA  952
             YKAGALKEG+ H YV+ C++VAIFDADF+P+PDFL R+IPFLIHN ++AL+Q RW+FVN+
Sbjct  121   YKAGALKEGMKHSYVKQCDFVAIFDADFQPDPDFLWRTIPFLIHNSDVALVQTRWKFVNS  180

Query  953   DECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDM  1132
             DECL+TRMQEMSLDYHF VEQEVGS+THAFFGFNG  G+WRIAA+NEAGGWKDRTTVEDM
Sbjct  181   DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGMAGVWRIAALNEAGGWKDRTTVEDM  240

Query  1133  DLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             DLAVRA L+GWKF+YL DL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  241   DLAVRASLRGWKFIYLSDLKVKNELPSTFKAYRYQQHRWSCGPAN  285



>ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum]
Length=527

 Score =   470 bits (1209),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 261/307 (85%), Gaps = 1/307 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W+ ++ P++VPAL LA+Y+C+AMS+MLF+ER+YM IVI  VK F  K   +YK E ++ED
Sbjct  25    WERIRVPVVVPALHLAMYICIAMSVMLFLERIYMAIVIAGVKCFGKKRYTKYKLESVKED  84

Query  527   YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQ  706
              E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRLVVQVLDDST+  ++ +V+ 
Sbjct  85    LEKNKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLVVQVLDDSTNEVLRTLVDL  143

Query  707   ECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRS  886
             EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCE+V IFDADF+PE DFL R+
Sbjct  144   ECRKWMERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEFVVIFDADFQPEEDFLWRT  203

Query  887   IPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGG  1066
             IP+L+ NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +FFGFNGT G
Sbjct  204   IPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAG  263

Query  1067  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHR  1246
             +WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKFL++GDL VK+ELPSTFKA+RFQQHR
Sbjct  264   VWRIRAVNDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGDLAVKNELPSTFKAYRFQQHR  323

Query  1247  WSCGPAN  1267
             WSCGPAN
Sbjct  324   WSCGPAN  330



>ref|XP_008787118.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=500

 Score =   469 bits (1206),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 258/300 (86%), Gaps = 0/300 (0%)
 Frame = +2

Query  368   LIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSV  547
             ++VP +R+A+  CL MS+MLF+E+  MG+V   VK+F  KPEK YKWEP+RED E+GT  
Sbjct  2     VLVPVVRVAIIFCLIMSVMLFIEKFSMGLVSFYVKVFRRKPEKIYKWEPIREDEELGTLA  61

Query  548   FPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWAS  727
             +P VL+QIPM+NE+EVY++SIGAVCN  WPSDRL++QVLDDSTD+ I++MV++EC +W  
Sbjct  62    YPMVLVQIPMYNEREVYRLSIGAVCNLVWPSDRLIIQVLDDSTDLTIRDMVQKECEKWLG  121

Query  728   KGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHN  907
             KGINI Y +R  R GYKAGA+KE +  DYVQ CE+VAIFDADF+P  DFL+R++PFL++N
Sbjct  122   KGINIHYISRDNRNGYKAGAMKEAMEIDYVQQCEHVAIFDADFQPASDFLIRTVPFLMNN  181

Query  908   PEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAI  1087
             PEIAL+QARW+FVNADECL+TR+QEMSL+YHFK+EQ+ GSST AFFGFNGT G+WRI AI
Sbjct  182   PEIALVQARWKFVNADECLMTRIQEMSLNYHFKIEQQSGSSTFAFFGFNGTAGVWRIQAI  241

Query  1088  NEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             NE  GWK+RTTVEDMDLAVRA L GWKF+Y+G++ VKSELPST+KA+RFQQHRWSCGPAN
Sbjct  242   NEVEGWKERTTVEDMDLAVRASLAGWKFVYVGNVKVKSELPSTYKAYRFQQHRWSCGPAN  301



>ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vinifera]
Length=526

 Score =   469 bits (1208),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 266/327 (81%), Gaps = 2/327 (1%)
 Frame = +2

Query  287   LMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             L  PE+R    DV + +   W  ++ P+I P L  A++VC AMS+MLF+ER+YM I+I+ 
Sbjct  6     LQEPEVR-VTDDVTSSLSYAWQCIRVPVIAPLLWFAIFVCAAMSIMLFIERVYMAIIILC  64

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+   K   +YK + M+ED E+  S +P VLIQIPM+NEKEVYK+SIGA C+ +WPSDR
Sbjct  65    VKVMRKKRYTKYKLDTMKEDLELNKS-YPKVLIQIPMYNEKEVYKLSIGAACSVSWPSDR  123

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
              ++QVLDDST+  ++ MVE EC +W  KG+N++Y+TR  R GYKAGAL+EGL   YV+DC
Sbjct  124   FIIQVLDDSTNEALRVMVELECRKWIDKGVNVKYETRNNRNGYKAGALREGLQKQYVEDC  183

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             E+VAIFDADF+PE +FL R+IPFL+ NP + L+QARW+FVNADECL+TR+QEMSLDYHF 
Sbjct  184   EFVAIFDADFQPEENFLWRTIPFLLENPGLGLVQARWKFVNADECLMTRLQEMSLDYHFS  243

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST +FFGFNGT G+WRI AIN+AGGWKDRTTVEDMDLAVRA LKGWKFL++GD
Sbjct  244   VEQEVGSSTCSFFGFNGTAGVWRIQAINDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGD  303

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   LSVKNELPSTFKAYRYQQHRWSCGPAN  330



>ref|XP_010554517.1| PREDICTED: probable mannan synthase 11 [Tarenaya hassleriana]
Length=546

 Score =   469 bits (1206),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 210/309 (68%), Positives = 259/309 (84%), Gaps = 0/309 (0%)
 Frame = +2

Query  341   LMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR  520
              +W+  ++ +I+P     V +CL +SL +F+E +YM IV+I VK+F  KPEK YKWE ++
Sbjct  45    FIWNQTRSFVILPLFEFLVTLCLVLSLAVFMESIYMSIVVIFVKLFNRKPEKVYKWEALK  104

Query  521   EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMV  700
             ED E+G S  P VL+QIPM+NEKEV+++SIGA C   WPSDRL+VQVLDDSTD  IKEMV
Sbjct  105   EDAELGHSNHPMVLVQIPMYNEKEVFQLSIGAACMLKWPSDRLIVQVLDDSTDPTIKEMV  164

Query  701   EQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLL  880
               EC +WASKGINI+ + R +R GYKAGAL++G+ H+YV+ C+YVAIFDADF+PEPDFL 
Sbjct  165   NVECGKWASKGINIKCEIRDSRSGYKAGALRQGMRHNYVKQCDYVAIFDADFQPEPDFLE  224

Query  881   RSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGT  1060
             RSIPFL+HN ++AL+QARW+FVNA+ECL+TRMQEMSL+YHF  EQE GS+ HAFFGFNGT
Sbjct  225   RSIPFLVHNSDVALVQARWKFVNANECLMTRMQEMSLNYHFMAEQESGSTRHAFFGFNGT  284

Query  1061  GGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQ  1240
              G+WRIAA+N+AGGWKDRTTVEDMDLAVRAGL+GWKF+++ DL VKSELP  FKAFRFQQ
Sbjct  285   AGVWRIAAMNDAGGWKDRTTVEDMDLAVRAGLRGWKFVFVNDLTVKSELPCKFKAFRFQQ  344

Query  1241  HRWSCGPAN  1267
             HRWSCGPAN
Sbjct  345   HRWSCGPAN  353



>emb|CAN74410.1| hypothetical protein VITISV_013215 [Vitis vinifera]
Length=529

 Score =   468 bits (1203),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 212/327 (65%), Positives = 265/327 (81%), Gaps = 2/327 (1%)
 Frame = +2

Query  287   LMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL  466
             L  PE+R    DV + +   W  ++ P+I P L  A++VC AMS+MLF+ER+YM I+I+ 
Sbjct  6     LQEPEVR-VTDDVTSSLSYAWQCIRVPVIAPLLWFAIFVCAAMSIMLFIERVYMAIIILC  64

Query  467   VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR  646
             VK+   K   +YK + M+ED E+  S +P VLIQIPM+NEKEVYK+SIGA C+ +WPSD 
Sbjct  65    VKVMRKKRYTKYKLDTMKEDLELNKS-YPKVLIQIPMYNEKEVYKLSIGAACSVSWPSDX  123

Query  647   LVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDC  826
              ++QVLDDST+  ++ MVE EC +W  KG+N++Y+TR  R GYKAGAL+EGL   YV+DC
Sbjct  124   FIIQVLDDSTNEALRVMVELECRKWIDKGVNVKYETRNNRNGYKAGALREGLQKQYVEDC  183

Query  827   EYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFK  1006
             E+VAIFDADF+PE +FL R+IPFL+ NP + L+QARW+FVNADECL+TR+QEMSLDYHF 
Sbjct  184   EFVAIFDADFQPEENFLWRTIPFLLENPGLGLVQARWKFVNADECLMTRLQEMSLDYHFS  243

Query  1007  VEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGD  1186
             VEQEVGSST +FFGFNGT G+WRI AIN+AGGWKDRTTVEDMDLAVRA LKGWKFL++GD
Sbjct  244   VEQEVGSSTCSFFGFNGTAGVWRIQAINDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGD  303

Query  1187  LHVKSELPSTFKAFRFQQHRWSCGPAN  1267
             L VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  304   LSVKNELPSTFKAYRYQQHRWSCGPAN  330



>gb|KFK25840.1| hypothetical protein AALP_AA8G168900 [Arabis alpina]
Length=478

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 256/313 (82%), Gaps = 2/313 (1%)
 Frame = +2

Query  335   MRLMW--DLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKW  508
             M  MW   ++++ LIVP  +  V +CL +SL++FVE +YM IV+I VK+F  KPEK YKW
Sbjct  1     MGTMWWIQVMRSLLIVPIFKCLVAICLVISLLVFVESVYMNIVVIYVKLFKRKPEKIYKW  60

Query  509   EPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNI  688
             E ++ED EIG   FP VL+QIPM+NE+EVY++SI A C   WP DRL+VQVLDDSTD  I
Sbjct  61    EAVQEDMEIGDQNFPMVLVQIPMYNEREVYQLSIAAACRLIWPLDRLIVQVLDDSTDPTI  120

Query  689   KEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEP  868
              EMV  ECV+WAS GIN++ + R  R GYKAGALK+G+ H YV+ C Y+AIFDADF+PEP
Sbjct  121   MEMVSMECVKWASTGINVKCERRDNRNGYKAGALKQGMRHSYVKQCNYIAIFDADFQPEP  180

Query  869   DFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFG  1048
             D+L R++PFLIHNPE+AL+QARWRFVNA++CL+TRMQEMSL+YHF  EQE GS+ HAFFG
Sbjct  181   DYLRRAVPFLIHNPELALVQARWRFVNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFG  240

Query  1049  FNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAF  1228
             FNGT G+WR+AA+ EAGGWKDRTTVEDMDLAVR GL GWKF+++ D+ VKSELPS FKAF
Sbjct  241   FNGTAGVWRMAALEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDIEVKSELPSQFKAF  300

Query  1229  RFQQHRWSCGPAN  1267
             RFQQHRWSCGPAN
Sbjct  301   RFQQHRWSCGPAN  313



>ref|XP_010554514.1| PREDICTED: probable mannan synthase 7 isoform X1 [Tarenaya hassleriana]
Length=565

 Score =   468 bits (1204),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 260/316 (82%), Gaps = 0/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             DV+ +    W+  +A ++VP  +  V +CL MS+MLF+E +YMGIVI  VK+F  KPEK 
Sbjct  51    DVSGEFGYGWEQARAVVVVPLFKFLVTLCLVMSVMLFIEIMYMGIVIAYVKLFKRKPEKV  110

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YKWE M +D E G+S++P VL+QIPM+NEKEV ++SI A C  +WPSDR+++QVLDDSTD
Sbjct  111   YKWEAMNDDIEYGSSLYPMVLVQIPMYNEKEVCQLSIAAACKLSWPSDRIIIQVLDDSTD  170

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
                KE+VEQEC RWA +G+NI ++ R  R GYKAGAL+EG+ H YV+ C+YVAIFDADF+
Sbjct  171   PASKELVEQECERWAREGVNITFEIRDNRNGYKAGALREGMRHSYVKQCDYVAIFDADFQ  230

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             P+PDFL R+IPFLIHNP+IAL+QARW FVNAD+C++TR+QEMSL YHFKVEQEVGSS  A
Sbjct  231   PDPDFLSRTIPFLIHNPKIALVQARWEFVNADQCIMTRLQEMSLSYHFKVEQEVGSSAFA  290

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI+A+NE+GGW D+TTVEDMDLAVRA L+GWKF+Y+ DL VKSELPST 
Sbjct  291   FFGFNGTAGVWRISALNESGGWNDQTTVEDMDLAVRATLRGWKFVYVDDLRVKSELPSTL  350

Query  1220  KAFRFQQHRWSCGPAN  1267
              AFR QQHRW+CGP+N
Sbjct  351   NAFRNQQHRWTCGPSN  366



>gb|KFK25839.1| hypothetical protein AALP_AA8G168900 [Arabis alpina]
Length=505

 Score =   465 bits (1197),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 256/313 (82%), Gaps = 2/313 (1%)
 Frame = +2

Query  335   MRLMW--DLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKW  508
             M  MW   ++++ LIVP  +  V +CL +SL++FVE +YM IV+I VK+F  KPEK YKW
Sbjct  1     MGTMWWIQVMRSLLIVPIFKCLVAICLVISLLVFVESVYMNIVVIYVKLFKRKPEKIYKW  60

Query  509   EPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNI  688
             E ++ED EIG   FP VL+QIPM+NE+EVY++SI A C   WP DRL+VQVLDDSTD  I
Sbjct  61    EAVQEDMEIGDQNFPMVLVQIPMYNEREVYQLSIAAACRLIWPLDRLIVQVLDDSTDPTI  120

Query  689   KEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEP  868
              EMV  ECV+WAS GIN++ + R  R GYKAGALK+G+ H YV+ C Y+AIFDADF+PEP
Sbjct  121   MEMVSMECVKWASTGINVKCERRDNRNGYKAGALKQGMRHSYVKQCNYIAIFDADFQPEP  180

Query  869   DFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFG  1048
             D+L R++PFLIHNPE+AL+QARWRFVNA++CL+TRMQEMSL+YHF  EQE GS+ HAFFG
Sbjct  181   DYLRRAVPFLIHNPELALVQARWRFVNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFG  240

Query  1049  FNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAF  1228
             FNGT G+WR+AA+ EAGGWKDRTTVEDMDLAVR GL GWKF+++ D+ VKSELPS FKAF
Sbjct  241   FNGTAGVWRMAALEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDIEVKSELPSQFKAF  300

Query  1229  RFQQHRWSCGPAN  1267
             RFQQHRWSCGPAN
Sbjct  301   RFQQHRWSCGPAN  313



>gb|EYU36103.1| hypothetical protein MIMGU_mgv1a004186mg [Erythranthe guttata]
Length=540

 Score =   466 bits (1200),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 264/323 (82%), Gaps = 1/323 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             L G   D+ AQ+  +W +++A  +VP LR ++Y+CL  S MLF+E +Y+G V+I VK+  
Sbjct  14    LMGTAADMPAQIGHVWVVIRASFLVPLLRFSLYICLVSSTMLFLEWVYIGAVLIYVKLSG  73

Query  482   GKPEKRYKWEPM-REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  658
               PE  YK +P+  ED EIGT+ FP VL+QIP+ NEKEVYK+SIGA CN +WP+DRL++Q
Sbjct  74    RNPENIYKCDPISEEDPEIGTAAFPMVLVQIPLCNEKEVYKLSIGAACNLSWPADRLLIQ  133

Query  659   VLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVA  838
             V+D S+D +I++M+E+EC++W SKG+NI+YQ R T+GGYKAGALKEG  +DYV++CE+V 
Sbjct  134   VIDGSSDSSIRDMIEKECMKWLSKGVNIKYQMRQTKGGYKAGALKEGSGYDYVKECEHVV  193

Query  839   IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  1018
             IFD+DF+P  DFL R++PFL+HNPEI L+QARWRFVNADECLLTR+QE+SLDYHF  EQE
Sbjct  194   IFDSDFQPGSDFLRRAVPFLVHNPEIGLVQARWRFVNADECLLTRLQEISLDYHFMAEQE  253

Query  1019  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  1198
             VGSS HAFFGFNG+ GIWRIAAINEAGGW DRTT EDMDLA+RAGL GWK +Y+G L V 
Sbjct  254   VGSSAHAFFGFNGSAGIWRIAAINEAGGWDDRTTSEDMDLAIRAGLLGWKLVYVGTLQVN  313

Query  1199  SELPSTFKAFRFQQHRWSCGPAN  1267
             SELPSTFKAFR QQHRW CGP N
Sbjct  314   SELPSTFKAFRSQQHRWFCGPTN  336



>ref|NP_193077.2| putative mannan synthase 15 [Arabidopsis thaliana]
 sp|Q9T0L2.2|CSLAF_ARATH RecName: Full=Probable mannan synthase 15; AltName: Full=Cellulose 
synthase-like protein A15; Short=AtCslA15 [Arabidopsis 
thaliana]
 gb|AEE83276.1| putative mannan synthase 15 [Arabidopsis thaliana]
 gb|AHL38701.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=537

 Score =   466 bits (1200),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 254/322 (79%), Gaps = 0/322 (0%)
 Frame = +2

Query  302   LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFC  481
             L+     V   M  MW   +   IVP  +  V +CL +SL++FVE +YM +V++ VK+F 
Sbjct  28    LKASVDGVGINMSTMWRETRNVFIVPLFKCIVVMCLIISLLVFVESVYMNLVVLYVKLFN  87

Query  482   GKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQV  661
              KPEK YKWE M+ED E+G   +P VL+QIPM+NE+EV+++SIGA C   WPSDRL+VQV
Sbjct  88    RKPEKVYKWEAMQEDMELGHQNYPMVLVQIPMYNEREVFELSIGAACRLTWPSDRLIVQV  147

Query  662   LDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAI  841
             LDDSTD  I E+V  EC +WASK INI Y+ R  R GYKAGALK G+ H YV+ C+Y+AI
Sbjct  148   LDDSTDPAIMELVSMECTKWASKDININYERRENRNGYKAGALKHGMRHSYVKQCQYLAI  207

Query  842   FDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  1021
             FDADF+PEPD+L R+IPFLIHNPE+AL+QARWRFVNA+ CL+TRMQEMSL+YHF  EQ+ 
Sbjct  208   FDADFQPEPDYLQRAIPFLIHNPEVALVQARWRFVNANTCLMTRMQEMSLNYHFMAEQQS  267

Query  1022  GSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKS  1201
             GS+ HAFFGFNGT G+WR+ A+ EAGGWKDRTTVEDMDLAVR GL GWKF+++ DL VKS
Sbjct  268   GSTRHAFFGFNGTAGVWRMVAMEEAGGWKDRTTVEDMDLAVRVGLLGWKFIFVNDLEVKS  327

Query  1202  ELPSTFKAFRFQQHRWSCGPAN  1267
             ELPS FKAFRFQQHRWSCGPAN
Sbjct  328   ELPSQFKAFRFQQHRWSCGPAN  349



>gb|KHN02317.1| Mannan synthase 1 [Glycine soja]
Length=496

 Score =   464 bits (1195),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 268/324 (83%), Gaps = 2/324 (1%)
 Frame = +2

Query  296   PELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKI  475
             PE+R PG D ++ +R  W+ ++AP+I+P L+LAV +C  MS+MLFVER+ M IVI++VK+
Sbjct  9     PEVRVPG-DTSSSLRYAWESIRAPVIIPVLKLAVILCSIMSIMLFVERVAMAIVILVVKV  67

Query  476   FCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  655
                K   +Y  E M++  E     FP VLIQIPM+NEKEVYK+SIGAVC  +WP+DR +V
Sbjct  68    LGKKRYTKYNLEAMKQKLERNKR-FPMVLIQIPMYNEKEVYKLSIGAVCGLSWPADRFIV  126

Query  656   QVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYV  835
             QVLDDST+ +++E V+ EC RW  KG+N++Y+TR  R GYKAGA+KEGL  +YV+DCE+V
Sbjct  127   QVLDDSTNQSLRECVQIECQRWMQKGVNVKYETRTNRNGYKAGAMKEGLEKEYVEDCEFV  186

Query  836   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  1015
             AIFDADF+P+ DFL  +IP+L+ NP++ L+QARW+FVN+ EC++TR+QEMSLDYHF VEQ
Sbjct  187   AIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSKECMMTRLQEMSLDYHFSVEQ  246

Query  1016  EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  1195
             EVGSST++FFGFNGT GIWRI AI +AGGWKDRTTVEDMDLAVRA L+GW+F+++GD+ V
Sbjct  247   EVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLQGWEFVFVGDIKV  306

Query  1196  KSELPSTFKAFRFQQHRWSCGPAN  1267
             K+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  307   KNELPSTFKAYRYQQHRWSCGPAN  330



>gb|ADW77641.1| putative mannan synthase [Amorphophallus konjac]
Length=519

 Score =   465 bits (1197),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 264/313 (84%), Gaps = 0/313 (0%)
 Frame = +2

Query  329   AQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKW  508
             A++  +W  V+  +++PA+R+AV +CL MS+ML +E+L MG V + VK+F  +P+K Y+W
Sbjct  6     ARILYIWGQVRTMVLIPAMRIAVLLCLIMSVMLLMEKLLMGGVSLYVKVFRRRPKKVYRW  65

Query  509   EPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNI  688
             EP+  D E+GT+ +P VL+QIPM+NE+EVY +SI A C   WPSDRL+VQVLDDSTD  I
Sbjct  66    EPVGGDEELGTAAYPMVLVQIPMYNEREVYHLSIKAACCLQWPSDRLIVQVLDDSTDPMI  125

Query  689   KEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEP  868
             K++V +EC +WA  G+NI+Y+TR  R GYKAGALKEG+ + YV++C+YVAIFDADF+ +P
Sbjct  126   KDLVYKECQKWALDGVNIKYETRANRNGYKAGALKEGMKYSYVEECDYVAIFDADFQADP  185

Query  869   DFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFG  1048
             D+L++ +PFLIHNPEI L QARW FVNA+ECL+TR+QEMS+DYHFKVEQE GSS HAFFG
Sbjct  186   DYLVQMVPFLIHNPEIGLAQARWNFVNAEECLMTRLQEMSMDYHFKVEQESGSSIHAFFG  245

Query  1049  FNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAF  1228
             FNGT G+WRI A+NEAGGWKDRTTVEDMDLA+RA L+GWKF+Y+GD+ VKSELPSTFKAF
Sbjct  246   FNGTAGVWRIRALNEAGGWKDRTTVEDMDLAIRATLEGWKFVYVGDVKVKSELPSTFKAF  305

Query  1229  RFQQHRWSCGPAN  1267
             R+QQHRWSCGPAN
Sbjct  306   RYQQHRWSCGPAN  318



>ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=527

 Score =   464 bits (1195),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 262/316 (83%), Gaps = 1/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             +    +   W+ ++ P++VPAL LA+Y+C+ MS+MLF+ER+YM IVI  VK F  K   +
Sbjct  16    NTTQNLNHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAIVIAGVKCFGRKRYTK  75

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YK E ++ED E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRL+VQVLDDST+
Sbjct  76    YKLESVKEDLEKHKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTN  134

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               ++ +V+ EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCE+V IFDADF+
Sbjct  135   EVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEFVVIFDADFQ  194

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             P+ DFL R+IP+L+ NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +
Sbjct  195   PDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCS  254

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKF+++GDL VK+ELPSTF
Sbjct  255   FFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLAVKNELPSTF  314

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+RFQQHRWSCGPAN
Sbjct  315   KAYRFQQHRWSCGPAN  330



>ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris]
Length=527

 Score =   464 bits (1194),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 260/307 (85%), Gaps = 1/307 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W+ ++ P++VPAL LA+Y+C+ MS+MLF+ER+YM IVI  VK F  K   +YK E ++ED
Sbjct  25    WERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAIVIAGVKCFGRKRYTKYKLESVKED  84

Query  527   YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQ  706
              E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRL+VQVLDDST+  ++ +V+ 
Sbjct  85    LEKHKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLRTLVDL  143

Query  707   ECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRS  886
             EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCE+V IFDADF+P+ DFL R+
Sbjct  144   ECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEFVVIFDADFQPDEDFLWRT  203

Query  887   IPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGG  1066
             IP+L+ NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +FFGFNGT G
Sbjct  204   IPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAG  263

Query  1067  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHR  1246
             +WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKF+++GDL VK+ELPSTFKA+RFQQHR
Sbjct  264   VWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLAVKNELPSTFKAYRFQQHR  323

Query  1247  WSCGPAN  1267
             WSCGPAN
Sbjct  324   WSCGPAN  330



>ref|XP_011094610.1| PREDICTED: mannan synthase 1-like [Sesamum indicum]
Length=527

 Score =   464 bits (1194),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 269/339 (79%), Gaps = 11/339 (3%)
 Frame = +2

Query  257   MAGVAINEVELMMPELRGPGGDVAAQMRLM--WDLVKAPLIVPALRLAVYVCLAMSLMLF  430
             M  +   EVE  M E   P       MRL+  WD ++ P+IVP LR AVY+C+ MS+MLF
Sbjct  1     MRDIVFREVE--MNETYDP------TMRLIHAWDSIRVPIIVPLLRFAVYICIGMSIMLF  52

Query  431   VERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISI  610
             +ER+YM IVI  VK    K   +Y+ + ++ED E   + +P VL+QIPMFNEKEVYK+SI
Sbjct  53    IERVYMAIVIACVKCLGKKRYTKYQLDAIKEDLEKNKN-YPKVLVQIPMFNEKEVYKLSI  111

Query  611   GAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGAL  790
             GAV   +WPSDRL+VQVLDDST+  ++ MVE EC +W  KG+N++Y+TR  R GYKAGAL
Sbjct  112   GAVSALSWPSDRLIVQVLDDSTNEVLRTMVELECRKWIEKGVNVKYETRNNRNGYKAGAL  171

Query  791   KEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLT  970
             +EGL   YV+DCE+V IFDADF+PE DFL R+IP+L+ NPE+ L+QARW+FVNADECL+T
Sbjct  172   REGLKKHYVEDCEFVIIFDADFQPEEDFLWRTIPYLLENPELGLVQARWKFVNADECLMT  231

Query  971   RMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRA  1150
             R+QEMSLDYHF VEQEVGSST +FFGFNGT G+WR+ AIN+AGGWKDRTTVEDMDLAVRA
Sbjct  232   RLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAGVWRMRAINDAGGWKDRTTVEDMDLAVRA  291

Query  1151  GLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRWSCGPAN  1267
              LKGWKFL++GDL VK+ELPSTFKA+R+QQHRWSCGPAN
Sbjct  292   SLKGWKFLFVGDLAVKNELPSTFKAYRYQQHRWSCGPAN  330



>ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 262/316 (83%), Gaps = 1/316 (0%)
 Frame = +2

Query  320   DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR  499
             +    +   W+ ++ P++VPAL LA+Y+C+ MS+MLF+ER+YM IVI  VK F  K   +
Sbjct  16    NTTQNLNHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAIVIAGVKCFGRKRYTK  75

Query  500   YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTD  679
             YK E ++ED E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRL+VQVLDDST+
Sbjct  76    YKLESVKEDLEKHKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTN  134

Query  680   VNIKEMVEQECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFR  859
               ++ +V+ EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCE+V IFDADF+
Sbjct  135   EVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEFVVIFDADFQ  194

Query  860   PEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHA  1039
             P+ DFL R+IP+L+ NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +
Sbjct  195   PDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCS  254

Query  1040  FFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTF  1219
             FFGFNGT G+WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKF+++GDL VK+ELPSTF
Sbjct  255   FFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLAVKNELPSTF  314

Query  1220  KAFRFQQHRWSCGPAN  1267
             KA+RFQQHRWSCGPAN
Sbjct  315   KAYRFQQHRWSCGPAN  330



>ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris]
Length=556

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 260/307 (85%), Gaps = 1/307 (0%)
 Frame = +2

Query  347   WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  526
             W+ ++ P++VPAL LA+Y+C+ MS+MLF+ER+YM IVI  VK F  K   +YK E ++ED
Sbjct  25    WERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAIVIAGVKCFGRKRYTKYKLESVKED  84

Query  527   YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDVNIKEMVEQ  706
              E   + +P VL+QIPMFNEKEVYK+SIGAVC  +WPSDRL+VQVLDDST+  ++ +V+ 
Sbjct  85    LEKHKN-YPMVLVQIPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLRTLVDL  143

Query  707   ECVRWASKGINIRYQTRITRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRS  886
             EC +W  +GIN++Y+TR  R GYKAGALKEGL   YV DCE+V IFDADF+P+ DFL R+
Sbjct  144   ECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYVDDCEFVVIFDADFQPDEDFLWRT  203

Query  887   IPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGG  1066
             IP+L+ NPE+AL+QARW+FVNADECL+TR+QEMSLDYHF VEQEVGSST +FFGFNGT G
Sbjct  204   IPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAG  263

Query  1067  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHR  1246
             +WRI A+N+AGGWKDRTTVEDMDLAVRA LKGWKF+++GDL VK+ELPSTFKA+RFQQHR
Sbjct  264   VWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLAVKNELPSTFKAYRFQQHR  323

Query  1247  WSCGPAN  1267
             WSCGPAN
Sbjct  324   WSCGPAN  330



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3225594928680